WorldWideScience

Sample records for bagre ariopsis felis

  1. Weight-Length Relationships in Gafftopsail Catfish (Bagre marinus) and Hardhead Catfish (Ariopsis felis) in Louisiana Waters

    OpenAIRE

    Courtney, Joshua; Klinkmann, Taylor; Torano, Joseph; 2; Courtney, Michael

    2012-01-01

    In spite of the abundance and commercial importance of these two species, there is little published weight-length data for the gafftopsail catfish (Bagre marinus) and hardhead catfish (Ariopsis felis). For this study 84 catfish were caught (hook and line) from the Calcasieu Estuary in Southwest Louisiana near the Gulf of Mexico and estuaries and near shore waters close to bayou Lafourche. Using least squares regression, best fit curves were determined for weight (W) vs. total length (L) relat...

  2. Metales pesados en tejido muscular del bagre Ariopsis felis en el sur del golfo de México (2001-2004 Heavy metals in muscular tissue of the catfish, Ariopsis felis, in the southern Gulfof México (2001-2004

    Directory of Open Access Journals (Sweden)

    Felipe Vázquez

    2008-01-01

    Full Text Available Se analizó el contenido de metales pesados en tejido muscular del bagre, Ariopsis felis en el sur del golfo de México durante el período 2001-2004. La investigación fue efectuada buscando establecer un marco de referencia ambiental para este organismo. La concentración metálica siguió el orden: Hg We analyzed the heavy metal content in the muscular tissue of the catfish, Ariopsis felis, in the southern Gulf of México between 2001 and 2004. The research was done in order to establish an environmental frame of reference for this organism. The metal concentration was as follows: Hg < Co < Pb < Ni < V < Cr. Cobalt and vanadium contents were found to decrease and those of nickel, mercury, and chromium to ulerease; however, neither of these trends was observed for the lead content. One-way analyses of variance con-firm significant temporal variation only for cobalt, mercury, lead, and vanadium. Significant linear correlation coefficients (p ≤ 0.05 were found for Co-V, Cr-Ni, Cr-Pb, Co-Hg, Ni-V, and V-Pb. The first three associa-tions showed positive correlations, whereas the remaining ones had negative correlations. A factor analysis grouped the studied metals depending on their origins. The metal levels found in the muscular tissue of A. felis from the southern Gulf of México were lower than those set by national and international regulations.

  3. Taste-mediated behavioral and electrophysiological responses by the predatory fish Ariopsis felis to deterrent pigments from Aplysia californica ink.

    Science.gov (United States)

    Nusnbaum, Matthew; Aggio, Juan F; Derby, Charles D

    2012-04-01

    Chemical defenses are used by many organisms to avoid predation, and these defenses may function by stimulating predators' chemosensory systems. Our study examined detection mechanisms for components of defensive ink of sea hares, Aplysia californica, by predatory sea catfish, Ariopsis felis. Behavioral analyses show aplysioviolin and phycoerythrobilin are detected intra-orally and by barbels and are deterrent at concentrations as low as 0.1% full strength. We performed electrophysiological recordings from the facial-trigeminal nerve complex innervating the maxillary barbel and tested aplysioviolin, phycoerythrobilin, amino acids, and bile salts in cross-adaptation experiments. Amino acids and bile salts are known stimulatory compounds for teleost taste systems. Our results show aplysioviolin and phycoerythrobilin are equally stimulatory and completely cross-adapt to each other's responses. Adaptation to aplysioviolin or phycoerythrobilin reduced but did not eliminate responses to amino acids or bile salts. Adaptation to amino acids or bile salts incompletely reduced responses to aplysioviolin or phycoerythrobilin. The fact that cross-adaptations with aplysioviolin and phycoerythrobilin were not completely reciprocal indicates there are amino acid and bile salt sensitive fibers insensitive to aplysioviolin and phycoerythrobilin. These results indicate two gustatory pathways for aplysioviolin and phycoerythrobilin: one independent of amino acids and bile salts and another shared with some amino acids. PMID:22200975

  4. Phylogenetic relationships among five marine Catfish species (Pisces: Ariidae from Mexico Relaciones filogenéticas entre cinco especies de bagres (Pisces: Ariidae de México

    Directory of Open Access Journals (Sweden)

    Guadalupe Tenorio-Colín

    2010-01-01

    Full Text Available The systematics of the marine catfish of the family Ariidae is controversial because at the present time the number of species and genera in the family, or their relationships, remain uncertain. Phylogenetic relationships among five representative species of marine catfish of the family Ariidae from both the Pacific and the Atlantic coasts of Mexico were assessed by the analysis of the variability in 21 alloenzymatic loci, and by the comparison of the electrophoretic patterns of whole muscle proteins. Interspecific genetic divergence levels obtained by both electrophoretic methods showed a clear separation among the genera Cathorops, Bagre and Ariopsis, as well as in the studied species of Cathorops and Ariopsis, with Bagre marinus showing a greater genetic similarity with the Ariopsis group. Finally, our results contribute to the definition of the presence of this species in the coasts of the Gulf of Mexico.La sistemática de los bagres marinos pertenecientes a la familia Ariidae es controversial, porque hasta la actualidad, no se conoce con exactitud el número de especies y géneros existentes en la familia, ni las relaciones que se establecen entre ellos. En el presente trabajo se estudiaron las relaciones filogenéticas entre cinco especies representativas de bagres marinos de la familia Ariidae, de ambas costas del Pacífico y del Atlántico Mexicano. El mencionado análisis se llevó a cabo mediante el análisis de la variabilidad en 21 loci aloenzimáticos y a través de la comparación de patrones electroforéticos de proteínas totales de músculo. Los niveles de divergencia interespecífica obtenidos por ambos métodos electroforéticos mostraron una clara separación entre los géneros Cathorops, Bagre y Ariopsis, así como entre las especies estudiadas de Cathorops y Ariopsis con Bagre marinus, mostrando una mayor similitud genética con el grupo Ariopsis. Los resultados obtenidos en este estudio contribuyen al establecimiento de la

  5. Filogenia de los bagres marinos (Siluriformes: Ariidae del nuevo mundo

    Directory of Open Access Journals (Sweden)

    Betancur Rodríguez Ricardo

    2004-12-01

    Full Text Available La familia Ariidae comprende peces marinos, estuarinos y dulceacuícolas, distribuidos en aguas tropicales y subtropicales de todos los continentes. La nomenclatura específica y genérica en el grupo es caótica y no hay continuidad de su uso en la literatura. En este trabajo se presenta una filogenia robusta para 37-41 especies de ariidos americanos y dos especies del Viejo Mundo, basada en un máximo de 2.922 caracteres del genoma mitocondrial (citocromo b, ATP sintetasa 8 y 6, 12S y 16S y 978 del nuclear (gen activador de la recombinación 2, por reconstrucción con los criterios de máxima parsimonia (MP e inferencia bayesiana (BI. Adicionalmente, se complementó el trabajo morfológico previo incluyendo siete especies y 11 caracteres adicionales, para una matriz final de 26 especies y 56 caracteres. Las secuencias mitocondriales proporcionaron alta resolución a diferentes niveles (subfamiliar, genérico y específico. Aunque BI recuperó en más ocasiones nodos débiles incongruentes con otros conjuntos de datos, mostró mayor sensibilidad que MP a la escasa señal filogenética del locus nuclear, el cual ofreció poca
    resolución. La evidencia morfológica fue congruente con las hipótesis moleculares a nivel subfamiliar, genérico y en gran medida intergenérico; las discrepancias más marcadas entre ambos
    enfoques se dan al interior del género Bagre. Las filogenias obtenidas concuerdan todas con la división de Ariidae en dos subfamilias: Ariinae y el grupo de los Galeichthyinos, el cual requiere
    estatus nomenclatural. Se corroboró la validez, y en gran medida la monofilia de los géneros Ariopsis, Bagre, Cathorops, Galeichthys, Potamarius y Selenaspis (incluyendo a S. proops y S. parkeri. El
    género Arius sensu lato no es monofilético y no debe ser usado para referir a las especies americanas. El linaje 'Arius A' conforma un grupo monofilético anfiamericano al cual debe atribuírsele un nombre gen

  6. Rickettsia felis infection in cat fleas Ctenocephalides felis felis

    Directory of Open Access Journals (Sweden)

    Mauricio C. Horta

    2010-10-01

    Full Text Available The present study evaluated the rickettsial infection in a laboratory colony of cat fleas, Ctenocephalides felis felis (Bouche in Brazil. All flea samples (30 eggs, 30 larvae, 30 cocoons, 30 males, and 30 females tested by polymerase chain reaction (PCR were shown to contain rickettsial DNA. PCR products, corresponding to the rickettsial gltA, htrA, ompA and ompB gene partial sequences were sequenced and showed to correspond to Rickettsia felis, indicating that the flea colony was 100% infected by R. felis. The immunofluorescence assay (IFA showed the presence of R. felis-reactive antibodies in blood sera of 7 (87.5% out of 8 cats that were regularly used to feed the flea colony. From 15 humans that used to work with the flea colony in the laboratory, 6 (40.0% reacted positively to R. felis by IFA. Reactive feline and human sera showed low endpoint titers against R. felis, varying from 64 to 256. With the exception of one human serum, all R. felis-reactive sera were also reactive to Rickettsia rickettsii and/or Rickettsia parkeri antigens at similar titers to R. felis. The single human serum that was reactive solely to R. felis had an endpoint titer of 256, indicating that this person was infected by R. felis.

  7. Rickettsia felis infection in cat fleas Ctenocephalides felis felis

    OpenAIRE

    Horta, Mauricio C.; Fabio B. Scott; Thaís R. Correia; Julio I. Fernandes; Leonardo J. Richtzenhain; Labruna, Marcelo B.

    2010-01-01

    The present study evaluated the rickettsial infection in a laboratory colony of cat fleas, Ctenocephalides felis felis (Bouche) in Brazil. All flea samples (30 eggs, 30 larvae, 30 cocoons, 30 males, and 30 females) tested by polymerase chain reaction (PCR) were shown to contain rickettsial DNA. PCR products, corresponding to the rickettsial gltA, htrA, ompA and ompB gene partial sequences were sequenced and showed to correspond to Rickettsia felis, indicating that the flea colony was 100% inf...

  8. Revision of the amphiamerican Neotetraonchus Bravo-Hollis, 1968 (Monogenoidea: Dactylogyridae), with a description of N. vegrandis n. sp. from the gill lamellae of the blue sea catfish Ariopsis guatemalensis (Siluriformes: Ariidae) off the Pacific Coast of Mexico.

    Science.gov (United States)

    Kritsky, Delane C; Mendoza-Franco, Edgar F; Bullard, Stephen A; Vidal-Martínez, Victor M

    2009-09-01

    Neotetraonchus Bravo-Hollis, 1968 is revised and reassigned to the Dactylogyridae Bychowsky, 1933 based on examinations of specimens representing four species from the gill lamellae of sea catfishes (Ariidae). The monotypic Neotetraonchidae Bravo-Hollis, 1968 is placed in synonymy with the Dactylogyridae. Neotetraonchus bychowskyi Bravo-Hollis, 1968 (type-species), is redescribed from the tete sea catfish Ariopsis seemanni (Günther) (type-host) in the eastern Pacific Ocean off Panama (new geographical record). Neotetraonchus vegrandis n. sp. is described from the blue sea catfish A. guatemalensis (Günther) off the Pacific Coast of Mexico. Neotetraonchus bravohollisae Paperna, 1977 is redescribed from the hardhead sea catfish A. felis (L.) in the Gulf of Mexico off the Yucatan Peninsula. Neotetraonchus felis (Hargis, 1955) Paperna, 1977 is redescribed from A. felis in the Gulf of Mexico off Mississippi and the Yucatan Peninsula (new geographical record). Morphological similarities between species of Neotetraonchus suggest the likely presence of geminate species pairs flanking the Isthmus of Panama. PMID:19633926

  9. On Felis badia Gray

    NARCIS (Netherlands)

    Jentink, F.A.

    1901-01-01

    Among some very commonly known mammals, presented to the Leyden Museum by the well-known Dutch Borneoexplorer Dr. Nieuwenhuis, I found a fine Cat quite distinct from all other cats I ever saw; it has a size somewhat larger than Felis planiceps, a small head like that cat, a much longer tail and a mu

  10. Apuntes sobre la reproduccion de algunos Bagres marinos

    NARCIS (Netherlands)

    Luengo, José A.

    1973-01-01

    Mouthbreeding in the male, and modifications of the pelvic fins of the female are recorded for the first time in Selenaspis herzbergii. The pelvic girdle of Selenaspis herzbergii is compared with those of Sciadeichthys proops, Arius spixii, and Bagre marinus. Data are given on eggs and fry in the bu

  11. Rickettsia felis in Xenopsylla cheopis, Java, Indonesia

    OpenAIRE

    Jiang, Ju; Soeatmadji, Djoko W.; Henry, Katherine M; Ratiwayanto, Sutanti; Michael J. Bangs; Richards, Allen L.

    2006-01-01

    Rickettsia typhi and R. felis, etiologic agents of murine typhus and fleaborne spotted fever, respectively, were detected in Oriental rat fleas (Xenopsylla cheopis) collected from rodents and shrews in Java, Indonesia. We describe the first evidence of R. felis in Indonesia and naturally occurring R. felis in Oriental rat fleas.

  12. Lattice design of FELI accelerator system

    International Nuclear Information System (INIS)

    FELI is constructing an S-band linac accelerator system for generating wide range FEL (Free Electron Laser). The accelerator system has for lasing sections, almost isochronous offsetting lattices, and returning lattices. This paper describes the lattice design. (author)

  13. RF system of FELI linac

    International Nuclear Information System (INIS)

    FELI (Free Electron Laser Research Institute, Inc.) is constracting a Free Electron Laser facility covering from 20μm (infrared region) to 0.35μm (ultra violet region), using an S-band linac. The building will be completed in November 1993 and linac will start to be installed in December 1993. RF system of linac for FEL is required of long pulse duration and high stability. An S-band klystron (Toshiba E3729) is operated in three pulse operation modes (pulse width and peak RF power); 24μs-24MW, 12.5μs-34MW, 0.5μs-70MW. Each klystron modulator has the PFN consisting of 4 parallel networks of 24 capacitors and 24 inductors, and it has a line switch of optical thyristor stack. (author)

  14. Cat Scratch Disease: the Rare Role of Afipia felis

    OpenAIRE

    Giladi, Michael; Avidor, Boaz; Kletter, Yehudith; Abulafia, Suzy; Slater, Leonard N.; Welch, David F.; Brenner, Don J.; Steigerwalt, Arnold G.; Whitney, Anne M.; Ephros, Moshe

    1998-01-01

    Since its isolation in 1988, Afipia felis has been associated with cat scratch disease (CSD) in only one report and its role in CSD has been questioned. We have cultured A. felis from a lymph node of a patient with CSD. 16S rRNA gene sequencing, DNA relatedness studies, fatty acid analysis, and PCR of the A. felis ferredoxin gene showed that the isolate is identical to the previously reported A. felis isolate. To determine the role of A. felis in CSD, PCR of the 16S rRNA gene followed by hybr...

  15. Rickettsia felis, an emerging flea-transmitted human pathogen

    Directory of Open Access Journals (Sweden)

    Stephen Graves

    2011-07-01

    Full Text Available Rickettsia felis was first recognised two decades ago and has now been described as endemic to all continents except Antarctica. The rickettsiosis caused by R. felis is known as flea-borne spotted fever or cat-flea typhus. The large number of arthropod species found to harbour R. felis and that may act as potential vectors support the view that it is a pan-global microbe. The main arthropod reservoir and vector is the cat flea, Ctenocephalides felis, yet more than 20 other species of fleas, ticks, and mites species have been reported to harbour R. felis. Few bacterial pathogens of humans have been found associated with such a diverse range of invertebrates. With the projected increase in global temperature over the next century, there is concern that changes to the ecology and distribution of R. felis vectors may adversely impact public health.

  16. Rickettsia felis, an emerging flea-transmitted human pathogen

    OpenAIRE

    Abdad, Mohammad Yazid; Stenos, John; Graves, Stephen

    2011-01-01

    Rickettsia felis was first recognised two decades ago and has now been described as endemic to all continents except Antarctica. The rickettsiosis caused by R. felis is known as flea-borne spotted fever or cat-flea typhus. The large number of arthropod species found to harbour R. felis, and be potential vectors, supports the view that it is a pan-global microbe. The main arthropod reservoir and vector is the cat flea, Ctenocephalides felis, yet a further twenty other species of fleas, ticks a...

  17. In vitro efficacy of essential oils and extracts of Schinus molle L. against Ctenocephalides felis felis.

    Science.gov (United States)

    DE S O Batista, Lilian C; Cid, Yara P; DE Almeida, Ana Paula; Prudêncio, Edlene R; Riger, Cristiano J; DE Souza, Marco A A; Coumendouros, Katherine; Chaves, Douglas S A

    2016-04-01

    Extracts and essential oils from plants are important natural sources of pesticides. These compounds are considered an alternative to control ectoparasites of veterinary importance. Schinus molle, an endemic species of Brazil, produces a high level of essential oil and several other compounds. The aim of this work was to determinate the chemical composition of extracts and essential oils of S. molle and further to evaluate the activity against eggs and adults of Ctenocephalides felis felis, a predominant flea that infests dogs and cats in Brazil. In an in vitro assay, the non-polar (n-hexane) extract showed 100% efficacy (800 µg cm-2; LD50 = 524·80 µg cm-2) at 24 and 48 h. Its major compound was lupenone (50·25%). Essential oils from fruits and leaves were evaluated, and had 100% efficacy against adult fleas at 800 µg cm-2 (LD50 = 353·95 µg cm-2) and at 50 µg cm-2 (LD50 = 12·02 µg cm-2), respectively. On the other hand, the essential oil from fruits and leaves was not active against flea eggs. This is the first study that reports the insecticidal effects of essential oils and extracts obtained from Schinus molle against Ctenocephalides felis felis. PMID:26887529

  18. Mycoplasma felis as a cause of pleuritis in horses.

    Science.gov (United States)

    Ogilvie, T H; Rosendal, S; Blackwell, T E; Rostkowski, C M; Julian, R J; Ruhnke, L

    1983-06-15

    Mycoplasma felis was the only organism recovered from the thoracic cavity of a horse with pleuritis. Large numbers of mildly degenerative neutrophils were in the pleural fluid. The horse developed a serologic response to M felis and recovered during hospitalization. Experimentally, a pony was inoculated in the thoracic cavity with a pure culture of the M felis isolate suspended in the pony's serum. A control pony was inoculated with serum only. Within 48 hours, the principal pony developed fever, increased respiratory rate, pleural effusion, and signs of pain. A highly cellular exudate with nondegenerative neutrophils and large numbers of M felis was recovered from the thoracic cavity. The control pony remained normal. The principal pony developed an antibody response to M felis. The control pony did not. Fourteen days after inoculation, both ponies were euthanatized. Necropsy revealed pleural inflammation in the principal pony. Pleural lesions were not found in the control pony. PMID:6874502

  19. Prevalence and infection load dynamics of Rickettsia felis in actively feeding cat fleas.

    Directory of Open Access Journals (Sweden)

    Kathryn E Reif

    Full Text Available BACKGROUND: Rickettsia felis is a flea-associated rickettsial pathogen recurrently identified in both colonized and wild-caught cat fleas, Ctenocephalides felis. We hypothesized that within colonized fleas, the intimate relationship between R. felis and C. felis allows for the coordination of rickettsial replication and metabolically active periods during flea bloodmeal acquisition and oogenesis. METHODOLOGY/PRINCIPAL FINDINGS: A quantitative real-time PCR assay was developed to quantify R. felis in actively feeding R. felis-infected fleas. In three separate trials, fleas were allowed to feed on cats, and a mean of 3.9x10(6 R. felis 17-kDa gene copies was detected for each flea. A distinct R. felis infection pattern was not observed in fleas during nine consecutive days of bloodfeeding. However, an inverse correlation between the prevalence of R. felis-infection, which ranged from 96% in Trial 1 to 35% in Trial 3, and the R. felis-infection load in individual fleas was identified. Expression of R. felis-infection load as a ratio of R. felis/C. felis genes confirmed that fleas in Trial 3 had significantly greater rickettsial loads than those in Trial 1. CONCLUSION/SIGNIFICANCE: Examining rickettsial infection dynamics in the flea vector will further elucidate the intimate relationship between R. felis and C. felis, and facilitate a more accurate understanding of the ecology and epidemiology of R. felis transmission in nature.

  20. Efecto de tres tipos de presas vivas en la larvicultura de bagre blanco (Sorubim cuspicaudus

    Directory of Open Access Journals (Sweden)

    Martha Prieto-Guevara

    2013-11-01

    Full Text Available Objetivo. Evaluar el efecto de diferentes presas vivas en la larvicultura de bagre blanco (Sorubim cuspicaudus. Materiales y métodos. Al inicio de la alimentación exógena de Sorubim cuspicaudus, se ofreció zooplancton producido en mesocosmos (T1, zooplancton silvestre (T2 y nauplios de Artemia (T3, en concentración de 10.000 zoop/L, dos veces al día, durante seis días. Se utilizaron 18 acuarios de cinco litros de volumen útil, con densidad de 25 Larvas/L, seis réplicas por tratamiento en un diseño al azar. Se estimaron la ganancia en peso (Gp y longitud (Gl, tasa de crecimiento específico (G, sobrevivencia (S, resistencia al estrés (Re, mortalidad acumulada (Ma y mortalidad por canibalismo (Mc. Resultados. Las larvas alimentadas con mesocosmos presentaron la mayor sobrevivencia (81.3±15.9%; aunque el mejor crecimiento lo presentaron las larvas alimentadas con zooplancton silvestre (T2 las cuales presentaron la mayor mortalidad (42.0±10.7% y la menor resistencia al estrés (30.0±33.0%. El canibalismo se observó en todos los tratamientos, oscilando entre 4.0 (T2 y 14.3% (T1 sin diferencias significativas entre estos valores (p>0.05. Conclusiones. El uso de zooplancton producido bajo condiciones controladas permitió una alta sobrevivencia, adecuado desempeño y resistencia de las larvas, perfilándose como alternativa viable en la primera alimentación de bagre blanco.

  1. Mycoplasma felis pleuritis in two show-jumper horses.

    Science.gov (United States)

    Hoffman, A M; Baird, J D; Kloeze, H J; Rosendal, S; Bell, M

    1992-04-01

    Mycoplasma felis was identified as the cause of acute pleuritis in 2 show-jumping horses. The pleural exudate was proteinaceous, contained large numbers of neutrophils, and had a markedly increased lactate concentration. M. felis was isolated in pure culture from pleural fluid. Rising serum antibody titers to M. felis as well as a precipitous decline in titers to equine influenza virus were demonstrated in both horses. Pleural effusion in both horses and a pneumothorax detected in one of the horses resolved following a single drainage of pleural fluid and intravenous fluid, antibiotic, and analgesic therapy. PMID:1623728

  2. Hepatic yersiniosis in a cougar (Felis concolor).

    Science.gov (United States)

    Owston, Michael A; Wu, Ching Ching; Ramos-Vara, José A

    2006-09-01

    A cougar (Felis concolor) was diagnosed with hepatic yersiniosis by bacterial culture and histopathology. The animal had a 2-week history of anorexia and jaundice before its death. Grossly, the liver exhibited caseo-necrotic foci. Histopathologically, there was necrotizing and suppurative hepatitis, with large numbers of intralesional gram-negative coccobacilli. Additional hepatic lesions included central vein thrombosis, lymphoplasmacytic portal hepatitis, and capsulitis. Yersinia pseudotuberculosis coccobacilli were isolated in pure culture from the hepatic lesions. Because the hepatic lesions in this animal resemble those of other zoonotic diseases, such as plague and tularemia, veterinarians and laboratory personnel who handle samples should take adequate safety precautions. This report is the first to describe the pathology associated with hepatic yersiniosis in a cougar. PMID:17037628

  3. Optical cavity and transport system for FELI

    International Nuclear Information System (INIS)

    FELI (Free Electron Laser Research Institute, Inc.) is aiming at FIR-, IR-, VISIBLE-, and UV-FEL (spectral range from 0.3 to 22.7μm) generation using 30-, 75-, 120-, 165-MeV beams, respectively. The linear accelerator and four undulators are installed in the ground floor and five FEL users rooms are located in the third floor, so the longest FEL transport pass is about 80m long. We will adopt hole out coupling for FIR- and IR-FEL optical cavities. The output beam is collimated by an inverted telescope and transported to the users rooms via N2 purged pipes. Achieving optical beam stability and quality are primary concerns. For keeping optical beam stability and quality, a beam axis control unit and a position monitoring system are used. These optical cavities and FEL transport systems are under construction and will be used for FIR- and IR-FEL experiments in this summer. (author)

  4. Prevalence and Infection Load Dynamics of Rickettsia felis in Actively Feeding Cat Fleas

    OpenAIRE

    Reif, Kathryn E.; Stout, Rhett W.; Gretchen C Henry; Lane D Foil; Macaluso, Kevin R.

    2008-01-01

    Background Rickettsia felis is a flea-associated rickettsial pathogen recurrently identified in both colonized and wild-caught cat fleas, Ctenocephalides felis. We hypothesized that within colonized fleas, the intimate relationship between R. felis and C. felis allows for the coordination of rickettsial replication and metabolically active periods during flea bloodmeal acquisition and oogenesis. Methodology/Principal Findings A quantitative real-time PCR assay was developed to quantify R. fel...

  5. El bagre de canal (Ictalurus punctatus Rafinesque, 1818: estado actual y problemática en México

    Directory of Open Access Journals (Sweden)

    Ana Laura Lara-Rivera

    2015-07-01

    Full Text Available El bagre de canal (Ictalurus punctatus es uno de los peces endémicos de Norte América con mayor potencial para la acuicultura. A pesar de esto, los datos sobre su distribución actual son escasos y se desconocen muchos aspectos de su dinámica y desempeño productivo. En el presente estudio se reportan los resultados de una búsqueda bibliográfica y análisis de campo que permiten describir la situación actual del bagre de canal con respecto a su distribución geográfica histórica y actual, así como de la problemática que enfrentan los sistemas productivos de esta especie en México. Se identificó la falta de información e indicadores que permitan conocer la extensión de su hábitat natural, movilización o potencial productivo. La calidad y disponibilidad del agua figuran entre las principales problemáticas de la industria; el alimento supone el mayor gasto para los productores y existe gran heterogeneidad de manejo tanto en granjas reproductoras como de engorde, gran parte de la dinámica productiva sigue un modelo de ensayo y error. Se requiere optimizar y homologar los procesos del sistema productivo de bagre de canal, así como caracterizar correctamente las poblaciones domésticas y silvestres para aprovechar al máximo su potencial.

  6. Optical properties of infrared FELs from the FELI Facility II

    Energy Technology Data Exchange (ETDEWEB)

    Saeki, K.; Okuma, S.; Oshita, E. [Free Electron Laser Institute, Osaka (Japan)] [and others

    1995-12-31

    The FELI Facility II has succeeded in infrared FEL oscillation at 1.91 {mu} m using a 68-MeV, 40-A electron beam from the FELI S-band linac in February 27, 1995. The FELI Facility II is composed of a 3-m vertical type undulator ({lambda}u=3.8cm, N=78, Km a x=1.4, gap length {ge}20mm) and a 6.72-m optical cavity. It can cover the wavelength range of 1-5{mu}m. The FELs can be delivered from the optical cavity to the diagnostics room through a 40-m evacuated optical pipeline. Wavelength and cavity length dependences of optical properties such as peak power, average power, spectrum width, FEL macropulse, FEL transverse profile are reported.

  7. Avaliação de diferentes dietas merídicas sobre a emergência de adultos de Ctenocephalides felis felis (Siphonaptera : Pulicidae Evaluation of different meridic diets upon adult emergence of Ctenocephalides felis felis (Siphonaptera: Pulicidae

    Directory of Open Access Journals (Sweden)

    Vanessa Paulino da Cruz Vieira

    2010-03-01

    Full Text Available O objetivo do presente trabalho foi avaliar a influência de dietas merídicas compostas por sangue de diferentes espécies animais sobre a emergência de adultos da pulga Ctenocephalides felis felis. Foram utilizadas seis dietas artificiais contendo areia e sangue desidratado de cão, boi, coelho e galinha, acrescidas ou não com farelo de trigo. Foram realizadas seis repetições contendo dez ovos de C. f. felis para cada dieta. Após 25 dias de incubação, os ovos foram quantificados e avaliados quanto à emergência de adultos. O número de pulgas emergidas para dietas com sangue de boi, cão, coelho e galinha, com areia e farelo de trigo, foi de aproximadamente oito pulgas. Para as dietas contendo apenas sangue de boi ou de cão e areia, essa emergência foi de aproximadamente uma pulga para ambas. Conclui-se que a origem do sangue empregado na elaboração da dieta não interfere significativamente no percentual de emergência de adultos de C. f. felis. Portanto, pode-se optar pela espécie animal disponível para o preparo da dieta artificial, aliada à suplementação com farelo de trigo, para suprir uma eventual perda nutricional decorrente da desidratação do sangue.The objective of the present study was to evaluate the influence of meridic diets composed by blood from different animal species upon the adult emergence of Ctenocephalides felis felis fleas. Six artificial diets containing dried blood of cattle (standard, dogs, rabbit and chicken, combined with sand or sand/wheat bran were prepared. For each diet six samples containing ten C. f. felis eggs were evaluated. After 25 days of incubation, samples were assessed for adult emergence. The number of emerge fleas for diets composed by bovine, canine, rabbit and chicken combined with sand/wheat bran was aproximally eight fleas. Diets composed by bovine and canine combined with sand, this emergence was aproximally one flea, for both. It can be concluded that the blood origin do not

  8. Genomic diversification in strains of Rickettsia felis Isolated from different arthropods.

    Science.gov (United States)

    Gillespie, Joseph J; Driscoll, Timothy P; Verhoeve, Victoria I; Utsuki, Tadanobu; Husseneder, Claudia; Chouljenko, Vladimir N; Azad, Abdu F; Macaluso, Kevin R

    2015-01-01

    Rickettsia felis (Alphaproteobacteria: Rickettsiales) is the causative agent of an emerging flea-borne rickettsiosis with worldwide occurrence. Originally described from the cat flea, Ctenocephalides felis, recent reports have identified R. felis from other flea species, as well as other insects and ticks. This diverse host range for R. felis may indicate an underlying genetic variability associated with host-specific strains. Accordingly, to determine a potential genetic basis for host specialization, we sequenced the genome of R. felis str. LSU-Lb, which is an obligate mutualist of the parthenogenic booklouse Liposcelis bostrychophila (Insecta: Psocoptera). We also sequenced the genome of R. felis str. LSU, the second genome sequence for cat flea-associated strains (cf. R. felis str. URRWXCal2), which are presumably facultative parasites of fleas. Phylogenomics analysis revealed R. felis str. LSU-Lb diverged from the flea-associated strains. Unexpectedly, R. felis str. LSU was found to be divergent from R. felis str. URRWXCal2, despite sharing similar hosts. Although all three R. felis genomes contain the pRF plasmid, R. felis str. LSU-Lb carries an additional unique plasmid, pLbaR (plasmid of L. bostrychophila associated Rickettsia), nearly half of which encodes a unique 23-gene integrative conjugative element. Remarkably, pLbaR also encodes a repeats-in-toxin-like type I secretion system and associated toxin, heretofore unknown from other Rickettsiales genomes, which likely originated from lateral gene transfer with another obligate intracellular parasite of arthropods, Cardinium (Bacteroidetes). Collectively, our study reveals unexpected genomic diversity across three R. felis strains and identifies several diversifying factors that differentiate facultative parasites of fleas from obligate mutualists of booklice. PMID:25477419

  9. Molecular evidence of Rickettsia felis infection in dogs from northern territory, Australia

    Directory of Open Access Journals (Sweden)

    Rees Robert L

    2011-10-01

    Full Text Available Abstract The prevalence of spotted fever group rickettsial infection in dogs from a remote indigenous community in the Northern Territory (NT was determined using molecular tools. Blood samples collected from 130 dogs in the community of Maningrida were subjected to a spotted fever group (SFG-specific PCR targeting the ompB gene followed by a Rickettsia felis-specific PCR targeting the gltA gene of R. felis. Rickettsia felis ompB and gltA genes were amplified from the blood of 3 dogs. This study is the first report of R. felis infection in indigenous community dogs in NT.

  10. Histología y morfometría del sistema digestivo del silúrido bagre tigrito (pimelodus pictus)

    OpenAIRE

    Olaya, C. M.; Ovalle, C. H.; Gómez Ramírez, E.; Rodríguez Caicedo, D.; Caldas Martínez, M. L.; Hurtado Giraldo, H.

    2009-01-01

    El bagre tigrito Pimelodus pictus es un pez ornamental con gran aceptación en el mercado acuarista internacional, sin embargo, se desconocen muchos aspectos de la biología básica de esta especie. Por tal motivo, se realizó un estudio histológico y morfométrico del sistema digestivo a fin de contribuir al diseño de futuras dietas. Se sacrificaron 7 individuos adultos de P. pictus de 10 ± 0,5 cm de longitud total con una sobredosis de MS-222 (0,5 g/l). Los especímenes se fijaron en formaldehído...

  11. FEL beam qualities and application researches at the FELI

    International Nuclear Information System (INIS)

    The FELI four FEL facilities (FEL-1, FEL-2, FEL-3 and FEL-4) are open for users to supply several MW-level FELs covering a wide wavelength range from 278 nm to 40 μm. The ultraviolet (UV)- and visible-FEL facility (FEL-3) keeps the world record for the shortest wavelength oscillation of linac-based FELs with a thermionic gun since 1995. Technical challenges have been tried at simultaneous FEL beam sharing with fan-shaped mirrors for multistations including two manipulators and at FEL beam diagnostics of micropulse length and beam profile. The latter is for the evaluations of FEL peak power densities at irradiated spots. FEL peak power densities and adequate wavelengths are evaluated at thirteen research subjects performed at the FELI. The application researches have been performed distributed in a wide field of material science, chemical technology and bio-medical applications. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  12. Outbreaks of Rickettsia felis in Kenya and Senegal, 2010

    Centers for Disease Control (CDC) Podcasts

    2010-06-09

    This podcast describes the outbreak of Rickettsia felis in Kenya between August 2006 and June 2008, and in rural Senegal from November 2008 through July 2009. CDC infectious disease pathologist Dr. Chris Paddock discusses what researchers learned about this flea-borne disease and how to prevent infection.  Created: 6/9/2010 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 6/24/2010.

  13. Life cycle of Cystoisospora felis (Coccidia: Apicomplexa) in cats and mice

    Science.gov (United States)

    Cystoisospora felis is a ubiquitous apicomplexan protozoon of cats. The endogenous development of C. felis was studied in cats after feeding them infected mice. For this, 5 newborn cats were killed at 24, 48, 72, 96, and 120 h after having been fed mesenteric lymph nodes and spleens of mice that wer...

  14. Rickettsia felis Infection in a Common Household Insect Pest, Liposcelis bostrychophila (Psocoptera: Liposcelidae)▿ †

    Science.gov (United States)

    Behar, Adi; McCormick, Laurie J.; Perlman, Steve J.

    2010-01-01

    Many species of Rickettsia are well-known mammalian pathogens transmitted by blood-feeding arthropods. However, molecular surveys are continually uncovering novel Rickettsia species, often in unexpected hosts, including many arthropods that do not feed on blood. This study reports a systematic molecular characterization of a Rickettsia infecting the psocid Liposcelis bostrychophila (Psocoptera: Liposcelidae), a common and cosmopolitan household pest. Surprisingly, the psocid Rickettsia is shown to be Rickettsia felis, a human pathogen transmitted by fleas that causes serious morbidity and occasional mortality. The plasmid from the psocid R. felis was sequenced and was found to be virtually identical to the one in R. felis from fleas. As Liposcelis insects are often intimately associated with humans and other vertebrates, it is speculated that they acquired R. felis from fleas. Whether the R. felis in psocids causes disease in vertebrates is not known and warrants further study. PMID:20139311

  15. Case report: pulicosis por Ctenocephalides felis felis en ovinos y caprinos en la sabana de Bogotá, Colombia

    Directory of Open Access Journals (Sweden)

    Efraín Benavides Ortiz

    2010-06-01

    Full Text Available In Colombia the rearing of hair sheep and goats are expanding in various regions for being an alternative for meat and milk production at competitive prices due to their adaptability and easiness to digest rough fodder. Among the ectoparasites that affect small ruminants traditionally are recognized the lice and the sheep keds Melophagus ovinus (Díptera: Hippoboscidae, however fleas are not included. Here the occurrence of the common cat flea Ctenocephalides felis felis (Díptera: Siphonaptera affecting sheep and goats in a farm at the Sabana de Bogotá are described an so there was performed an epidemiological and parasitological evaluation. The barn maintained animals in rotational grazing at an approximated stocking rate of 25 head/ha, receiving additional supplements of hay and silage. The presence of the flea was confirmed in sheep and goats, young and adult, as well as in dogs. Diverse degrees of anemia were evidenced but the association between flea infestation and anemia, or the presence of other anemia producing agents could not be studied. In the farm synthetic parasiticides are not used, extracts of Ruda (Ruta graveolens are administered to mitigate parasitosis, without major efficacy. Sheep and goat breeders in the tropics should consider flea infestation as an agent causing adverse animal welfare situations in their farms. Control should start from the knowledge of the life cycle of the flea, trying to interrupt it.

  16. Efecto antioxidante y antimicrobiano de sales de ácidos orgánicos y extractos naturales en filetes de bagre dorado (Brachyplatystoma rousseauxii) refrigerados

    OpenAIRE

    José Vicente Pacheco Guerrero; Elisabetta Tomé; Marisa Guerra; Rosa Raybaudi

    2011-01-01

    En el presente trabajo fueron investigados los efectos del lactato de sodio, acetato de sodio, romero y ajo en soluciones acuosas a 2,5 % sobre la calidad microbiológica y oxidación lipídica en rebanadas de bagre dorado (Brachyplatystoma rousseauxii) almacenadas a 4 ºC. Los resultados mostraron que estas soluciones fueron eficaces (p < 0,05) contra la proliferación de distintas categorías de microorganismos deteriorativos, incluyendo poblaciones aeróbicas y psicrotróficas, Pseudomonas spp., b...

  17. Modelo de restauración de áreas degradadas por minería en El Bagre – Antioquia

    OpenAIRE

    Vanegas Villa, Huber Alexander

    2014-01-01

    Resumen: Actualmente la minería aurífera aluvial, explota la mayor parte del área de humedales asociados al río Nechí en el municipio del Bagre, Antioquia - Colombia. En los humedales operados por las grandes empresas mineras, sus programas de “recuperación de tierras” en el Bajo Cauca antioqueño, incluyen medidas como reforestación, parcelas productivas, recuperación de humedales, conformación de diques de protección, manejo de sedimentos, etc. Sin embargo, se han identificado algunos efecto...

  18. Antimalaric antiobodies in school children in El Bagre, Colombia Detección de anticuerpos antimaláricos en un grupo de escolares del municipio de El Bagre, Antioquia

    Directory of Open Access Journals (Sweden)

    Isabel Polanco

    1998-01-01

    Full Text Available A cases and controls study was carried out in 1996 in El Bagre, Colombia, endemic zone for malaria, in order to determine the relationship between nutritional situation and immune response to malaria in 51 children with malaria and 49 without it; IgG and IgM antibodies were determined by means of indirect inmunofluorescence .against P. falciparum antigens (Strain FCB2. Nutritional situation was evaluated according to USA National Center for Health Statistics. No child was found positive for IGM antibodies; concerning IgG response, it was positive in 29 (56.9% malaric children but only in 4 (8.2% of the non-malaric ones (p<0.00001 . Difference was also signjficant (p<0.00001 for malarja antecedents in the previous year (70.6% in malaric children vs 10.2% jn the nonmalaric ones. Of the 29 malaric seropositive children 20 (69% were malnourished (p<0.01 . En 1996, en el municipio de El Bagre (Antioquia-Colombia, zona endémica para malaria y con altos niveles de desnutrición, se realizó un estudio de casos y controles con el objeto de determinar la relación entre el estado nutricional y la respuesta inmune humoral de niños con y sin malaria. Se trabajó con un grupo de 100 niños entre 4 y 9 años de edad, 51 con malaria y 49 sin ella, al cual se le determinaron los niveles de anticuerpos antimaláricos IgG e IgM por la técnica de inmunofluorescencia indirecta (IFI, empleando antigenos de P. falciparum cepa FCB 2 mantenida en cultivo continuo. El estado nutricional se evaluó por comparación de las medidas antropométricas con la referencia de crecimiento del National Center for Health Statistics (NCHS de los Estados Unidos. Los resultados mostraron diferencias en la tasa de positividad de anticuerpos IgG entre los niños maláricos y los no maláricos. En efecto: Veintinueve niños maláricos (56.9% y sólo 4 de los no maláricos (8.2% tenían dichos anticuerpos (P<0.00001 ; la diferencia también fue significativa para el antecedente de

  19. Clusters in social behaviour of female domestic cats (Felis silvestris catus) living in confinement

    NARCIS (Netherlands)

    vandenBos, R; de Vries, Han

    1996-01-01

    Associations between different agonistic and affiliative behavioural patterns of female domestic cats (Felis silvestris catus) were studied. In three groups of intact cats living in confinement frequencies of fourteen agonistic and affiliative behavioural patterns were recorded. The technique of fac

  20. Chlamydia felis exposure in companion dogs and cats in Lanzhou, China: a public health concern

    OpenAIRE

    Wu, Song-Ming; Huang, Si-Yang; Xu, Min-Jun; Zhou, Dong-Hui; Song, Hui-Qun; Zhu, Xing-Quan

    2013-01-01

    Background Chlamydiaceae is a family of obligate intracellular pathogens with a worldwide distribution in many animal species, including humans. No information exists on the prevalence of Chlamydia felis infections in cats and dogs in Lanzhou, the geographical center of China. The aim of this study was to carry out a census of cats and dogs in Lanzhou and document the seroprevalence of C. felis exposure in these companion animals. Results In this study, blood samples were collected from 485 a...

  1. Molecular and morphologic characterization of Sarcocystis felis (Apicomplexa: Sarcocystidae) in South American wild felids from Brazil.

    Science.gov (United States)

    Cañón-Franco, William Alberto; López-Orozco, Natalia; Christoff, Alexandre Uarth; de Castilho, Camila Schlieper; de Araújo, Flavio Antônio Pacheco; Verma, Shiv Kumar; Dubey, J P; Soares, Rodrigo Martins; Gennari, Solange Maria

    2016-02-15

    Wild felids are thought to share parasites with domestic cats. However, little is known of the coccidian parasites of wild felids. We investigated the presence of Sarcocystis spp. in tissues of 6 species of 90 Neotropical small felids killed in road accidents in the state of Rio Grande do Sul, Brazil by using microscopic and molecular techniques. Formalin-fixed tissues from 28 felids were examined, and Sarcocystis felis-like sarcocysts were detected in 4 wild cats (2 Puma yagouaroundi and 2 Leopardus guttulus). By transmission electron microscopy, sarcocysts from a P. yagouaroundi were identical to S. felis from domestic cats in the USA. Direct sequencing of PCR amplicons resulted the unambiguous sequences of the ITS-1 region from 18 of the 31 PCR positive wild cats; 5 sequences from each P. yagouaroundi, and Leopardus geoffroyi, 4 sequences from L. guttulus, and 2 sequences from each Leopardus wiedii, and Leopardus colocolo. Sequences analysis of ITS-1 region revealed the highest identiy (97-99%) with that of previously describe isolates of S. felis from domestic cats in the USA and identified them as S. felis. Tissues of 1 Leopardus pardalis tested by PCR and histology were negative. The phylogenetic relationship indicated that S. felis is quite different to species which employ opossums as their definitive host. This is the first report of S. felis infection in small wild felids from Brazil. PMID:26827854

  2. Plasmids and rickettsial evolution: insight from Rickettsia felis.

    Directory of Open Access Journals (Sweden)

    Joseph J Gillespie

    Full Text Available BACKGROUND: The genome sequence of Rickettsia felis revealed a number of rickettsial genetic anomalies that likely contribute not only to a large genome size relative to other rickettsiae, but also to phenotypic oddities that have confounded the categorization of R. felis as either typhus group (TG or spotted fever group (SFG rickettsiae. Most intriguing was the first report from rickettsiae of a conjugative plasmid (pRF that contains 68 putative open reading frames, several of which are predicted to encode proteins with high similarity to conjugative machinery in other plasmid-containing bacteria. METHODOLOGY/PRINCIPAL FINDINGS: Using phylogeny estimation, we determined the mode of inheritance of pRF genes relative to conserved rickettsial chromosomal genes. Phylogenies of chromosomal genes were in agreement with other published rickettsial trees. However, phylogenies including pRF genes yielded different topologies and suggest a close relationship between pRF and ancestral group (AG rickettsiae, including the recently completed genome of R. bellii str. RML369-C. This relatedness is further supported by the distribution of pRF genes across other rickettsiae, as 10 pRF genes (or inactive derivatives also occur in AG (but not SFG rickettsiae, with five of these genes characteristic of typical plasmids. Detailed characterization of pRF genes resulted in two novel findings: the identification of oriV and replication termination regions, and the likelihood that a second proposed plasmid, pRFdelta, is an artifact of the original genome assembly. CONCLUSION/SIGNIFICANCE: Altogether, we propose a new rickettsial classification scheme with the addition of a fourth lineage, transitional group (TRG rickettsiae, that is unique from TG and SFG rickettsiae and harbors genes from possible exchanges with AG rickettsiae via conjugation. We offer insight into the evolution of a plastic plasmid system in rickettsiae, including the role plasmids may have played in

  3. Evaluation of the chromium contamination at Ribeirão dos Bagres, Franca (SP), Brazil, by the 210Pb method

    International Nuclear Information System (INIS)

    This paper presents a chronological study focusing the use of 210Pb in four sediment cores collected at Ribeirão dos Bagres in the region of Franca, São Paulo State, Brazil. When evaluating the sedimentation rate by using the 210Pb method, it was possible to monitor historical changes occurring in the concentrations of chromium present in the sediments. In order to do so, several specific parameters were determined in sediments, as chromium concentration, major oxides, organic matter, grain size, and chemical and physical–chemical parameters of waters. The sediments possessed a Cr concentration range of 0.83–26.25 mg/kg that is below the world's average of shales. The sedimentation rates obtained from the 210Pb analysis were between 0.07 and 0.77 g cm−2 year−1, while the linear sedimentation rate was from 0.6 to 3.2 cm/year. The adoption of the CIC (Constant Initial Concentration) 210Pb model allowed characterize older sediments, aged 177 years, and younger sediments, aged 4 years. The organic matter in the sediments was more abundant in the first few centimeters of practically all profiles, and the analysis of oxides showed that silica is the major constituent of the sediments, in which there is predominance of sand and silt. In addition, the analysis of the physical and chemical parameters of waters indicated that they are suitable for navigation and natural harmony landscape. - Highlights: • Application of natural radionuclides in an important industrial center devoted to the production of leather for manufacturing shoes. • Study of a well-known site of environmental Cr contamination. • Use of the Pb-210 chronological CIC model to provide an approach of the historical Cr contamination in the region

  4. Variación estacional de las características seminales del bagre rayado Pseudoplatystoma metaense (Telostei, pimelodidae

    Directory of Open Access Journals (Sweden)

    Juan Ramirez-Merlano

    2011-04-01

    Full Text Available Objetivo. Determinar la variación de la calidad, el contenido iónico y la osmolaridad del plasma seminal de Pseudoplatystoma metaense durante la estación reproductiva. Materiales y métodos. Se utilizaron machos sexualmente maduros durante un periodo reproductivo (marzo a agosto. La espermiación fue inducida con Extracto de Hipófisis de Carpa (4 mg/kg. Se evaluó el volumen (mL, movilidad masal (%, tiempo de activación (sg, espermatocrito (%; concentración espermática (106 sptz/µL y viabilidad (%. También fue determinada la movilidad (% y velocidad individual por medio de un Sistema de Análisis Espermático Asistido por Computador (CASA. La osmolaridad (mOsm/Kg y la concentración de iones (Na+, Cl+, K+ y Mg2+ y glucosa fue determinada en plasma seminal obtenido por centrifugación del semen a 14.000 g. La concentración de iones y glucosa fue establecida a través de un sistema de reflectancia. Resultados. El semen de Pseudoplatystoma metaense presentó una movilidad masal mayor al 90%, con el menor valor de movilidad progresiva lineal rápida para el mes de abril (34.9±9.0% y en general valores de espermatozoides inmóviles menores al 10%. El plasma seminal mostró una osmolaridad de 259.3± 3.5 mOsm/Kg, con una concentración promedio de glucosa e iones Na+, Cl+, K+ y Mg2+ de 142.7±2.8, 118±2.2, 4.8±0.4 y 0.33±0.0 mmol/L, respectivamente, durante la época reproductiva. Conclusiones. La calidad seminal de bagre rayado no presentó variaciones en la estación reproductiva mostrando una alta calidad para los procesos de fecundación.

  5. Molecular evidence for the presence of Rickettsia Felis in the feces of wild-living African apes.

    Directory of Open Access Journals (Sweden)

    Alpha Kabinet Keita

    Full Text Available BACKGROUND: Rickettsia felis is a common emerging pathogen detected in mosquitoes in sub-Saharan Africa. We hypothesized that, as with malaria, great apes may be exposed to the infectious bite of infected mosquitoes and release R. felis DNA in their feces. METHODS: We conducted a study of 17 forest sites in Central Africa, testing 1,028 fecal samples from 313 chimpanzees, 430 gorillas and 285 bonobos. The presence of rickettsial DNA was investigated by specific quantitative real-time PCR. Positive results were confirmed by a second PCR using primers and a probe targeting a specific gene for R. felis. All positive samples were sequenced. RESULTS: Overall, 113 samples (11% were positive for the Rickettsia-specific gltA gene, including 25 (22% that were positive for R. felis. The citrate synthase (gltA sequence and outer membrane protein A (ompA sequence analysis indicated 99% identity at the nucleotide level to R. felis. The 88 other samples (78% were negative using R. felis-specific qPCR and were compatible with R. felis-like organisms. CONCLUSION: For the first time, we detected R. felis in wild-living ape feces. This non invasive detection of human pathogens in endangered species opens up new possibilities in the molecular epidemiology and evolutionary analysis of infectious diseases, beside HIV and malaria.

  6. Biomarcadores histológicos em duas espécies de bagres estuarinos da Costa Maranhense, Brasil Histology biomarkers in two estuarine catfish species from the Maranhense Coast, Brazil

    Directory of Open Access Journals (Sweden)

    D.B.P.Sousa

    2013-04-01

    Full Text Available Neste estudo objetivou-se validar lesões branquiais como biomarcadores em peixes de importância econômica (Sciades herzbergii e Bagre bagre capturados pela pesca artesanal em dois locais diferenciados da Baía de São Marcos, MA, a fim de selecionar um táxon como bioindicador capaz de ser utilizado em programas de biomonitoramento. O primeiro ponto (S1 foi utilizado como uma área de referência - Ilha dos Caranguejos -, e o segundo ponto (S2 foi considerado potencialmente impactado - Complexo Portuário de São Luís, MA. Encontraram-se várias alterações histológicas para as duas espécies em S2, destacando-se: estreitamento lamelar, teleangectasia, fusão e descolamento do epitélio da lamela secundária. Lesões branquiais em B. bagre coletados em S1 também foram observadas, não sendo possível diferenciar os indivíduos das duas áreas analisadas. Os dados indicam que S. herzbergii é um bioindicador mais apropriado para análise de biomarcadores de contaminação aquática.This study aimed to validate branchial lesions as a biomarker in fish (Sciades herzbergii and Bagre bagre caught by traditional fishing in two different places at São Marcos Bay, MA, in order to select a bioindicator taxon which can be used in biomonitoring programs. The first point (S1 was used as a reference area - Caranguejos (Crab Island and the second point (S2 was considered potentially impacted - Port Complex of São Luis, MA. Several histological changes were found for both species in S2, including: narrowing lamellar, teleangectasy, fusion and separation of secondary lamellar epithelium. Gill lesions in B. bagre collected were also observed in S1, it is not possible to differentiate between individuals of the two areas analyzed. The data indicate that S. herzbergii is more appropriate as a bioindicator for analysis of biomarkers of aquatic contamination.

  7. Efecto antioxidante y antimicrobiano de sales de ácidos orgánicos y extractos naturales en filetes de bagre dorado (Brachyplatystoma rousseauxii refrigerados

    Directory of Open Access Journals (Sweden)

    José Vicente Pacheco Guerrero

    2011-06-01

    Full Text Available En el presente trabajo fueron investigados los efectos del lactato de sodio, acetato de sodio, romero y ajo en soluciones acuosas a 2,5 % sobre la calidad microbiológica y oxidación lipídica en rebanadas de bagre dorado (Brachyplatystoma rousseauxii almacenadas a 4 ºC. Los resultados mostraron que estas soluciones fueron eficaces (p acetato de sodio > lactato de sodio > ajo. La vida útil de los productos tratados fue, al menos, de 15 días. Por lo tanto, el acetato de sodio, lactato de sodio, romero y ajo pueden ser utilizados como preservativos seguros para el pescado almacenado bajo refrigeración.

  8. Efecto antioxidante y antimicrobiano de sales de ácidos orgánicos y extractos naturales en filetes de bagre dorado (Brachyplatystoma rousseauxii refrigerados

    Directory of Open Access Journals (Sweden)

    José Vicente Pacheco Guerrero

    2011-01-01

    Full Text Available En el presente trabajo fueron investigados los efectos del lactato de sodio, acetato de sodio, romero y ajo en soluciones acuosas a 2,5 % sobre la calidad microbiológica y oxidación lipídica en rebanadas de bagre dorado (Brachyplatystoma rousseauxii almacenadas a 4 ºC. Los resultados mostraron que estas soluciones fueron eficaces (p acetato de sodio > lactato de sodio > ajo. La vida útil de los productos tratados fue, al menos, de 15 días. Por lo tanto, el acetato de sodio, lactato de sodio, romero y ajo pueden ser utilizados como preservativos seguros para el pescado almacenado bajo refrigeración.

  9. INFECTION BY Rickettsia felis IN OPOSSUMS (Didelphis sp. FROM YUCATAN, MEXICO

    Directory of Open Access Journals (Sweden)

    Gaspar PENICHE-LARA

    2016-01-01

    Full Text Available Rickettsia felis is an emergent pathogen and the causative agent of a typhus-like rickettsiosis in the Americas. Its transmission cycle involves fleas as biological vectors (mainly Ctenocephalides felis and multiple domestic and synanthropic mammal hosts. Nonetheless, the role of mammals in the cycle of R. felis is not well understood and many efforts are ongoing in different countries of America to clarify it. The present study describes for the first time in Mexico the infection of two species of opossum (Didelphis virginiana and D. marsupialis by R. felis. A diagnosis was carried out from blood samples by molecular methods through the gltAand 17 kDa genes and sequence determination. Eighty-seven opossum samples were analyzed and 28 were found to be infected (32.1% from five out of the six studied localities of Yucatan. These findings enable recognition of the potential epidemiological implications for public health of the presence of infected synanthropic Didelphis in households.

  10. INFECTION BY Rickettsia felis IN OPOSSUMS (Didelphis sp.) FROM YUCATAN, MEXICO

    Science.gov (United States)

    PENICHE-LARA, Gaspar; RUIZ-PIÑA, Hugo A.; REYES-NOVELO, Enrique; DZUL-ROSADO, Karla; ZAVALA-CASTRO, Jorge

    2016-01-01

    Rickettsia felis is an emergent pathogen and the causative agent of a typhus-like rickettsiosis in the Americas. Its transmission cycle involves fleas as biological vectors (mainly Ctenocephalides felis) and multiple domestic and synanthropic mammal hosts. Nonetheless, the role of mammals in the cycle of R. felis is not well understood and many efforts are ongoing in different countries of America to clarify it. The present study describes for the first time in Mexico the infection of two species of opossum (Didelphis virginiana and D. marsupialis) by R. felis. A diagnosis was carried out from blood samples by molecular methods through the gltAand 17 kDa genes and sequence determination. Eighty-seven opossum samples were analyzed and 28 were found to be infected (32.1%) from five out of the six studied localities of Yucatan. These findings enable recognition of the potential epidemiological implications for public health of the presence of infected synanthropic Didelphis in households. PMID:27074326

  11. INFECTION BY Rickettsia felis IN OPOSSUMS (Didelphis sp.) FROM YUCATAN, MEXICO.

    Science.gov (United States)

    Peniche-Lara, Gaspar; Ruiz-Piña, Hugo A; Reyes-Novelo, Enrique; Dzul-Rosado, Karla; Zavala-Castro, Jorge

    2016-01-01

    Rickettsia felis is an emergent pathogen and the causative agent of a typhus-like rickettsiosis in the Americas. Its transmission cycle involves fleas as biological vectors (mainly Ctenocephalides felis) and multiple domestic and synanthropic mammal hosts. Nonetheless, the role of mammals in the cycle of R. felis is not well understood and many efforts are ongoing in different countries of America to clarify it. The present study describes for the first time in Mexico the infection of two species of opossum (Didelphis virginiana and D. marsupialis) by R. felis. A diagnosis was carried out from blood samples by molecular methods through the gltA and 17 kDa genes and sequence determination. Eighty-seven opossum samples were analyzed and 28 were found to be infected (32.1%) from five out of the six studied localities of Yucatan. These findings enable recognition of the potential epidemiological implications for public health of the presence of infected synanthropic Didelphis in households. PMID:27074326

  12. Anti-inflammatory and Anti-tumorigenic Effects of Açai Berry in Helicobacter felis-infected mice

    OpenAIRE

    Lee, Ju Yup; Kim, Nayoung; Choi, Yoon Jeong; Nam, Ryoung Hee; Lee, Seonmin; Ham, Min Hee; Suh, Ji Hyung; Choi, Yoon Jin; Lee, Hye Seung; Lee, Dong Ho

    2016-01-01

    Background: The aim of this study was to evaluate the anti-inflammatory and anti-tumorigenic effect of açai berry after chronic Helicobacter felis colonization in the stomachs of C57BL/6 mice. Methods: A total of 57 four-week-old female C57BL/6 mice (18 control mice and 39 experimental mice) were used. The mice were administered orogastrically with vehicle only or vehicle containing H. felis, 5 times every other day. After inoculation of H. felis, mice were fed either a standard or an açai-co...

  13. Conservation inequality and the charismatic cat: Felis felicis

    Directory of Open Access Journals (Sweden)

    E.A. Macdonald

    2015-01-01

    . While the felids are widely regarded as a popular taxonomic group, the great extent to which they appealed to our respondents emphasises their potential as ambassadors for conservation. Indeed, the big cats were so highly rated that we might think of them as one, Felis felicis: a globally powerful flagship for conservation.

  14. Presence of IgG antibodies against Chlamydophila felis in cats positive to FIV and/or FeLV

    Directory of Open Access Journals (Sweden)

    Dovč Alenka

    2008-01-01

    Full Text Available The aim of our study was to confirm the presence of Ig G antibodies against Chlamydophila felis (Cp. felis in cats infected with feline immunodeficiency virus (FIV and/or feline leukemia virus (FeLV and possible higher incidence of any clinical symptoms. A group of 30 cats which had been exposed to FIV and/or FeLV were tested for chlamydial antibodies presence. FIV and FeLV exposure were established by commercial ELISA rapid tests. The results of serological testing to antibodies against Cp. felis in cats with immunofluorescence assay (IFA are shown. In 16.7% (5/30 of tested cats Ig G antibodies against Cp. felis were found. No correlation with FIV and/or FeLV infection neither with clinical symptoms of upper respiratory tract could be confirmed.

  15. Atrophic gastric changes in both Helicobacter felis and Helicobacter pylori infected mice are host dependent and separate from antral gastritis.

    OpenAIRE

    Sakagami, T; Dixon, M; O'Rourke, J; Howlett, R.; Alderuccio, F; Vella, J; Shimoyama, T; Lee, A.

    1996-01-01

    BACKGROUND/AIMS: The role of host factors has been neglected in studies of the pathogenesis of Helicobacter associated disease. The aim of this study was to assess the response of different mouse strains to infection with a single strain of Helicobacter felis. METHOD: Six strains of inbred mice were infected with the identical H felis culture and were killed at one month, two months, and six months after infection to assess histopathological changes. In addition, two strains of mice were infe...

  16. Desenvolvimento dos fungos Metarhizium anisopliae (Metschnikoff, 1879 Sorokin, 1883 E Beauveria bassiana (Balsamo Vuillemin, 1912 sobre Ctenocephalides felis felis (Bouché, 1835 Development of the fungi Metarhizium anisopliae (Metschnikoff, 1879 Sorokin, 1883 and Beauveria bassiana (Balsamo Vuillemin, 1912 on the Ctenophephalides felis felis (Bouché, 1835

    Directory of Open Access Journals (Sweden)

    Denise R. De Melo

    2007-09-01

    Full Text Available A pulga Ctenocephalides felis felis é um parasita causador dermatites alérgicas e também pode transmitir diversos agentes etiológicos aos animais domésticos e aos homens. O objetivo deste trabalho foi verificar o desenvolvimento do fungo sobre a cutícula da pulga, através da microscopia eletrônica de varredura. Os isolados fúngicos testados foram o Metarhizium anisopliae 959 e Beauveria bassiana 986, ambos na concentração 10(8 conídios/ml. Após a exposição dos isolados fúngicos no período de duas, 15, 26 e 96 horas , o material foi processado para a microscopia eletrônica de varredura. Com a obtenção das micrografias, pode-se observar que com 2 horas após exposição aos fungos, os conídios estavam aderidos por toda a cutícula, situando-se preferencialmente nas membranas intersegmentais do abdome. Com 15 horas observou-se a formação do tubo de germinação e a cabeça do apressório e após 26 horas foi possível observar as ramificações e o engrossamento das hifas sobre a cutícula das pulgas. Os resultados indicam que os fungos testados foram capazes de se desenvolver sobre a cutícula de C. f. felis.The flea Ctenocephalides felis felis is a parasite that causes allergic dermatitis and also may transmit etiologic agents to domestic animals and humans. This study investigated by scanning electron microscopy the development of entomopathogenic fungi on flea cuticle. Fleas were exposed to conidia (10(8 ml-1 of Metarhizium anisopliae (isolate 959 or Beauveria bassiana (isolate 986. Following standard protocols for electron microscopy, the specimens were prepared 2, 15, 26 and 96 h after infection. The micrography revealed that 2 h after fungus exposure, conidia attachments encompassed the entire flea cuticle, especially on abdominal intersegmental membranes. The emergence of germ tubes and appressoria formation occurred at 15 h, thickening and branching of hyphae on the flea cuticle was noted at 26 h. Therefore, both of

  17. The genetic integrity of the ex situ population of the European wildcat (Felis silvestris silvestris) is seriously threatened by introgression from domestic cats (Felis silvestris catus).

    Science.gov (United States)

    Witzenberger, Kathrin A; Hochkirch, Axel

    2014-01-01

    Studies on the genetic diversity and relatedness of zoo populations are crucial for implementing successful breeding programmes. The European wildcat, Felis s. silvestris, is subject to intensive conservation measures, including captive breeding and reintroduction. We here present the first systematic genetic analysis of the captive population of Felis s. silvestris in comparison with a natural wild population. We used microsatellites and mtDNA sequencing to assess genetic diversity, structure and integrity of the ex situ population. Our results show that the ex situ population of the European wildcat is highly structured and that it has a higher genetic diversity than the studied wild population. Some genetic clusters matched the breeding lines of certain zoos or groups of zoos that often exchanged individuals. Two mitochondrial haplotype groups were detected in the in situ populations, one of which was closely related to the most common haplotype found in domestic cats, suggesting past introgression in the wild. Although native haplotypes were also found in the captive population, the majority (68%) of captive individuals shared a common mtDNA haplotype with the domestic cat (Felis s. catus). Only six captive individuals (7.7%) were assigned as wildcats in the STRUCTURE analysis (at K = 2), two of which had domestic cat mtDNA haplotypes and only two captive individuals were assigned as purebred wildcats by NewHybrids. These results suggest that the high genetic diversity of the captive population has been caused by admixture with domestic cats. Therefore, the captive population cannot be recommended for further breeding and reintroduction. PMID:25162450

  18. Concurrent Infestation of Buffalo Calves with Ctenocephalides felis strongylus and Piroplasms

    Directory of Open Access Journals (Sweden)

    Asif Iqbal, Muhammad Sohail Sajid*, Muhammad Kasib Khan and Zeeshan Furhaad

    2012-01-01

    Full Text Available The present report describes four cases of Ctenocephalides felis strongylus infestation in buffalo calves of district Toba Tek Singh, Punjab, Pakistan. The infested animals were suffering from pyrexia, alopecia, hyperkeratinization, accelerated pulse, tachypnea, depression, anemic mucous membranes and ataxia (n=3. Flea infestation was generalized with higher infestation in hairy areas of body especially legs, flank and mane. Microscopic examination of the peripheral blood revealed moderate (n=2 to high (n=2 numbers of piroplasms. All four calves were treated with ivermectin (Ivomec, Merial, France; 0.02mg/kg twice at 15 days intervals. The treated calves were found aparasitemic on day 10th post treatment. The three cases recovered in 10 days after completion of the second round of treatment. One calf died 8 days after second treatment on day 11. However, the vector role of Ctenocephalides felis strongylus may be better studied on conventional/ molecular grounds using salivary glands of the specimens.

  19. Detection of Helicobacter felis in a cat with gastric disease in laboratory animal facility

    Science.gov (United States)

    Hong, Sunhwa; Chung, Yungho; Kang, Won-Guk

    2016-01-01

    A 3-month-old male cat in the animal facility was presented for investigation of anorexia and occasional vomiting. We collected the specimens from gastroscopic biopsy and stool collection. The gastroscopic biopsy specimens were tested using a rapid urease test, CLO Helicobacter-detection kits. Stool specimens were gathered and evaluated using the commercially available SD Bioline H. pylori Ag kit according to the manufacturer's instructions. Genomic DNAs from gastroscopic biopsy and stool specimens of the cat were extracted and submitted to the consensus PCR to amplify Helicobacter rpoB gene. Then the DNAs from gastroscopic biopsy and stool specimens were conducted a multiplex species-specific PCR to amplify urease B gene for H. heilmannii, H. pylori and H. felis. As the results, the rapid urease test with gastroscopic biopsy was revealed positive reaction. The result of H. pylori Stool Ag assay was one red line, negative for H. pylori. The gastroscopic biopsy and stool specimen were positive reactions by the consensus PCR reaction using the RNA polymerase beta-subunit-coding gene (rpoB) to detect Helicobacter species. By multiplex species-specific PCR with gastroscopic biopsy and stool specimens, no amplification products corresponding to either H. heilmannii or H. pylori were detected, but the specimens tested were positive for H. felis. This case was confirmed as gastroenteric disease induced by H. felis infection. On our knowledge, this is a very rare report about H. felis-induced gastroenteric disease in cat and may provide a valuable data on the study of feline Helicobacter infection. PMID:27382381

  20. Clusters in social behaviour of female domestic cats (Felis silvestris catus) living in confinement

    OpenAIRE

    vandenBos, R; de Vries, Han

    1996-01-01

    Associations between different agonistic and affiliative behavioural patterns of female domestic cats (Felis silvestris catus) were studied. In three groups of intact cats living in confinement frequencies of fourteen agonistic and affiliative behavioural patterns were recorded. The technique of factor analysis (Principal Components Analysis followed by varimax rotation on a dyads X behavioural patterns matrix) was used to detect clusters in these behavioural patterns. Five factors (or types ...

  1. Isolation of Rickettsia felis in the Mosquito Cell Line C6/36

    OpenAIRE

    Horta, Maurício C.; Labruna, Marcelo B.; Edison L. Durigon; Teresinha T.S. Schumaker

    2006-01-01

    We report the isolation and establishment of Rickettsia felis in the C6/36 cell line. Rickettsial growth was intense, always with 90 to 100% of cells being infected after few weeks. The rickettsial isolate was confirmed by testing infected cells by PCR and sequencing fragments of three major Rickettsia genes (gltA, ompB, and the 17-kDa protein gene).

  2. Ecological features, populations traits and conservation status of Helianthemum caput-felis along its distribution range

    OpenAIRE

    Sulis, Elena

    2016-01-01

    Understanding factors limiting populations’ growth and persistence is crucial to evaluate the current conservation status and possible future management of plant populations. This Ph.D. thesis focussed on ecological constraints related to population trends and the conservation status of Helianthemum caput-felis Boiss., characterized by a highly fragmented areal isolated from the distribution centre. In particular, the specifics aims of the thesis were: (1) to analyse the distribution range, p...

  3. Frequency of Piroplasms Babesia microti and Cytauxzoon felis in Stray Cats from Northern Italy

    OpenAIRE

    2014-01-01

    Emerging diseases caused by piroplasms pose a health risk for man and other animals, and domestic cats have been proposed as potential reservoirs for some piroplasm infections. The aim of this study was to identify the frequency of the piroplasms Babesia microti and Cytauxzoon felis in stray cats from northern Italy and to identify possible risk factors associated with these infections. Blood samples from 260 stray cats enrolled in a trap-neuter-release (TNR) program in northern Italy were ex...

  4. Integrating anthropic factors into wildcat Felis silvestris conservation in Southern Iberia landscapes

    OpenAIRE

    Ferreira, Joaquim Pedro Santos Mercês, 1969-

    2010-01-01

    Tese de doutoramento, Biologia (Biologia da Conservação), Universidade de Lisboa, Faculdade de Ciências, 2010 The European wildcat Felis silvestris is a threatened species in Europe, where suitable management of forests has been considered crucial for its conservation. However, this recommendation may not be general due to the lack of studies that test this hypothesis in the Mediterranean area, where landscapes are very different from those of centralnorth Europe. Nowadays, the...

  5. Detection of Rickettsia felis, Rickettsia typhi, Bartonella Species and Yersinia pestis in Fleas (Siphonaptera from Africa.

    Directory of Open Access Journals (Sweden)

    Hamza Leulmi

    2014-10-01

    Full Text Available Little is known about the presence/absence and prevalence of Rickettsia spp, Bartonella spp. and Yersinia pestis in domestic and urban flea populations in tropical and subtropical African countries.Fleas collected in Benin, the United Republic of Tanzania and the Democratic Republic of the Congo were investigated for the presence and identity of Rickettsia spp., Bartonella spp. and Yersinia pestis using two qPCR systems or qPCR and standard PCR. In Xenopsylla cheopis fleas collected from Cotonou (Benin, Rickettsia typhi was detected in 1% (2/199, and an uncultured Bartonella sp. was detected in 34.7% (69/199. In the Lushoto district (United Republic of Tanzania, R. typhi DNA was detected in 10% (2/20 of Xenopsylla brasiliensis, and Rickettsia felis was detected in 65% (13/20 of Ctenocephalides felis strongylus, 71.4% (5/7 of Ctenocephalides canis and 25% (5/20 of Ctenophthalmus calceatus calceatus. In the Democratic Republic of the Congo, R. felis was detected in 56.5% (13/23 of Ct. f. felis from Kinshasa, in 26.3% (10/38 of Ct. f. felis and 9% (1/11 of Leptopsylla aethiopica aethiopica from Ituri district and in 19.2% (5/26 of Ct. f. strongylus and 4.7% (1/21 of Echidnophaga gallinacea. Bartonella sp. was also detected in 36.3% (4/11 of L. a. aethiopica. Finally, in Ituri, Y. pestis DNA was detected in 3.8% (1/26 of Ct. f. strongylus and 10% (3/30 of Pulex irritans from the villages of Wanyale and Zaa.Most flea-borne infections are neglected diseases which should be monitored systematically in domestic rural and urban human populations to assess their epidemiological and clinical relevance. Finally, the presence of Y. pestis DNA in fleas captured in households was unexpected and raises a series of questions regarding the role of free fleas in the transmission of plague in rural Africa, especially in remote areas where the flea density in houses is high.

  6. Bases científicas para contribuir a la gestión de la pesquería comercial de bagres (familia pimelodidae) en la Amazonia colombiana y sus zonas de frontera

    OpenAIRE

    Agudelo Córdoba, Edwin

    2015-01-01

    Los peces son uno de los principales recursos alimenticios, culturales y económicos en la Amazonia, importantes para la seguridad alimentaria de los núcleos familiares ribereños como en la generación de ingreso a quienes dependen económicamente de la extracción de este recurso natural. Esta tesis doctoral, se ha enfocado en analizar variables biológicas y pesqueras en varios bagres de la familia Pimelodidae, así como el componente humano y económico de esta actividad en la frontera en Colomb...

  7. Biología reproductiva del bagre cominate Occidentarius platypogon (Pisces: Ariidae) en el sureste del golfo de California Reproductive biology of the cominate sea catfish Occidentarius platypogon (Pisces: Ariidae) from the southeastern Gulf of California

    OpenAIRE

    Felipe Amezcua; Víctor Muro-Torres

    2012-01-01

    En el sureste del golfo de California, el bagre cominate presenta gran abundancia y es explotado comercialmente. Sin embargo, estudios sobre su biología son escasos y no existen normas que regulen su explotación en México. En este trabajo se describe la biología reproductiva de Occidentarius platypogon. Se capturaron 480 organismos con redes agalleras entre octubre 2008 y diciembre 2009. El estado de madurez gonadal se determinó macroscópicamente. Esta especie tiene una época de desove de may...

  8. Environmental changes and microbiological health risks. Satellite-derived turbidity: an indicator of "health hazard" for surface water in West Africa (Bagre lake, Burkina Faso).

    Science.gov (United States)

    Robert, E.; Grippa, M.; Kergoat, L.; Martinez, J.; Pinet, S.; Gal, L.; Soumaguel, N.

    2015-12-01

    A significant correlation exists between the concentration of parasites, bacteria and some water quality parameters including surface suspended solids (SSS) and turbidity. Suspended particles can carry viruses and pathogenic bacteria affecting human health and foster their development. High SSS, associated with high turbidity, can therefore be considered as a vector of microbiological contaminants, causing diarrheal diseases. Few studies have focused on the turbidity parameter in rural Africa, while many cases of intestinal parasitic infections are due to the consumption of unsafe water from ponds, lakes, and rivers. Monitoring turbidity may therefore contribute to health hazard monitoring. Turbidity refers to the optical properties of water and is known to impact water reflectance in the visible and near-infrared domain. Ideally, its spatial and temporal variability requires the use of high temporal resolution (MODIS) and spatial resolution (Landsat, SPOT, Sentinel-2). Here we investigate turbidity in West-Africa. Various algorithms and indices proposed in the literature for inland waters are applied to MODIS series and to Landsat 7 and 8 CDR images, and SPOT5 images. The data and algorithms are evaluated with field measurements: turbidity, SSS, and hyperspectral ground radiometry. We show that turbidity of the Bagre Lake displays a strong increase over 2000-2015, associated with the corresponding increase of the red and NIR reflectances, as well as a reduction of the seasonal variations. Water level derived from the Jason 2 altimeter does not explain such variations. The most probable hypothesis is a change in land use (increase in bare and degraded soils), that leads to an increase in the particles transported by surface runoff to the lake. Such an increase in turbidity reinforces the health risk. We will discuss the link between turbidity and health in view of data from health centers on diarrheal diseases as well as data on practices and uses of populations.

  9. A new variant of endemic pemphigus foliaceus in El-Bagre, Colombia: the Hardy-Weinberg-Castle law and linked short tandem repeats

    Directory of Open Access Journals (Sweden)

    Ana María Abreu Velez

    2009-01-01

    Full Text Available Background : We reported a new variant of endemic pemphigus foliaceus in El Bagre, Colombia. Aims : Our study performed Complex Segregation Analysis (CSA and short tandem repeats to discriminate between environmental and/or genetic factors in this disorder. Materials and Methods: The CSA analysis was carried out according to the unified model, implemented using the transmission probabilities implemented in the computer program POINTER, and evaluated by using a software package for population genetic data analysis (GDA, Arlequin. We performed pedigree analyses by using Cyrillic 2.1 software, with a total of 30 families with 50 probands (47 males and 3 females tested. In parallel to the CSA, we tested for the presence of short tandem repeats from HLA class II, DQ alpha 1, involving the gene locus D6S291 by using the Hardy-Weinberg- Castle law. Results : Our results indicate that the best model of inheritance in this disease is a mixed model, with multifactorial effects within a recessive genotype. Two types of possible segregation patterns were found; one with strong recessive penetrance in families whose phenotype is more Amerindian-like, and another of possible somatic mutations. Conclusion : The penetrance of 10% or less in female patients 60 years of age or older indicates that hormones could protect younger females. The greatest risk factor for men being affected by the disorder was the NN genotype. These findings are only possible due to somatic mutations, and/or strong environmental effects. We also found a protective role for two genetic loci (D6S1019 AND D6S439 in the control group.

  10. Presence of IgG antibodies against Chlamydophila felis in cats positive to FIV and/or FeLV

    OpenAIRE

    Dovč Alenka; Vlahović Ksenija; Suhadolc-Scholten Sara; Tozon Nataša

    2008-01-01

    The aim of our study was to confirm the presence of Ig G antibodies against Chlamydophila felis (Cp. felis) in cats infected with feline immunodeficiency virus (FIV) and/or feline leukemia virus (FeLV) and possible higher incidence of any clinical symptoms. A group of 30 cats which had been exposed to FIV and/or FeLV were tested for chlamydial antibodies presence. FIV and FeLV exposure were established by commercial ELISA rapid tests. The results of serological testing to antibodies against C...

  11. Blood Meal Identification in Off-Host Cat Fleas (Ctenocephalides felis) from a Plague-Endemic Region of Uganda

    OpenAIRE

    Graham, Christine B.; Borchert, Jeff N.; Black, William C.; ATIKU, LINDA A.; Mpanga, Joseph T; Boegler, Karen A.; Moore, Sean M.; Gage, Kenneth L.; Eisen, Rebecca J.

    2013-01-01

    The cat flea, Ctenocephalides felis, is an inefficient vector of the plague bacterium (Yersinia pestis) and is the predominant off-host flea species in human habitations in the West Nile region, an established plague focus in northwest Uganda. To determine if C. felis might serve as a Y. pestis bridging vector in the West Nile region, we collected on- and off-host fleas from human habitations and used a real-time polymerase chain reaction-based assay to estimate the proportion of off-host C. ...

  12. Design of FELiChEM, the first infrared free-electron laser user facility in China

    CERN Document Server

    Li, He-Ting; Zhang, Shan-Cai; Wang, Lin; Yang, Yong-Liang

    2016-01-01

    FELiChEM is a new experimental facility under construction at University of Science and Technology of China (USTC), whose core device is two free electron laser oscillators generating middle-infrared and far-infrared laser and covering the spectral range of 2.5-200 ?m. It will be a dedicated infrared light source aiming at energy chemistry research. We present the brief design of FEL oscillators with the emphasis put on the middle-infrared oscillator. Most of the basic parameters are determined and the anticipated performance of the output radiation is given. The first light of FELiChEM is targeted for the end of 2017.

  13. High variation in multiple paternity of domestic cats (Felis catus L.) in relation to environmental conditions.

    OpenAIRE

    Say, L.; Pontier, D; Natoli, E

    1999-01-01

    Paternity was analysed in two domestic cat (Felis catus) populations differing in habitat structure (rural versus urban) and density (234 cats km-2 versus 2,091 cats km-2). A total of 312 offspring, 76 mothers and 65 putative fathers were typed at nine microsatellite loci in the two populations. Our data showed a high rate of multiple paternity in the urban population (70-83% of litters with more than one father), whereas it was much lower in the rural population (0-22% of litters with more t...

  14. PCR amplification of a multi-copy mitochondrial gene (cox3) improves detection of Cytauxzoon felis infection as compared to a ribosomal gene (18S).

    Science.gov (United States)

    Schreeg, Megan E; Marr, Henry S; Griffith, Emily H; Tarigo, Jaime L; Bird, David M; Reichard, Mason V; Cohn, Leah A; Levy, Michael G; Birkenheuer, Adam J

    2016-07-30

    Cytauxzoon felis is a tick-transmitted protozoan parasite that infects felids. Clinical disease caused by acute C. felis infection rapidly progresses in domestic cats, leading to high morbidity and mortality. Accurately diagnosing cytauxzoonosis as soon as possible during acute infection would allow for earlier initiation of antiprotozoal therapy which could lead to higher survival rates. Molecular detection of parasite rRNA genes (18S) by PCR has previously been shown to be a sensitive method of diagnosing C. felis infections. Based on evidence from related apicomplexan species, we hypothesized that C. felis mitochondrial genes would exist at higher copy numbers than 18S and would be a more sensitive diagnostic target. In this study we have designed a PCR assay targeting the C. felis mitochondrial gene cytochrome c oxidase subunit III (cox3). Herein we demonstrate that (1) the cox3 PCR can detect as low as 1 copy of DNA target and can detect C. felis in samples with known mitochondrial sequence heterogeneity, (2) cox3 copy number is increased relative to 18S in blood and tissue samples from acutely infected cats, and (3) the cox3 PCR is more sensitive than 18S PCR for detection of C. felis during early infections. PMID:27369587

  15. OCCURRENCE OF LUNGWORMS IN EUROPEAN WILDCATS (FELIS SILVESTRIS SILVESTRIS) OF CENTRAL ITALY.

    Science.gov (United States)

    Veronesi, Fabrizia; Traversa, Donato; Lepri, Elvio; Morganti, Giulia; Vercillo, Francesca; Grelli, Dorian; Cassini, Rudi; Marangi, Marianna; Iorio, Raffaella; Ragni, Bernardino; Di Cesare, Angela

    2016-04-28

    The increasing focus on infections in domestic cats ( Felis catus ) has raised questions about lungworm distribution in wild hosts. To enhance knowledge of the occurrence of lungworms in enzootic regions of central Italy, we examined the carcasses of 16 European wildcats ( Felis silvestris silvestris). Adult nematodes, feces, respiratory flushings, and pulmonary tissues were collected at necropsy and then microscopically and genetically analyzed. Fourteen wildcats had single or mixed lungworm species. Aelurostrongylus abstrusus was the most common parasite retrieved, followed by Troglostrongylus brevior. In addition, three specimens of Angiostrongylus chabaudi were found in the pulmonary arteries of one wildcat. Histologically, the most common lesions were a mild-to-severe chronic catarrhal bronchitis and a chronic interstitial pneumonia with smooth muscle hypertrophy, associated with T. brevior and A. abstrusus , respectively. These results demonstrate that the European wildcats may harbor several species of lungworms that may impair their health and welfare. Also, F. s. silvestris is a potential reservoir for respiratory nematodes in domestic cats. PMID:26967134

  16. Seroprevalence of Toxoplasma gondii and Neospora caninum in feral cats (Felis silvestris catus) in Majorca, Balearic Islands, Spain

    Science.gov (United States)

    Felids are important in the epidemiology of Toxoplasma gondii infection because they are the only hosts that can excrete environmentally-resistant oocysts. Antibodies to T. gondii and Neospora caninum were determined in serum samples from 59 feral cats (Felis silvestris catus) captured in baited tra...

  17. Variação espacial e temporal de bagres marinhos (Siluriformes, Ariidae na Baía de Sepetiba, Rio de Janeiro Spacial and temporal variation of marines catfishes on Sepetiba Bay, RJ

    Directory of Open Access Journals (Sweden)

    M. C. C. AZEVEDO

    1999-08-01

    Full Text Available Bagres marinhos (Ariidae são os mais abundantes recursos pesqueiros em arrastos de fundo na Baía de Sepetiba, RJ (Lat. 22º54’-23º04’S; Long. 43º34’-44º10’W, que é uma importante área de criação e alimentação de uma grande variedade de espécies de peixes na fase juvenil. Padrões espaciais e sazonais de distribuição dos bagres marinhos, baseados no número e no peso de peixes por arrasto, foram analisados com base em 151 amostragens de arrasto de fundo, em sete locais da Baía de Sepetiba, entre julho de 1993 e junho de 1996. Para comparações espaciais da área de estudo, estabeleceu-se como zona interna a região situada no interior da Baía e como zona externa a área com maior influência das águas oceânicas. Juntamente com os arrastos de fundo, foram feitas medições da temperatura e salinidade da água de superfície e de fundo, da transparência e da profundidade. Um padrão de variação espacial baseado nos fatores ambientais, através da análise multivariada, é apresentado com maiores profundidades e transparências na zona externa e menores na zona interna, com pequeno gradiente de aumento de salinidade da zona interna para a zona externa. Somente a temperatura apresentou sazonalidade. Cinco espécies de bagres marinhos foram registradas, na seguinte ordem decrescente de abundância numérica: Genidens genidens (Valenciennes, 1839, Cathorops spixii (Agassiz, 1829, Sciadeichthys luniscutis (Valenciennes, 1840, Netuma barba (Lacépède, 1803 e Bagre marinus (Mitchill,1814. Um padrão de variação espacial na distribuição dos bagres marinhos na Baía de Sepetiba foi apresentado, com as quatro mais abundantes espécies distribuindo-se principalmente na zona interna da Baía, com indicações de separação espacial entre as mesmas. G. genidens foi abundante em todas as estações de coleta da zona interna da Baía, C. spixii apresentou distribuição mais restrita na zona interna e N. barba, nas proximidades da

  18. Mercury in fishes of the Chassahowitzka National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From August 24 to 28, 1990, spotted seatrout (Cynoscion nebulosus), hardhead catfish (Arius felis) and gafftopsail catfish (Bagre marinus) were collected from...

  19. A hybrid type undulator for far-infrared FELs at FELI

    Energy Technology Data Exchange (ETDEWEB)

    Zako, A.; Miyauchi, Y.; Koga, A. [Free Electron Laser Research Institute, Inc., Osaka (Japan)] [and others

    1995-12-31

    Two FEL facilities of the FELI are now operating in the wavelength range of 1-20 {mu}m. A 3.2-m hybrid type undulator ({lambda}{sub u}=80mm, N=40) has been designed for far-infrared FELs and will be installed in December. It can cover the wavelength of 20-60 {mu}m by changing K-value from 1 to 2.7 for a 28.0-MeV electron beam. It is composed of ferrite magnetic poles and Sm-Co permanent magnets. Commonly wound coils induce alternating magnetic field in ferrite poles. Combination of the induced field and the permanent magnet field can controls the magnetic field between the undulator gap.

  20. Heartworm (Dirofilaria immitis) disease and glomerulonephritis in a black-footed cat (Felis nigripes).

    Science.gov (United States)

    Deem, S L; Heard, D J; LaRock, R

    1998-06-01

    A 6-yr-old, 1.36-kg, intact female black-footed cat (Felis nigripes) was presented to the Veterinary Medical Teaching Hospital, University of Florida, with a history of depression, lethargy, and anorexia. Cardiac dysfunction and renal failure were diagnosed on the basis of antemortem and postmortem findings. At necropsy, heartworms (Dirofilaria immitis), glomerulonephritis, and endometritis were present. The glomerulonephritis could have been immune mediated and may have been associated with the heartworm infection or the chronic endometritis or both. Heartworm disease should be included in the list of differential diagnoses for any exotic cat housed outdoors in an endemic heartworm region that dies peracutely or has suggestive gastrointestinal or respiratory signs. Heartworm prophylaxis and annual serologic testing in exotic cats housed outdoors in heartworm endemic regions are recommended. PMID:9732037

  1. PCR confirmation of Chlamydophila felis from nasal and conjunctival swab samples of a domestic cat in Croatia

    Directory of Open Access Journals (Sweden)

    Gregurić-Gračner Gordana

    2010-01-01

    Full Text Available Until now there is no evidence that chlamydiosis does exist among cats in the Republic of Croatia regardless of the fact that feline chlamydiosis is a worldwide disease. This report describes the clinical examination of a one year old cat with bilateral conjunctivitis, as well as the diagnostic methods used to confirm infection with Chlamydophila (Cp. felis. We have used rapid enzyme immunoassay test (EIA for antigen detection, in order to examine the swabs taken from the eyes and nostrils. The positive result was confirmed by direct immunofluorescence (DIF made on scrapings from cat's conjunctivas. Conventional polymerase chain reaction (PCR made on swabs taken from cat's conjunctivas and nostrils and sequencing the PCR product was used to confirmed infection of cat precisely with Chlamydophila felis. No increase of IgG antibodies against chlamydias was noted using indirect immunofluorescence (IFA method.

  2. Differential passage rates of prey components through the gut of serval Felis serval and black-backed jackal Canis mesomelas

    Directory of Open Access Journals (Sweden)

    J.M. Bowland

    1991-09-01

    Full Text Available Feeding trials conducted on Felis serval and Canis mesomelas showed that the same prey item may appear in up to seven scats (mean=2.8, n=7. The basic assumption that prey remains of the same species in different scats represent different individuals is invalid. Therefore over-estimation of some prey species relative to others in the diet of carnivores studied can occur.

  3. Puzzling out the reproductive biology of the endangered cat’s head rockrose (Helianthemum caput-felis, Cistaceae)

    OpenAIRE

    Agulló Brotons, Jonás César; Pérez Bañón, Celeste; Crespo Villalba, Manuel Benito; Juan Gallardo, Ana Isabel

    2015-01-01

    Helianthemum caput-felis is an endangered plant species growing in fragmented habitats in the western Mediterranean basin. Reproductive traits, breeding system and pollinator assemblage were studied in its largest known (mainland) European population to improve knowledge on the reproductive biology of the species. Hand-pollination experiments were carried out to determine the breeding system. Generalized linear mixed models (GLMM) were fitted to the data to evaluate the effect of treatment on...

  4. Estudo de carcaça do bagre africano (Clarias gariepinus em diferentes categorias de peso Study of African Catfish (Clarias gariepinus carcass in different weight categories

    Directory of Open Access Journals (Sweden)

    Adriana Aparecida Pinto

    1999-11-01

    Full Text Available O objetivo deste experimento foi estudar carcaças de Clarias gariepinus, em três categorias de peso (P1=inferior a 1kg; P2=de 1 a 2kg e P3=superior a 2kg, para analisar o rendimento de carcaça com cabeça (RCC, sem cabeça (RCS, filé (RFI, músculos abdominais (RMA, partes comestíveis (RPC, tronco limpo (RTL, porcentagem de pele (PPE, cabeça (PCA, vísceras (PVI, resíduos totais (PRE e determinar a composição proximal do filé (proteína bruta, umidade, gordura e cinza. Foram utilizados 60 bagres, em delineamento inteiramente casualizado, 3 tratamentos com 20 repetições, em nível de significância de 5%. O rendimento de filé foi maior para P2 (38,61% que para P1 e P3. O rendimento das partes comestíveis e tronco limpo foram superiores para P2 (RPC=46,27% e RTL=56,67%, mas sem diferirem do P3. O rendimento de carcaça sem cabeça foi maior para P3, não diferindo de P2. O P2 foi inferior para PPE (4,64%, PCA (23,62% e PRE (53,73%, sem diferir de P3, para porcentagem de cabeça e de resíduos totais. Não houve diferença significativa para rendimentos dos músculos abdominais, carcaça com cabeça e vísceras. P2 (2,25% e 77,49% não diferiu do P1 (1,51% e 77,78% e P3 (3,03% e 76,39%, para gordura e umidade, respectivamente, enquanto, para proteína bruta, não houve diferença significativa. Conclui-se que P2 apresentou melhores rendimentos de filetagem, ao passo que a composição proximal do filé, nas três categorias de peso, foi relativamente similar, com aumento de deposição de gordura nos peixes acima de 1kg de peso vivo.The aim of this experiment was to study Clarias gariepinus carcass in three weight categories (P1=below 1kg; P2= 1 to 2kg and P3=over 2kg to analyze yield of carcass with head (YCH, without head (YCW, fillet (YF, abdominal muscles (YAM, eatable parts (YEP, dressed out (YDO and percentages of skin (PSK, head (PHE, viscera (PVI, total residues (PTR; and to determine the proximate composition of fillet (crude

  5. Performance of an undulator for visible and UV FELs at FELI

    Energy Technology Data Exchange (ETDEWEB)

    Miyauchi, Y.; Zako, A.; Koga, A. [Free Electron Laser Research Institute, Inc., Osaka (Japan)] [and others

    1995-12-31

    Two infrared free electron lasers (FELs) of the FELI project are now operating in the wavelength range of 1-20{mu}m. A 2.68-m undulator has been constructed for visible and UV FELs covering the wavelength of 1-0.2{mu}m for 100-165 MeV electron beams. It generates alternating, horizontal magnetic field, and wiggles electron beam on a vertical plane. The undulator length and period are 2.68m and 40mm, respectively. The gap of undulator magnets can be changed remotely by using servomotors with an accuracy of 1 {mu}m from the control room. The maximum K-value and related magnetic field strength are 1.9 and 0.5T, respectively, when its gap is set to the minimum value of 16mm. In order to minimize magnetic field reduction due to radiation damage, Sm-Co permanent magnet was adopted. Its structure and the results of magnetic field measurement will be reported.

  6. Birds be safe: Can a novel cat collar reduce avian mortality by domestic cats (Felis catus?

    Directory of Open Access Journals (Sweden)

    S.K. Willson

    2015-01-01

    Full Text Available The domestic cat (Felis catus has been described as the largest anthropogenic threat to songbird populations in North America. We examined the effectiveness of a novel cat collar in reducing avian and small mammal mortality by cats. The 2-inch wide Birdsbesafe® collar cover (CC is worn over a nylon quick-release collar, and the bright colors and patterns of the CC are hypothesized to warn birds of approaching cats. We conducted two seasonal trials, each lasting 12 weeks, in autumn 2013 (n=54 cats and spring 2014 (n=19 cats. Cats were randomly assigned to two groups, and CCs with interior collars were removed or put on every two weeks, to control for weather fluctuations and seasonal change. Cats wearing Birdsbesafe® CCs killed 19 times fewer birds than uncollared cats in the spring trial, and 3.4 times fewer birds in the fall. Birdsbesafe® CCs were extremely effective at reducing predation on birds. Small mammal data were less clear, but did decrease predation by half in the fall. The Birdsbesafe® CC is a highly effective device for decreasing bird predation, especially in the spring season. We suggest that the CCs be used as a conservation tool for owned as well as feral cats.

  7. Feeding habits of feral cats Felis silvestris catus in the countryside of Majorca Island, Spain

    Directory of Open Access Journals (Sweden)

    J. Milan

    2010-06-01

    Full Text Available The diet of feral cats ( Felis silvestris catus in the Mediterranean island of Majorca (Spain was studied from July 2008 to June 2009 by the analysis of the scats of 75 feral cats captured in baited traps in 14 different areas. A total of 138 preys were identified in the analyzed scats. Mammals were the main group preyed on and constituted 93% both in frequency and biomass. Among them, mice were the most frequent prey consumed (55% Mus sp., 18% Apodemus sylvaticus but represented only 20% of biomass. Rat was present in 29% of scats and was the main component in terms of biomass (57%. Rabbit was found at a frequency of 6.6%, and constituted 18% of biomass. Other prey (birds, geckos and insects were found in lower frequency, and all pooled constituted only 7% of biomass. Reproductive females preyed less upon mice (20% than the other cats (77%. This may indicate that these females tended to predate upon higher preys, which may be secondary to increased energetic requirements due to pregnancy or lactation. No seasonal variations were found in any of the different parameters studied. Results indicate that rodents constitute all year round the main prey item in feral cat diet in the countryside of Majorca.

  8. Gastrointestinal Helminthic Parasites in Stray Cats (Felis catus from North of Iran

    Directory of Open Access Journals (Sweden)

    A Rezaei-Doust

    2007-08-01

    Full Text Available Background: Cats play a crucial role in the epidemiology of gastrointestinal helminthic parasites and also play a major role in transmitting of these parasites through faecal contamination of soil, food or water. The aim of this study was to determine the species of gastrointestinal helminthes parasites in stray cats from a rural area of Bandar-e-Anzali, Iran.Method: Gastrointestinal helminthes were collected from 50 necropsied stray cats (Felis catus after capturing them by trapping from different regions of the city and humanely euthanatized in Bandar-e-Anzali, a port in the Caspian Sea in northern Iran, from March to November 2003. Results: The prevalence of infection was 90%, with those of individual parasites being Diplopylidium nolleri 54%, Phy­saloptera praeputialis 32%, Ancylostoma tubaeforme 20%, Joyeuxiella pasqualei 10%, Toxocara cati 8%, Pterygoderma­tites affinis 6%, Ancylostoma caninum 4%, and Taenia taeniaeformis 2%. Concurrent infections with two or more parasites were recorded in 34% of the individuals. In relation to the sex, the differences were not significant. Conclusion: P. praeputialis, T. cati, D. nolleri and sometime J. pasqualei are the commonest Helminthes in cats. This is the first reported isolation of P. affinis and A. caninum infections from cats in Iran.

  9. Immobilizing wild mountain lions (Felis concolor) with ketamine hydrochloride and xylazine hydrochloride.

    Science.gov (United States)

    Logan, K A; Thorne, E T; Irwin, L L; Skinner, R

    1986-01-01

    A mixture of 120 mg ketamine hydrochloride (KHCL)/20 mg xylazine hydrochloride (XHCL)/ml was used to immobilize 37 wild mountain lions (Felis concolor) 46 times. Observations were recorded during 37 trials that included kittens, adult females, and adult males. Dosages were based on 11 mg KHCL and 1.8 mg XHCL/kg estimated body weight. Actual doses for 24 lions requiring a single injection for immobilization ranged from 4.7-15.8 mg KHCL/kg and 0.8-2.6 mg XHCL/kg. Induction, duration, and recovery times did not differ (P greater than 0.05) between the sex and age classes. Two kittens were overdosed with the drug combination, but the effects were not life threatening. Eleven other lions, nine of which were initially underdosed, required additional injections of the drug combination for safe handling. Immobilization was characterized initially by semi-consciousness, open eyelids, pupillary dilation, and muscle rigidity. Later, most lions appeared unconscious, muscles relaxed, and breathing slowed considerably. No convulsions or hypersalivation occurred. The KHCL/XHCL mixture given at approximately 11 mg KHCL and 1.8 mg XHCL/kg body weight proved useful for immobilizing wild mountain lions for research purposes. Suggestions for case of immobilized cats are included. PMID:3951066

  10. Felis catus gammaherpesvirus 1; a widely endemic potential pathogen of domestic cats.

    Science.gov (United States)

    Beatty, Julia A; Troyer, Ryan M; Carver, Scott; Barrs, Vanessa R; Espinasse, Fanny; Conradi, Oliver; Stutzman-Rodriguez, Kathryn; Chan, Cathy C; Tasker, Séverine; Lappin, Michael R; VandeWoude, Sue

    2014-07-01

    Felis catus gammaherpesvirus 1 (FcaGHV1), recently discovered in the USA, was detected in domestic cats in Australia (11.4%, 95% confidence interval 5.9-19.1, n=110) and Singapore (9.6%, 95% confidence interval 5.9-14.6, n=176) using qPCR. FcaGHV1 qPCR positive cats were 2.8 times more likely to be sick than healthy. Risk factors for FcaGHV1 detection included being male, increasing age and coinfection with pathogenic retroviruses, feline immunodeficiency virus (FIV) or feline leukaemia virus. FcaGHV1 DNA was detected in multiple tissues from infected cats with consistently high virus loads in the small intestine. FcaGHV1 viral load was significantly higher in FIV-infected cats compared with matched controls, mimicking increased Epstein-Barr virus loads in human immunodeficiency virus-infected humans. FcaGHV1 is endemic in distant geographic regions and is associated with being sick and with coinfections. Horizontal transmission of FcaGHV1 is supported, with biting being a plausible route. A pathogenic role for FcaGHV1 in domestic cats is supported. PMID:25010275

  11. Efficacy of indoxacarb applied to cats against the adult cat flea, Ctenocephalides felis, flea eggs and adult flea emergence

    OpenAIRE

    Dryden, Michael W; Payne, Patricia A; Smith, Vicki; Heaney, Kathleen; Sun, Fangshi

    2013-01-01

    Background A study was conducted to evaluate the effect of indoxacarb applied to cats on adult cat fleas, Ctenocephalides felis, flea egg production and adult flea emergence. Methods Sixteen cats were selected for the study and allocated to two treatment groups. Eight cats were treated with a 19.5% w/v topical spot-on solution of indoxacarb on day 0 and eight cats served as untreated controls. Each cat was infested with 50 fleas on Days -2, 7, 14, 21, 28, 35 and 42. On Days 1, 2, and 3, and a...

  12. The use of a T-maze to measure cognitive-motor function in cats (Felis catus)

    OpenAIRE

    Sherman, Barbara L.; Gruen, Margaret E.; Meeker, Rick B.; Milgram, Bill; DiRivera, Christina; Thomson, Andrea; Clary, Gillian; Hudson, Lola

    2013-01-01

    Few tests have been developed to test the cognitive and motor capabilities of domestic cats, in spite of the suitability of cats for specific studies of neuroanatomy, infectious diseases, development, aging, and behavior. The present study evaluated a T-maze apparatus as a sensitive and reliable measure of cognition and motor function of cats. Eighteen purpose-bred, specific-pathogen-free, male, neutered domestic shorthair cats (Felis catus), 1-2 years of age, were trained and tested to a T-m...

  13. Functional Analyses of Bitter Taste Receptors in Domestic Cats (Felis catus).

    Science.gov (United States)

    Lei, Weiwei; Ravoninjohary, Aurore; Li, Xia; Margolskee, Robert F; Reed, Danielle R; Beauchamp, Gary K; Jiang, Peihua

    2015-01-01

    Cats are obligate carnivores and under most circumstances eat only animal products. Owing to the pseudogenization of one of two subunits of the sweet receptor gene, they are indifferent to sweeteners, presumably having no need to detect plant-based sugars in their diet. Following this reasoning and a recent report of a positive correlation between the proportion of dietary plants and the number of Tas2r (bitter receptor) genes in vertebrate species, we tested the hypothesis that if bitter perception exists primarily to protect animals from poisonous plant compounds, the genome of the domestic cat (Felis catus) should have lost functional bitter receptors and they should also have reduced bitter receptor function. To test functionality of cat bitter receptors, we expressed cat Tas2R receptors in cell-based assays. We found that they have at least 7 functional receptors with distinct receptive ranges, showing many similarities, along with some differences, with human bitter receptors. To provide a comparative perspective, we compared the cat repertoire of intact receptors with those of a restricted number of members of the order Carnivora, with a range of dietary habits as reported in the literature. The numbers of functional bitter receptors in the terrestrial Carnivora we examined, including omnivorous and herbivorous species, were roughly comparable to that of cats thereby providing no strong support for the hypothesis that a strict meat diet influences bitter receptor number or function. Maintenance of bitter receptor function in terrestrial obligate carnivores may be due to the presence of bitter compounds in vertebrate and invertebrate prey, to the necessary role these receptors play in non-oral perception, or to other unknown factors. We also found that the two aquatic Carnivora species examined had fewer intact bitter receptors. Further comparative studies of factors driving numbers and functions of bitter taste receptors will aid in understanding the forces

  14. Molecular characterisation of Cryptosporidium and Giardia in cats (Felis catus) in Western Australia.

    Science.gov (United States)

    Yang, Rongchang; Ying, Joyce Lau Jie; Monis, Paul; Ryan, Una

    2015-08-01

    Little is known of the prevalence of Cryptosporidium and Giardia in domestic cats in Western Australia and their potential role as zoonotic reservoirs for human infection. In the present study, a total of 345 faecal samples from four different sources were screened for the presence of Cryptosporidium and Giardia by PCR and genotyped by sequence analysis. Oocyst numbers and cyst numbers for Cryptosporidium and Giardia respectively were also determined using quantitative PCR assays. Cryptosporidium and Giardia were detected in 9.9% (95% CI 6.7-13.0) and 10.1% (95% CI 7.0-13.3) of cats in Western Australia respectively. Sequence analysis at the 18S rRNA locus identified five Cryptosporidium species/genotypes; C. felis (n = 8), C. muris (n = 1), C. ryanae (n = 1), Cryptosporidium rat genotype III (n = 5) and a novel genotype most closely related to Cryptosporidium rat genotype III in one isolate. This is the first report of C. ryanae and Cryptosporidium rat genotype III in cats. For Giardia, assemblage F the most commonly identified species, while only 1 assemblage sequence was detected. Since most human cases of cryptosporidiosis are caused by C. parvum and C. hominis and human cases of giardiasis are caused by G. duodenalis assemblage A and B, the domestic cats in the present study are likely to be of low zoonotic risk to pet owners in Perth. Risk analyses identified that elderly cats (more than 6 years) were more prone to Cryptosporidium and Giardia infections than kittens (less than 6 months) (P = 0.009). Clinical symptoms were not associated with the prevalence of Cryptosporidium and Giardia infections in cats. PMID:25959691

  15. Phenotypic and Molecular Characterization of Domestic Cat (Felis catus) Spermatogonial Stem Cells.

    Science.gov (United States)

    Powell, Robin H; Galiguis, Jason; Biancardi, Monica N; Pope, C Earle; Leibo, Stanley P; Wang, Guoshun; Gómez, Martha C

    2016-07-01

    In many mammalian species, surface markers have been used to obtain enriched populations of spermatogonial stem cells (SSCs) for assisted reproduction and other applications; however, little is known about the expression patterns of feline SSCs. In this study, we assessed expression of the SSC surface markers commonly used in other species, KIT, ITGA6, CD9, GFRalpha1, ADGRA3, and THY1, in addition to the less frequently used pluripotent markers TRA-1-60, TRA-1-81, SSEA-1, and SSEA-4 in SSCs of both prepubertal and adult domestic cats (Felis catus). To further characterize cat SSCs, we sorted cells using SSC-specific markers and evaluated the expression of the pluripotent transcription factors NANOG, POU5F1, and SOX2 and the proto-oncogene MYC within these populations. We concluded that SSC surface markers used in other mammalian species were not specific for identifying cat SSCs. However, the pluripotent markers we evaluated were more specific to cat spermatogonia, and the presence of SSEA-1 and SSEA-4 in fewer and primarily individual cells suggests that these two markers may be used for enrichment of cat SSCs. The expression of pluripotent transcription factors at mRNA level by single-stained cells positive for SSEA-4 and by dual-stained cells positive for both GFRalpha1 and SSEA-4 reflects the undifferentiated stage of cat SSCs. The absence of transcription factors in double-stained cells positive for only one marker implies the loss of the stem cell-like identity with the loss of either GFRalpha1 or SSEA-4. Further investigation is warranted to elucidate the biological characteristics of these spermatogonial subpopulations. PMID:27281702

  16. Functional Analyses of Bitter Taste Receptors in Domestic Cats (Felis catus.

    Directory of Open Access Journals (Sweden)

    Weiwei Lei

    Full Text Available Cats are obligate carnivores and under most circumstances eat only animal products. Owing to the pseudogenization of one of two subunits of the sweet receptor gene, they are indifferent to sweeteners, presumably having no need to detect plant-based sugars in their diet. Following this reasoning and a recent report of a positive correlation between the proportion of dietary plants and the number of Tas2r (bitter receptor genes in vertebrate species, we tested the hypothesis that if bitter perception exists primarily to protect animals from poisonous plant compounds, the genome of the domestic cat (Felis catus should have lost functional bitter receptors and they should also have reduced bitter receptor function. To test functionality of cat bitter receptors, we expressed cat Tas2R receptors in cell-based assays. We found that they have at least 7 functional receptors with distinct receptive ranges, showing many similarities, along with some differences, with human bitter receptors. To provide a comparative perspective, we compared the cat repertoire of intact receptors with those of a restricted number of members of the order Carnivora, with a range of dietary habits as reported in the literature. The numbers of functional bitter receptors in the terrestrial Carnivora we examined, including omnivorous and herbivorous species, were roughly comparable to that of cats thereby providing no strong support for the hypothesis that a strict meat diet influences bitter receptor number or function. Maintenance of bitter receptor function in terrestrial obligate carnivores may be due to the presence of bitter compounds in vertebrate and invertebrate prey, to the necessary role these receptors play in non-oral perception, or to other unknown factors. We also found that the two aquatic Carnivora species examined had fewer intact bitter receptors. Further comparative studies of factors driving numbers and functions of bitter taste receptors will aid in

  17. Estimated Number of Birds Killed by House Cats (Felis catus in Canada

    Directory of Open Access Journals (Sweden)

    Peter Blancher

    2013-12-01

    Full Text Available Predation by house cats (Felis catus is one of the largest human-related sources of mortality for wild birds in the United States and elsewhere, and has been implicated in extinctions and population declines of several species. However, relatively little is known about this topic in Canada. The objectives of this study were to provide plausible estimates for the number of birds killed by house cats in Canada, identify information that would help improve those estimates, and identify species potentially vulnerable to population impacts. In total, cats are estimated to kill between 100 and 350 million birds per year in Canada (> 95% of estimates were in this range, with the majority likely to be killed by feral cats. This range of estimates is based on surveys indicating that Canadians own about 8.5 million pet cats, a rough approximation of 1.4 to 4.2 million feral cats, and literature values of predation rates from studies conducted elsewhere. Reliability of the total kill estimate would be improved most by better knowledge of feral cat numbers and diet in Canada, though any data on birds killed by cats in Canada would be helpful. These estimates suggest that 2-7% of birds in southern Canada are killed by cats per year. Even at the low end, predation by house cats is probably the largest human-related source of bird mortality in Canada. Many species of birds are potentially vulnerable to at least local population impacts in southern Canada, by virtue of nesting or feeding on or near ground level, and habitat choices that bring them into contact with human-dominated landscapes where cats are abundant. Because cat predation is likely to remain a primary source of bird mortality in Canada for some time, this issue needs more scientific attention in Canada.

  18. Survey on parasitic infections in wildcat (Felis silvestris silvestris Schreber, 1777) by scat collection.

    Science.gov (United States)

    Napoli, Ettore; Anile, Stefano; Arrabito, Carmelo; Scornavacca, Davide; Mazzamuto, Maria Vittoria; Gaglio, Gabriella; Otranto, Domenico; Giannetto, Salvatore; Brianti, Emanuele

    2016-01-01

    Wildcats are endangered felid species living in Europe, Asia, and Africa. Regrettably, scientific information on parasites of wildcats is particularly meager and they often rely on data gained by necropsies of a small number of animals. In the present study, scat collection was used to assess the parasite spectrum of European wildcats living in the Etna Park (Sicily, Italy). Scat collection was performed from May to September 2010 by weekly walking four transects for a total of 391 km. Samples were then analyzed by flotation and sedimentation techniques to investigate wildcat parasitic fauna. A total of 121 scats of wildcats were collected, and parasitic forms (i.e., oocysts, eggs, and larvae) were retrieved in 110 (90.9 %) of the samples. Parasites found were Physaloptera sp. (52.1 %), tapeworms (45.5 %), Toxocara cati (43.8 %), Eucoleus aerophilus (27.3 %), Ancylostoma sp. (22.3 %), Troglostrongylus brevior (15.7 %), trematodes (9.9 %), Isospora felis (4.1 %), Cylicospirura sp. (1.7 %), and Acanthocephala (0.8 %). The prevalence of endoparasitic infections herein recorded is similar to that described in other studies conducted using necropsy technique. The species richness of parasites found in the present survey, with a total of nine helminths and one protozoon, is the highest ever reported for wildcat in Europe. Scat collection and examination are reliable and rapid non-invasive tools which can be used in a systematic survey design to study the parasite spectrum of wildcat as well as that of other endangered wild species. PMID:26377843

  19. Recent status of five FEL facilities and application research at FELI

    International Nuclear Information System (INIS)

    Four FEL facilities FEL-1, FEL-2, FEL-3 and FEL-4 achieved lasing at FELI in Oct. 1994, in Feb. 1995, in Dec. 1995 and in Oct. 1996, respectively. Two IR facilities FEL-1 and FEL-2 are open for users to supply several MW-level FELs covering the wavelength range of 1-20μm every other week. Total operation time in 1996 was about 2400 hours. The visible- and UV-facility FEL-3 has broken the world record for the shortest wavelength oscillation of linac-based FELs with a thermionic gun up to 0.278μm. An FIR facility FEL-4 (20-80μm) was installed at the 33-MeV beam line, downstream of FEL-1. The electron beam once lased at FEL-1 is used for lasing at FEL-4. The electron beam of the 165-MeV linac consists of a train of several picosecond micropulse repeating at 22.3125MHz or at 89.25MHz. The train of the micropulse continues for 24μs (macropulse) and the repetition rate of the macropulse is 10Hz or 20Hz. The number of the micropulse in a macropulse is 2140 with a micropulse separation of 11.2ns. The maximum average power of the IR-FEL will be a few W. The FEL beams are delivered from the optical cavities to the diagnostics room and four user's rooms (eighteen stations) through the pipe lines. The beam can be shared by using fan-shaped Au-coated mirrors to several stations including two manipulators simultaneously for bio-medical and semiconductor applications. An FIR-FEL facility FEL-5 (50-100μm) was installed at the beam line of the 20-MeV linac with an RF gun. FEL-5 is in the commissioning stage. (author)

  20. Comparación química y funcional de tres dietas comerciales y una experimental, a través de la tasa de crecimiento de bagre de canal (Ictalurus punctatus) y su efecto en la calidad del agua

    OpenAIRE

    Sánchez Pérez, Karina Yurittsy

    2013-01-01

    Dietas de alta calidad nutricional, bajo impacto ambiental y económicamente rentables, son una necesidad apremiante para alcanzar mayor eficiencia alimenticia, tasa máxima de crecimiento de los peces y reducir los recambios en el ciclo de engorda. El objetivo del trabajo fue evaluar el crecimiento y los efectos de la proteína dietaría sobre la degradación de la calidad del agua, a través de la acumulación de nutrientes no asimilados en el agua de cultivo del bagre (Ictalurus punctatus).

  1. Toxoplasmosis in sand cats (Felis margarita) and other animals in the Breeding Centre for Endangered Arabian Wildlife in the United Arab Emirates

    Science.gov (United States)

    The Sand cat (Felis margarita) is a small-sized felid occurring in the United Arab Emirates (UAE). The Sand cat captive breeding program at the Breeding Centre for Endangered Arabian Wildlife (BCEAW), Sharjah, UAE, has experienced high newborn mortality rates, and congenital toxoplasmosis was recent...

  2. ISOLATION AND GENETIC CHARACTERIZATION OF TOXOPLASMA GONDII FROM RACCOONS (PROCYON LOTOR), CATS (FELIS DOMESTICUS), STRIPED SKUNK (MEPHITIS MEPHITIS), BLACK BEAR (URSUS AMERICANUS), AND COUGAR (PUMA CONCOLOR) FROM CANADA

    Science.gov (United States)

    Viable Toxoplasma gondii was isolated by bioassay in mice from tissues of 2 feral cats ( Felis domesticus), 2 raccoons (Procyon lotor), a skunk (Mephitis mephitis) trapped in remote locations in Manitoba, Canada, and a black bear (Ursus americanus ) from Kuujjuaq, northern Quebec, Canada. Geno...

  3. A new atypical genotype mouse virulent strain of Toxoplasma gondii isolated from the heart of a wild caught puma (Felis concolor) from Durango, Mexico

    Science.gov (United States)

    Nothing is known of the genetic diversity of Toxoplasma gondii circulating in wildlife in Mexico. In the present study, a mouse virulent T. gondii strain was isolated from the heart of a wild puma (Felis concolor). The puma was found roaming in outskirt of Durango City, Mexico and tranquailized for ...

  4. Aspectos morfométricos do timo em gatos domésticos (Felis domesticus

    Directory of Open Access Journals (Sweden)

    Camila E. Barroso

    2012-12-01

    Full Text Available O timo é um órgão linfático primário que desenvolve sua atividade em organismos jovens. Apesar de sua função ser responsável por mecanismos fundamentais na aquisição das defesas e conseqüentes respostas orgânicas, ela ainda não está totalmente esclarecida, nem tampouco as bases morfológicas que respondem por tais funções, como o processo de desenvolvimento e involução do órgão. Objetivou-se analisar e caracterizar os aspectos morfológicos do timo, tais como seu tamanho e volume, e aspectos histológicos do timo em gatos, correlacionando o sexo e o desenvolvimento etário. Doze timos provenientes de fetos de gatos domésticos (Felis domesticus sem raça definida (SRD, machos e fêmeas, separados em três grupos etários. O timo apresentou-se com uma coloração rosa-pálida e com duas porções, a torácica e a cervical, sendo que cada uma delas possuía um lobo direito e um lobo esquerdo em sua maioria. A porção torácica localizava-se em região de mediastino cranial, entre os pulmões e à base do coração. E a porção cervical estendia-se além das costelas em sentido cranial, estando localizada ventralmente à traqueia. A estrutura celular do timo demonstrou-se organizada com a presença de agregados concêntricos, os chamados corpúsculos tímicos, formados por células epiteliais, sustentada por uma cápsula de tecido conjuntivo de onde partiam septos que ao penetrar no órgão dividia-o em lóbulos. Ocorreram variações significativas quanto à lobação e as dimensões do timo entre indivíduos da mesma faixa etária, e entre sexos diferentes. Os valores relativos ao comprimento, espessura e largura, de maneira geral, apresentaram aumento, em conformidade ao desenvolvimento dos animais, mas com diferenças entre os sexos.

  5. Survival of feral cats, Felis catus (Carnivora: Felidae), on Mauna Kea, Hawai'i, based on tooth cementum lines

    Science.gov (United States)

    Danner, Raymond M.; Farmer, Chris; Hess, Steven C.; Stephens, Robert M.; Banko, Paul C.

    2010-01-01

    Feral cats (Felis catus) have spread throughout anthropogenic and insular environments of the world. They now threaten many species of native wildlife with chronic depredation. Knowledge of feral cat population dynamics is necessary to understand their ecological effects and to develop effective control strategies. However, there are few studies worldwide regarding annual or lifetime survival rates in remote systems, and none on Pacific islands. We constructed the age distribution and estimated survival of feral cats in a remote area of Hawai'i Island using cementum lines present in lower canine teeth. Our data suggest annual cementum line formation. A log-linear model estimated annual survival ≥ 1 yr of age to be 0.647. Relatively high survival coupled with high reproductive output allows individual cats to affect native wildlife for many years and cat populations to rebound quickly after control efforts.

  6. Redescription of Parspina argentinensis (Szidat, 1954) (Digenea: Cryptogonimidae) from freshwater fishes (Pimelodidae) in the basins of the Paraná and La Plata Rivers, Argentina, with comments on P. bagre Pearse, 1920.

    Science.gov (United States)

    Ostrowski de Núñez, Margarita C; Arredondo, Nathalia J; Doma, Irene L; Gil de Pertierra, Alicia A

    2011-01-01

    The type-specimens of Parspina argentinensis (Szidat, 1954) from Pimelodus maculatus Lacépède, and new material from Iheringichthys labrosus (Lütken), Parapimelodus valenciennis (Lütken), Pimelodella gracilis (Valenciennes), Pimelodus albicans (Valenciennes), P. argenteus Perugia and P. maculatus caught in the basins of the La Plata and Paraná Rivers, Argentina, were studied to elucidate its taxonomic status. The type-specimens of Parspina bagre Pearse, 1920 from Pimelodella metae Eigenmann in Lake Valencia, Venezuela, were also studied and new observations on its morphology recorded. The amendation of the generic diagnosis of Parspina Pearse, 1920 is proposed based on the study of both species, which revealed, among other features, the absence of a thin walled-membrane enclosing the male terminal genitalia. Parspina argentinensis is characterised by the following features: absence of a gonotyl; presence of a bipartite seminal vesicle, pars prostatica and ejaculatory duct; caeca of nearly equal length; uterus extending from the level of the ventral sucker to end of body; testes symmetrical to slightly oblique; ovary transversely elongate, compact and variable in shape; and the utilisation of a wide range of freshwater fishes as hosts. The tegumental surface of this species is covered with pectinate spines arranged quincuncially. Spines decrease in size and density from forebody to hindbody. There are two types of sensory papillae, ciliated and dome-shaped. Ciliated papillae are distributed on the surface of the oral region and on the dorsal and ventral surfaces of the body, whereas dome-shaped papillae are found on the surface of the ventral rim of the oral sucker associated with a ciliated papilla. Gland-duct openings are interspersed with the spines of the oral crown. In addition, the infection indices of P. argentinensis vary widely, not only among different hosts but also between the Paraná and La Plata River basins. Higher prevalences of P. argentinensis

  7. Differential passage rates of prey components through the gut of serval Felis serval and black-backed jackal Canis mesomelas

    OpenAIRE

    J.M. Bowland; A.E. Rowland

    1991-01-01

    Feeding trials conducted on Felis serval and Canis mesomelas showed that the same prey item may appear in up to seven scats (mean=2.8, n=7). The basic assumption that prey remains of the same species in different scats represent different individuals is invalid. Therefore over-estimation of some prey species relative to others in the diet of carnivores studied can occur.

  8. Rickettsia typhi IN RODENTS AND R. felis IN FLEAS IN YUCATÁN AS A POSSIBLE CAUSAL AGENT OF UNDEFINED FEBRILE CASES

    Directory of Open Access Journals (Sweden)

    Gaspar PENICHE-LARA

    2015-04-01

    Full Text Available Rickettsia typhi is the causal agent of murine typhus; a worldwide zoonotic and vector-borne infectious disease, commonly associated with the presence of domestic and wild rodents. Human cases of murine typhus in the state of Yucatán are frequent. However, there is no evidence of the presence of Rickettsia typhi in mammals or vectors in Yucatán. The presence of Rickettsia in rodents and their ectoparasites was evaluated in a small municipality of Yucatán using the conventional polymerase chain reaction technique and sequencing. The study only identified the presence of Rickettsia typhi in blood samples obtained from Rattus rattus and it reported, for the first time, the presence of R. felis in the flea Polygenis odiosus collected from Ototylomys phyllotis rodent. Additionally, Rickettsia felis was detected in the ectoparasite Ctenocephalides felis fleas parasitizing the wild rodent Peromyscus yucatanicus. This study’s results contributed to a better knowledge of Rickettsia epidemiology in Yucatán.

  9. Antifungal activity of extracts from Atacama Desert fungi againstParacoccidioides brasiliensis and identification ofAspergillus felis as a promising source of natural bioactive compounds

    Directory of Open Access Journals (Sweden)

    Graziele Mendes

    2016-03-01

    Full Text Available Fungi of the genus Paracoccidioides are responsible for paracoccidioidomycosis. The occurrence of drug toxicity and relapse in this disease justify the development of new antifungal agents. Compounds extracted from fungal extract have showing antifungal activity. Extracts of 78 fungi isolated from rocks of the Atacama Desert were tested in a microdilution assay against Paracoccidioides brasiliensis Pb18. Approximately 18% (5 of the extracts showed minimum inhibitory concentration (MIC values≤ 125.0 µg/mL. Among these, extract from the fungus UFMGCB 8030 demonstrated the best results, with an MIC of 15.6 µg/mL. This isolate was identified as Aspergillus felis (by macro and micromorphologies, and internal transcribed spacer, β-tubulin, and ribosomal polymerase II gene analyses and was grown in five different culture media and extracted with various solvents to optimise its antifungal activity. Potato dextrose agar culture and dichloromethane extraction resulted in an MIC of 1.9 µg/mL against P. brasiliensis and did not show cytotoxicity at the concentrations tested in normal mammalian cell (Vero. This extract was subjected to bioassay-guided fractionation using analytical C18RP-high-performance liquid chromatography (HPLC and an antifungal assay using P. brasiliensis. Analysis of the active fractions by HPLC-high resolution mass spectrometry allowed us to identify the antifungal agents present in the A. felis extracts cytochalasins. These results reveal the potential of A. felis as a producer of bioactive compounds with antifungal activity.

  10. Antifungal activity of extracts from Atacama Desert fungi against Paracoccidioides brasiliensis and identification of Aspergillus felis as a promising source of natural bioactive compounds.

    Science.gov (United States)

    Mendes, Graziele; Gonçalves, Vívian N; Souza-Fagundes, Elaine M; Kohlhoff, Markus; Rosa, Carlos A; Zani, Carlos L; Cota, Betania B; Rosa, Luiz H; Johann, Susana

    2016-03-01

    Fungi of the genus Paracoccidioides are responsible for paracoccidioidomycosis. The occurrence of drug toxicity and relapse in this disease justify the development of new antifungal agents. Compounds extracted from fungal extract have showing antifungal activity. Extracts of 78 fungi isolated from rocks of the Atacama Desert were tested in a microdilution assay against Paracoccidioides brasiliensis Pb18. Approximately 18% (5) of the extracts showed minimum inhibitory concentration (MIC) values ≤ 125.0 µg/mL. Among these, extract from the fungus UFMGCB 8030 demonstrated the best results, with an MIC of 15.6 µg/mL. This isolate was identified as Aspergillus felis (by macro and micromorphologies, and internal transcribed spacer, β-tubulin, and ribosomal polymerase II gene analyses) and was grown in five different culture media and extracted with various solvents to optimise its antifungal activity. Potato dextrose agar culture and dichloromethane extraction resulted in an MIC of 1.9 µg/mL against P. brasiliensis and did not show cytotoxicity at the concentrations tested in normal mammalian cell (Vero). This extract was subjected to bioassay-guided fractionation using analytical C18RP-high-performance liquid chromatography (HPLC) and an antifungal assay using P. brasiliensis. Analysis of the active fractions by HPLC-high resolution mass spectrometry allowed us to identify the antifungal agents present in the A. felis extracts cytochalasins. These results reveal the potential of A. felis as a producer of bioactive compounds with antifungal activity. PMID:27008375

  11. Techniques used in the study of African wildcat, Felis silvestris cafra, in the Kgalagadi Transfrontier Park (South Africa/Botswana

    Directory of Open Access Journals (Sweden)

    Marna Herbst

    2010-03-01

    Full Text Available The techniques used for the capture, marking and habituation of African wildcats (Felis silvestris cafra in the Kalahari are described and evaluated in this paper. African wildcats were captured, with either baited cage traps or chemical immobilisation through darting. Darting proved to be a more efficient and less stressful way of capturing cats. Very high frequency (VHF radio collars fitted with activity monitors were especially effective in the open habitat of the Kalahari for locating and maintaining contact with cats; they also aided in determining if the cats were active or resting in dense vegetation. The habituation of individual cats to a 4×4 vehicle proved to be time consuming, but it provided a unique opportunity to investigate the feeding ecology and spatial organisation of cats through direct visual observations.Conservation implications: In describing and comparing the various methods of capture, handling and release of the African wildcats that we followed during our study in the southern Kalahari, we recommend the most efficient, least stressful method for researchers to follow – both in relation to time and energy, as well as in terms of the impact on the animals being studied.

  12. High prevalence of Felis catus gammaherpesvirus 1 infection in haemoplasma-infected cats supports co-transmission.

    Science.gov (United States)

    McLuckie, A; Tasker, S; Dhand, N K; Spencer, S; Beatty, J A

    2016-08-01

    Felis catus gammaherpesvirus 1 (FcaGHV1), a potential feline pathogen, has been identified in domestic cats from USA, Asia-Pacific and Central Europe. Transmission of FcaGHV1 during territorial encounters, a route not typical for gammaherpesviruses, is suggested by risk factor analyses from some regions. The aim of this study was to investigate the relationship between FcaGHV1 detection and risk factors, including haemoplasma co-infections, among UK cats to better understand transmission and global distribution of FcaGHV1. FcaGHV1 DNA was detected in blood samples from UK cats (11.56%; 95% confidence interval [CI], 7.47-16.84; n = 199). Logistic regression analyses showed that entire male cats were more likely to be FcaGHV1 positive than neutered male cats (odds ratio, 3.60; 95% CI, 1.22-10.46). Samples positive for DNA from any of three haemoplasma species had 19 times greater odds for testing positive for FcaGHV1 than haemoplasma negative cats in multivariable analyses after adjusting for age, sex and neuter status. Domestic cats in the UK can be infected with FcaGHV1, confirming that this virus is globally endemic. The identification of neuter status as a risk factor for FcaGHV1 detection provides further evidence to support transmission of this virus during territorial encounters and co-transmission with haemoplasmas is suggested. PMID:27387737

  13. What's inside your cat's head? A review of cat (Felis silvestris catus) cognition research past, present and future.

    Science.gov (United States)

    Vitale Shreve, Kristyn R; Udell, Monique A R

    2015-11-01

    The domestic cat (Felis silvestris catus) has shared an intertwined existence with humans for thousands of years, living on our city streets and in our homes. Yet, little scientific research has focused on the cognition of the domestic cat, especially in comparison with human's other companion, the domestic dog (Canis lupus familiaris). This review surveys the current status of several areas of cat cognition research including perception, object permanence, memory, physical causality, quantity and time discrimination, cats' sensitivity to human cues, vocal recognition and communication, attachment bonds, personality, and cognitive health. Although interest in cat cognition is growing, we still have a long way to go until we have an inclusive body of research on the subject. Therefore, this review also identifies areas where future research must be conducted. In addition to the scientific value of future work in this area, future research on cat cognition could have an important influence on the management and welfare of pet and free-roaming cats, leading to improved human-cat interactions. PMID:26154131

  14. Control of immature stages of the flea Ctenocephalides felis(Bouché in carpets exposed to cats treated with imidacloprid

    Directory of Open Access Journals (Sweden)

    L.J. Fourie

    2000-07-01

    Full Text Available Fleas cause allergic dermatitis in cats and dogs and therefore warrant control. It has been demonstrated previously that there is marked inhibition of the development of the immature stages of the cat flea Ctenocephalides felis on fleece blankets exposed to cats treated with imidacloprid. This study reports on the efficacy of imidacloprid in suppressing adult flea emergence in carpet exposed to treated cats. Circular discs of carpet pre-seeded with flea eggs and larvae were exposed to 6 untreated control and 6 topically treated (imidacloprid 10 % m/v cats 1 to 2 days after treatment and subsequently fortnightly for 6 weeks. Exposure times on alternate days were either 1 or 6 hours. Adult flea yield from carpets was determined 35 days after exposure. Differences between flea yield on control carpets and those exposed for 1 hour were significant only for days +1 and +14. For the 6-hour exposure, differences were significant at all times except on Day +43. The ability of imidacloprid to suppress the yield of adult fleas on carpets (6-hour exposure steadily declined from 82 % (Day +2 to 12 %(Day +43. For the 1-hour exposure it varied inconsistently between 0 and 83 % over the 6-week study period.

  15. Influences of stage of lactation, teat position and sequential milk sampling on the composition of domestic cat milk (Felis catus).

    Science.gov (United States)

    Jacobsen, K L; DePeters, E J; Rogers, Q R; Taylor, S J

    2004-02-01

    Milk from 11 domestic shorthair cats (Felis catus; n=7 fed dry low-fat diet, n=4 fed dry high-fat diet) was collected weekly for 6 weeks following parturition, and analysed for total solids (TS), crude protein (CP), fat, lactose and ash. Samples were collected in 1-ml sequential fractions to determine whether within-sampling changes in composition existed Samples of extracted milk fat were also analysed for fatty acid content. Two commercia kitten milk replacers were analysed according to the same procedures utilized for mil samples. In statistical analyses individual cat, diet, stage of lactation, litter size, and teat position influenced concentrations of milk components; parity and sequential sampling had no effect. Averaged cat milk was 27.9% TS, and 8.7% CP, 12.7% fat, 4.2% lactose and 1.3% ash (on a wet basis). Milk protein percentage increased over lactation for both diet groups, but fat percentage increased only for queens fed the high-fat diet. Milk replacers were lower in fat and protein content than milk from queens, and had considerably lower levels of arachidonic acid. Data from this study contribute to the limited information available regarding the composition of domestic cat milk, and give possible reasons for poor growth occasionally observed in kittens fed unsupplemented commercial milk replacers. PMID:19774762

  16. The karyotype of Cathorops sp, a marine catfish from Brazil

    Directory of Open Access Journals (Sweden)

    Vicente Gomes

    1992-01-01

    Full Text Available Cathorops sp has the diploid number of 54 chromosomes. The karyotype comprises lm + sm, 6m, 6sm and 14st pairs. This result is compared with those of other species of Ariidae, mainly Ariopsis felis and Arius dussumieri, found in literature.Foram realizados estudos cromossômicos em 25 espécimens de Cathorops sp pelo método de air-drying. O número modal diplóide encontrado foi de 54 cromossomos sendo 1 par m + sm, 6 pares m, 6 pares sm e 14 pares st. Os resultados são comparados com dados da literatura referentes a cromossomos de outros ariídeos, principalmente de Ariopsis felis e Arius dussumieri.

  17. Multidimensional effects of biologically synthesized silver nanoparticles in Helicobacter pylori, Helicobacter felis, and human lung (L132) and lung carcinoma A549 cells

    Science.gov (United States)

    Gurunathan, Sangiliyandi; Jeong, Jae-Kyo; Han, Jae Woong; Zhang, Xi-Feng; Park, Jung Hyun; Kim, Jin-Hoi

    2015-02-01

    Silver nanoparticles (AgNPs) are prominent group of nanomaterials and are recognized for their diverse applications in various health sectors. This study aimed to synthesize the AgNPs using the leaf extract of Artemisia princeps as a bio-reductant. Furthermore, we evaluated the multidimensional effect of the biologically synthesized AgNPs in Helicobacter pylori, Helicobacter felis, and human lung (L132) and lung carcinoma (A549) cells. UV-visible (UV-vis) spectroscopy confirmed the synthesis of AgNPs. X-ray diffraction (XRD) indicated that the AgNPs are specifically indexed to a crystal structure. The results from Fourier transform infrared spectroscopy (FTIR) indicate that biomolecules are involved in the synthesis and stabilization of AgNPs. Dynamic light scattering (DLS) studies showed the average size distribution of the particle between 10 and 40 nm, and transmission electron microscopy (TEM) confirmed that the AgNPs were significantly well separated and spherical with an average size of 20 nm. AgNPs caused dose-dependent decrease in cell viability and biofilm formation and increase in reactive oxygen species (ROS) generation and DNA fragmentation in H. pylori and H. felis. Furthermore, AgNPs induced mitochondrial-mediated apoptosis in A549 cells; conversely, AgNPs had no significant effects on L132 cells. The results from this study suggest that AgNPs could cause cell-specific apoptosis in mammalian cells. Our findings demonstrate that this environmentally friendly method for the synthesis of AgNPs and that the prepared AgNPs have multidimensional effects such as anti-bacterial and anti-biofilm activity against H. pylori and H. felis and also cytotoxic effects against human cancer cells. This report describes comprehensively the effects of AgNPs on bacteria and mammalian cells. We believe that biologically synthesized AgNPs will open a new avenue towards various biotechnological and biomedical applications in the near future.

  18. Food habits and temporal activity patterns of the Golden Jackal Canis aureus and the Jungle Cat Felis chaos in Pench Tiger Reserve, Madhya Pradesh

    OpenAIRE

    Majumder, A.; K. Sankar; Q. Qureshi; S. Basu

    2011-01-01

    The food habits and temporal activity patterns of the Golden Jackal Canis aureus and the Jungle Cat Felis chaus were studied between January 2008 and June 2009 in Pench Tiger Reserve (PTR), Madhya Pradesh. A total of 50 jackal scats and 85 jungle cat scats were collected where-ever encountered in the study area. Information on activity pattern was obtained using camera traps. Fifty-two pair self-triggered analog cameras were deployed in each 2 x 2 km² across the study area (> 250 km²) close t...

  19. Vocal correlates of sender-identity and arousal in the isolation calls of domestic kitten (Felis silvestris catus

    Directory of Open Access Journals (Sweden)

    Scheumann Marina

    2012-12-01

    Full Text Available Abstract Introduction Human speech does not only communicate linguistic information but also paralinguistic features, e.g. information about the identity and the arousal state of the sender. Comparable morphological and physiological constraints on vocal production in mammals suggest the existence of commonalities encoding sender-identity and the arousal state of a sender across mammals. To explore this hypothesis and to investigate whether specific acoustic parameters encode for sender-identity while others encode for arousal, we studied infants of the domestic cat (Felis silvestris catus. Kittens are an excellent model for analysing vocal correlates of sender-identity and arousal. They strongly depend on the care of their mother. Thus, the acoustical conveyance of sender-identity and arousal may be important for their survival. Results We recorded calls of 18 kittens in an experimentally-induced separation paradigm, where kittens were spatially separated from their mother and siblings. In the Low arousal condition, infants were just separated without any manipulation. In the High arousal condition infants were handled by the experimenter. Multi-parametric sound analyses revealed that kitten isolation calls are individually distinct and differ between the Low and High arousal conditions. Our results suggested that source- and filter-related parameters are important for encoding sender-identity, whereas time-, source- and tonality-related parameters are important for encoding arousal. Conclusion Comparable findings in other mammalian lineages provide evidence for commonalities in non-verbal cues encoding sender-identity and arousal across mammals comparable to paralinguistic cues in humans. This favours the establishment of general concepts for voice recognition and emotions in humans and animals.

  20. FOCUSED ASSESSMENT WITH SONOGRAPHY AS AN AID FOR THE DIAGNOSIS OF GASTROINTESTINAL PERFORATION IN A BOBCAT ( FELIS RUFUS ).

    Science.gov (United States)

    Mejia-Fava, Johanna; Mayer, Jörg; Divers, Stephen J; Cohen, Eli B; Schmiedt, Chad; Holmes, Shannon P

    2015-12-01

    A 10-yr-old female spayed bobcat (Felis rufus) presented with a 3-day history of lethargy, anorexia, and two episodes of vomiting. An emergency field visit was scheduled to perform abdominal radiography and ultrasonography. The bobcat was assessed to be approximately 5-10% dehydrated, on the basis of decreased skin turgor and tacky mucous membranes. Free peritoneal gas, reduced abdominal serosal detail, and an abnormal-appearing right-sided intestinal segment were identified in the abdominal radiographs. However, the emergency field clinicians were not knowledgeable of these abnormalities, because the radiographs could not be processed in the field. During an initial complete abdominal ultrasound evaluation, a nondependent hyperechoic interface with reverberation artifact suggestive of intestinal or free gas and focal intestinal changes indicative of marked enteritis or peritonitis were identified. Free peritoneal fluid was not present on initial examination. In a focused abdominal sonography for trauma (FAST) scan, made after subcutaneous fluid administration, a small volume of anechoic free fluid was present in the peritoneal space. With ultrasound guidance, the fluid was aspirated and appeared grossly turbid. This fluid was subsequently confirmed as septic suppurative effusion, secondary to a foreign body-associated intestinal perforation. The use of a FAST scan is well described in human medicine, and to a limited degree in veterinary literature. This case represents a novel application of FAST scanning in an emergency field setting in a nontraumatized patient. This case report illustrates the utility of the FAST scan in yielding critical clinical information after fluid resuscitation in a zoological setting. PMID:26667552

  1. Primer caso de platinosomosis en Colombia: Platynosomum illiciens (Digenea: Dicrocoeliidae en Felis catus, Turbo, Antioquia Primeiro caso da platinosomosis na Colombia: Platynosomum illiciens (Digenea: Dicrocoeliidae em Felis Catus, Turbo, Antioquia First case of platinosomosis from Colombia: Platynosomum illiciens (Digenea: Dicrocoeliidae in Felis Catus, Turbo, Antioquia

    Directory of Open Access Journals (Sweden)

    Carolina Lenis

    2009-12-01

    Full Text Available La platinosomosis es una enfermedad hepática causada por digéneos del género Platynosomum Looss, 1907, que afecta aves y mamíferos de áreas tropicales y subtropicales. La alta incidencia de la enfermedad en gatos ha posibilitado contar con detallada información acerca del ciclo de vida del parásito, su patogenia, diagnostico y tratamiento. En el 2002, en Turbo, Antioquia, se detectó un gato (Felis catus con mala condición corporal, alopecia, extrema delgadez, vientre inflamado y notables síntomas de enfermedad hepática. Dada la gravedad de la enfermedad, al gato se le realizó la eutanasia y durante la necropsia se hallaron quistes en el hígado que contenían digéneos de la familia Dicrocoeliidae. Este artículo tiene como propósito establecer el estatus taxonómico específico del parásito y dar a conocer el caso mediante la descripción de los signos clínicos. El digéneo fue identificado como Platynosomum illiciens y sus signos clínicos son típicos de la enfermedad, su difícil diagnostico sugiere realizar un examen coprológico acompañado de una ecografía. Se recomienda realizar un estudio de foco en Turbo Antioquia, considerando su amplia distribución en la región del Caribe y países vecinos. El presente estudio constituye el primer caso de platinosomosis en Colombia.Platinosomosis é uma doença hepática causada pelo gênero Digenea Platynosomum Looss de 1907, que afecta as aves e mamíferos em áreas tropicais e subtropicais. A alta incidência da doença em gatos levou a ter informações detalhadas sobre o ciclo de vida do parasita, patogenia, diagnóstico e tratamento. Em 2002, na Turbo, Antioquia, era um gato (Felis catus com má condição corporal, perda de cabelo, magreza extrema, barriga inchada e significativos sintomas de doença hepática. Dada a gravidade da doença, os gatos foram submetidos à eutanásia e foram encontrados durante a autópsia no fígado cistos contendo Digenea Dicrocoeliidae da fam

  2. The detection of Felis catus papillomavirus 3 DNA in a feline bowenoid in situ carcinoma with novel histologic features and benign clinical behavior.

    Science.gov (United States)

    Munday, John S; Fairley, Rob; Atkinson, Karen

    2016-09-01

    Bowenoid in situ carcinoma (BISC; papillomavirus-associated squamous cell carcinoma in situ) is an uncommon skin neoplasm of cats that can result in euthanasia because of the development of multiple lesions or because of progression to invasive squamous cell carcinoma. BISCs are currently thought to be caused by Felis catus papillomavirus 2 (FcaPV-2). The presently described cat developed a single 0.5 cm in diameter interscapular mass. Over the following 18 months, the mass doubled in size; no additional lesions developed. The mass was surgically excised and histologically diagnosed as a BISC. However, in contrast to previously reported BISCs, neither prominent thickening of the deep aspects of the follicular infundibula nor marked cell dysplasia were present. Furthermore, ~50% of the keratinocytes in the affected epidermis had prominent PV cytopathic changes that included shrunken angular nuclei and elongated basophilic cytoplasmic inclusions. As the histopathology was not typical for FcaPV-2 infection, polymerase chain reaction was performed and revealed only DNA sequences from Felis catus papillomavirus 3 (FcaPV-3). No further BISCs developed in this cat 6 months postremoval, hence surgical excision appeared to be curative. Results from this case suggest that, although FcaPV-2 appears to be the predominant cause of BISCs in cats, infection by FcaPV-3 can also cause these neoplasms. BISCs caused by FcaPV-3 appear to have unique histologic features that allow the causative PV type to be predicted. Results from this single case suggest that BISCs caused by FcaPV-3 may have a more benign clinical course than those caused by FcaPV-2. PMID:27423734

  3. Synthèse et étude structrale de lyonsite-type (Na0,4,Li0,6)(Fe,Li2)(MoO4)3

    OpenAIRE

    Amira Souilem; Mohamed Faouzi Zid; Ahmed Driss

    2015-01-01

    The new compound (Na0.4,Li0.6)(Fe,Li2)(MoO4)3 was synthesized by cooling from the melt. Its anionic framework is built up from two distinct MO6 octa­hedra, each containing disordered Li+ and Fe3+ ions in 0.6:0.4 and 0.7:0.3 ratios, and two MoO4 tetra­hedra, which link by vertex-sharing of their O atoms. These tetra­meric units are further linked by sharing edges between octa­hedra and by formation of M—O—Mo (M = Fe/Li) bridges, forming ribbons propagating in the [100] direction. The ribbons a...

  4. Proposal of Afipia gen. nov., with Afipia felis sp. nov. (formerly the cat scratch disease bacillus), Afipia clevelandensis sp. nov. (formerly the Cleveland Clinic Foundation strain), Afipia broomeae sp. nov., and three unnamed genospecies.

    OpenAIRE

    Brenner, D. J.; Hollis, D G; Moss, C W; English, C K; Hall, G. S.; Vincent, J.; Radosevic, J; Birkness, K A; W.F. Bibb; Quinn, F D

    1991-01-01

    On the basis of phenotypic characterization and DNA relatedness determinations, the genus Afipia gen. nov., which contains six species, is described. The type species is Afipia felis sp. nov. (the cat scratch disease bacillus). Afipia clevelandensis sp. nov., Afipia broomeae sp. nov., and three unnamed not associated with cat-borne disease. All but one strain (Afipia genospecies 3) were isolated from human wound and respiratory sources. All Afipia species are gram-negative, oxidase-positive, ...

  5. Molecular cloning of ion channels in Felis catus that are related to periodic paralyses in man: a contribution to the understanding of the genetic susceptibility to feline neck ventroflexion and paralysis

    Directory of Open Access Journals (Sweden)

    Marlyn Zapata

    2014-07-01

    Full Text Available Neck ventroflexion in cats has different causes; however, the most common is the hypokalemia associated with flaccid paralysis secondary to chronic renal failure. In humans, the most common causes of acute flaccid paralysis are hypokalemia precipitated by thyrotoxicosis and familial forms linked to mutations in sodium, potassium, and calcium channel genes. Here, we describe the sequencing and analysis of skeletal muscle ion channels in Felis catus that could be related to periodic paralyses in humans, contributing to the understanding of the genetic susceptibility to feline neck ventroflexion and paralysis. We studied genomic DNA from eleven cats, including five animals that were hyperthyroid with hypokalemia, although only one presented with muscle weakness, and six healthy control domestic cats. We identified the ion channel ortholog genes KCNJ2, KCNJ12, KCNJ14, CACNA1S and SCN4A in the Felis catus genome, together with several polymorphic variants. Upon comparative alignment with other genomes, we found that Felis catus provides evidence for a high genomic conservation of ion channel sequences. Although we hypothesized that neck ventroflexion in cats could be associated with a thyrotoxic or familial periodic paralysis channel mutation, we did not identify any previously detected human channel mutation in the hyperthyroid cat presenting hypokalemia. However, based on the small number of affected cats in this study, we cannot yet rule out this molecular mechanism. Notwithstanding, hyperthyroidism should still be considered as a differential diagnosis in hypokalemic feline paralysis.

  6. Molecular cloning of ion channels in Felis catus that are related to periodic paralyses in man: a contribution to the understanding of the genetic susceptibility to feline neck ventroflexion and paralysis.

    Science.gov (United States)

    Zapata, Marlyn; Kunii, Ilda S; Paninka, Rolf M; Simões, Denise M N; Castillo, Víctor A; Reche, Archivaldo; Maciel, Rui M B; Dias da Silva, Magnus R

    2014-01-01

    Neck ventroflexion in cats has different causes; however, the most common is the hypokalemia associated with flaccid paralysis secondary to chronic renal failure. In humans, the most common causes of acute flaccid paralysis are hypokalemia precipitated by thyrotoxicosis and familial forms linked to mutations in sodium, potassium, and calcium channel genes. Here, we describe the sequencing and analysis of skeletal muscle ion channels in Felis catus that could be related to periodic paralyses in humans, contributing to the understanding of the genetic susceptibility to feline neck ventroflexion and paralysis. We studied genomic DNA from eleven cats, including five animals that were hyperthyroid with hypokalemia, although only one presented with muscle weakness, and six healthy control domestic cats. We identified the ion channel ortholog genes KCNJ2, KCNJ12, KCNJ14, CACNA1S and SCN4A in the Felis catus genome, together with several polymorphic variants. Upon comparative alignment with other genomes, we found that Felis catus provides evidence for a high genomic conservation of ion channel sequences. Although we hypothesized that neck ventroflexion in cats could be associated with a thyrotoxic or familial periodic paralysis channel mutation, we did not identify any previously detected human channel mutation in the hyperthyroid cat presenting hypokalemia. However, based on the small number of affected cats in this study, we cannot yet rule out this molecular mechanism. Notwithstanding, hyperthyroidism should still be considered as a differential diagnosis in hypokalemic feline paralysis. PMID:25063199

  7. Avaliação dos estoques pesqueiros de quatro espécies de grandes bagres (Siluriformes, Pimelodidae na bacia do rio Cuiabá, Pantanal norte, Brasil, utilizando alguns Pontos de Referência Biológicos Fisheries stock assessment of four large catfish (Siluriformes, Pimelodidae in the Cuiaba River basin, north Pantanal, Brazil, using some Biological Reference Points

    Directory of Open Access Journals (Sweden)

    Lúcia A. F. Mateus

    2007-03-01

    Full Text Available Os parâmetros de crescimento e mortalidade estimados a partir da estrutura em comprimento foram utilizados para avaliar o estado de explotação dos estoques de quatro espécies de grandes bagres da bacia do rio Cuiabá, Pantanal norte. As espécies estudadas foram o barbado, o cachara, o jaú e o pintado. As avaliações foram realizadas por meio do modelo de rendimento por recruta, considerando os Pontos de Referência Biológicos Fmax, F0,1, F = M e F BDR. As análises indicam que os estoques do pintado e do jaú estão bem conservados. Os estoques do cachara e, menos fortemente, o do barbado estão em iminente ameaça de sobrepesca na bacia do rio Cuiabá.The growth and mortality parameters estimated from length structure were used to evaluate the state of explotation of the stocks of four large catfish species from Cuiabá River basin, north Pantanal. The species studied were the Flatwhiskered catfish, the Jaú, the Barred sorubim, and the Spotted sorubim. The assessment were conducted with the yield per recruit model, and the Biological Reference Points Fmax, F0.1, F = M, and F BDR. The analysis indicates that the stocks of the Spotted sorubim, and of the Jaú are not overexploited. However, the stocks of the Barred sorubim, and, in lower degree, of the Flatwhiskered catfish of the Cuiabá River basin are in imminent threat of overfishing.

  8. Food habits and temporal activity patterns of the Golden Jackal Canis aureus and the Jungle Cat Felis chaos in Pench Tiger Reserve, Madhya Pradesh

    Directory of Open Access Journals (Sweden)

    A. Majumder

    2011-11-01

    Full Text Available The food habits and temporal activity patterns of the Golden Jackal Canis aureus and the Jungle Cat Felis chaus were studied between January 2008 and June 2009 in Pench Tiger Reserve (PTR, Madhya Pradesh. A total of 50 jackal scats and 85 jungle cat scats were collected where-ever encountered in the study area. Information on activity pattern was obtained using camera traps. Fifty-two pair self-triggered analog cameras were deployed in each 2 x 2 km² across the study area (> 250 km² close to animal trails which were set to work on a continuous 24 hour period. Rodents contributed maximum in the diet of these two species (65% golden jackal scats and 56% jungle cat scats. Eight thousand five hundred and sixty camera-trap nights revealed 189 jungle cat captures and 49 golden jackal captures. The activity of golden jackal had a more homogeneous distribution in time. Present study showed that although some degree of overlap is observed between the two sympatric species, an overall difference in dietary composition and activity patterns enabled them to coexist in PTR.

  9. The glucose and insulin response to isoenergetic reduction of dietary energy sources in a true carnivore: the domestic cat ( Felis catus).

    Science.gov (United States)

    Verbrugghe, Adronie; Hesta, Myriam; Van Weyenberg, Stephanie; Papadopoulos, Georgios A; Gommeren, Kris; Daminet, Sylvie; Bosmans, Tim; Polis, Ingeborgh; Buyse, Johan; Janssens, Geert P J

    2010-07-01

    The present study assessed the effect of separate reduction of each energy-delivering nutrient - protein, fat and carbohydrate - on glucose tolerance and insulin response in a strict carnivore: the domestic cat (Felis catus). Three isoenergetic, home-made diets with the following energetic distribution, low protein (LP): protein 28 % of metabolisable energy; fat 43 %; nitrogen-free extract 29 %; low fat: 47, 27 and 25 %; low carbohydrate (LC): 45, 48 and 7 %, were tested in a 3 x 3 Latin square design. Nine healthy normal-weight cats were randomly assigned to each of the diets in a random order at intervals of 3 weeks. At the end of each testing period, intravenous glucose tolerance tests were performed. Plasma glucose concentrations and area under the glucose curve showed no differences. Area under the insulin curve was lower when cats were fed the LP diet, and the second insulin peak tended to be delayed when the LC diet was fed. In contrast to other studies, in which energy sources were elevated instead of being reduced, the present trial contradicts the often suggested negative impact of carbohydrates on insulin sensitivity in carnivores, and shows that reducing the dietary carbohydrate content below common amounts for commercial foods evokes an insulin-resistant state, which can be explained by the cats' strict carnivorous nature. It even points to a negative effect of protein on insulin sensitivity, a finding that corresponds with the highly gluconeogenic nature of amino acids in strict carnivores. PMID:20193098

  10. Transforming properties of Felis catus papillomavirus type 2 E6 and E7 putative oncogenes in vitro and their transcriptional activity in feline squamous cell carcinoma in vivo.

    Science.gov (United States)

    Altamura, Gennaro; Corteggio, Annunziata; Pacini, Laura; Conte, Andrea; Pierantoni, Giovanna Maria; Tommasino, Massimo; Accardi, Rosita; Borzacchiello, Giuseppe

    2016-09-01

    Felis catus papillomavirus type 2 (FcaPV2) DNA is found in feline cutaneous squamous cell carcinomas (SCCs); however, its biological properties are still uncharacterized. In this study, we successfully expressed FcaPV2 E6 and E7 putative oncogenes in feline epithelial cells and demonstrated that FcaPV2 E6 binds to p53, impairing its protein level. In addition, E6 and E7 inhibited ultraviolet B (UVB)-triggered accumulation of p53, p21 and pro-apoptotic markers such as Cleaved Caspase3, Bax and Bak, suggesting a synergistic action of the virus with UV exposure in tumour pathogenesis. Furthermore, FcaPV2 E7 bound to feline pRb and impaired pRb levels, resulting in upregulation of the downstream pro-proliferative genes Cyclin A and Cdc2. Importantly, we demonstrated mRNA expression of FcaPV2 E2, E6 and E7 in feline SCC samples, strengthening the hypothesis of a causative role in the development of feline SCC. PMID:27236740

  11. Simultaneous two-color lasing in the mid-IR and far-IR region with two undulators and one RF linac at the FELI

    International Nuclear Information System (INIS)

    Simultaneous two-color FEL lasing on the same electron macropulse has been demonstrated at 4.65 and 19.4 μm using a 33 MeV electron beam and two FEL facilities (FEL-1 and FEL-4) of the FELI. The average powers are 11 mW at 4.65 μm and 2 mW at 19.4 μm. Their spectral widths (FWHM) are 0.85% and 1.06%. They are delivered to users through two evacuated optical pipes. FEL-1 achieved lasing in the mid-infrared region with the undulator-1 (UND-1; λu=34 mm, K=0.5-1.5, Nu=34) in 1994 and FEL-4 achieved lasing at far-infrared region with the undulator-4 (UND-4; λu=80 mm, K=1.26-3.37, Nu=30) in 1996. UND-4 is installed at the downstream of the UND-1 and an electron beam is transported through an S-type electron beam transport line including two 45 deg. bending magnets

  12. Reprodução do bagre amarelo, Cathorops spixii (Agassiz (Siluriformes, Ariidae, da Baía de Pinheiros, região estuarina do litoral do Paraná, Brasil Reproduction of the Madamango sea catfish, Cathorops spixii (Agassiz (Siluriformes, Ariidae, of the Pinheiros Bay, estuarine coastal area of Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Luís F. Fávaro

    2005-12-01

    Full Text Available O presente estudo investigou a biologia reprodutiva do bagre amarelo Cathorops spixii (Agassiz, 1829 na Baía de Pinheiros, litoral do Paraná, Brasil. Os peixes foram coletados mensalmente no período de junho de 2003 a maio de 2004, com rede de arrasto de fundo. De cada exemplar foram tomados os dados de comprimento total, peso total, sexo e peso da gônada. As seis fases de desenvolvimento ovocitário (ovogênese e os cinco estádios de desenvolvimento ovariano (escala de maturidade foram determinadas por análises microscópicas dos ovários. Através dos valores individuais e media mensais do Índice gônado-somático (IGS tratado para sexos separados, da freqüência relativa dos estádios de desenvolvimento ovariano e das análises histológicas durante o período de estudo foi possível determinar que o período reprodutivo de C. spixii dá-se entre os meses de setembro e novembro. Fêmeas apresentando ovários desovados ou em recuperação foram registradas nos meses de novembro a abril, com altos percentuais no período de dezembro a março. A desova foi caracterizada como sendo do tipo total.The present study investigated the reproductive biology of Cathorops spixii (Agassiz, 1829 in Pinheiros Bay, littoral of Paraná State, Brazil. Fishes were captured monthly from June 2003 to May 2004 by using bottom trawls. For each individual, total body length, total weight, sex, and gonadal weight were recorded. The oogenesis (six ovarian follicle phases of development and gonadal development stages (five stages were also defined based on the histological examination of the ovaries. It was defined that the reproductive period of C. spixii extends from September to November, based on the analyses of individual gonadosomatic index (GSI values distribution in relation to the sampling periods, on the monthly variation of the GSI mean values (Curve of Maturation, both for males and females, and on the monthly variation of the relative frequencies of

  13. Evaluation and comparison of a flumethrin-imidacloprid collar and repeated monthly treatments of fipronil/(s)-methoprene to control flea, Ctenocephalides f. felis, infestations on cats for eight months

    OpenAIRE

    Dryden, Michael W; Smith, Vicki; Davis, Wendell L; Settje, Terry; Hostetler, Joe

    2016-01-01

    Background This controlled laboratory study was designed to evaluate the efficacy of the 10 % imidacloprid/4.5 % flumethrin collar (Seresto®, Bayer Animal Health) against fleas (Ctenocephalides f. felis) on cats, when compared to fipronil (9.8 %w/w)/(s)-methoprene (11.8 % w/w) topical spot-on formulation (Frontline® Plus for Cats and Kittens, Merial). Methods Thirty cats were randomized into three groups of ten animals based on pre-treatment flea counts: Group 1: imidacloprid/flumethrin colla...

  14. Absence of zoonotic Bartonella species in questing ticks: First detection of Bartonella clarridgeiae and Rickettsia felis in cat fleas in the Netherlands

    Directory of Open Access Journals (Sweden)

    Reimerink Johan R

    2011-04-01

    Full Text Available Abstract Background Awareness for flea- and tick-borne infections has grown in recent years and the range of microorganisms associated with these ectoparasites is rising. Bartonella henselae, the causative agent of Cat Scratch Disease, and other Bartonella species have been reported in fleas and ticks. The role of Ixodes ricinus ticks in the natural cycle of Bartonella spp. and the transmission of these bacteria to humans is unclear. Rickettsia spp. have also been reported from as well ticks as also from fleas. However, to date no flea-borne Rickettsia spp. were reported from the Netherlands. Here, the presence of Bartonellaceae and Rickettsiae in ectoparasites was investigated using molecular detection and identification on part of the gltA- and 16S rRNA-genes. Results The zoonotic Bartonella clarridgeiae and Rickettsia felis were detected for the first time in Dutch cat fleas. B. henselae was found in cat fleas and B. schoenbuchensis in ticks and keds feeding on deer. Two Bartonella species, previously identified in rodents, were found in wild mice and their fleas. However, none of these microorganisms were found in 1719 questing Ixodes ricinus ticks. Notably, the gltA gene amplified from DNA lysates of approximately 10% of the questing nymph and adult ticks was similar to that of an uncultured Bartonella-related species found in other hard tick species. The gltA gene of this Bartonella-related species was also detected in questing larvae for which a 16S rRNA gene PCR also tested positive for "Candidatus Midichloria mitochondrii". The gltA-gene of the Bartonella-related species found in I. ricinus may therefore be from this endosymbiont. Conclusions We conclude that the risk of acquiring Cat Scratch Disease or a related bartonellosis from questing ticks in the Netherlands is negligible. On the other hand fleas and deer keds are probable vectors for associated Bartonella species between animals and might also transmit Bartonella spp. to humans.

  15. Spatio-temporal variation in predation by urban domestic cats (Felis catus and the acceptability of possible management actions in the UK.

    Directory of Open Access Journals (Sweden)

    Rebecca L Thomas

    Full Text Available Urban domestic cat (Felis catus populations can attain exceedingly high densities and are not limited by natural prey availability. This has generated concerns that they may negatively affect prey populations, leading to calls for management. We enlisted cat-owners to record prey returned home to estimate patterns of predation by free-roaming pets in different localities within the town of Reading, UK and questionnaire surveys were used to quantify attitudes to different possible management strategies. Prey return rates were highly variable: only 20% of cats returned ≥4 dead prey annually. Consequently, approximately 65% of owners received no prey in a given season, but this declined to 22% after eight seasons. The estimated mean predation rate was 18.3 prey cat⁻¹ year⁻¹ but this varied markedly both spatially and temporally: per capita predation rates declined with increasing cat density. Comparisons with estimates of the density of six common bird prey species indicated that cats killed numbers equivalent to adult density on c. 39% of occasions. Population modeling studies suggest that such predation rates could significantly reduce the size of local bird populations for common urban species. Conversely, most urban residents did not consider cat predation to be a significant problem. Collar-mounted anti-predation devices were the only management action acceptable to the majority of urban residents (65%, but were less acceptable to cat-owners because of perceived risks to their pets; only 24% of cats were fitted with such devices. Overall, cat predation did appear to be of sufficient magnitude to affect some prey populations, although further investigation of some key aspects of cat predation is warranted. Management of the predation behavior of urban cat populations in the UK is likely to be challenging and achieving this would require considerable engagement with cat owners.

  16. Seroprevalence of Toxoplasma gondii in White-Tailed Deer (Odocoileus virginianus) and Free-Roaming Cats (Felis catus) Across a Suburban to Urban Gradient in Northeastern Ohio.

    Science.gov (United States)

    Ballash, Gregory A; Dubey, J P; Kwok, O C H; Shoben, Abigail B; Robison, Terry L; Kraft, Tom J; Dennis, Patricia M

    2015-06-01

    Felids serve as the definitive host of Toxoplasma gondii contaminating environments with oocysts. White-tailed deer (WTD; Odocoileus virginianus) are used as sentinel species for contaminated environments as well as a potential source for human foodborne infection with T. gondii. Here we determine the seroprevalence of T. gondii in a WTD and felid population, and examine those risk factors that increase exposure to the parasite. Serum samples from 444 WTD and 200 free-roaming cats (Felis catus) from urban and suburban reservations were tested for T. gondii antibodies using the modified agglutination test (MAT, cut-off 1:25). Antibodies to T. gondii were found in 261 (58.8%) of 444 WTD, with 164 (66.1%) of 248 from urban and 97 (49.5%) of 196 from suburban regions. Significant risk factors for seroprevalence included increasing age (P < 0.0001), reservation type (P < 0.0001), and household densities within reservation (P < 0.0001). Antibodies to T. gondii were found in 103 (51.5%) of 200 cats, with seroprevalences of 79 (51%) of 155 and 24 (53.3%) of 45 from areas surrounding urban and suburban reservations, respectively. Seroprevalence did not differ by age, gender, or reservation among the cats' sample. Results indicate WTD are exposed by horizontal transmission, and this occurs more frequently in urban environments. The difference between urban and suburban cat densities is the most likely the reason for an increased seroprevalence in urban WTD. These data have public health implications for individuals living near or visiting urban areas where outdoor cats are abundant as well as those individuals who may consume WTD venison. PMID:25269422

  17. Synthèse et étude structrale de lyonsite-type (Na0,4,Li0,6(Fe,Li2(MoO43

    Directory of Open Access Journals (Sweden)

    Amira Souilem

    2015-06-01

    Full Text Available The new compound (Na0.4,Li0.6(Fe,Li2(MoO43 was synthesized by cooling from the melt. Its anionic framework is built up from two distinct MO6 octahedra, each containing disordered Li+ and Fe3+ ions in 0.6:0.4 and 0.7:0.3 ratios, and two MoO4 tetrahedra, which link by vertex-sharing of their O atoms. These tetrameric units are further linked by sharing edges between octahedra and by formation of M—O—Mo (M = Fe/Li bridges, forming ribbons propagating in the [100] direction. The ribbons are cross-linked in both the b- and c-axis directions, giving rise to a three-dimensional framework having [100] tunnels in which the monovalent Na+/Li+ cations (0.4:0.6 ratio lie. Bond-valence calculations are consistent with the disorder model for the cations. The structure of the title compound, which is isotypic with Li3Fe(MoO43 and Li3Ga(MoO43, is compared briefly with those of LiFeMo2O8 and Li1.6Mn2.2(MoO43.

  18. Synthèse et étude structrale de lyonsite-type (Na0,4,Li0,6)(Fe,Li2)(MoO4)3.

    Science.gov (United States)

    Souilem, Amira; Zid, Mohamed Faouzi; Driss, Ahmed

    2015-06-01

    The new compound (Na0.4,Li0.6)(Fe,Li2)(MoO4)3 was synthesized by cooling from the melt. Its anionic framework is built up from two distinct MO6 octa-hedra, each containing disordered Li(+) and Fe(3+) ions in 0.6:0.4 and 0.7:0.3 ratios, and two MoO4 tetra-hedra, which link by vertex-sharing of their O atoms. These tetra-meric units are further linked by sharing edges between octa-hedra and by formation of M-O-Mo (M = Fe/Li) bridges, forming ribbons propagating in the [100] direction. The ribbons are cross-linked in both the b- and c-axis directions, giving rise to a three-dimensional framework having [100] tunnels in which the monovalent Na(+)/Li(+) cations (0.4:0.6 ratio) lie. Bond-valence calculations are consistent with the disorder model for the cations. The structure of the title compound, which is isotypic with Li3Fe(MoO4)3 and Li3Ga(MoO4)3, is compared briefly with those of LiFeMo2O8 and Li1.6Mn2.2(MoO4)3. PMID:26090130

  19. Dietary canitine maintains energy reserves and delays fatigue of exercised african catfish (Clarias gariepinus fed high fat diets Carnitina dietética mantem reservas energéticas e evita a fatiga de bagre-africano durante exercício

    Directory of Open Access Journals (Sweden)

    Rodrigo Ozório

    2005-06-01

    Full Text Available Lipids, together with proteins, are traditionally considered as primary fuels during aerobic swimming. The effects of dietary fat and carnitine supplements and exercise on the energy metabolism of juvenile fish were investigated. One hundred African catfish (Clarias gariepinus were fed four isonitrogenous diets containing a fat level of 100 or 190 g kg-1 diet and one of the two levels of carnitine (15 and 1000 mg kg-1. Fish grew from 61 to 162 g in 10 wk. Thereafter, 6 fish per group swam vigorously for 3 h and the results were compared with unexercised groups. Fish receiving 1,000 mg carnitine accumulated 2- to 3-fold more carnitine than fish receiving 15 mg carnitine. Plasma acyl-carnitine level was affected by an interaction between dietary treatment and exercise (P Lipídios e proteínas são tradicionalmente considerados combustíveis primários durante natação aeróbica. Nesse ensaio foi investigado o efeito da suplementação de vários níveis de gordura e carnitina no metabolismo de 100 bagres africanos juvenis (Clarias gariepinus. Os peixes foram arraçoados com quatro dietas isoprotéicas, cada uma contendo 100 ou 190 g gordura kg-1 dieta, e um dos dois níveis de carnitina (15 e 1000 mg kg-1. Os peixes cresceram de 61 a 162 g em 10 semanas. No final do ensaio de alimentação, grupos de seis peixes por tratamento foram induzidos a nadar vigorosamente por 3 h e em seguida vários parâmetros foram determinados no tecido muscular e plasma, e os resultados observados nos grupos exercitados foram comparados com grupos controles (não exercitados. Os peixes arraçoados com 1,000 mg carnitina acumularam de duas a três vezes mais carnitina que os peixes arraçoados com 15 mg carnitina. O nível de acyl-carnitina no plasma foi influenciado pela interação entre os tratamentos dietéticos e exercício físico (P < 0.05. As concentrações de adenosina trifosfato (ATP e fosfocreatina no tecido muscular branco (WM foram mais elevadas em

  20. The biological and reproductive parameters of the invasive armored catfish Pterygoplichthys disjunctivus from Adolfo López Mateos El Infiernillo Reservoir, Michoacán-Guerrero, Mexico Parámetros biológicos y reproductivos del bagre armado invasivo Pterygoplichthys disjunctivus del embalse Adolfo López Mateos El Infiernillo, Michoacán-Guerrero, México

    Directory of Open Access Journals (Sweden)

    Rebeca Aneli Rueda-Jasso

    2013-03-01

    Full Text Available Invasive Pterygoplichthys disjunctivus (Weber, 1991 (synonymy: Liposarcus multiradiatus armored catfish were first reported in Mexico in 1995 and have spread successfully in several aquatic ecosystems. In Adolfo López Mateos El Infiernillo Reservoir, Michoacán - Guerrero, the population of this armored catfish is growing substantially because natural predators are not present and exploitation by humans does not occur. Over a complete annual cycle, we studied the following population parameters: weight, total and standard length, the relationship of weight to total length, the hepatosomatic (HSI and gonadosomatic (GSI indices, total fecundity (TF and relative fecundity (RF. The average total (TL and standard lengths (SL were 248 ± 37.5 and 188 ± 30.7 mm, respectively, and the average weight (W was 135.3± 66.8 g. The largest fish reported was 520 mm in TL and weighed 1 280 g. The species showed an extended reproductive season from May to November, as indicated by the GSI, TF and RF. The strongest reproductive peak occurred from July through October. During the annual cycle, the highest monthly average fecundity was 2 447 eggs, and the average relative fecundity was 12.6 eggs per g of fish (August and September. This information will be crucial for calculating the current biomass and future growth of the population. The calculation of these results could provide a basis for the exploitation of this resource for human consumption and animal feeds.La especie invasiva "bagre armado" P. disjunctivus (Weber 1991 (sinonimia de Liposarcus multuradiatus fue registrada por primera vez en México en 1995; en diversos sistemas acuáticos se ha distribuido exitosamente. En la presa Adolfo López Mateos El Infiernillo, Michoacán - Guerrero, la población de peces armados se ha incrementado considerablemente debido a la ausencia de depredadores y la falta de aprovechamiento. Por ello, a lo largo de un ciclo anual evaluamos los siguientes par

  1. Sanitary conditions of a colony of urban feral cats (Felis catus Linnaeus, 1758 in a zoological garden of Rio de Janeiro, Brazil Condições sanitárias de uma colônia urbana de gatos (Felis catus Linnaeus, 1758 em um jardim zoológico do Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Flavya Mendes-de-Almeida

    2004-10-01

    Full Text Available The colony of urban stray cats living in the Rio de Janeiro zoological garden was studied in order to develop a population and health control program. As many cats as possible were captured during two months (47 animals and were classified according to gender, age, weight and coat markings. They were submitted to a general health evaluation, examined for the presence of ectoparasites and sent to a surgical neutering program. All animals had a blood sample drawn for CBC, platelet count, heartworm and retroviruses detection. Capillary blood smears were made for hemoparasites detection. Coat marking and colors were tabby (59.7%, followed by solid black (17%; torbie (10.6%; bicolor (10.6% and harlequin (2.1%. The only ectoparasites found were fleas, which infested 28% of the animals. The hemoparasites found were Haemobartonella felis (38% and piroplasmas that could not be differentiated between Cytauxzoon spp. and Babesia spp. (47%. No cat was found infected by Dirofilaria immitis or FeLV (Feline Leukemia Virus, although FIV (Feline Immunodeficiency Virus antibodies could be detected (21%. There was no correlation between hemoparasites and FIV infections. The estimated total cat population (mark-recapture method was 59; 68% female and 32% male, suggesting that a neutering program is in fact needed.As condições sanitárias e composição populacional de uma colônia de gatos urbanos, errantes, habitantes do zoológico do Rio de Janeiro foram estudadas, objetivando-se um programa de controle populacional e sanitário. Capturou-se o maior número de indivíduos possível durante dois meses (47 animais. Os animais capturados foram examinados quanto ao gênero, idade, peso, pelagem, inspeção geral e presença de ectoparasitas e eram encaminhados a um programa de esterilização cirúrgica. Cada animal teve uma amostra de sangue colhida para realização de hemograma completo, plaquetometria, pesquisa de hemoparasitas e de retrovírus. As marca

  2. Spotlight census of the red fox (Vulpes vulpes and the domestic cat (Felis catus in three sample areas of the Marches region (Central Italy / Censimento notturno di Volpe (Vulpes vulpes e di Gatto domestico (Felis catus in tre aree campione delle Marche

    Directory of Open Access Journals (Sweden)

    Massimo Pandolfi

    1991-07-01

    Full Text Available Abstract In order to evaluate the density of the red fox and of the domestic cat, 55 transects were made from 1986 to 1989 using spotlight census method in three sample areas. The mean density of foxes agreed substantially with its biological cycle and the hightes values (2.01 foxes/km² in spring and 4.3 foxes/km² in winter were recorded in the study area with the better natural characteristics. Foxes selected the shrub woodland (macchia all year round, the inhabited area in spring. The domestic cat was widely spread and abundant, and selected especially inhabited areas where the density varied from 4.27 cats/km² (in winter to 12.42 cat/km² (in spring. Riassunto Dal 1986 al 1989, con il metodo dei percorsi notturni con fari, sono stati effettuati complessivamente 55 conteggi in tre aree campione per valutare la densità della Volpe (Vulpes vulpes e del Gatto domestico (Felis catus nonché le loro preferenze ambientali limitatamente ad una zona campione. Per la Volpe le densità medie rilevate sono sostanzialmente in accordo con il ciclo biologico della specie e quelle più elevate (2,O1 volpi/km² in primavera e 4,3 volpi/km² in inverno sono state registrate nella zona campione con maggior presenza di boschi ed aree incolte. La Volpe seleziona le zone con vegetazione "di macchia" in ogni periodo dell'anno, e le aree abitate in primavera. Per il Gatto domestico le densità rilevate evidenziano la presenza di una diffusa ed abbondante popolazione. La specie mostra una spiccata preferenza per le aree abitate dove raggiunge densità di 4,27 individui/km² e 12,42 individui/km² in inverno e primavera rispettivamente.

  3. Feeding habits of Barbul de piedra (ariopsis sp.) in the Sinu River, Colombia

    International Nuclear Information System (INIS)

    The feeding habits of Barbul de piedra in the Sinu River were studied. the stomach content was analyzed using the proportion of empty stomachs, grade of digestion, frequency of occurrence, numerical frequency, gravimetry, relative importance index and the gut length total length relationship. Only 18.8% of stomachs were empty, most of preys were half digested and five food groups were identified: crustaceans, fishes, vegetable rests, molluscs and others. Crustaceans were the most frequent, abundant and greater weight composition group. The relative importance index indicated that crustaceans and fishes were secondary relative importance groups and vegetable rests, molluscs and others were occasional or circumstantial groups. The results achieved in this work indicate that Barbul de piedra is a fish that keeps your feeding habits as they grow and along the hydrological cycle, although shows carnivorous preference, especially by crustaceans.

  4. Mitogenic activity of fetal bovine serum, fish fry extract, insulin-like growth factor-I, and fibroblast growth factor on brown bullhead catfish cells - BB line Atividade mitogênica do soro fetal bovino, extrato de larvas de peixe, fator insulínico de crescimento-I e fator de crescimento de fibroblastos na linhagem celular BB do bagre "brown bullhead"

    Directory of Open Access Journals (Sweden)

    J. E. P. CYRINO

    1999-08-01

    Full Text Available Biossays were performed to assess the effects of different levels of growth medium supplementation with fetal bovine serum (FBS, fish fry extract (FE, combinations of FBS and FE, and addition of insulin-like growth factor I (IGF-I and fibroblast growth factor (FGF on the proliferation of brown bullhead catfish cells (BB line. Treatments (n = 4 were: 2.5, 5, 10, and 15.0% FBS or FE and 5/2.5, 5/5, 10/2.5, and 10/5 of a FBS/FE combination as supplement to the growth medium, or the addition of 0.1, 1, 2.5, 10, 25, and 75 ng/ml of either IGF-I or FGF to the growth media. Initial cell density was 1.1 x 10(6 cells per well on uncoated 24-well plates. Incubation temperature was 29.5 ± 0.7ºC. Six hours after plating, initial culture medium was removed, plates rinsed with Dulbecco’s phosphate buffered saline, treatment media added, and cells allowed to proliferate for 24 hours. Another bioassay was performed with rat myoblast omega cells (RMo using the same levels of growth medium supplemented with FBS, FE and FBS/FE. Base growth medium was Dulbecco’s MEM. The initial cell density was 7.2 x 10(6 cells per well, and the bioassay was carried out at 36.0 ± 0.5ºC, on a 95% air, 5% CO2 incubator. Increasing levels of FBS had a positive effect (P Foram avaliados os efeitos de diferentes níveis de suplementação do meio de cultivo com soro fetal bovino (FBS, extrato de larvas de peixe (FE, combinações de FBS e FE e adição de fator de crescimento semelhante à insulina I (IGF-I e fator de crescimento fibroblástico (FGF, na proliferação da linhagem de células somáticas do bagre "brown bullhead" (BB. Os tratamentos (n = 4 utilizados foram: suplementação do meio de cultivo com 2,5, 5, 10% e 15% FBS ou FE, ou 5/2,5, 5/5, 10/2,5 e 10/5 da combinação FBS/FE ou, ainda, a adição de 0,1, 1, 2,5, 10, 25 e 75 ng/ml de IGF-I ou FGF ao meio de cultivo. Foi utilizada uma densidade inicial de 1,1 x 10(6 células/câmara, em placas não recobertas de 24

  5. Comparative efficacy on dogs of a single topical treatment with fipronil/(S-methoprene or weekly physiological hygiene shampoos against Ctenocephalides felis in a simulated flea-infested environment

    Directory of Open Access Journals (Sweden)

    Beugnet F.

    2012-05-01

    Full Text Available Flea infestations of pets continue to persist due to the lack of knowledge of flea biology and ecology. It is not unusual that pet owners believe regular hygiene, such as shampooing their dogs can replace regular insecticidal treatment. The objective of this study was to compare in a flea simulated environment, modelling exposure similar to that found in a home, that the use of regular physiological shampoo does not control fleas adequately when compared to a long acting topical formulation. Three groups of six dogs were formed: one untreated control group, one group treated monthly with the topical formulation of fipronil/(S-methoprene, and a third group treated weekly with a hygiene shampoo. All dogs were infested with adult unfed Ctenocephalides felis fleas (200 ± 5 on Days -28 and -21. Each animal’s sleeping box was fitted with a plastic cup mounted to the inside roof of the box. The sleeping bench of each animal was covered with a carpet to accommodate flea development. The dogs were maintained in their kennels throughout the study. In order to maintain the environmental flea challenge, C. felis pupae (100 ± 5 were placed in the plastic cup in each animal’s sleeping box on Days -14, -7, 0, 7, 14, 21, 28, 35 and 42. The dogs were combed and fleas counted weekly on Days -1, 3, 10, 17, 24, 31, 38, 45, and 51. The fleas were placed immediately back on the dogs. On Day 60, fleas were counted and removed. Flea infestations in the untreated control group at each count averaged between 46.2 and 74.2 fleas throughout the study. The average number of fleas infesting dogs was significantly different (p < 0.05 between the untreated and the two treatment groups and between the two treatment groups at all counts throughout the two months study (Days 3, 10, 17, 24, 31, 38, 45, 51 and 60. The efficacy was never below 99.1% in the fipronil/(S-methoprene group, and efficacy in the shampoo group was never above 79.2%. Weekly shampooing in treatment

  6. Analysis of single-nucleotide polymorphisms in the APOBEC3H gene of domestic cats (Felis catus) and their association with the susceptibility to feline immunodeficiency virus and feline leukemia virus infections.

    Science.gov (United States)

    de Castro, Fernanda Luz; Junqueira, Dennis Maletich; de Medeiros, Rúbia Marília; da Silva, Tailene Rabello; Costenaro, Jamile Girardi; Knak, Marcus Braga; de Matos Almeida, Sabrina Esteves; Campos, Fabrício Souza; Roehe, Paulo Michel; Franco, Ana Cláudia

    2014-10-01

    Feline immunodeficiency virus (FIV) and feline leukemia virus (FeLV) are widely distributed retroviruses that infect domestic cats (Felis catus). Restriction factors are proteins that have the ability to hamper retroviruses' replication and are part of the conserved mechanisms of anti-viral immunity of mammals. The APOBEC3 protein family is the most studied class of restriction factors; they are cytidine deaminases that generate hypermutations in provirus DNA during reverse transcription, thus causing hypermutations in the viral genome, hindering virus replication. One of the feline APOBEC3 genes, named APOBEC3H, encodes two proteins (APOBEC3H and APOBEC3CH). In other mammals, APOBEC3H single-nucleotide polymorphisms (SNPs) can alter the stability and cellular localization of the encoded protein, thus influencing its subcellular localization and reducing its anti-viral effect. In cats, the association of APOBEC3H SNPs with susceptibility to retroviral infections was not yet demonstrated. Therefore, this study aimed the investigation on the variability of APOBEC3H and the possible association with FIV/FeLV infections. DNA obtained from whole blood of fifty FIV- and/or FeLV-infected cats and fifty-nine FIV- and/or FeLV-uninfected cats were used as templates to amplify two different regions of the APOBEC3H, with subsequent sequencing and analysis. The first region was highly conserved among all samples, while in the second, six single-nucleotide variation points were identified. One of the SNPs, A65S (A65I), was significantly correlated with the susceptibility to FIV and/or FeLV infections. On the other hand, the haplotype analysis showed that the combination "GGGGCC" was positively correlated with the lack of FIV and/or FeLV infections. Our results indicate that, as previously shown in other mammals, variability of restriction factors may contribute to susceptibility of domestic cats to retroviral infections; however, these results should be confirmed by more

  7. Toxoplasmosis in Sand cats (Felis margarita) and other animals in the Breeding Centre for Endangered Arabian Wildlife in the United Arab Emirates and Al Wabra Wildlife Preservation, the State of Qatar.

    Science.gov (United States)

    Dubey, J P; Pas, An; Rajendran, C; Kwok, O C H; Ferreira, L R; Martins, J; Hebel, C; Hammer, S; Su, C

    2010-09-20

    The Sand cat (Felis margarita) is a small-sized felid found in sand and stone deserts ranging from the north of Africa to Asia, with the Arabian Peninsula as its centre of distribution. The Sand cat captive breeding program at the Breeding Centre for Endangered Arabian Wildlife (BCEAW), Sharjah, UAE, has experienced high newborn mortality rates, and congenital toxoplasmosis was recently recognized as one of the causes of this mortality. In the present study, one 18-month-old Sand cat (FM019) died of acute toxoplasmosis-associated hepatitis and pneumonitis acquired after birth; Toxoplasma gondii was demonstrated in histological sections which reacted with T. gondii polyclonal antibodies by immunohistochemistry (IHC). T. gondii DNA was found by PCR of extracted DNA from liver and lung tissues of this cat. Antibodies to T. gondii were found in serum examined in 1:1600 dilution in the modified agglutination test (MAT); its 2-year-old cage mate seroconverted (MAT titer 1:3200) at the same time. Another Sand cat (FM017) was euthanized because of ill health when 3 years old; its MAT titer was >1:3200, and T. gondii tissue cysts were found in brain, heart, ocular muscles and skeletal muscle, confirmed by IHC. Viable T. gondii was isolated by bioassays in mice inoculated with tissues of another chronically infected Sand cat (FM002); T. gondii was not found in histological sections of this cat. T. gondii antibodies were found in several species of animals tested, notably in 49 of 57 wild felids at BCEAW. A 7-year-old Sand cat (3657) from Al Wabra Wildlife Preservation (AWWP), Doha, State of Qatar died of acute visceral toxoplasmosis with demonstrable T. gondii tachyzoites by IHC, and T. gondii DNA by PCR, and a MAT titer of >3200. T. gondii antibodies were found in 21 of 27 of wild felids at AWWP. PCR-RFLP genotyping at 10 genetic loci revealed that these T. gondii isolates from Sand cat (FM002 and FM019) at BCEAW have an atypical genotype, which was previously reported in T

  8. Folliculogenesis in the domestic cat (Felis catus).

    Science.gov (United States)

    Bristol-Gould, Sarah; Woodruff, Teresa K

    2006-07-01

    The dynamic regulation of mammalian folliculogenesis is a key component of the reproductive process. Traditionally, the rodent had been used as a model to study ovarian function and reproductive physiology due to the availability of animals, their relatively short cycle length, high rate of fecundity and short generation interval. We maintain that much basic information can be determined using domestic cat ovaries retrieved from local veterinary clinics following routine spaying, without having the expense of maintaining a colony of laboratory cats. Studies of normal feline reproductive physiology and advances in reproductive technology may be extrapolated for use in endangered non-domestic felids. Increased understanding of feline reproduction will be beneficial to veterinary medicine, and to groups working to control feral cat populations. It is important to examine reproductive mechanisms in alternative animal models as there are a vast number of threatened and endangered species in which we lack the critical reproductive information needed to assist in preserving their long-term survival. PMID:16620931

  9. Estudo microscópico e macroscópico, com enfoque radiográfico e de alizarina, no desenvolvimento embrionário e fetal de gatos domésticos (Felis catus em diferentes idades gestacionais

    Directory of Open Access Journals (Sweden)

    Dilayla K Abreu

    2011-12-01

    Full Text Available O gato doméstico (Felis catus foi nomeado por Carolus Linnaeus em seu livro Systema Naturae, em 1798. A família Felidea apresenta muita semelhança morfológica com os felinos selvagens. O estudo da embriologia do gato doméstico é de grande valia, uma vez que, é considerado um importante modelo animal quando comparado aos gatos selvagem em extinção, especialmente relacionado às pesquisas sobre biologia reprodutiva. Este trabalho objetivou análisar e comparar as fases embrionárias de quatro embriões e um feto de felinos domésticos. Nos embriões com idade gestacional estimada em 17 dias (0,5cm CR podemos observar pela análise macroscópica a presença de dilatação rostral correspondente ao prosencéfalo, o local placóide do cristalino, a flexura cervical, os quatro arcos faríngeos com os sulcos que o dividem, a proeminência cardíaca, o indício do brotamento do membro pélvico, além da presença de somitos. Na região caudal do embrião, visualizamos a curvatura cranio-caudal, permitindo ao mesmo uma posição em formato de "C". Nos embriões com idade gestacional estimada em 22 dias (1,2cm CR, na análise macroscópica foi visualizado o prosencéfalo, vesícula óptica com pigmentação da retina, vesícula ótica, quarto ventrículo, fígado, membros torácicos e pélvicos com discreta distinção dos dígitos e vascularização superficial. Nos embriões com idade gestacional estimada em 25 dias (1,5cm CR notamos a presença do prosencéfalo e mesencéfalo, a curvatura cervical pronunciada, vesícula óptica com forte pigmentação da retina, vesícula ótica, membros pélvicos e torácicos bem desenvolvidos, com distinção dos dígitos e fígado bem pronunciado. Os fetos com idade gestacional estimada em 52 dias (10cm CR possuem estruturas internas e externas facilmente identificadas em animais adultos. Com relação às estruturas ósseas notamos que as mesmas não apresentam nenhuma epífise óssea formada, sendo vis

  10. Assessing Introgression betweenEuropean Wildcats (Felis silvestris silvestris) and Domestic Cats (Felis silvestris catus)

    OpenAIRE

    Nussberger, Beatrice

    2013-01-01

    Introgression is an important issue in evolutionarybiology. It is defined as the flow of genes between taxa through hybridization beyond the first generation. Introduced genes of a closely related taxon may serve as raw material for rapid adaptive evolutionary change. On the other hand, introgression could lead to reduced fitness in hybrids, i.e. outbreeding depression, if the newly mixed traits are maladapted to the environment or if, on the genomiclevel, co-adapted gene complexes are di...

  11. Annotated features of domestic cat ??? Felis catus genome

    OpenAIRE

    Tamazian, Gaik; Simonov, Serguei; Dobrynin, Pavel; Makunin, Alexey; Logachev, Anton; Komissarov, Aleksey; Shevchenko, Andrey; Brukhin, Vladimir; Cherkasov, Nikolay; Svitin, Anton; Goldman, David B. (David Benjamin); Antunes, Agostinho; Quilez, Javier; Lorente-Gald??s, Bel??n, 1981-; Alkan, Can

    2014-01-01

    Background. Domestic cats enjoy an extensive veterinary medical surveillance which has described nearly 250 genetic diseases analogous to human disorders. Feline infectious agents offer powerful natural models of deadly human diseases, which include feline immunodeficiency virus, feline sarcoma virus and feline leukemia virus. A rich veterinary literature of feline disease pathogenesis and the demonstration of a highly conserved ancestral mammal genome organization make the cat genome annotat...

  12. Adiponectin mRNA Expression in the Cat (Felis domesticus

    Directory of Open Access Journals (Sweden)

    Angela L. Lusby

    2010-01-01

    Full Text Available Problem statement: Adiponectin is a hormone expressed from adipose tissue in people, rodents and dogs. Adiponectin has anti-inflammatory action with beneficial effects on cardiovascular health and insulin sensitivity. With increasing fat mass, adiponectin concentrations paradoxically decrease. Adiponectin’s role in metabolism and diabetes mellitus is of interest in feline medicine because cats are susceptible to developing type II diabetes with weight gain. This study determined relative amounts of adiponectin mRNA expression from various body tissues and organs in domestic cats. Approach: Two intact male cats and one intact female cat were evaluated post-mortem. All cats were estimated to be young adults and had lean body conditions. Tissues samples from inguinal subcutaneous adipose, visceral mesenteric adipose, liver, skeletal muscle, cardiac muscle, aorta, stomach fundus, duodenum, pancreas, thyroid gland, adrenal gland (cortex and medulla and renal cortex were collected and frozen. Following RNA extraction, adiponectin mRNA expression of each tissue was detected using Reverse Transcriptase (RT real-time (Q PCR. Results: Visceral adipose tissue had the highest level of expression, averaging 12% higher than subcutaneous adipose. All other tissues had negligible levels of expression compared to adipose samples. Conclusion: This study provided a valuable step for adiponectin research in cats by determining which tissues express this hormone. Cats differ from human beings by expressing higher levels of adiponectin in visceral compared to subcutaneous fat. The metabolic impact of this expression pattern is not known and provides a basis for future research.

  13. Pseudocapillaria yucatanensis sp. n. (Nematoda: Capillariidae) from the bagre Rhamdia guatemalensis (Pisces) from cenotes in Yucatan, Mexico.

    Science.gov (United States)

    Moravec, F; Scholz, T; Vivas Rodríguez, C

    1995-01-01

    A new nematode species, Pseudocapillaria yucatanensis sp. n., is described from the intestine of the freshwater pimelodid catfish Rhamdia guatemalensis (Günther) from cenotes (= sinkholes) in Yucatan, Mexico. It differs from other three related species parasitizing freshwater fishes mainly in possessing the spicule with a simple rim of its proximal end and a non-expanded distal end, in the length of the spicule (0.218-0.295 mm), and the size (0.050-0.060 x 0.025-0.030 mm), shape and structure of eggs, and also in the host types and geographical distribution. Pseudocapillaria yucatanensis is the first known autochtonous species of Pseudocapillaria parasitizing freshwater fishes in Mexico. PMID:9599428

  14. Aspectos biometricos del bagre Arius Furthii Steindachner (Pisces Ariidae, colectado en punta Morales, Golfo de Nicoya, Costa Rica

    Directory of Open Access Journals (Sweden)

    Maurizio Protti Quesada

    2016-03-01

    Full Text Available Se analizan estadísticamente algunos parámetros biométricos de 257 ejemplares de Arius furthii (Ariidae, colectados en una zona de playa y otra de manglar en Punta Morales, Puntarenas, Costa Rica. Las colectas se realizaron por medio de “arrastres” con una red tipo “chinchorro”. La talla de los especímenes capturados osciló entre 55 y 276 mm de longitud total y 1,3 a 176 g en peso fresco. El análisis estadístico mostró que la longitud total es la mejor variable para la estimación del peso fresco a través de una ecuación de regresión logarítmica.  Además, se mostró que no existen diferencias significativas en el peso de los Arius furthii colectados en la playa y los colectados en el manglar.

  15. Aspectos biometricos del bagre Arius Furthii Steindachner (Pisces Ariidae), colectado en punta Morales, Golfo de Nicoya, Costa Rica

    OpenAIRE

    Maurizio Protti Quesada

    2016-01-01

    Se analizan estadísticamente algunos parámetros biométricos de 257 ejemplares de Arius furthii (Ariidae), colectados en una zona de playa y otra de manglar en Punta Morales, Puntarenas, Costa Rica. Las colectas se realizaron por medio de “arrastres” con una red tipo “chinchorro”. La talla de los especímenes capturados osciló entre 55 y 276 mm de longitud total y 1,3 a 176 g en peso fresco. El análisis estadístico mostró que la longitud total es la mejor variable para l...

  16. Spatial variability of primary organic sources regulates ichthyofauna distribution despite seasonal influence in Terminos lagoon and continental shelf of Campeche, Mexico

    Science.gov (United States)

    Romo Rios, J. A.; Aguíñiga-García, S.; Sanchez, A.; Zetina-Rejón, M.; Arreguín-Sánchez, F.; Tripp-Valdéz, A.; Galeana-Cortazár, A.

    2013-05-01

    Human activities have strong impacts on coastal ecosystems functioning through their effect on primary organic sources distributions and resulting biodiversity. Hence, it appears to be of utmost importance to quantify contribution of primary producers to sediment organic matter (SOM) spatial variability and its associated ichthyofauna. The Terminos lagoon (Gulf of Mexico) is a tropical estuary severely impacted by human activities even though of primary concern for its biodiversity, its habitats, and its resource supply. Stable isotope data (d13C, d15N) from mangrove, seaweed, seagrass, phytoplankton, ichthyofauna and SOM were sampled in four zones of the lagoon and the continental shelf through windy (November to February), dry (March to June) and rainy (July to October) seasons. Stable Isotope Analysis in R (SIAR) mixing model were used to determine relative contributions of the autotrophic sources to the ichthyofauna and SOM. Analysis of variance of ichthyofauna isotopic values showed significant differences (P seaweed (41%) contributions to the adjacent continental shelf ichthyofauna were the main organic sources, there was 37% mangrove contribution to SOM, demonstrating conspicuous terrigenous influence from lagoon ecosystem. Our results point toward organic sources spatial variations that regulate fish distribution. In Terminos lagoon, significant correlation (p-value = 0.2141 and r=0.79) of Ariopsis felis and Sphoeroides testudineus abundances and seaweed and seagrasses contributions (30-35%) during both dry and rainy seasons, evidence that spatial variability organic sources could be central for the state of equilibrium of ecosystems. Keywords: sediment organic matter, mangrove, ecosystems, mixing model, trophic structure

  17. Revision of the amphiamerican Neotetraonchus BravoHollis,1968(Monogenoidea:Dactylogyridae),with a description of N. vegrandis n. sp from the gill lamellae of the blue sea catfish Ariopsis guatemalensis(Siluriformes:Ariidae)off the Pacific Coast of Mexico

    Czech Academy of Sciences Publication Activity Database

    Kritsky, D. C.; Mendoza-Franco, Edgar F.; Bullard, S. A.; Vidal-Martínez, V. M.

    2009-01-01

    Roč. 74, č. 1 (2009), s. 1-15. ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Monogenea * Dactylogyridae * catfishes * morphology * morphology * Pacific Ocean * Panama Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009

  18. Integrated morphological and molecular identification of cat fleas (Ctenocephalides felis) and dog fleas (Ctenocephalides canis) vectoring Rickettsia felis in central Europe

    Czech Academy of Sciences Publication Activity Database

    Lawrence, A.L.; Hii, S.-F.; Jirsová, D.; Panáková, L.; Ionică, A.M.; Gilchrist, K.; Modrý, David; Mihalca, A. D.; Webb, C.E.; Traub, R.J.; Šlapeta, J.

    2015-01-01

    Roč. 210, 3-4 (2015), s. 215-223. ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Arthropod * Siphonaptera * Zoonosis * Bartonella * Taxonomy * cox1 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.460, year: 2014

  19. Isolation and genetic characterization of Toxoplasma gondii from black bears (Ursus americanus), bobcats (Felis rufus), and feral cats (Felis catus) from Pennsylvania

    Science.gov (United States)

    Toxoplasma gondii infects virtually all warm-blooded hosts worldwide. Recently, attention has been focused on the genetic diversity of the parasite to explain its pathogenicity in different hosts. It has been hypothesized that interaction between feral and domestic cycles of T. gondii may increase u...

  20. Biología de la gestación en la gata doméstica (Felis catus Biology of pregnancy in the domestic cat (Felis catus

    Directory of Open Access Journals (Sweden)

    A.E SANCHEZ

    2002-01-01

    Full Text Available La gata es una hembra poliéstrica estacional en la cual el estímulo coital desencadena la liberación de LH y la ovulación, fenómenos que ocurren dentro de las primeras 50 horas postcoito. La fecundación de los ovocitos ocurre en el oviducto dentro de 30 horas post-ovulación. El transporte embrionario en oviducto toma alrededor de 132 horas y al momento de ingresar al útero los embriones se encuentran al estado de mórula compacta. A continuación los blastocistos migran entre los cuernos uterinos por aproximadamente 80 horas, hasta producirse la implantación 12 a 13 días post-coito. Durante la etapa preimplantacional existe un aumento significativo de la progesterona sérica así como de los receptores luteales a LH. A partir de la segunda mitad de la gestación, decae la producción de progesterona y aumenta la secreción de prolactina, postulándose que esta última sería el principal agente luteotrófico en la gata. También durante la segunda mitad de la gestación aumenta la secreción de relaxina. La producción y rol de la progesterona en la gestación tardía es un tema controversial. Se ha demostrado que la placenta felina posee actividad esteroidogénica y capacidad de sintetizar progesterona, lo cual sugiere que estaría relacionada con el soporte hormonal de la preñezThe domestic cat can be defined as a seasonal poliestrous female. During mating the physical stimulus produce the release of LH and ovulation, which occur during the first 50 hours post mating. The fertilization of oocytes takes place inside the oviduct during the 30 hours post ovulation. The embryos transport on the oviduct takes about 132 hours and when embryos reach the uterus they are already a compacted morulae. After this, the blastocyst migrates to both uterine horns for a period of 80 hours aproximately until implantation ocurrs 12 to 13 days after mating. During the preimplantation period, there is a significant increase in blood progesterone and also in LH lutheal receptors. From the second half of gestation, the production of progesterone decrease and prolactin secretion increase. Thus it is thought that the later would be the main luteotrophic agent in the cat. Also during the second half of gestation the secretion of relaxin increase. The production and function of progesterone during late gestation is controversial. It has been shown that placenta of cats has a steroidogenic function and that it is also to produce progesterone

  1. Esporotricose do gato doméstico (Felis catus: transmissão humana Sporothricosis of the domestic cat (Felis catus: human transmission

    Directory of Open Access Journals (Sweden)

    Silvio Alencar Marques

    1993-08-01

    Full Text Available No presente trabalho relata-se caso de paciente, funcionário de hospital veterinário, infectado através de arranhadura de gato doméstico portador de esporotricose. Inquérito domiciliar junto aos proprietários do animal fonte de infecção, revelou dois outros casos presuntivos de esporotricose humana transmitida por gatos, e confirmou o diagnóstico, por cultivo do Sporotrix schenckii, em 3 gatos domésticos adicionais. A esporotricose felina caracteriza-se por lesões cutâneas ulceradas e tendência à disseminação sistêmica e evolução fatal. A transmissão intra e inter-espécie é facilitada pela exuberância de fungos nas lesões cutâneas de felinos infectados.A case of sporothricosis transmitted by cat to a veterinarian hospital employee is reported. Inquiry at domiciliar area of the cat's owner revelled two other presumable cases of human sporothricosis transmitted by cats, and confirmed the diagnosis (by culture of Sporothrix schenckii of disease in three other domestic cats. Feline sporothricosis is characterized by ulcerative, cutaneous lesions and systemic dissemination, which invariably cause animal's death. The transmission of sporothricosis to other animals and humans is enhanced by the great amount of fungus present in cat's lesions.

  2. PRODUCCION DE UN ENSILADO BIOLOGICO A PARTIR DE VISCERAS DE PESCADO DE LAS ESPECIES Prochilodus mariae (coporo), Pseudoplatystoma fasciatum (bagre rayado) y Phractocephalus hemiliopterus (cajaro)

    OpenAIRE

    Martínez Prada, Renson Jesús

    2003-01-01

    La producción pesquera del país en aguas continentales y marinas es de aproximadamente 178.797 ton y genera un volumen de residuos considerable, principalmente contenido visceral. Actualmente estos residuos no están siendo utilizados adecuadamente y están siendo dispuestos en forma directa sobre las fuentes de agua. El contenido de proteína y grasa de los residuos puede representar un potencial de daño a las fuentes hídricas reflejado en el aumento de la carga orgánica y la disminución del ox...

  3. Computed tomography (CT) of the granial mediastinum in the cat (Felis silverstris F. domestica)

    International Nuclear Information System (INIS)

    14 mature clinically healthy domestic cats were studied using contrast computed tomography. Tomographic slices were made transversally across second (Th2) and third (Th3) thoracic vertebrae. The study was carried out using a soft-tissue and lung window. When using a lung window (Th2) the mediastinum was visualised as a heterodense mass, delineated by the lungs. The use of a soft-tissue window at levels Th2 and Th3 visualised the main mediastinal vessels and allowed a percise anatomic CT analysis

  4. Evaluation of cats (Felis catus) as possible asymptomatic carriers of dermatophytes in extreme south of Brazil

    Institute of Scientific and Technical Information of China (English)

    Tony Silveira; Renata de Faria; Mariana Remio; Camila Graeff; Fabiana Poetsch; Guilherme Azevedo; Juliane Guimares; Rafaela Bellora; Tassiane Moraes; Pedro Quevedo

    2015-01-01

    Objective: To investigate the presence of Microsporum canis in pelage of asymptomatic cats for dermatophytosis, in south region of Rio Grande do Sul, Brazil, and evaluate its importance in epidemiology of dermatophytosis in the study area. Methods: A total of 60 domestic cats were evaluated for the presence of Microsporum canis. The animals were divided into three groups of 20 felines. Each group consisted of exclusively domiciled, semi-domiciled and rural animals. Samples were collected following the carpet-square technique. The microorganisms were cultivated under laminar flow in mycosel agar and grown in a greenhouse. Results: All the cats of the three groups analysed had negative cultures for dermatophytes. In 85% of the dishes, there was a growth of environmental saprophytic fungi such as Aspergillus sp., Fusarium sp. and Penicillium sp. Conclusions: Thus, asymptomatic cats for dermatophytes did not show importance in the transmission and maintenance of the disease in southern of Rio Grande do Sul, Brazil.

  5. A Mutation in LTBP2 Causes Congenital Glaucoma in Domestic Cats (Felis catus).

    Science.gov (United States)

    Kuehn, Markus H; Lipsett, Koren A; Menotti-Raymond, Marilyn; Whitmore, S Scott; Scheetz, Todd E; David, Victor A; O'Brien, Stephen J; Zhao, Zhongyuan; Jens, Jackie K; Snella, Elizabeth M; Ellinwood, N Matthew; McLellan, Gillian J

    2016-01-01

    The glaucomas are a group of diseases characterized by optic nerve damage that together represent a leading cause of blindness in the human population and in domestic animals. Here we report a mutation in LTBP2 that causes primary congenital glaucoma (PCG) in domestic cats. We identified a spontaneous form of PCG in cats and established a breeding colony segregating for PCG consistent with fully penetrant, autosomal recessive inheritance of the trait. Elevated intraocular pressure, globe enlargement and elongated ciliary processes were consistently observed in all affected cats by 8 weeks of age. Varying degrees of optic nerve damage resulted by 6 months of age. Although subtle lens zonular instability was a common feature in this cohort, pronounced ectopia lentis was identified in less than 10% of cats examined. Thus, glaucoma in this pedigree is attributed to histologically confirmed arrest in the early post-natal development of the aqueous humor outflow pathways in the anterior segment of the eyes of affected animals. Using a candidate gene approach, significant linkage was established on cat chromosome B3 (LOD 18.38, θ = 0.00) using tightly linked short tandem repeat (STR) loci to the candidate gene, LTBP2. A 4 base-pair insertion was identified in exon 8 of LTBP2 in affected individuals that generates a frame shift that completely alters the downstream open reading frame and eliminates functional domains. Thus, we describe the first spontaneous and highly penetrant non-rodent model of PCG identifying a valuable animal model for primary glaucoma that closely resembles the human disease, providing valuable insights into mechanisms underlying the disease and a valuable animal model for testing therapies. PMID:27149523

  6. A Mutation in LTBP2 Causes Congenital Glaucoma in Domestic Cats (Felis catus)

    OpenAIRE

    Kuehn, Markus H.; Lipsett, Koren A.; Menotti-Raymond, Marilyn; Whitmore, S. Scott; Scheetz, Todd E.; David, Victor A.; O'Brien, Stephen J.; Zhao, Zhongyuan; Jens, Jackie K.; Snella, Elizabeth M; Ellinwood, N. Matthew; Gillian J McLellan

    2016-01-01

    The glaucomas are a group of diseases characterized by optic nerve damage that together represent a leading cause of blindness in the human population and in domestic animals. Here we report a mutation in LTBP2 that causes primary congenital glaucoma (PCG) in domestic cats. We identified a spontaneous form of PCG in cats and established a breeding colony segregating for PCG consistent with fully penetrant, autosomal recessive inheritance of the trait. Elevated intraocular pressure, globe enla...

  7. Coat genetic markers of the domestic cat Felis catus (Felidae) from southwestern Colombia

    OpenAIRE

    Mauricio Peñuela A; Enrique Pardo P.; Víctor Hugo García M; Heiber Cárdenas H

    2016-01-01

    Objectives. Establish the genetic profiles of cats from 12 neighboring municipalities in southwestern Colombia, in a town course from Pereira-Popayán. Estimate the degree of diversity, genetic structure, and quantify gene flow. Materials and methods. Were inventoried the phenotypic markers present in the pigmentation and structure of the coat of 1482 cats of the municipalities surveyed. Based on these phenotypic frequencies, allele frequencies, heterozygosity, Hardy-Weinberg equilibrium, F ...

  8. Domestic cats (Felis catus) are definitive hosts for Sarcocystis sinensis from water buffaloes (Bubalus bubalis).

    Science.gov (United States)

    Gjerde, Bjørn; Hilali, Mosaad

    2016-08-01

    The definitive hosts of Sarcocystis sinensis in water buffaloes have hitherto been unknown, but the close similarity of this species to the cat-transmitted Sarcocystis bovifelis in cattle suggested they were felids. In a previous study, two domestic cats were fed macroscopic sarcocysts of Sarcocystis fusiformis contained within or dissected from the esophageal muscles of water buffaloes, while no microscopic sarcocysts of S. sinensis were noticed. Both cats started shedding small numbers of sporocysts 8-10 days post infection (dpi) and were euthanized 15 dpi. Using a PCR-based molecular assay targeting the mitochondrial cox1 gene of S. fusiformis, both cats were shown to act as definitive hosts for this species. In the present study, DNA samples derived from oocysts/sporocysts in the intestinal mucosa of both cats were further examined by PCR for the presence of S. sinensis using 2 newly designed primers selectively targeting the cox1 gene of this species. All 6 DNA samples examined from each cat tested positive for S. sinensis. A 1,038-bp-long portion of cox1 was amplified and sequenced as 2 overlapping fragments from 5 of these DNA samples. The 5 sequences shared 99.3-100% identity with 7 previous cox1 sequences of S. sinensis obtained from sarcocysts in water buffaloes. Additionally, amplification of the ITS1 region with primers targeting various Sarcocystis spp., yielded amplicons of 2 different lengths, corresponding to those obtained from sarcocyst isolates of S. sinensis and S. fusiformis, respectively. This is the first study to show that cats act as definitive hosts for S. sinensis. PMID:27075117

  9. Postmortale Untersuchungen an der Europäischen Wildkatze (Felis silvestris silvestris SCHREBER, 1777)

    OpenAIRE

    Steeb, Sandra

    2015-01-01

    Hundert Totfunde von Europäischen Wildkatzen aus Deutschland und Luxemburg wurden morphologisch, morphometrisch, pathologisch, virologisch, bakteriologisch und parasitologisch untersucht. Die Haupttodesursache war mit 84 % der Verkehrstod, daher entspricht der pathologische Teil in weiten Teilen einer Trauma-Studie. Todesursächliche Infektionen standen mit 5 % an zweiter Stelle (Salmonella enterica, E. coli, Erysipelothirix rhusiopathiae, Streptococcus dysgalactiae und Felines Parvovirus). Ei...

  10. Direct transmission of the cat flea (Ctenocephalides felis) between cats exhibiting social behaviour

    OpenAIRE

    Franc, Michel; Bouhsira, Émilie; Beugnet, Frédéric

    2013-01-01

    A study design was created to assess the potential for fleas to infest cats directly from other cats. In the first experiment, six cats were infested with 100 fleas each and then immediately put in contact with six flea-free cats for 24 h. After removal of all fleas the study was repeated and the contact between cats lasted 48 h. The total numbers of fleas recovered out of the 600 fleas deposited on the 6 donor cats after each infestation were 499 and 486 at 24 h and 48 h respectively. At 1 h...

  11. Retroviruses and sexual size dimorphism in domestic cats (Felis catus L.).

    OpenAIRE

    Pontier, D; Fromont, E; Courchamp, F.; Artois, M; Yoccoz, N G

    1998-01-01

    Hochberg and co-workers have predicted that an increase in host adult mortality due to parasites is balanced by an earlier age at first reproduction. In polygynous species we hypothesize that such a pattern would lead to diverging selection pressure on body size between sexes and increased sexual size dimorphism. In polygynous mammals, male body size is considered to be an important factor for reproductive success. Thus, under the pressure of a virulent infection, males should be selected for...

  12. Serotyping of Toxoplasma gondii in Cats (Felis domesticus) Reveals Predominance of Type II Infections in Germany

    Science.gov (United States)

    Background: Cats are definitive hosts of Toxoplasma gondii and play an essential role in the epidemiology of this parasite. The study aims at clarifying whether cats are able to develop specific antibodies against different clonal types of T. gondii and to determine by serotyping the T. gondii clona...

  13. Seasonal Variation in the Voluntary Food Intake of Domesticated Cats (Felis Catus)

    OpenAIRE

    Serisier, Samuel; Feugier, Alexandre; Delmotte, Sebastien; Biourge, Vincent; German, Alexander James

    2014-01-01

    There are numerous reports about seasonal cycles on food intake in animals but information is limited in dogs and cats. A 4-year prospective, observational, cohort study was conducted to assess differences in food intake in 38 ad-libitum-fed adult colony cats, of various breeds, ages and genders. Individual food intake was recorded on a daily basis, and the mean daily intake for each calendar month was calculated. These data were compared with climatic data (temperature and daylight length) f...

  14. Detection of antibodies against Leishmania infantum in cats (Felis catus from the State of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Nascimento Silva

    2014-01-01

    Full Text Available Introduction: Little information is available concerning infection by Leishmania infantum in cats. Therefore, the aim of this study was to perform a serological study in domestic cats. Methods: Serum samples (n=153 obtained from animals living in the Cities of Recife and Petrolina, State of Pernambuco, Brazil, were tested by ELISA/S7® (Biogene. Results: Anti-L. infantum antibodies were detected in 3.9% (6/153 of the cats. All seroreagent animals were from Petrolina. Conclusions: These results serve as an important alert, and future studies are needed to better understand the possible role of cats in the epidemiology of visceral leishmaniasis (VL in this area.

  15. Effect of melatonin implants on spermatogenesis in the domestic cat (Felis silvestris catus).

    Science.gov (United States)

    Favre, R Nuñez; Bonaura, M C; Praderio, R; Stornelli, M C; de la Sota, R L; Stornelli, M A

    2014-10-01

    The aim of this study was to assess the efficacy of subcutaneous melatonin implants to temporarily and reversibly suppress spermatogenesis in male cats. Tomcats (n = 8) were housed in a conditioned room with alternating long and short 2-month photoperiod cycles to maintain sperm production and quality. Animals were randomly assigned to one of the two treatments. Four animals received a subcutaneous melatonin implant (MEL, 18 mg; Syntex, Argentina), whereas the other four received a subcutaneous placebo implant (PLA, 0 mg; Syntex). Semen samples were collected by electroejaculation every 14 days for 252 days. Sperm parameters were evaluated in all ejaculates, and data were analyzed by ANOVA. Melatonin-implanted cats significantly decreased their sperm quality in all the parameters studied compared with the control group (MEL vs. PLA; least squares means ± SEM; motility, 71.3 ± 3.4 vs. 82.1 ± 3.6; velocity, 3.4 ± 0.1 vs. 4.6 ± 0.1; total sperm count, 2.6 ± 2.2 vs. 19.4 ± 3.3; acrosome integrity, 48.7 ± 5.6 vs. 62.8 ± 5.6; plasma membrane integrity, 52.2 ± 4.7 vs. 72.9 ± 5.5; normal sperm morphology, 45.8 ± 3.3 vs. 63.7 ± 3.4; P 0.05). At 91 ± 7 days after implant insertion, sperm motility decreased 38.5%, velocity 26.5%, total sperm count 82%, acrosome integrity 22%, plasma membrane integrity 30%, and normal sperm morphology decreased 32% of preimplant values. This effect was present until 120 ± 15 days after implant insertion. After that, seminal parameters started to increase and reached preimplant values at about 140 ± 7 days after implant insertion. Nevertheless, treated animals conserved the capacity to produce semen during the treatment period. In conclusion, a single subcutaneous melatonin implant effectively and reversibly reduced sperm production and quality in male domestic cats for approximately 120 ± 15 days without clinically detectable adverse effects. PMID:25082022

  16. Atferd hos katter (Felis silvestris catus) på omplasseringssentre og etter adopsjon

    OpenAIRE

    Kristiansen, Kristina B.; Landfald, Oda

    2014-01-01

    I dette studiet ble det utført en undersøkelse på to omplasseringssentre i Oslo, Norge, der atferden til 239 omplasserte katter ble registrert ved bruk av et spørreskjema. Skjemaet inkluderte 12 spørsmål om normalatferd, problematferd og anbefalinger angående plassering av katt i nytt hjem. Det andre spørreskjemaet ble sendt ut til eierne av de omplasserte kattene, rundt tre måneder etter adopsjon, 65 svarte. Spørreskjemaet til eier inkluderte 71 spørsmål og var tilsvarende det...

  17. Seroprevalence of Toxoplasma gondii in Cats (Felis catus, Linnaeus 1758 Living in San Carlos (Chile

    Directory of Open Access Journals (Sweden)

    Ignacio Eduardo Troncoso Toro

    2015-05-01

    Full Text Available There are few studies about seroprevalence of toxoplasmosis in Chile; therefore, this article aims to determine seroprevalence in cats in the district of San Carlos, by ELISA Immuno- Comb® serological technique, and, at the same time, to examine association with variables of sex, age, diet, and habitat. To the effect, 60 cats over 2 months old were randomly sampled. Sera were analyzed using the ELISA ImmunoComb® Biogal Toxo & Chlamydia test kit, which detects specific immunoglobulin G-type antibodies against Toxoplasma gondii with a sensitivity of 92.3% and a specificity of 100%. The study evidenced that 29 individuals were positive (48.3% seroprevalence; when broken down by gender this corresponded to 9 males and 20 females (39.1% and 54%, respectively. By age, seropositivity was higher in the “Adult” group (76.7%, followed by groups “Over 7 years” (50% and “Young” (25%. With respect to diet, higher seropositivity was obtained in animals fed on mixed diet, as opposed to commercial diet (60% vs. 47.2%. By variable habitat, 16 indoor and 13 outdoor cats were positive (45.7% and 52%, showing statistically significant difference only for the variable age (p < 0.05. Finally, through relating age with seropositivity, a negative correlation was evidenced (r = –0.3, indicating that older individuals had lower seroprevalence. The results show the presence of antibodies against Toxoplasma gondii in domestic cats.

  18. Growth of a male Caracal kitten felis Caracal in the Mountain Zebra National Park

    Directory of Open Access Journals (Sweden)

    J. H Grobler

    1982-11-01

    Full Text Available Three caracal (lynx Fells caracal kittens, two females and a male were received from the Fish River area some 50 km north of Cradock, Republic of South Africa, on the 20th March 1980. These were found at the base of a dense Rhus erosa bush on the side of a hill and estimated at 14 days old based on the findings of Cade (1968 Int. Zoo Yb. 45 and Kralik (1967 Int. Zoo Yb. 132.

  19. Simplified isolation and enrichment of spermatogonial stem-like cells from pubertal domestic cats (Felis catus)

    OpenAIRE

    TIPTANAVATTANA, Narong; Techakumphu, Mongkol; THARASANIT, Theerawat

    2015-01-01

    The efficiency of spermatogonial stem cell (SSC) isolation and culture from pubertal donors is currently poor primarily, because of contamination with other testicular cells. This study aimed to purify SSC-like cells using different extracellular matrixes and a discontinuous gradient density. In experiment 1, testes (n=6) were analyzed for histology and SSC-related protein expressions (laminin, SSEA-4, DDX-4 and GFRα-1). After enzymatic digestion, the cell suspension was plated onto either a ...

  20. Estacionalidad reproductiva en animales domésticos : Nuevas perspectivas en el gato (Felis silvestris catus)

    OpenAIRE

    Núñez Favre, Romina de los Ángeles; Bonaura, María Candela; García Mitacek, María Carla; Stornelli, María Cecilia; Stornelli, María Alejandra; Sota, Rodolfo Luzbel de la

    2013-01-01

    Algunas especies de animales como los pequeños rumiantes y algunos roedores presentan un período de reposo sexual estacional de duración e intensidad variable. Esta estacionalidad está directamente relacionada con las horas luz diarias (fotoperiodo) a las que se hallan sometidos los animales y se evidencia en las localizaciones geográficas en las que existen marcadas variaciones en la duración del día durante el año. En el caso de los pequeños rumiantes, ambos sexos tienen una actividad sexua...

  1. Physical Map and Genome Sequencing Survey of Mycoplasma haemofelis (Haemobartonella felis)

    OpenAIRE

    Berent, Linda M.; Joanne B. Messick

    2003-01-01

    Mycoplasma haemofelis is an uncultivable red-cell pathogen of cats. Isolated M. haemofelis DNA was used to create a bacterial artificial chromosome library and physical map. Random sequencing of this material revealed 75 genes that had not been previously reported for M. haemofelis or any other hemotrophic mycoplasma.

  2. Seasonal Variation in the Voluntary Food Intake of Domesticated Cats (Felis Catus)

    OpenAIRE

    Samuel Serisier; Alexandre Feugier; Sébastien Delmotte; Vincent Biourge; Alexander James German

    2014-01-01

    International audience There are numerous reports about seasonal cycles on food intake in animals but information is limited in dogs and cats. A 4-year prospective, observational, cohort study was conducted to assess differences in food intake in 38 ad-libitum-fed adult colony cats, of various breeds, ages and genders. Individual food intake was recorded on a daily basis, and the mean daily intake for each calendar month was calculated. These data were compared with climatic data (temperat...

  3. A Mutation in LTBP2 Causes Congenital Glaucoma in Domestic Cats (Felis catus)

    Science.gov (United States)

    Lipsett, Koren A.; Menotti-Raymond, Marilyn; Whitmore, S. Scott; Scheetz, Todd E.; David, Victor A.; O'Brien, Stephen J.; Zhao, Zhongyuan; Jens, Jackie K.

    2016-01-01

    The glaucomas are a group of diseases characterized by optic nerve damage that together represent a leading cause of blindness in the human population and in domestic animals. Here we report a mutation in LTBP2 that causes primary congenital glaucoma (PCG) in domestic cats. We identified a spontaneous form of PCG in cats and established a breeding colony segregating for PCG consistent with fully penetrant, autosomal recessive inheritance of the trait. Elevated intraocular pressure, globe enlargement and elongated ciliary processes were consistently observed in all affected cats by 8 weeks of age. Varying degrees of optic nerve damage resulted by 6 months of age. Although subtle lens zonular instability was a common feature in this cohort, pronounced ectopia lentis was identified in less than 10% of cats examined. Thus, glaucoma in this pedigree is attributed to histologically confirmed arrest in the early post-natal development of the aqueous humor outflow pathways in the anterior segment of the eyes of affected animals. Using a candidate gene approach, significant linkage was established on cat chromosome B3 (LOD 18.38, θ = 0.00) using tightly linked short tandem repeat (STR) loci to the candidate gene, LTBP2. A 4 base-pair insertion was identified in exon 8 of LTBP2 in affected individuals that generates a frame shift that completely alters the downstream open reading frame and eliminates functional domains. Thus, we describe the first spontaneous and highly penetrant non-rodent model of PCG identifying a valuable animal model for primary glaucoma that closely resembles the human disease, providing valuable insights into mechanisms underlying the disease and a valuable animal model for testing therapies. PMID:27149523

  4. Domestic Cats (Felis silvestris catus Do Not Show Signs of Secure Attachment to Their Owners.

    Directory of Open Access Journals (Sweden)

    Alice Potter

    Full Text Available The Ainsworth Strange Situation Test (SST has been widely used to demonstrate that the bond between both children and dogs to their primary carer typically meets the requirements of a secure attachment (i.e. the carer being perceived as a focus of safety and security in otherwise threatening environments, and has been adapted for cats with a similar claim made. However methodological problems in this latter research make the claim that the cat-owner bond is typically a secure attachment, operationally definable by its behaviour in the SST, questionable. We therefore developed an adapted version of the SST with the necessary methodological controls which include a full counterbalance of the procedure. A cross-over design experiment with 20 cat-owner pairs (10 each undertaking one of the two versions of the SST first and continuous focal sampling was used to record the duration of a range of behavioural states expressed by the cats that might be useful for assessing secure attachment. Since data were not normally distributed, non-parametric analyses were used on those behaviours shown to be reliable across the two versions of the test (which excluded much cat behaviour. Although cats vocalised more when the owner rather the stranger left the cat with the other individual, there was no other evidence consistent with the interpretation of the bond between a cat and its owner meeting the requirements of a secure attachment. These results are consistent with the view that adult cats are typically quite autonomous, even in their social relationships, and not necessarily dependent on others to provide a sense of security and safety. It is concluded that alternative methods need to be developed to characterise the normal psychological features of the cat-owner bond.

  5. Adiponectin mRNA Expression in the Cat (Felis domesticus)

    OpenAIRE

    Angela L. Lusby; Kania, Stephen A.; Bartges, Joseph W.; Claudia A. Kirk

    2010-01-01

    Problem statement: Adiponectin is a hormone expressed from adipose tissue in people, rodents and dogs. Adiponectin has anti-inflammatory action with beneficial effects on cardiovascular health and insulin sensitivity. With increasing fat mass, adiponectin concentrations paradoxically decrease. Adiponectins role in metabolism and diabetes mellitus is of interest in feline medicine because cats are susceptible to developing type II diabetes with weight gain. This study deter...

  6. Rickettsia felis Infection in a Common Household Insect Pest, Liposcelis bostrychophila (Psocoptera: Liposcelidae)▿ †

    OpenAIRE

    Behar, Adi; McCormick, Laurie J.; Perlman, Steve J.

    2010-01-01

    Many species of Rickettsia are well-known mammalian pathogens transmitted by blood-feeding arthropods. However, molecular surveys are continually uncovering novel Rickettsia species, often in unexpected hosts, including many arthropods that do not feed on blood. This study reports a systematic molecular characterization of a Rickettsia infecting the psocid Liposcelis bostrychophila (Psocoptera: Liposcelidae), a common and cosmopolitan household pest. Surprisingly, the psocid Rickettsia is sho...

  7. Taxonomy Icon Data: domestic cat [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available domestic cat ... Felis silvestris cat us Chordata/Vertebrata/Mammalia/Theria/Eutheria/Carnivora Felis ... _silvestris_cat us_L.png Felis_silvestris_cat us_NL.png Felis_silves ... tris_cat us_S.png Felis_silvestris_cat us_NS.png http://biosc ...

  8. Acute Toxicity Of Euphorbia Royleana Boiss (Euphorbiaceae latex on freshwater catfish, Heteropneustes Fossilis (Siluriformes, Heteropneustidae Toxicidad aguda del látex de Euphorbia royleana Boiss (Euphorbiaceae en el bagre de agua dulce, Heteropneutes fossilis (Siluriformes, Heteropneustidae

    Directory of Open Access Journals (Sweden)

    Prasad ManiRam

    2010-06-01

    Full Text Available An acute toxicity test was performed by using a four-day static renewal test to determine the LC50 value of aqueous extract of Euphorbia royleana latex for the freshwater fsh, Heteropneustes fossilis. The LC50 values, their upper and lower confdence limits and slope functions were calculated. The LC50 values for aqueous extract of Euphorbia royleana latex at various exposure periods were 7.758 mg/L for 24 h, 5.847 mg/L for 48 h, 4.474 mg/L for 72 h and 3.090 mg/L for 96 h. The regression coeffcient showed that there was signifcant negative correlation between exposure time and different LC values. Hence, it is concluded that the concentration to produce toxicity of latex of Euphorbia royleana is comparable and close to the concentration to produce toxicity of synthetic organophosphates pesticides for the fsh H. fossilis. Therefore, adequate precautions must be taken when Euphorbia royleana latex is being used near fsh- inhabited areas.La prueba de la toxicidad aguda fue realizada utilizando un test estático con renovación, de cuatro días de duración, para determinar el valor de la CL50 de un extracto acuoso del látex de Euphorbia royleana, en el pez de agua dulce Heteropneustes fossilis. Se calcularon el valor de la CL50, los límites de confanza máximo y mínimo y la pendiente. Los valores de la CL50 para el extracto acuoso del látex en varios períodos de exposición fueron 7,758 mg/L para 24 h, 5,847 mg/L para 48 h, 4,474 mg/L para 72 h y 3,090 mg/L para 96 h. El coefciente de regresión mostró una correlación negativa signifcativa entre el tiempo de exposición y diferentes valores de la CL50. Se concluye que la concentración del látex de E. royleana que produce toxicidad es comparable y cercana a la de los plaguicidas sintéticos organofosforados para el pez H. fossilis. Por lo tanto, se deben tomar precauciones adecuadas cuando el látex de E. royleana es utilizado cerca de áreas donde habita el pez H. fossilis.

  9. Distribuição, abundância relativa e movimentos sazonais de bagres marinhos (Siluriformes, Ariidae no estuário da Lagoa dos Patos (RS, Brasil

    Directory of Open Access Journals (Sweden)

    Francisco Gerson Araújo

    1988-01-01

    Full Text Available Three ariid fish, Netuma barba, Netuma planifrons and Genidens genidens, use the estuary of the Patos Lagoon (32ºS, Rio Grande do Sul, Brazil, as a nursery and feeding ground in various stages of their life history. A comparative study was made of the temporal and spatial distribution and relative abundance. Seasonal movements were interpreted on the basis of distribution and abundance of the young of these coexisting sea catfishe. Monthly otter trawl samples were made between November, 1979 and April, 1983. Temperature, salinities and dissolved oxygen contents were taken at each of the 674 sample stations. All three species were caught in ample temperature (12,1 to 26,3ºC, salinity (0,3 to 35,5‰ and dissolved oxygen (4,7 to 11,5 mg/l ranges. However, they were more abundant in stations of low temperature and in salinity with highly dissolved oxygen content. N. barba was the most abundant catfish caught in the estuary, it constituted 81,9% in number and 81,4% in weight of ali ariid trawl catches during the study. N. barba occurred throughout the estuary, from the adjacent coastal region to the upper reaches of the Patos Lagoon estuary near the liminetic zone. N. planifrons occurred from adjacent coastal regions to low saline parts of the Patos Lagoon estuary, whereas G. genidens were distributed mainly in low saline and freshwater parts of the lagoon. Young-of-the-year N. barba aggregated near of the entrance of the lagoon in fall and winter, then moved up to intermediary parts of the estuary in spring, and they went to the upper part of the estuary in summer. Yearlings N. barba moved into the estuary in common with young-of-the-year but did not reach the coastal adjacent area. Young-of-the-year and yearling N. planifrons moved in to the estuary as the same pattern as N. barba but they became scarce during the late summer and early fall. G. genidens were scarcely captured in the estuary throughout the year. The spatial and temporal segregations among Netuma and Genidens were evident. A hypothetical model for the life history of N. barba is suggested.

  10. Acute Toxicity Of Euphorbia Royleana Boiss (Euphorbiaceae) latex on freshwater catfish, Heteropneustes Fossilis (Siluriformes, Heteropneustidae) Toxicidad aguda del látex de Euphorbia royleana Boiss (Euphorbiaceae) en el bagre de agua dulce, Heteropneutes fossilis (Siluriformes, Heteropneustidae)

    OpenAIRE

    Prasad ManiRam; Kumar Abhishek; Mishra Diwakar; Srivastav Sunil K; Srivastav Ajai K.

    2010-01-01

    An acute toxicity test was performed by using a four-day static renewal test to determine the LC50 value of aqueous extract of Euphorbia royleana latex for the freshwater fsh, Heteropneustes fossilis. The LC50 values, their upper and lower confdence limits and slope functions were calculated. The LC50 values for aqueous extract of Euphorbia royleana latex at various exposure periods were 7.758 mg/L for 24 h, 5.847 mg/L for 48 h, 4.474 mg/L for 72 h and 3.090 mg/L for 96 h. The regression coef...

  11. Descripción de una nueva especie de bagre marino fósil (Teleostei, Siluriformes, Ariidae del Mioceno de la provincia de Río Negro, Argentina

    Directory of Open Access Journals (Sweden)

    Sergio Bogan

    2011-01-01

    Full Text Available En este trabajo se describen dos cráneos de la familia Ariidae procedentes del miembro Saladar de la Formación Gran Bajo del Gualicho, ubicados en las Salinas del Gualicho, provincia de Río Negro, Argentina. La edad de los depósitos del Miembro Saladar se remonta al Mioceno Temprano alto/Mioceno Medio bajo. Los materiales son asignados a una nueva especie extinta del género viviente Genidens. Este nuevo taxón se distingue de todas las especies actuales por presentar un proceso supraoccipital muy corto, ancho y redondeado, extraescapular subcircular y mesetmoides amplios con una conspicua escotadura mesial, frontales prácticamente planos en vista lateral y margen lateral de los huesos esfenóticos rectilíneo. Genidens sp. nov., representa el registro más antiguo para el género y constituiría una especie de aspecto similar a las formas actuales del género. sp. nov., representa el registro más antiguo para el género y constituiría una especie de aspecto similar a las formas actuales del género.

  12. Revalidação de Cathorops arenatus e Cathorops agassizii (Siluriformes, Ariidae, bagres marinhos das regiões norte e nordeste da América do Sul

    Directory of Open Access Journals (Sweden)

    Alexandre P. Marceniuk

    2007-12-01

    Full Text Available As espécies nominais das regiões norte e nordeste da América do Sul, reconhecidas na literatura como sinônimos júnior de Cathorops spixii (Agassiz, 1829 têm seu status específico revisto. Os tipos de Arius arenatus Valenciennes, 1840, Arius fissus Valenciennes, 1840, Tachisurus agassizii Eigenmann & Eigenmann, 1888 e Arius pleurops Boulenger, 1897 foram examinados. Cathorops arenatus e Cathorops agassizii são espécies válidas, Cathorops fissus é sinônimo júnior de Cathorops arenatus e Cathorops pleurops sinônimo júnior de Cathorops agassizii. Os caracteres morfométricos tradicionalmente usados em descrições e chaves de identificação para espécies da família Ariidae são redefinidos e novos caracteres são utilizados.Nominal species from north and northeast South America, traditionally recognized in the literature as synonymous of Cathorops spixii (Agassiz, 1829, have their specific status redefined. Type specimens of Arius arenatus Valenciennes, 1840, Arius fissus Valenciennes, 1840, Tachisurus agassizii Eigenmann & Eigenmann, 1888 and Arius pleurops Boulenger, 1897 were examined. Cathorops arenatus and Cathorops agassizii are considered valid, Cathorops fissus is a junior synonym of Cathorops arenatus and Cathorops pleurops a junior synonym of Cathorops agassizii. The morphometric characters traditionally used in descriptions and keys in the family Ariidae are redefined and new characters are used.

  13. Fontes não-convencionais de proteína na primeira alimentação do bagre sul americano (Rhamdia quelen Unconventional protein sources in the first feeding of South American catfish (Rhamdia quelen

    Directory of Open Access Journals (Sweden)

    David Roque Hernández

    2009-06-01

    Full Text Available O presente estudo teve como objetivo avaliar diferentes fontes de proteína na primeira alimentação de jundiá (Rhamdia quelen sob condições de laboratório. Foram testadas três rações balanceadas secas: ovo de peixe (TA, hidrolisado de carcaça do peixe (TB e fígado de frango cru (TC, na quais foram analisadas, pelo crescimento, a biomassa final produzida e a sobrevivência das larvas. O ensaio teve uma duração de 20 dias, e as rações foram fornecidas ad libitum. As larvas alimentadas com ovo de peixe apresentaram os melhores resultados com peso médio individual de 340mg, sobrevivência de 57% e biomassa final de 1.350mg, diferindo significativamente dos demais tratamentos. Os resultados indicaram que a formulação de rações balanceadas com ovos de peixes fornecida na primeira alimentação de larvas de jundiá pode tornar-se uma alternativa promissora na larvicultura dessa espécie.This study aimed to evaluate different proteins sources in first feeding of jundiá (Rhamdia quelen under laboratory conditions. Three balanced dry rations were tested, fish roe (TA, biological fish silage (TB and crude chicken liver (TC evaluating specific growth rate, final biomass produced and survival rate. The experiment was performed in 20 days, and all the rations were provided ad libitum. Larvae fed with fish roe presented better results, with 340mg of individual mean weight, 57% of survival rate and 1.350mg of final biomass, differing significantly with the other treatments. The results show that the inclusion of fish roe in balanced rations offered at the first feeding of jundiá larvae may become a promising alternative for the hatchering of the species.

  14. Expression profiles of relaxin family peptides and their receptors indicate their influence on spermatogenesis in the domestic cat (Felis catus).

    Science.gov (United States)

    Braun, B C; Müller, K; Jewgenow, K

    2015-07-01

    Disturbed spermatogenesis is a common problem in felines. Studying spermatogenesis in the domestic cat can improve the understanding of the biological background and help to counteract fertility problems in other feline species. Here, we analyzed 3 relaxin family peptides (relaxin, relaxin-3, and INSL3) and their receptors (RXFP1, RXFP2, and RXFP3) as potential spermatogenic factors involving their expression in the testis at different stages of its development. It may be concluded from its stage-dependent expression that relaxin, together with RXFP1, appears to be involved in the first stage of spermatogenesis, whereas relaxin-3 via binding to RXFP3 influences spermiogenesis. Furthermore, correlations were observed between relaxin, relaxin-3, RXFP1, RXFP2 and RXFP3 messenger RNA expression, and the relative numbers of haploid cells in testes. The peptide INSL3 was highly expressed at all testis development stages. Because of the low and stage-independent expression of its receptor RXFP2, an auto- and/or paracrine function of INSL3 in spermatogenesis seems unlikely. In the adult testis, messenger RNA expression of relaxin, RXFP1, and RXFP3 predominantly occurs in the tubular testis compartment, whereas INLS3 is mainly expressed in the interstitium. PMID:25704248

  15. INDUCTION OF NITRIC OXIDE SYNTHASE AND ASSOCIATED TOXICITY IN LIVERS OF HARDHEAD CATFISH, ARIUS FELIS, FROM CONTROL AND EPIZOOTIC SITES

    Science.gov (United States)

    Earlier work with a live channel catfish (Ictalurus punctatus) pathogen, Edwardsiella ictaluri, demonstrated the induction of nitric oxide synthase (NOS) in the head kidney, paralleling enteric septicemia (Hawke et al. 1981; Schoor and Plumb 1994). However, another study exposing...

  16. Are cats (Felis catus) from multi-cat households more stressed? Evidence from assessment of fecal glucocorticoid metabolite analysis.

    Science.gov (United States)

    Ramos, D; Reche-Junior, A; Fragoso, P L; Palme, R; Yanasse, N K; Gouvêa, V R; Beck, A; Mills, D S

    2013-10-01

    Given the social and territorial features described in feral cats, it is commonly assumed that life in multi-cat households is stressful for domestic cats and suggested that cats kept as single pets are likely to have better welfare. On the other hand, it has been hypothesized that under high densities cats can organize themselves socially thus preventing stress when spatial dispersion is unavailable. This study was aimed at comparing the general arousal underpinning emotional distress in single housed cats and in cats from multi-cat households (2 and 3-4 cats) on the basis of fecal glucocorticoid metabolites (GCM) measured via enzyme immunoassay (EIA). GCM did not significantly vary as a function of living style (single, double or group-housing); highly stressed individuals were equally likely in the three groups. Young cats in multi-cat households had lower GCM, and overall cats that tolerate (as opposed to dislike) petting by the owners tended to have higher GCM levels. Other environmental aspects within cat houses (e.g. relationship with humans, resource availability) may play a more important role in day to day feline arousal levels than the number of cats per se. PMID:24021924

  17. Haematology and biochemistry values of captive sand cats (Felis margarita) in Al Ain Wildlife Park and Resort, United Arab Emirates

    Institute of Scientific and Technical Information of China (English)

    Stephen Chege; Arshad Toosy; Judith Howlett; Ahmed Saker; John Kagira

    2013-01-01

    Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values.Methods:Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS Montpellier, France). Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05) between males and females values.Conclusions:Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  18. Haematology and biochemistry values of captive sand cats (Felis margarita in Al Ain Wildlife Park and Resort, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Stephen Chege

    2013-09-01

    Full Text Available Objective: To investigate the haematology and biochemistry values of apparently healthy captive sand cats kept in Al Ain Wildlife Park and Resort, United Arab Emirates, with a view to establishing baseline values. Methods: Blood was collected from the femoral vein using aseptic techniques, kept in a cool box and sent to laboratory for analysis. The blood was analysed for haematological and biochemical values using veterinary hematology and chemistry analysers (ABX ABC Vet, Horiba ABX SAS ® Montpellier, France. Results: Haematological values were within the normal ranges recorded in domestic cats and there was no statistical difference between values found in males and females. Aspartate aminotransferase values were higher (P0.05 between males and females values. Conclusions: Our results present reference ranges for haematology and biochemistry parameters in captive sand cats. These values will be important for diagnosis of various diseases and monitoring of treatments.

  19. L'areale italiano del gatto selvatico europeo (Felis silvestris silvestris: ancora un dilemma?

    Directory of Open Access Journals (Sweden)

    Bernardino Ragni

    2003-10-01

    Full Text Available Nel 1992 dall'Aspromonte l'area di distribuzione del gatto selvatico europeo si arrestava al parallelo UTM 4800000 Nord, su una linea corologica che andava da Piombino a Fabriano (Ragni et al. 1994. Nessuna spiegazione ecologica poteva giustificare i 450 chilometri di iato corologico che separava tale linea dal frammento di areale disgiunto delle Alpi Liguri; ad Est la stazione più prossima era ubicata nell'area del Cansiglio (Prealpi Venete. Dopo un decennio si presenta un aggiornamento sullo stato del "dilemma". Dal giugno 1992 al giugno 2003 sono stati raccolti 46 reperti (esemplari rinvenuti morti, catturati vivi o fotografati in natura in Toscana, Umbria e Marche, le regioni "tagliate" dal limite d'areale peninsulare. Uno solo dei reperti risulta rinvenuto a Nord di detto limite: "sui monti di Carpegna", in Provincia di Pesaro-Urbino all'altezza del parallelo UTM 4850000 Nord; si tratta di un maschio adulto, abbattuto illegalmente. La nuova stazione zoogeografica è separata dal limite del 1992 con un salto longitudinale di almeno 50 chilometri, così come i 12440 Kmq di Penisola Italiana compresi tra i due paralleli risultano completamente privi del felide. Analogamente a quello spaziale si osserva un salto temporale di 10 anni (giugno 1992-ottobre 2002 tra le due condizioni corologiche. Al contrario, i 13200 Kmq di penisola compresi tra il parallelo "storico" e quello posto 50 chilometri più a Sud, sono punteggiati da 35 reperti con distribuzione spaziale relativamente uniforme; così come la distribuzione delle stazioni nel tempo. Se si esclude il ritrovamento di Carpegna i limiti di areale definiti nel 1992 sono rimasti immutati: le nuove stazioni peninsulari confermano, al giugno 2003, la linea Piombino-Fabriano; le nuove stazioni Nord-orientali confermano, all'ottobre del 2002, l'area del Cansiglio; mentre, dopo il 1992, le stazioni della Liguria occidentale, che risalivano già al 1981, non hanno ricevuto alcuna conferma. In conclusione, dal punto di vista della dinamica d'areale F. s. silvestris in Italia si mostra, complessivamente, molto conservativo: un fenomeno noto anche per un altro felide, la lince eurasiatica nel suo areale alpino. La situazione sopra delineata, quindi, impone di considerare il ritrovamento di Carpegna con molta prudenza: per escludere la possibilità che si tratti delle conseguenze di un intervento antropico o di un evento naturale stocastico, occorre sviluppare un monitoraggio intensivo in adeguate aree di studio, al fine di verificare l'esistenza di una popolazione vitale del felide.

  20. Coinfection by Toxoplasma gondii and Leishmania spp. in domestic cats (Felis catus in State of Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Audrey Rennó Campos Braga

    2014-12-01

    Full Text Available Introduction Leishmaniasis and toxoplasmosis are important to public health. Methods Antibodies for Toxoplasma gondii and Leishmania spp. were evaluated in cats from Campo Grande, State of Mato Grosso do Sul, Brazil, a region endemic for canine visceral leishmaniasis. Serum samples from 50 asymptomatic cats were titrated for T. gondii by the immunofluorescence antibody test and modified agglutination test and for Leishmania spp. by the immunofluorescence antibody test. Results These two agents coinfected two (4% of the 50 tested animals. Conclusions These findings demonstrate the concomitant presence of two important zoonoses in cats from Brazilian endemic regions for canine visceral leishmaniasis.

  1. Anticipation is differently expressed in rats (Rattus norvegicus) and domestic cats (Felis silvestris catus) in the same Pavlovian conditioning paradigm

    NARCIS (Netherlands)

    Bos, van den R.; Meijer, M.K.; Renselaar, van J.; Harst, van der J.E.; Spruijt, B.M.

    2003-01-01

    In rats (Rattus norvegicus) anticipation to an oncoming food reward in an appetitive Pavlovian conditioning procedure is expressed as an increase of behavioural transitions, i.e. hyperactivity. This behaviour might be related to the spontaneous appetitive behaviour of animals in relation to oncoming

  2. Using population genetic tools to develop a control strategy for feral cats (Felis catus) in Hawai'i

    Science.gov (United States)

    Hansen, H.; Hess, S.C.; Cole, D.; Banko, P.C.

    2007-01-01

    Population genetics can provide information about the demographics and dynamics of invasive species that is beneficial for developing effective control strategies. We studied the population genetics of feral cats on Hawai'i Island by microsatellite analysis to evaluate genetic diversity and population structure, assess gene flow and connectivity among three populations, identify potential source populations, characterise population dynamics, and evaluate sex-biased dispersal. High genetic diversity, low structure, and high number of migrants per generation supported high gene flow that was not limited spatially. Migration rates revealed that most migration occurred out of West Mauna Kea. Effective population size estimates indicated increasing cat populations despite control efforts. Despite high gene flow, relatedness estimates declined significantly with increased geographic distance and Bayesian assignment tests revealed the presence of three population clusters. Genetic structure and relatedness estimates indicated male-biased dispersal, primarily from Mauna Kea, suggesting that this population should be targeted for control. However, recolonisation seems likely, given the great dispersal ability that may not be inhibited by barriers such as lava flows. Genetic monitoring will be necessary to assess the effectiveness of future control efforts. Management of other invasive species may benefit by employing these population genetic tools. ?? CSIRO 2007.

  3. Male and female agonistic and affiliative relationships in a social group of farm cats (Felis catus L.).

    Science.gov (United States)

    Natoli, E; Baggio, A; Pontier, D

    2001-03-13

    A dominance hierarchy based on the outcome of agonistic encounters was found among male and female domestic cats. A female dominated over some males. The dominance concept is also discussed in terms of social bonding. The relationships among adult females were amicable, whereas adult males showed reciprocal tolerance. The flow of affiliative behaviour was directed mainly from females to one male of the group. The analysis of marking behaviour showed that this male sprayed urine and rubbed the perioral and cheek regions of the face on the objects of the environment at a higher rate than the other members of the group. Nevertheless, rubbing the perioral and cheek regions of the face on objects was not correlated to dominance rank, possibly because it has some function in social communication other than territorial defence against strangers. No relationships have been found between claw scratching, rolling on the ground and social rank, or between the former and other marking behaviour. It is concluded that claw scratching and rolling were not utilised to mark territory. PMID:11255001

  4. Detection of Babesia hongkongensis sp. nov. in a Free-Roaming Felis catus Cat in Hong Kong

    OpenAIRE

    Wong, Samson S. Y.; Poon, Rosana W. S.; Hui, Janet J. Y.; Yuen, Kwok-Yung

    2012-01-01

    Intraerythrocytic Babesia-like trophozoites were seen in postmortem kidney sections of a free-roaming cat in Hong Kong. DNA sequences of the 18S rRNA and mitochondrial cytochrome b genes had only 96.7% and 90.4% nucleotide identity with known Babesia sequences. We propose that this new species be named Babesia hongkongensis.

  5. Human Spotted Fever Group Rickettsioses Are Underappreciated in Southern Taiwan, Particularly for the Species Closely-Related to Rickettsia felis

    OpenAIRE

    Lai, Chung-Hsu; Chang, Lin-Li; Lin, Jiun-Nong; Tsai, Kun-Hsien; Hung, Ya-Chien; Kuo, Li-Li; Lin, Hsi-Hsun; Chen, Yen-Hsu

    2014-01-01

    Background Despite increased identification of spotted fever group rickettsioses (SFGR) in animals and arthropods, human SFGR are poorly characterized in Taiwan. Methods Patients with suspected Q fever, scrub typhus, murine typhus, leptospirosis, and dengue fever from April 2004 to December 2009 were retrospectively investigated for SFGR antibodies (Abs). Sera were screened for Rickettsia rickettsii Abs by indirect immunofluorescence antibody assay (IFA), and those with positive results were ...

  6. Propionate absorbed from the colon acts as gluconeogenic substrate in a strict carnivore, the domestic cat (Felis catus)

    DEFF Research Database (Denmark)

    Verbrugghe, A; Hesta, M; Daminet, S;

    2012-01-01

    In six normal-weight and six obese cats, the metabolic effect of propionate absorbed from the colon was assessed. Two colonic infusions were tested in a crossover design with intervals of 4 weeks. The test solution contained 4 mmol sodium propionate per kg ideal body weight in a 0.2% NaCl solution...

  7. Mercury concentrations in gafftopsail catfish and other fishes in waters adjacent to Hobe Sound National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From September 22-26, 1990, 20 gafftopsail catfish (Bagre marinus) and 3 other fish species (n=4) were collected from marine waters adjacent to Hobe Sound National...

  8. Mercury in fishes of the J.N. "Ding" Darling National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — From June 26 to 30,1990 spotted gar (Lepisosteus oculatus), spotted seatrout (Cynoscion nebulosus), gafftopsail catfish (Bagre marinus), and largemouth bass...

  9. Epidemiology of flea infestation of ruminants in Libya.

    Science.gov (United States)

    Kaal, J F; Baker, K; Torgerson, P R

    2006-11-01

    The results of an epidemiological and clinical study of flea infestations of farm animals in northern Libya is reported. Of 12,130 sheep examined from 124 flocks, 150 sheep were found to be infested with fleas from 50 different flocks. Likewise 23 goats from 2981 examined, and 11 calves from 1124 cattle examined were infested No fleas were recovered from camels or horses. Of 1861 fleas recovered from farm livestock, 1857 were Ctenocephalides felis strongylus and 4 were Pulex irritans. Dogs from farms and local clinics were also examined. Eight farms dogs were found to be infested with P. irritans. Of 79 infested dogs examined in veterinary clinics, 53 were found infested with P. irritans, 11 with Ctenocephalides felis felis, 12 had a mixed infestation of P. irritans and C. felis felis. Single dogs had mixed infestation of P. irritans and C. canis; C. felis felis and C. canis; and P. irritans, C. felis felis and Echidnophaga gallinacia. C. felis felis was also found on 15 infested cats. C. felis felis was never found on large farm animals despite frequently sharing their environment with dogs or cats. Likewise C. felis stongylus was never isolated from dogs or cats. This is consistent with the hypothesis that C. felis strongylus has become adapted to large farm animals, whilst C. felis felis is better adapted to dogs and cats. However, four stockmen were found infested with a total of 176 C. felis strongylus, which suggests that this subspecies is also a potential zoonosis. A significantly higher proportion of intensive farms had animals with flea infestation compared to semi-intensive farms. Fleas were not found in nomadic herds. Infested farm animals often presented with excoriation, alopecia, pruritus and hyperkeratitis particularly on the lower limbs. These signs are consistent with the generation of flea-bite hypersensitivity. PMID:16962246

  10. Rickettsia typhi IN RODENTS AND R. felis IN FLEAS IN YUCATÁN AS A POSSIBLE CAUSAL AGENT OF UNDEFINED FEBRILE CASES

    OpenAIRE

    PENICHE-LARA, Gaspar; Dzul-Rosado, Karla; PÉREZ-OSORIO, Carlos; Zavala-Castro, Jorge

    2015-01-01

    Rickettsia typhi is the causal agent of murine typhus; a worldwide zoonotic and vector-borne infectious disease, commonly associated with the presence of domestic and wild rodents. Human cases of murine typhus in the state of Yucatán are frequent. However, there is no evidence of the presence of Rickettsia typhi in mammals or vectors in Yucatán. The presence of Rickettsia in rodents and their ectoparasites was evaluated in a small municipality of Yucatán using the conventional polymerase chai...

  11. Uso de la ecografía para el bloqueo de nervios periféricos del miembro torácico en el gato (Felis catus L:)

    OpenAIRE

    Ansón Fernández, Agustina

    2016-01-01

    Objetivos 1. Describir los abordajes ecográficos para la evaluación del plexo braquial (PB) y los principales nervios del miembro torácico, así como la anatomía y apariencia ecográfica normales correlacionando las imágenes ecográficas con la disección anatómica y las criosecciones. 2. Establecer los abordajes ecográficos para el bloqueo ecoguiado del PB. 3. Determinar la eficacia de los diferentes abordajes para el bloqueo anestésico ecoguiado del PB, mediante la evaluación de la d...

  12. Toward a genome-wide approach for detecting hybrids: informative SNPs to detect introgression between domestic cats and European wildcats (Felis silvestris).

    Science.gov (United States)

    Oliveira, R; Randi, E; Mattucci, F; Kurushima, J D; Lyons, L A; Alves, P C

    2015-09-01

    Endemic gene pools have been severely endangered by human-mediated hybridization, which is posing new challenges in the conservation of several vertebrate species. The endangered European wildcat is an example of this problem, as several natural populations are suffering introgression of genes from the domestic cat. The implementation of molecular methods for detecting hybridization is crucial for supporting appropriate conservation programs on the wildcat. In this study, genetic variation at 158 single-nucleotide polymorphisms (SNPs) was analyzed in 139 domestic cats, 130 putative European wildcats and 5 captive-bred hybrids (N=274). These SNPs were variable both in wild (HE=0.107) and domestic cats (HE=0.340). Although we did not find any SNP that was private in any population, 22 SNPs were monomorphic in wildcats and pairwise FCT values revealed marked differences between domestic and wildcats, with the most divergent 35 loci providing an average FCT>0.74. The power of all the loci to accurately identify admixture events and discriminate the different hybrid categories was evaluated. Results from simulated and real genotypes show that the 158 SNPs provide successful estimates of admixture, with 100% hybrid individuals (two to three generations in the past) being correctly identified in STRUCTURE and over 92% using the NEWHYBRIDS' algorithm. None of the unclassified cats were wrongly allocated to another hybrid class. Thirty-five SNPs, showing the highest FCT values, provided the most parsimonious panel for robust inferences of parental and first generations of admixed ancestries. This approach may be used to further reconstruct the evolution of wildcat populations and, hopefully, to develop sound conservation guidelines for its legal protection in Europe. PMID:26103945

  13. When cats' ways of life interact with their viruses: a study in 15 natural populations of owned and unowned cats (Felis silvestris catus).

    Science.gov (United States)

    Hellard, E; Fouchet, D; Santin-Janin, H; Tarin, B; Badol, V; Coupier, C; Leblanc, G; Poulet, H; Pontier, D

    2011-09-01

    In natural populations, virus circulation is influenced by host behavior and physiological characteristics. Cat populations exhibit a great variability in social and spatial structure, the existence of different ways of life within a same population may also result in different epidemiological patterns. To test this hypothesis, we used a logistic regression to analyze the risk factors of Feline immunodeficiency virus (FIV), feline herpes virus (FHV), feline calicivirus (FCV), and feline parvovirus (FPV) infection in owned (fed and sheltered) and unowned (neither fed nor sheltered, unsocialized) cats living in a rural environment in the North Eastern part of France. A serological survey was carried out in 492 non-vaccinated and non-sterilized individuals from 15 populations living in the same area. The prevalence of feline leukemia virus (FeLV) was also studied, but too few were infected to analyze the risk factors of this virus. For each virus, the epidemiological pattern was different in owned and unowned cats. Unowned cats were more frequently infected by directly transmitted viruses like FIV, FHV and FCV (21.22%, 67.66%, 86.52% in unowned cats vs 9.55%, 53.88%, 77.18% in owned cats, respectively), a difference that may be explained by a more solitary and more aggressive behavior in unowned adults, and/or possibly by a higher sensitivity related to a more stressful life. On the contrary, owned cats were more frequently infected with FPV (36.41% in owned cats vs 15.61% in unowned cats), possibly as a result of their concentration around human settlements. The present study showed that owned and unowned cats living in a same area have behavioral and physiological characteristics sufficiently different to influence virus circulation. Pooling different types of cats in a single sample without taking it into account could give a wrong picture of the epidemiology of their viruses. The conclusion of this work can be extended to any epidemiological studies led in wildlife species with flexible behavior as any variations in social or spatial structure, between or within populations, could result in different virus circulation. PMID:21705099

  14. Region-specific localization of NOS isoforms and NADPH-diaphorase activity in the intratesticular and excurrent duct systems of adult domestic cats (Felis catus).

    Science.gov (United States)

    Liman, Narin; Alan, Emel

    2016-03-01

    Nitric oxide (NO) is produced by nitric oxide synthases (NOSs) and plays an important role in all levels of reproduction from the brain to the reproductive organs. Recently, it has been discovered that all germ cells and Leydig cells in the cat testis exhibit stage-dependent nuclear and cytoplasmic endothelial (eNOS) and inducible (iNOS)-NOS immunoreactivity and cytoplasmic nicotinamide adenine dinucleotide phosphate-diaphorase (NADPH-d) reactivity. As a continuation of this finding, in this study, cellular localization of NADPH-d and immunolocalization and expression of all three NOS isoforms were investigated in the intratesticular (tubuli recti and rete testis), and excurrent ducts (efferent ductules, epididymal duct and vas deferens) of adult cats using histochemistry, immunohistochemistry and western blotting. NADPH-d activity was found in the midpiece of the spermatozoa tail and epithelial cells of all of ducts, except for nonciliated cells of the efferent ductules. Even though the immunoblotting results revealed similar levels of nNOS, eNOS and iNOS in the caput, corpus and cauda segments of epididymis and the vas deferens, immunostainings showed cell-specific localization in the efferent ductules and region- and cell-specific localization in the epididymal duct. All of three NOS isoforms were immunolocalized to the nuclear membrane and cytoplasm of the epithelial cells in all ducts, but were found in the tail and the cytoplasmic droplets of spermatozoa. These data suggest that NO/NOS activity might be of importance not only for the functions of the intratesticular and excurrent ducts but also for sperm maturation. PMID:26910642

  15. Isolation and characterization of viable Toxoplasma gondii isolates revealed possible high frequency of mixed infection in feral cats (felis domesticus) from St. Kitts, West Indies

    Science.gov (United States)

    Cats are essential in the epidemiology of Toxoplasma gondii because they are the only hosts that can excrete the environmentally resistant oocysts in nature. Samples of serum, feces, and tissues from feral cats from St. Kitts, West Indies were examined for T. gondii infection. Antibodies to T. gon...

  16. Ecología del gato montés ("Felis silvestris") y su relación con el conejo de monte ("Oryctolagus cuniculus")

    OpenAIRE

    Lozano Mendoza, Jorge

    2008-01-01

    Se ha estudiado la ecología del gato montés y su relación particular con el conejo de monte tanto en preferencias de hábitat, dieta, relaciones con ungulados y tendencias de población. El gato montés fue más abundante a escala de paisaje en los mosaicos formados por matorral y pastizal, siendo el matorral además la variable de hábitat más claramente asociada con la especie en todas las escalas espaciales. Por tanto, se identifica al matorral como un elemento estructural del medio clave para l...

  17. Short term preservation of chilled tomcat (Felis catus L.) spermatozoa, obtained by urethral catheterization after medetomidine administration, diluted with a laboratory prepared extender

    OpenAIRE

    Constantin Pavli; Irina O. Tănase

    2013-01-01

    Semen collection in tomcat represents the first step to establish a breeding protocol. Therefore we used a method of harvesting that involves little difficulties and discomfort for the test male. The method was described previously by Zambelli (2006) and is represented by semen collection by a tomcat catheter, after medetomidine administration. In a few cases, when was possible, semen was also collected by electroejaculation, the males were housed in individual cages and collectio...

  18. AVALIAÇÃO DE SEGURANÇA E ANALGESIA DE PROTOCOLOS ANESTÉSICOS PARA ELETROEJACULAÇÃO EM GATOS DOMÉSTICOS (Felis catus

    Directory of Open Access Journals (Sweden)

    TICIANA FRANCO PEREIRA DA SILVA

    2011-09-01

    Full Text Available The objective of this study was to evaluate the security and analgesia of anesthetics protocols usually used for electroejaculation (EEJ in domestic cats. Fourteen toms were anesthetized with 4 protocols and submitted to a 3 series of electric stimuli (2-6 mA. The heart rate, respiratory rate, temperature, pain sensibility and eyes blink were analyzed prior and after induction, and during and after electroejaculation. The anesthesia protocol thatused isoflurane was the best for analgesic parameters, security and speed of recuperation for electroejaculation in domestic cats

  19. AVALIAÇÃO DE SEGURANÇA E ANALGESIA DE PROTOCOLOS ANESTÉSICOS PARA ELETROEJACULAÇÃO EM GATOS DOMÉSTICOS (Felis catus)

    OpenAIRE

    TICIANA FRANCO PEREIRA DA SILVA; CARLOS GABRIEL ALMEIDA DIAS; CAMILA LOUISE ACKERMANN; FRANCISCO TIAGO SILVA PINHEIRO; ANA CRISTINA PAULINO BRAGA; LÚCIA DANIEL MACHADO DA SILVA

    2011-01-01

    The objective of this study was to evaluate the security and analgesia of anesthetics protocols usually used for electroejaculation (EEJ) in domestic cats. Fourteen toms were anesthetized with 4 protocols and submitted to a 3 series of electric stimuli (2-6 mA). The heart rate, respiratory rate, temperature, pain sensibility and eyes blink were analyzed prior and after induction, and during and after electroejaculation. The anesthesia protocol thatused isoflurane was the best for analgesic pa...

  20. Isoflavone metabolism in domestic fcats (Felis catus): comparison of plasma metabolites detected after ingestion of two different dietary forms of genistein daidzein

    NARCIS (Netherlands)

    Whitehouse-Tedd, K.; Cave, N.J.; Ugarte, C.E.; Waldron, L.A.; Prasain, J.K.; Arabshahi, A.; Barnes, S.; Hendriks, W.H.; Thomas, D.G.

    2013-01-01

    Some felid diets contain isoflavones but the metabolic capacity of cats towards isoflavones is relatively unknown, despite the understanding that isoflavones have divergent biological potential according to their metabolite end-products. The objective of this study was to determine the plasma metabo

  1. Absence of zoonotic Bartonella species in questing ticks: First detection of Bartonella clarridgeiae and Rickettsia felis in cat fleas in the Netherlands

    NARCIS (Netherlands)

    Tijsse-Klasen, E.; Fonville, M.; Gassner, F.; Nijhof, A.M.; Hovius, E.K.E.; Jongejan, F.; Takken, W.; Reimerink, J.R.; Overgaauw, P.A.M.; Sprong, H.

    2011-01-01

    Background: Awareness for flea-and tick-borne infections has grown in recent years and the range of microorganisms associated with these ectoparasites is rising. Bartonella henselae, the causative agent of Cat Scratch Disease, and other Bartonella species have been reported in fleas and ticks. The r

  2. SEROPREVALENCE OF Toxoplasma gondii (Nicole & Manceaux, 1909 AND RETROVIRAL STATUS OF CLIENT-OWNED PET CATS (Felis catus, Linnaeus, 1758 IN RIO DE JANEIRO, BRAZIL

    Directory of Open Access Journals (Sweden)

    Bethânia Ferreira Bastos

    2014-06-01

    Full Text Available Cats, as definitive host, play an important role in the transmission of Toxoplasma gondii. This study aimed to establish the seroprevalence of anti-T. gondii immunoglobulins G and M, and determine the frequency of oocysts in the feces of the domestic cat population in Rio de Janeiro, Brazil. We also aimed to study the association between T. gondii infection and age, sex, breed, lifestyle, diet and retroviral infection. A total of 108 cats were included in the study and fecal samples of 54 of those cats were obtained. Only 5.6% of the cats were seropositive for anti-T. gondii immunoglobulins using the indirect hemagglutination test. None of the 54 cats presented oocysts in their fecal samples. Although not statistically significant, males, mixed-breed, free-roaming and cats aged two years and older were found to be more exposed. Age, lifestyle and the use of litter boxes were found to play an important role as risk factors. Anemia and retroviral infections were independent of T. gondii infection. No antibodies were detected in the majority of cats (94.4%, indicating that those cats had never been exposed to the parasite and, therefore, once infected, they could present the risk of shedding large numbers of oocysts into the environment.

  3. Exame parasitológico de fezes de gatos (Felis catus domesticus domiciliados e errantes da Região Metropolitana do Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Serra Cathia Maria Barrientos

    2003-01-01

    Full Text Available Foram estudadas 131 amostras de fezes de gatos de comportamento domiciliado e errante da Região Metropolitana do Rio de Janeiro, obtendo-se uma positividade de 63,4% das amostras, com maior ocorrência no grupo de animais errantes. Foi observado predomínio de parasitismo por Ancylostoma sp (43,5%, Toxocara sp (19,1% e Cystoisospora sp (43,5% em ambos os grupos. Também foram encontrados ovos de Uncinaria sp (1,5%, Toxascaris leonina (7,6%, cistos de Giardia sp (6,1% e esporocistos de Sarcocystis sp (0,8%. A alta prevalência de enteroparasitas na amostra estudada ressalta a importância de um maior controle parasitológico nesses animais, para proteção da saúde animal e humana.

  4. Uso de la ecografía para el bloqueo de los nervios periféricos del miembro pelviano en el gato (Felis catus L.)

    OpenAIRE

    Haro Álvarez, Ana Paulina

    2013-01-01

    El presente estudio fue llevado a cabo para describir la apariencia ecográfica y desarrollar los abordajes ecoguiados para el bloqueo de los nervios ciático y femoral, así como evaluar la eficacia clínica del bloqueo ecoguiado del nervio ciático en el gato. Se realizaron disecciones anatómicas y criosecciones para determinar las marcas anatómicas para localizar los nervios de interés. La apariencia ecográfica de los nervios ciático y femoral fue estudiada tanto en cadáveres como en gatos vivo...

  5. The 18-kDa form of cat allergen Felis domesticus 1 (Fel d 1) is associated with gelatin- and fibronectin-degrading activity

    DEFF Research Database (Denmark)

    Ring, P C; Wan, H; Schou, C;

    2000-01-01

    BACKGROUND: Fel d 1, an important allergen from domestic cats, is a significant cause of asthma. In addition to directly promoting IgE synthesis, other biological activities of allergens may contribute to either allergic sensitization or the magnitude of allergic effector responses. For example...

  6. [Natural infestation of domestic cats (Felis catus L.) by Echinococcus multilocularis Leuckart, 1863 (Cestoda): first case in France detected in peri-urban area].

    Science.gov (United States)

    Pétavy, A F; Prost, C; Gevrey, J; Gilot, B; Deblock, S

    1988-01-01

    A minute specimen of a tapeworm from the small intestine of a domestic cat is related to Echinococcus multilocularis. The natural infestation of the cat by this species of cestode is demonstrated in France for the first time. The cat was captured in the field around buildings of the neighbourhood of Annemasse (Haute-Savoie). This case illustrates the possibility of an urban life cycle extension of alveolar echinococcosis in the permanent endemic areas of the zoonosis in France and also the eventual risks of contamination for urban dwellers by parasite eggs laying on the ground or on the carnivorous domestic animal furs. PMID:3144426

  7. COMPARISON BETWEEN TWO METHODS OF STAINING FOR ASSESSMENT OF MORPHOLOGY AND ACROSOME IN DOMESTIC CAT (Felis catus SPERMATOZOA COMPARAÇÃO ENTRE DOIS MÉTODOS DE COLORAÇÃO PARA ANÁLISE MORFOLÓGICA E ACROSSOMAL DE ESPERMATOZÓIDES DE GATO DOMÉSTICO (Felis catus.

    Directory of Open Access Journals (Sweden)

    Frederico Ozanam Papa

    2008-10-01

    Full Text Available

    The objective of this study was to evaluate the efficiency of the modified Karras staining technique (KA to analyze domestic cat sperm morphology by comparing it with the Fast Green FCF/ Rose Bengal staining (FR, previously used for this species. Four adult cats were used, from which sperm samples were collected four times in alternate days for each tom using an artificial vagina (n=16 ejaculates. Both staining techniques were performed for each ejaculate. For the FR staining technique, the semen in natura was diluted in 2.9% sodium citrate and, afterwards, in the staining solution. After 70 seconds, smears were made onto slide and dried at 37ºC. For the KA staining technique, previously made and formol saline fixed slides were sequentially immersed in Rose Bengal solution, Tannin solution, and Victoria Blue B solution, and dried at room temperature. For sperm evaluation, 200 sperm cells were assessed for each staining technique in all ejaculate samples using a bright field microscope at 1000X magnification. Statistical analysis used the non-parametric Wilcoxon test, establishing significance at p<0.05. For the KA staining technique, higher percentage of distal cytoplasmic droplets and lower percentage of sperm head defects were obtained when compared to the FR staining technique. This way, both staining techniques were not totally efficient for the assessment of morphological defects found in the domestic cat in natura spermatozoa.

    KEY WORDS: Acrosome, domestic cat, spermatozoa, sperm morphology, staining.

     

    O objetivo do estudo foi avaliar a eficiência do método de coloração Karras modificado (KA para a análise da morfologia espermática no gato doméstico através da comparação com a coloração Fast Green FCF/Rosa Bengala (FR, previamente utilizada para esta espécie. Utilizaram-se quatro gatos adultos, colhendo-se quatro vezes amostras de sêmen em dias alternados para cada animal através de vagina artificial (n=16 ejaculados. Para cada ejaculado, realizaram-se duas colorações. Para a coloração FR, o sêmen in natura foi diluído em citrato de sódio 2,9% e, posteriormente, em solução de coloração. Após setenta segundos, procedeu-se a esfregaços em lâminas, as quais foram secas a 37ºC. Para a coloração KA, os esfregaços previamente confeccionados e fixados em formol salino foram imersos seqüencialmente nas soluções de Rosa Bengala, Tanino e Azul Vitória e secas em temperatura ambiente. Avaliaram-se duzentas células para cada tipo de coloração em todos os ejaculados, usando-se microscópio de luz em aumento de 1.000X. Efetuou-se análise estatística mediante o teste não-paramétrico de Wilcoxon, estabelecendo diferença significativa quando p<0,05. Para a coloração de KA, obtiveram-se maior porcentagem de gota citoplasmática distal e menor porcentagem de defeitos de cabeça quando comparada à coloração FR. Assim, nenhuma das colorações mostrou-se totalmente eficiente na identificação dos defeitos de morfologia encontrados na avaliação do sêmen in natura de gatos domésticos.

    PALAVRAS-CHAVES: Acrossomo, coloração, espermatozóide, gato doméstico, morfologia espermática.

     

  8. Seroprevalence of Rickettsia bellii and Rickettsia felis in dogs, São José dos Pinhais, State of Paraná, Brazil Soroprevalência de Rickettsia bellii e Rickettsia felis em cães, São José dos Pinhais, Paraná, Brasil

    OpenAIRE

    Fernanda Silva Fortes; Iara Silveira; Jonas Moraes-Filho; Ronaldo Viana Leite; José Edivaldo Bonacim; Alexander Welker Biondo; Marcelo Bahia Labruna; Marcelo Beltrão Molento

    2010-01-01

    Brazilian spotted fever (BSF) is a vector-borne zoonosis caused by Rickettsia rickettsii bacteria. Dogs can be host sentinels for this bacterium. The aim of the study was to determine the presence of antibodies against Rickettsia spp. in dogs from the city of São José dos Pinhais, State of Paraná, Southern Brazil, where a human case of BSF was first reported in the state. Between February 2006 and July 2007, serum samples from 364 dogs were collected and tested at 1:64 dilutions by indirect i...

  9. Sanitary conditions of a colony of urban feral cats (Felis catus Linnaeus, 1758) in a zoological garden of Rio de Janeiro, Brazil Condições sanitárias de uma colônia urbana de gatos (Felis catus Linnaeus, 1758) em um jardim zoológico do Rio de Janeiro, Brasil

    OpenAIRE

    Flavya Mendes-de-Almeida; Maria Carolina Ferreira Faria; Aline Serricella Branco; Maria Lucia Serrão; Aline Moreira Souza; Nádia Almosny; Márcia Charme; Norma Labarthe

    2004-01-01

    The colony of urban stray cats living in the Rio de Janeiro zoological garden was studied in order to develop a population and health control program. As many cats as possible were captured during two months (47 animals) and were classified according to gender, age, weight and coat markings. They were submitted to a general health evaluation, examined for the presence of ectoparasites and sent to a surgical neutering program. All animals had a blood sample drawn for CBC, platelet count, heart...

  10. Occurrence of Leishmania (Leishmania chagasi in a domestic cat (Felis catus in Andradina, São Paulo, Brazil: case report Ocorrência de Leishmania (Leishmania chagasi em gato doméstico (Felis catus em Andradina, São Paulo, Brasil: relato de caso

    Directory of Open Access Journals (Sweden)

    Willian Marinho Dourado Coelho

    2010-12-01

    Full Text Available This work describes natural infection by Leishmania in a domestic cat where amastigote forms of the parasite were observed in the popliteal lymph node imprint. Positive and negative serological reactions were observed by enzyme-linked immunosorbent assay (ELISA and indirect immunofluorescence assay (IFA, respectively. Polymerase chain reaction (PCR revealed that the nucleotide sequence of the sample was identical to Leishmania (L. chagasi. This is the first report of the disease in felines of the city of Andradina, SP, an area considered endemic for canine and human visceral leishmaniasis.Neste trabalho, é relatada a infecção natural por Leishmania em um gato doméstico no qual, formas amastigotas do parasito foram observadas em imprint de linfonodo poplíteo. Reações sorológicas positivas e negativas foram observadas pelo teste de imunoadsorção enzimática (ELISA e reação de imunofluorescência indireta (RIFI, respectivamente. A reação em cadeia da polimerase (PCR revelou que a sequência de nucleotídeos foi idêntica à Leishmania (L. chagasi. Este é o primeiro relato da doença em felino da cidade de Andradina, Estado de São Paulo, Brasil, área considerada endêmica para leishmaniose visceral canina e humana.

  11. Occurrence of Leishmania (Leishmania) chagasi in a domestic cat (Felis catus) in Andradina, São Paulo, Brazil: case report Ocorrência de Leishmania (Leishmania) chagasi em gato doméstico (Felis catus) em Andradina, São Paulo, Brasil: relato de caso

    OpenAIRE

    Willian Marinho Dourado Coelho; Valéria Marçal Felix de Lima; Alessandro Francisco Talamini do Amarante; Helio Langoni; Virgínia Bodelão Richini Pereira; Aziz Abdelnour; Katia Denise Saraiva Bresciani

    2010-01-01

    This work describes natural infection by Leishmania in a domestic cat where amastigote forms of the parasite were observed in the popliteal lymph node imprint. Positive and negative serological reactions were observed by enzyme-linked immunosorbent assay (ELISA) and indirect immunofluorescence assay (IFA), respectively. Polymerase chain reaction (PCR) revealed that the nucleotide sequence of the sample was identical to Leishmania (L.) chagasi. This is the first report of the disease in feline...

  12. Efeito de dois métodos de resfriamento sobre a funçao espermática in vitro de semen criopreservado de felinos (Leopardus tigrinus, Leopardus pardalis E Felis catus), avaliada através de ensaio competitivo de ligaçao em ovócitos de gata doméstica (Felis

    OpenAIRE

    Baudi, Daiam Loyola Kampa

    2005-01-01

    A busca de estratégias eficientes para a manutenção de espécies em risco de extinção tem impulsionado a comunidade científica a pesquisar alternativas para a preservação de material genético, com intuito de formação de bancos de genoma e aplicação de biotécnicas reprodutivas. Este estudo teve por objetivo avaliar os efeitos de dois protocolos diferentes de resfriamento pré-congelamento para a criopreservação de sêmen de jaguatirica (n=3), gato-do-mato-pequeno (n=4) e gato doméstíco (n=15). Ap...

  13. Biologia reprodutiva dos bagres marinhos Genidens genidens (Valenciennes e Cathorops spixii (Agassiz (Siluriformes, Ariidae, na Baía de Sepetiba, Rio de Janeiro, Brasil Reproductive biology of the marine catfish Genidens genidens Valenciennes and Cathorops spixii Agassiz (Siluriformes, Ariidae in the Sepetiba Bay, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Iracema David Gomes

    1999-01-01

    Full Text Available The reproductive cycle of the marine catfishes Genidens genidens Valenciennes, 1833 and Cathorops spixii Agassiz, 1839 in the Sepetiba Bay, was assessed by an annual period of sampling from October 1993 to September 1994. The fishes were caught by standardized otter trawl and environmental parameters of temperature, salinity and transparency of water were recorded at each sampling. Five gonadal phases were described, based in macroscopic observations. Changes in the gonadosomatic index (GSI and in the percentual of stages of gonadal development showed that G. genidens spawns in Summer/early Autumn, coinciding with low salinity and high temperature and transparency. Cathorops spixii spawns in late Spring/early Summer, coinciding with rising temperature and transparency and low salinity. Total spawning are shown for both species, as indicated by length-frequency of oocytes per stages of maturation with two groups synchronic development of oocytes. Fecundity is low (10-23 oocytes, for G. genidens and 24-30 for C. spixii, when compared with other teleosteans, and was not strongly correlated to the total length (G. genidens, r=0.65, C. spixii, r=0.76. Strategy-k is developed by both species as indicated by high brood and enbrions protection and high body length.

  14. Caracterização macro- e microscópica dos ovários do bagre amarelo, Cathorops spixii (Agassiz, 1829, durante o ciclo reprodutivo Macro- and microscopic characterization of yellow-catfish Cathorops spixii (Agassis, 1829 ovaries during reproductive cycle

    Directory of Open Access Journals (Sweden)

    Jodir Pereira da Silva

    1998-01-01

    Full Text Available Este estudo é baseado na análise da anatomia macroscópica e da estrutura histológica de 452 ovários de fêmeas de Cathorops spixii coletadas nas Ilhas Pai Matos (região estuarino-lagunar de Cananéia-Iguape - 24°59'42"S 47°54'27"W, São Paulo, Brasil. Foram consideradas seis fases de desenvolvimento ovocitário, com base nas características citológicas das células germinativas durante o processo de maturação, e sete estádios de maturação ovarianos, determinados pela estrutura histológica dos ovários e pela ocorrência e freqüência relativa das seis fases ovocitárias: "A"(imaturo, "Bi" (em maturação inicial, "Bf'(em maturação final, "Ci"(parcialmente maduro, "Cf€�'(maduro, "D"(esvaziado e "R"(em recuperação. A presença de apenas um lote ovocitário, unido durante a desova por uma substncia adesiva acelular, sugere desova total, e o desenvolvimento ovocitário é classificado como sincrônico em grupos. A anatomia ovariana macroscópica e a estrutura histológica verificadas são características do tipo cistovariano.This study is based on the analysis of macroscopic anatomy and histological structure of 452 ovaries from females of Cathorops spixii caught in the "Pai Matos" islands (Cananéia-Iguape lagoonal-estuarine region - 24°59'42"S 47°54'27"W, São Paulo, Brazil. Six phases of oocyte development are considered, based on cytological characteristics of the germinative cells during the maturation process, and seven ovarian maturity stages, determined by histological structure of ovaries and by the occurrence and relative frequency of the six oocyte phases: "A"(immature, "Bi"(initial maturation, "Bf'(advanced maturation, "Ci"(partially mature, "Cf'(mature, "D"(spent and "R"(recuperation. The presence of a single patch of oocytes clustered during the spawn by an acellular adhesive substance, suggests total spawning, and the oocyte development is classified as synchronic in groups. The examined ovarian macroscopic anatomy and histological structure are characteristic of the cistovarian type.

  15. Dietary canitine maintains energy reserves and delays fatigue of exercised african catfish (Clarias gariepinus) fed high fat diets Carnitina dietética mantem reservas energéticas e evita a fatiga de bagre-africano durante exercício

    OpenAIRE

    Rodrigo Ozório; Vincent Van Ginneken; Guido van den Thillart; Martin Verstegen; Johan Verreth

    2005-01-01

    Lipids, together with proteins, are traditionally considered as primary fuels during aerobic swimming. The effects of dietary fat and carnitine supplements and exercise on the energy metabolism of juvenile fish were investigated. One hundred African catfish (Clarias gariepinus) were fed four isonitrogenous diets containing a fat level of 100 or 190 g kg-1 diet and one of the two levels of carnitine (15 and 1000 mg kg-1). Fish grew from 61 to 162 g in 10 wk. Thereafter, 6 fish per group swam v...

  16. Espectro trófico del bagre Ictalurus punctatus (Silurifomes: Ictaluridae), en la presa Lázaro Cárdenas, Indé, Durango, México Trophic spectrum of the catfish Ictalurus punctatus (Siluriformes: Ictaluridae), in the Lázaro Cárdenas reservoir, Indé, Durango, Mexico

    OpenAIRE

    Gabriel Fernando Cardoza Martínez; José Luis Estrada Rodríguez; Fernando Alonzo Rojo; Carmen Leticia Mar Tovar; Frances Gelwick

    2011-01-01

    Se analizó el contenido de 240 estómagos de Ictalurus punctatus (Rafinesque, 1818), colectados de 2006 a 2007, con el objetivo de determinar su espectro trófico, su variación por talla y época climática. Los contenidos estomacales se analizaron en laboratorio y los organismos se determinaron hasta nivel de orden. Los datos obtenidos fueron analizados por métodos cuantitativos y cualitativos. Los órdenes más frecuentes fueron Perciformes y Atheriniformes que corresponden a peces forraje, así c...

  17. Espectro trófico del bagre Ictalurus punctatus (Silurifomes: Ictaluridae, en la presa Lázaro Cárdenas, Indé, Durango, México Trophic spectrum of the catfish Ictalurus punctatus (Siluriformes: Ictaluridae, in the Lázaro Cárdenas reservoir, Indé, Durango, Mexico

    Directory of Open Access Journals (Sweden)

    Gabriel Fernando Cardoza Martínez

    2011-08-01

    Full Text Available Se analizó el contenido de 240 estómagos de Ictalurus punctatus (Rafinesque, 1818, colectados de 2006 a 2007, con el objetivo de determinar su espectro trófico, su variación por talla y época climática. Los contenidos estomacales se analizaron en laboratorio y los organismos se determinaron hasta nivel de orden. Los datos obtenidos fueron analizados por métodos cuantitativos y cualitativos. Los órdenes más frecuentes fueron Perciformes y Atheriniformes que corresponden a peces forraje, así como algas verdes del orden Charales. Además, se encontraron otros siete órdenes de invertebrados: Schizodonta, Odonata, Himenoptera, Orthoptera, Hemiptera, Homoptera y Scorpionida, además de dos órdenes de plantas: Poales y Fabales. El orden Perciforme constituyó casi la mitad del total del peso del contenido estomacal, seguido por los órdenes Atheriniforme y Charales. En las estaciones de verano e invierno se presentó el mayor número de estómagos vacíos, mientras que en primavera se encontró el mayor número de estómagos llenos. La cantidad de alimento ingerida en la estación de invierno fue significativamente menor que en las demás estaciones. El principal alimento en primavera, verano y otoño, fueron los peces, mientras que en invierno hubo mayor preferencia por las algas.Having the objective of determining their trophic spectrum and their variations within a year, the contents of 240 stomachs of Ictalurus punctatus (Rafinesque, 1818 were analyzed from 2006 to 2007. The items of the stomach contents were determined to the order level. The data was analyzed by different quantitative and qualitative methods. The most frequent orders were Perciforms and Atheriniforms corresponding to forage fish, along with green algae of the Charales order. Also, seven orders of invertebrates were found: Schizodonta, Odonata, Himenoptera, Orthoptera, Hemiptera, Homoptera and Scorpionida, and two orders of plants: Poales and Fabales. The Perciform order made up almost half of the total weight of the stomach contents, followed by the Atheriniform and the Charales orders. The greatest number of empty stomachs showed up during summer and winter, while the greatest number of filled-up stomachs was found during the spring season. The quantity of food consumed during winter time was significantly lower than the amount consumed during all other seasons. The kind of food consumed during the spring, summer and autumn was mainly fish, while algae were preferred during the winter season.

  18. Manual de métodos parasitológicos e histopatológicos en piscicultura

    OpenAIRE

    Keim, Albert

    1982-01-01

    Recientes problemas provocados por epiemias de infecciones de Ichthyophthirius multifiliie en la cría de bagre negro (Rhandia sapo) cultivado por el Departamento de Acuicultura del INAPE de Uruguay, y el conocimiento de que todos los piscicultores tienen problemas con los parásitos, constituyeron la base y antecedente para el inicio de un programa de investigaciones parasitológicas. Este programa incluyó. 1) Disección de bagres capturados en Laguna de Sauce y colecta de parásitos. 2) Disecció...

  19. Dicty_cDB: CHH715 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 215...an tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90 1e-13 1 BM0585...78 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clon

  20. Dicty_cDB: SHA256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85, mRNA sequence. 92 3e-14 1 DR447725 |DR4477...94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cD...acted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90 1e-13 1 dna update 2005.12. 5

  1. Parasites of domestic and wild animals in South Africa. XLIV. Fleas (Insecta : Siphonaptera : Pulicidae collected from 15 carnivore species

    Directory of Open Access Journals (Sweden)

    I.G. Horak

    2004-11-01

    Full Text Available Fleas were collected from 61 wild carnivores belonging to 13 species in various nature reserves and on farms, two feral domestic cats in a nature reserve and a domestic dog in the city of Johannesburg. Eleven flea species, including two subspecies of one of these, belonging to six genera were recovered. Amongst these only Ctenocephalides felis felis and Ctenocephalides felis strongylus are considered specific parasites of carnivores. The remaining ten species normally infest the prey animals of the various carnivores.

  2. Toxoplasma gondii, Dirofilaria immitis, feline immunodeficiency virus (FIV), and feline leukemia virus (FeLV) infections in stray and pet cats (Felis catus) in northwest China: co-infections and risk factors.

    Science.gov (United States)

    Cong, Wei; Meng, Qing-Feng; Blaga, Radu; Villena, Isabelle; Zhu, Xing-Quan; Qian, Ai-Dong

    2016-01-01

    This study was conducted to estimate the prevalence of Toxoplasma gondii, Dirofilaria immitis, feline immunodeficiency virus (FIV), and feline leukemia virus (FeLV) infections among stray and pet cats in Lanzhou, northwest China, and to identify the influence of age, gender, and regions on seropositivity. T. gondii antibodies were examined in cat sera by the modified agglutination test (MAT). The circulating antigens of D. immitis and FeLV and specific antibodies to FIV were examined using kits commercially available. The overall prevalence of T. gondii, FIV, FeLV, and D. immitis was 19.34, 9.12, 11.33, and 3.04 %, respectively. For the genetic characterization of T. gondii genotypes in cats, genomic DNA was extracted from the seropositive cats and the T. gondii B1 gene was amplified using a semi-nested PCR. DNA samples giving positive B1 amplification were then genotyped using multilocus PCR-RFLP. Two T. gondii genotypes (ToxoDB#9 and ToxoDB#1) were identified. Results of the multivariate logistic regression analysis showed that older cats are more likely to be seropositive than juveniles for T. gondii, FIV, FeLV, and D. immitis. This is the first report of T. gondii genotypes in cats in northwest China. Moreover, the present study is the first study of retrovirus and D. immitis seroprevalence in cats in China. The results revealed that T. gondii, FIV, and FeLV infections are common in stray and pet cats in northwest China. PMID:26362646

  3. DETECTION OF RICKETTSIA FELIS LIKE AGENT FROM EULAELAPS STABULARIS KOCH%从厩真厉螨中检出与猫立克次体近缘的立克次体核酸片段

    Institute of Scientific and Technical Information of China (English)

    姚李四; 刘勇先; 邵丽筠; 张晓龙; 杨宇; 王静; 徐宝梁; 王宝麟; 赵彤言

    2012-01-01

    本研究用立克次体属特异的gltA和ompB基因扩增引物,从吉林长白县捕获鼠中分拣的534只厩真厉螨中扩得gltA和ompB基因片段.通过基因片段的序列测定、BLAST比对和系统发育分析,显示两个扩增基因与猫立克次体Rickettsia felis同源性最高(99%),证明该地区厩真厉螨携带与猫立克次体近缘的立克次体.%The segments of glt A gene and omp B gene were amplified and identified with Rickettsia specific git A and omp B primers from 534 mites (Eulaelaps stabularis Koch) collected from rodents of Changbai County, Jilin Province, China. By sequencing, BLAST qualifying and phylogenetic analyzing, it was revealed that the two amplified segments were of highest homology to Rickettsia fells (99% ) , implying that the locally collected E. Stabularis may carry some Rickettsia sp. Allied to Rickettsia fells.

  4. Efecto del fotoperíodo y de la administración de melatonina sobre la producción espermática en el gato doméstico (Felis silvestris catus)

    OpenAIRE

    Núñez Favre, Romina de los Ángeles

    2013-01-01

    En el felino doméstico, la estacionalidad ovulatoria y estral de la hembra ocurre durante los días que presentan más de 12 h luz. Sin embargo, la estacionalidad reproductiva del gato ha sido definida recientemente. El objetivo de esta tesis fue estudiar el efecto del fotoperiodo natural, el manejo lumínico artificial y la administración de melatonina sobre la producción espermática en el gato doméstico. En el primer estudio se evaluó el efecto del fotoperiodo natural sobre la morfología testi...

  5. Dicty_cDB: SLJ752 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA sequence. ...acted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 60 1e-05 1 CA916753 |CA916753.1

  6. Dicty_cDB: CHE836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone... 2154-85, mRNA sequence. 92 2e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalide...hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA

  7. Dicty_cDB: Contig-U12539-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AP006861_737( AP006861 |pid:none) Chlamydophila felis Fe/C-56 DNA,... 38 0.76 CU638744_458( CU638744 |pid:none) Podospo..._3927( CP000667 |pid:none) Salinispora tropica CNB-440, co... 36 2.9 AP006861_730( AP006861 |pid:none) Chlamydophila feli...CP000686 |pid:none) Roseiflexus sp. RS-1, complete ... 46 0.004 AP006861_723( AP006861 |pid:none) Chlamydophila feli...P006861_722( AP006861 |pid:none) Chlamydophila felis Fe/C-56 DNA,... 44 0.018 AE0...|pid:none) Chlamydia trachomatis strain TW-3 ... 41 0.090 AP006861_721( AP006861 |pid:none) Chlamydophila feli

  8. Endemic pemphigus over a century: Part II

    OpenAIRE

    Ana María Abréu-Vélez; Ana Maria Roselino; Howard, Michael S.; Iara J. de Messias Reason

    2010-01-01

    Background : Endemic pemphigus foliaceus (EPF) is an autoimmune disease, classically occurring in a restricted geographic area. Foci of EPF have been described in several Central and South American countries, often affecting young people and Amerindians, with some female predilection. Although most American EPF cases have been documented in Brazil, cases have been reported in Peru, Paraguay, El Salvador and Venezuela. An additional variant of EPF has been described in El Bagre, Colombia, (El ...

  9. A Hypothesis Concerning a Potential Involvement of Ceramide in Apoptosis and Acantholysis Induced by Pemphigus Autoantibodies

    OpenAIRE

    Bollag, Wendy B.

    2010-01-01

    Autoimmune diseases affect more than 50 million Americans, resulting in significant healthcare costs. Most autoimmune diseases occur sporadically; however, endemic pemphigus foliaceus (EPF) is an autoimmune skin disease localized to specific geographic loci. EPF, and the related diseases pemphigus vulgaris (PV) and pemphigus foliaceus (PF), are characterized by skin lesions and autoantibodies to molecules found on epidermal keratinocytes. A variant of EPF in patients from El Bagre, Colombia, ...

  10. Dicty_cDB: SHH217 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides feli...9 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDN...2018A03 5', mRNA sequence. 88 6e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 1e-13 1 BM058379 |BM058379.1 2191-2

  11. Dicty_cDB: AHA269 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clo...BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDN...ne 2154-85, mRNA sequence. 92 2e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 8e-14 1

  12. A Hypothesis Concerning a Potential Involvement of Ceramide in Apoptosis and Acantholysis Induced by Pemphigus Autoantibodies

    Directory of Open Access Journals (Sweden)

    Wendy B. Bollag

    2010-01-01

    Full Text Available Autoimmune diseases affect more than 50 million Americans, resulting in significant healthcare costs. Most autoimmune diseases occur sporadically; however, endemic pemphigus foliaceus (EPF is an autoimmune skin disease localized to specific geographic loci. EPF, and the related diseases pemphigus vulgaris (PV and pemphigus foliaceus (PF, are characterized by skin lesions and autoantibodies to molecules found on epidermal keratinocytes. A variant of EPF in patients from El Bagre, Colombia, South America, has recently been reported to be distinct from previously described loci in Brazil and Tunisia epidemiologically and immunologically. As in PF and EPF, El Bagre EPF patients exhibit autoantibodies towards desmoglein-1, a cell adhesion molecule critical for maintaining epidermal integrity. An association of El Bagre EPF with sun exposure has been detected, and ultraviolet irradiation also exacerbates symptoms in PV, PF and EPF. Our hypothesis is that: (1 the autoantibodies generate pathology through an alteration in ceramide metabolism in targeted keratinocytes, resulting in apoptosis and/or cell death and acantholysis, but only when the cell's ability to metabolize ceramide is exceeded, and (2 apoptosis in response to this altered ceramide metabolism is initiated and/or exacerbated by other agents that increase ceramide levels, such as cytokines, ultraviolet irradiation, and senescence.

  13. Avaliação do jundiá (Rhamdia quelen em diferentes sistemas de cultivo para a região do litoral centro norte de Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Hilton Amaral Junior

    2008-12-01

    Full Text Available El bagre (Rhamdia quelen, un pez nativo habitante de la mayoría de los ríos, lagos y lagunas de Santa Catarina, y que pertenecen a la orden Siluriformes, familia Pimelodidae, género Rhandia. El estudio tiene como objetivo evaluar el desempeño de este pez nativo en los sistemas más utilizados en Santa Catarina. El experimento se llevó a cabo en el ámbito del Campo Experimental de Piscicultura de Camboriú CEPC-EPAGRI, cuando 11 tanques excavados fueron utilizados, tres en representación de un monocultivo de bagre con una densidad de 1,5 p/m2, tres en representación de un bicultivo de bagre y tilapia con una densidad de 3p/m2, tres en representación de un policultivo de la carpa, tilapia y "jundiás" con una densidad de 3p/m2, y en dos tanques excavados fueron instalados seis tanques redes, en representación de las culturas de alta densidad de 50 y 100 p/m3.

  14. CROSS TRANSMISSION OF 'GIARDIA'

    Science.gov (United States)

    Giardia cysts isolated from fecal samples obtained from humans (Homo sapiens), beaver (Castor canadensis), dogs (Canis familiaris), cats (Felis domesticus), bighorn X mouflon sheep (Ovis canadensis X O. musimon), guinea pig (Cavis porcellus), muskrat (Ondatra ziethica) and mule d...

  15. Mercury contamination in Florida panthers [Draft

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — As a result of the death of an apparently healthy, radio-collared female Florida panther (Felis concolor qoryi) (FP#27) in Everglades National Park in July 1989, we...

  16. Tõsõ mu maailman : [luuletused] / Häniläne, pseud.

    Index Scriptorium Estoniae

    Häniläne,, pseud.

    2008-01-01

    Sisu: Bombus lucorum (maakimalane) ; Podiceps auritus (sarvikpütt) ; Malus domestica (aed-õunapuu) ; Felis catus domesticus (kodukass) ; Inachis io (päevapaabusilm) ; Lacerta vivipara (arusisalik) ; Canis familiaris (kodukoer) ; Clangula hyemalis (aul)

  17. Howland, Baker and Jarvis Islands 25 Years after Cat Eradication: the Recovery of Seabirds in a Biogeographical Context

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Feral cats Felis catus were eradicated from Howland, Baker and Jarvis Islands, all U.S. National Wildlife Refuges in the equatorial Central Pacifi c Ocean, by the...

  18. Dicty_cDB: VSK384 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pighian tubule cDNA library Ctenocephalides felis cDNA clone 3232-81, mRNA sequence. 40 0.60 2 BM059302 |BM0...59302.1 2243-04 hindgut and Malpighian tubule cDNA library Ctenocephalides felis cDNA clone 2243-04, mRNA se...quence. 40 0.63 2 BF779703 |BF779703.1 3232-82 hindgut and Malpighian tubule cDNA library Ctenocephalides

  19. Dicty_cDB: VHD773 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85...uence. 88 7e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...hian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRN

  20. Dicty_cDB: AFK408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2154...-85, mRNA sequence. 92 1e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...ut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. 90

  1. Dicty_cDB: VSG402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available M058328 |BM058328.1 2189-54 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA...d cDNA library Ctenocephalides felis cDNA clone 2163-12, mRNA sequence. 42 3.7 1 ... clone 2189-54, mRNA sequence. 42 3.7 1 BM057177 |BM057177.1 2163-12 hindgut and Malpighian tubule subtracte

  2. Dicty_cDB: VSD850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available exiguus. 42 0.13 2 BF779702 |BF779702.1 3232-81 hindgut and Malpighian tubule cDNA library Ctenocephalides ...e cDNA library Ctenocephalides felis cDNA clone 2243-04, mRNA sequence. 40 0.26 2...felis cDNA clone 3232-81, mRNA sequence. 40 0.24 2 BM059302 |BM059302.1 2243-04 hindgut and Malpighian tubul

  3. The Carnivores of the Northeastern Badia, Jordan

    OpenAIRE

    BUNAIAN, Fayez

    2001-01-01

    The presence of 8 carnivores representing 3 families (Canidae, Felidae and Hyaenidae) in the northeastern Badia was con-firmed by trapping and spotlighting. The family Canidae is represented by 4 species: Canis aureus syriaca, Canis lupus arabs, Vulpes vulpes and Vulpes rueppelli. Three felines, Caracal caracal schmitzi, Felis margarita and Felis sylvestris tristrami, were spotlighted. Remains of recently killed Hyaena hyaena syriacawere recovered. Major threats affecting the population of d...

  4. Caratterizzazione biometrica di popolazioni selvatiche di gatto selvatico sardo

    OpenAIRE

    Murgia, Carlo; Murgia, Andrea; Deiana, Anna Maria

    2005-01-01

    This paper is about the variation in body size and cranial dimensions in natural population of the Sardinian wildcat. We have recorded biometric measures of 40 wildcats (24 male and 16 female) collected or captured in different localities of Sardinia. Craniometrical measures were taken on seven of these cats. The results obtained in this study indicate that the Sardinian wildcat is smaller than the European (Felis silvestris silvestris) and the African (Felis silvestris libyca) wildcat. Crani...

  5. Transmission mechanisms of an emerging insect-borne rickettsial pathogen

    OpenAIRE

    Brown, Lisa D.; Kaikhushroo H Banajee; Lane D Foil; Macaluso, Kevin R.

    2016-01-01

    Background Vector-borne pathogens must overcome arthropod infection and escape barriers (e.g. midgut and salivary glands) during the extrinsic incubation period (EIP) before subsequent transmission to another host. This particular timespan is undetermined for the etiological agent of flea-borne spotted fever (Rickettsia felis). Artificial acquisition of R. felis by blood-feeding cat fleas revealed dissemination to the salivary glands after seven days; however, this length of time is inconsist...

  6. Haemobartonellosis in Van Cats

    OpenAIRE

    AKKAN, Hasan Altan; Karaca, Mehmet; TÜTÜNCÜ, Mehmet

    2005-01-01

    The present study was conducted to determine prevalence of Haemobartonella felis in Van cats. 121 Van cats (82 female, 39 male, aged 1-9 years) were the materials of the study. To determine biochemical and haematological parameters, 2 ml blood with and without anticoagulant were taken according to technique from vena cephalica antebrachii. H. felis was detected in blood smears preparations of 18 (14.88%) by Papenheim staining. Among biochemical parameters aspartate amino transferase (AST), al...

  7. A comparative study on electrochemical cycling stability of lithium rich layered cathode materials Li1.2Ni0.13M0.13Mn0.54O2 where M = Fe or Co

    Science.gov (United States)

    Laisa, C. P.; Nanda Kumar, A. K.; Selva Chandrasekaran, S.; Murugan, P.; Lakshminarasimhan, N.; Govindaraj, R.; Ramesha, K.

    2016-08-01

    In this work we compare electrochemical cycling stability of Fe containing Li rich phase Li1.2Ni0.13Fe0.13Mn0.54O2 (Fe-Li rich) with the well-known Co containing Li rich composition Li1.2Ni0.13Co0.13Mn0.54O2 (Co-Li rich). During the first charge, the activation plateau corresponding to removal of Li2O from the structure is smaller (removal of 0.6 Li) in the case of Fe-Li rich compared to Co-Li rich composition (0.8 Li removal). Consequently, the Fe compound shows better capacity retention; for example, after 100 cycles Fe-Li rich compound exhibits 20% capacity degradation where as it is about 40% in the case of Co-Li rich phase. The electrochemical and microscopy studies support the fact that compared to Co-Li rich compound, the Fe-Li rich composition display smaller voltage decay and reduced spinel conversion. XPS studies on charged/discharged Fe-Li rich samples show participation of Fe+3/Fe+4 redox during electrochemical cycling which is further supported by our first principles calculations. Also the temperature dependent magnetic studies on charge-discharged samples of Fe-Li rich compound point out that magnetic behavior is sensitive to cation oxidation states and Ni/Li disorder.

  8. Ankara Kedilerinde (Felis catus angorensis) dış yapı, tüy, büyüme, gelişme ve üreme özellikleri üzerine araştırmalar

    OpenAIRE

    ÖZÇETİN, Sebahattin Tarkan

    2007-01-01

    Ankara Atatürk Orman Çiftliği (A.O.Ç.) Hayvanat Bahçesinde yetiştirilen 5 erkek, 28 dişi ve bu kedilerden doğan 70  yavru  ile  Ankara’nın  çeşitli  semtlerinde  bakılan  11  erkek, 10 dişi, 4 kastre erkek ve 9 steril dişi olmak üzere toplam 137 Ankara Kedisinin kullanıldığı   çalışmada  Ankara Kedisinin dış yapı, tüy, büyüme, gelişme ve üreme özellikleri incelenmiştir. Ankara A.O.Ç. Ha...

  9. Endemic pemphigus over a century: Part II

    Directory of Open Access Journals (Sweden)

    Ana María Abréu-Vélez

    2010-03-01

    Full Text Available Background: Endemic pemphigus foliaceus (EPF is an autoimmune disease, classically occurring in a restricted geographic area. Foci of EPF have been described in several Central and South American countries, often affecting young people and Amerindians, with some female predilection. Although most American EPF cases have been documented in Brazil, cases have been reported in Peru, Paraguay, El Salvador and Venezuela. An additional variant of EPF has been described in El Bagre, Colombia, (El Bagre-EPF affecting older men and a few post-menopausal females. Finally, one additional type of EPF has been described in nomadic tribes affecting females of child bearing age in Tunisia, Africa. Aims: The main aim of this review is to summarize current knowledge about autoantigens, and immunologic and genetic studies in EPF. Material and Methods: We utilized a retrospective review of the literature, aiming to compile and compare the multiple geographic foci of EPF. Results: The primary autoantigens in EPF are still considered to be desmogleins in the case of the Tunisian and all American cases, in contradistinction to plakins and desmogleins in El Bagre-EPF. Although several autoantigens are been suggested, their biochemical nature needs further elucidation. Current knowledge still supports the concept that an antibody mediated immune response represents the principal pathophysiology in all variants of EPF. Conclusion: A strong genetic susceptibility appears to contribute to disease development in several people affected by these diseases; however, no specific genes have been confirmed at present. We conclude that further investigation is necessary to define these disorders immunologically and genetically.

  10. Endemic pemphigus over a century: Part II

    Directory of Open Access Journals (Sweden)

    Ana María Abréu-Vélez

    2010-01-01

    Full Text Available Background : Endemic pemphigus foliaceus (EPF is an autoimmune disease, classically occurring in a restricted geographic area. Foci of EPF have been described in several Central and South American countries, often affecting young people and Amerindians, with some female predilection. Although most American EPF cases have been documented in Brazil, cases have been reported in Peru, Paraguay, El Salvador and Venezuela. An additional variant of EPF has been described in El Bagre, Colombia, (El Bagre-EPF affecting older men and a few post-menopausal females. Finally, one additional type of EPF has been described in nomadic tribes affecting females of child bearing age in Tunisia, Africa. Aims: The main aim of this review is to summarize current knowledge about autoantigens, and immunologic and genetic studies in EPF. Material and Methods: We utilized a retrospective review of the literature, aiming to compile and compare the multiple geographic foci of EPF. Results: The primary autoantigens in EPF are still considered to be desmogleins in the case of the Tunisian and all American cases, in contradistinction to plakins and desmogleins in El Bagre-EPF. Although several autoantigens are been suggested, their biochemical nature needs further elucidation. Current knowledge still supports the concept that an antibody mediated immune response represents the principal pathophysiology in all variants of EPF. Conclusion : A strong genetic susceptibility appears to contribute to disease development in several people affected by these diseases; however, no specific genes have been confirmed at present. We conclude that further investigation is necessary to define these disorders immunologically and genetically.

  11. MAST CELLS, MAST/STEM CELL GROWTH FACTOR RECEPTOR (C-KIT/CD117 AND IGE MAY BE INTEGRAL TO THE PATHOGENESIS OF ENDEMIC PEMPHIGUS FOLIACEUS

    Directory of Open Access Journals (Sweden)

    Ana Maria Roselino

    2013-11-01

    Full Text Available Introduction: Pemphigus foliaceus (PF is endemic in some South American countries, especially in Colombia and Brazil; in Brazil, it is also known as fogo selvagem (FS. We aimed to study the presence of mast cells and the expression of the mast/stem cell growth factor receptor (c-kit/CD117 in PF skin biopsies, as well as the role of IgE in the disease pathogenesis. Methods: Forty-four skin biopsies from patients affected by endemic PF (EPF (30 patients from El Bagre, Colombia, and 14 from the northeastern region of São Paulo State, Brazil, 48 control biopsies from Colombian and Brazilian endemic areas, and additional control biopsies from none endemic areas in Colombia and the USA non were studied. Immunohistochemistry (IHC was performed to evaluate skin biopsies with anti-mast cell tryptase (MCT, anti-c-kit and anti-IgE antibodies. We also searched for serum IgE in 30 EPF and 30 non-atopic controls from the El Bagre region via ELISA. In our El Bagre patients and controls, we also searched for IgE in skin samples by direct immunofluorescence. Results: In 100% of the EPF biopsies, MCT, c-kit and IgE were identified with stronger expression relative to control biopsies, especially in the inflammatory infiltrates around upper dermal blood vessels and dermal eccrine glands. IgE staining was positive along the BMZ in some EPF skin samples. The DIF results confirmed a linear deposition of IgE at the BMZ. Increased IgE serum levels were also noted in PF patients relative to controls.. Conclusions: In patients with EPF, the observed increased expression of MCT, c-kit and IgE in lesional skin, associated with higher serum IgE levels may indicate possible IgE participation in the antigenic response.

  12. Determination of the prevalence of Helicobacter heilmannii-like organisms type 2 (HHLO-2) infection in humans and dogs using non-invasive genus/species-specific PCR in Korea.

    Science.gov (United States)

    Chung, Tae-Ho; Kim, Hee-Dong; Lee, Young-Sun; Hwang, Cheol-Yong

    2014-01-01

    Helicobacter spp. may have multiple routes of transmission. It is unclear, however, whether the agent is zoonotic and therefore transmitted from an animal reservoir, including dogs. The aim of this population-based study was to assess the relationship between pet ownership or frequent exposure to dogs and Helicobacter spp. infection, especially focusing on HHLO-2 (Helicobacter heilmannii-like organisms type 2) in saliva and feces samples in Korea, using non-invasive genus/species-specific PCR. One hundred twenty-four eligible human subjects and 39 dogs participated in this study. Relativity of contact with dogs and Helicobacter spp. infection diagnosed by genus-specific PCR showed a statistically significant result (Pdogs and H. pylori, H. felis and H. bizzozeronii infections diagnosed using species-specific PCR, only Helicobacter felis showed a statistically significant result. Although H. pylori infection showed a statistically significant relativity, no statistically significant association was found between veterinarian subjects and Helicobacter. spp., H. felis and H. bizzozeronii infections. On performing risk factor analyses of HHLO-2 infection by transmission, using matching species, between HHLO-2-positive dog owners and HHLO-2-positive dogs, Helicobacter felis infection showed an extremely significant relativity (Pdogs was proved to be correlated with human H. felis and H. bizzozeronii infections in this study. PMID:24065079

  13. Phylogeography of the Neotropical catfish Pimelodus albicans (Siluriformes: Pimelodidae) from río de la Plata basin, South America, and conservation remarks

    OpenAIRE

    Julia Vergara; María de las Mercedes Azpelicueta; Graciela Garcia

    2008-01-01

    Pimelodus albicans Valenciennes, 1840 (common name "moncholo" or "bagre blanco") is an endemic species of the family Pimelodidae in the río de la Plata basin. Phylogenetic approach based on cytochrome b sequences was performed to test the existence of a unique evolutionary lineage in P. albicans and to discriminate populations units or subpopulations related to a migration behavior of this taxon in the río de la Plata basin. This study included 34 samples of P. albicans of different collectin...

  14. Malaria vivax en niños: aspectos clínicos y respuesta a la cloroquina.

    OpenAIRE

    Jaime Carmona Fonseca; Rosa M. Uscátegui; Adriana María Correa

    2009-01-01

    Introducción: En Colombia, no hay información actualizada sobre malaria vivax en niños. Objetivo: Describir el cuadro clínico-paraclínico de la enfermedad y evaluar la eficacia de la cloroquina (dosis estándar) para curar el ataque agudo de paludismo vivax en niños (4-10 años). Metodología: Diseño experimental, balanceado, no ciego; 82 pacientes, residentes en Turbo o El Bagre. Seguimiento, 30 días. Resultados: Los síntomas y signos concordaron con la literatura. Hubo desnutrición de largo pl...

  15. La malaria en Colombia, Antioquia y las zonas de Urabá y Bajo Cauca: panorama para interpretar la falla terapéutica antimalárica. Parte 1

    OpenAIRE

    Jaime Cardona Fonseca

    2003-01-01

    Antecedentes y Problema: en 1998-2002 se investigó en Antioquia (Turbo, Zaragoza y El Bagre), la eficacia terapéutica de medicamentos y combinaciones antimaláricos. La interpretación de la respuesta terapéutica (adecuada, fallas precoz y tardía) requiere información adicional para una mejor comprensión. Objetivo: definir un marco de referencia para interpretar los resultados de las evaluaciones de respuesta terapéutica antimalárica, constituido por información sobre el comportamiento de los p...

  16. Salida de campo a Ribera del Cubo (o Torre Duero, en Torrecilla de Abadesa), Vega Mayor y Tordesillas, Valladolid, el 4 y 5 de noviembre de 1952

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo a Ribera del Cubo (seguramente, sinónimo de Torre Duero, que se halla en la localidad de Torrecilla de Abadesa), Vega Mayor (seguramente, zona cercana a Villalar de los Comuneros) y Tordesillas, todos en la provincia de Valladolid, el 4 y 5 de noviembre de 1952, de la que se anotaron observaciones sobre el pez Squalius cephalus (Bagre, llamado Leuciscus cephalus por el autor), hallado en el estómado de una Garza real, y las siguientes aves: Actitis hypoleucos (Andarríos chico,...

  17. Isolation and identification of Helicobacter spp, from canine and feline gastric mucosa

    DEFF Research Database (Denmark)

    Jalava, K.; On, Stephen L.W.; VanDamme, P.A.R.;

    1998-01-01

    It is known that virtually all healthy adult dogs and cats harbor spiral helicobacters in their gastric mucosa, Three species, Helicobacter felis, Helicobacter bizzozeronii, and Helicobacter salomonis have been isolated in vitro from the gastric mucosa of these animals. The aims of this study were...... standardized conventional phenotypic tests, whole-cell protein profiling, and ultrastructural analysis in identifying the different species isolated from canine and feline gastric mucose. We cultured 95 and 22 gastric mucosal biopsies from dogs and cats, respectively. Twenty-one H. bizzozeronii strains, 8 H....... felis strains, 8 H. salomonis strains, 3 mixed cultures, 2 "Flexispira rappini"-like organisms, and 3 as get uncharacterized strains were isolated from the dogs, and 3 H. felis strains were isolated from the cats. The methods used here yielded Helicobacter isolation rates of 51% from dogs and 13.6% from...

  18. Dicty_cDB: FC-AO13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2191-29, mRNA sequence. ...76 4e-10 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...bule subtracted cDNA library Ctenocephalides felis cDNA clone 2154-85, mRNA seque...privation. 68 9e-08 1 BM059287 |BM059287.1 2241-52 hindgut and Malpighian tubule cDNA library Ctenocephalides

  19. Dicty_cDB: CHQ652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA sequence. 90 ...1e-13 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides f...d cDNA library Ctenocephalides felis cDNA clone 2154-85, mRNA sequence. 92 3e-14 1 DR447725 |DR447725.1 AR10.... 66 4e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracte

  20. Development of long-pulse, high-flatness pulse power supply for an S-band klystron

    International Nuclear Information System (INIS)

    FELI(Free Electron Laser Research Institute, Inc.) is constructing a free electron laser facility covering from 20 μm (infra-red region) to 0.35 μm (ultra-violet region), using an S-band linac. This linac uses two S-band klystrons capable of supplying long and flat microwave pulse in order to get the high stable and high quality FELs. In this paper, a long-pulse(24μs), high-flatness(0.08%) klystron pulse power supply developed by FELI and Nissin Electric Co. is described. (author)

  1. A genetic basis for atrophy: dominant non-responsiveness and helicobacter induced gastritis in F1 hybrid mice

    OpenAIRE

    Sutton, P.; Wilson, J.; Genta, R; Torrey, D; Savinainen, A; Pappo, J; Lee, A.

    1999-01-01

    BACKGROUND—The importance of host factors in helicobacter induced gastritis has been shown in animal models. Infection of most mouse strains with Helicobacter felis results in a functional atrophic gastritis, while other strains remain gastritis free.
AIMS—To investigate these host factors further by using genetic crosses of responder and non-responder mice.
METHODS—F1 hybrids of the non-responder CBA/Ca strain and three strains of mice known to develop H felis induced gastritis were infected...

  2. ЭКОЛОГО-ФАУНИСТИЧЕСКАЯ ХАРАКТЕРИСТИКА ГЕЛЬМИНТОЦЕНОЗА КАВКАЗКОГО ЛЕСНОГО КОТА (FELIS SILVESTRIS DAEMON)

    OpenAIRE

    Итин Г.С.; Кравченко В.М.

    2012-01-01

    One represented the helminth coenoses in 12 European wild cats which all were infected by helminths. Mainly helminth coenoses were composed of three-four species. Totally 18 helminth species were recovered in European wild cats.

  3. Modelling growth-competition relationships in trembling aspen and white spruce mixed boreal forests of Western Canada.

    Directory of Open Access Journals (Sweden)

    Jian-Guo Huang

    Full Text Available We examined the effect of competition on stem growth of Picea glauca and Populus tremuloides in boreal mixedwood stands during the stem exclusion stage. We combined traditional approaches of collecting competition data with dendrochronology to provide retrospective measurements of stem diameter growth. Several competition indices including stand basal area (BA, the sum of stem diameter at breast height (SDBH, and density (N for the broadleaf and coniferous species, as well as similar indices considering only trees with diameters greater than each subject (BAGR, SDBHGR, and NGR, were evaluated. We used a nonlinear mixed model to characterize the basal area increment over the past 5, 10, 15, 20, 25, 30, and 35 years as a function of growth of nearby dominant trees, the size of the subject trees, deciduous and coniferous competition indices, and ecoregions. SDBHGR and BAGR were better predictors for spruce, and SDBHGR and NGR were better for aspen, respectively, than other indices. Results showed strongest correlations with long-term stem growth, as the best models integrated growth for 10-25 years for aspen and ≥ 25 for spruce. Our model demonstrated a remarkable capability (adjusted R(2>0.67 to represent this complex variation in growth as a function of site, size and competition.

  4. Evaluation of mercury, selenium and methylmercury in fish consumed by Santos Bay communities, Sao Paulo, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Farias, Luciana A.; Favaro, Deborah I.T. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mail: lufarias@usp.br; Azevedo, Juliana de S.; Braga, Elisabete S. [Sao Paulo Univ., SP (Brazil). Inst. Oceanografico. Lab. de Nutrientes, Micronutrientes e Tracos no Mar (LABNUT)]. E-mail: juliana@io.usp.br

    2005-07-01

    In the present study, mercury and selenium levels were evaluated in fish tissues and fish organs in the Santos Bay, Sao Paulo State, southeastern Brazil. Santos Bay waters are polluted by the large industrial complex of Cubatao. The estuary system filters part of this pollution before it reaches the Bay. Mercury and methylmercury determination were performed using Cold Vapor Atomic Absorption Spectrometry (CV-AAS) and selenium determination by Instrumental Neutron Activation Analysis (INAA). Methodology validation for the determination of these elements was carried out by means of reference materials analyses. There was no significant correlation between mercury and selenium concentrations (n = 17, (r2 ) R2 = 0.3482, p = 0.1709) in Cathorops spixii (bagre amarelo)- Ariidae family and Centropomus sp. (robalo)- Centropomidae family livers. Mercury and methylmercury concentrations in muscle from carnivorous species: Ariidae Cathorops spixii (bagre amarelo), Scianidae Steliffer rastifer (cangoa) and Scianidae Paralonchurus brasiliensis (maria-luiza) were determined and discussed. Total mercury concentration in Ariidae Catharops spixii livers presented the highest Hg level (7.6 mg kg-1). Although the Santos Bay is less contaminated than the inner section of its estuary system (Cubatao), it presents signs of environmental impact. (author)

  5. Evaluation of mercury, selenium and methylmercury in fish consumed by Santos Bay communities, Sao Paulo, Brazil

    International Nuclear Information System (INIS)

    In the present study, mercury and selenium levels were evaluated in fish tissues and fish organs in the Santos Bay, Sao Paulo State, southeastern Brazil. Santos Bay waters are polluted by the large industrial complex of Cubatao. The estuary system filters part of this pollution before it reaches the Bay. Mercury and methylmercury determination were performed using Cold Vapor Atomic Absorption Spectrometry (CV-AAS) and selenium determination by Instrumental Neutron Activation Analysis (INAA). Methodology validation for the determination of these elements was carried out by means of reference materials analyses. There was no significant correlation between mercury and selenium concentrations (n = 17, (r2 ) R2 = 0.3482, p = 0.1709) in Cathorops spixii (bagre amarelo)- Ariidae family and Centropomus sp. (robalo)- Centropomidae family livers. Mercury and methylmercury concentrations in muscle from carnivorous species: Ariidae Cathorops spixii (bagre amarelo), Scianidae Steliffer rastifer (cangoa) and Scianidae Paralonchurus brasiliensis (maria-luiza) were determined and discussed. Total mercury concentration in Ariidae Catharops spixii livers presented the highest Hg level (7.6 mg kg-1). Although the Santos Bay is less contaminated than the inner section of its estuary system (Cubatao), it presents signs of environmental impact. (author)

  6. Numerical research on SASE FEL using a multi-frequency SDE code

    CERN Document Server

    Goto, M; Mima, K; Imasaki, K; Tsunawaki, Y; Yamanaka, C

    2000-01-01

    A multi-frequency 2D SASE FEL simulation code has been developed using the Source Dependent Expansion (SDE) method. With this code we calculated the evolution of the radiation amplitude and the spectrum of a SASE FEL using the beam parameters of FELI and the micro-wiggler developed by ILT/ILE/OSU. The effect of beam energy spread is also clarified.

  7. EST Table: FS933546 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS933546 E_FL_fwgP_37G09_F_0 10/09/28 41 %/186 aa gb|AAD21841.1| trypsin-like serine protease [Ctenocephalid...es felis] 10/09/13 low homology 10/08/29 n.h 10/09/10 37 %/190 aa AGAP004318-PA Pro

  8. EST Table: FY745967 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY745967 E_FL_famL_28K09_F_0 11/11/04 46 %/171 aa gb|AAD21841.1| trypsin-like serine protease [Ctenocephalid...es felis] 11/11/04 low homology 11/11/04 n.h 11/11/04 38 %/173 aa AGAP004318-PA Pro

  9. Gene : CBRC-FCAT-01-0577 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0577 UN A Glycoprotein hormones receptors TSHR_FELCA 1e-172 83% ref|NP_001009288.1| ... thyroid ... stimulating hormone receptor [Felis catus] sp|Q9BG ... TSHR_FELCA Thyrotropin receptor precursor (TSH-R) (Thyroid -stimulating hormone receptor) gb|AAK00133.1|AF2182 ...

  10. HISTOPATHOLOGICAL EVIDENCE OF REGENERATION FOLLOWING HEPATOTOXIC EFFECTS OF THE CYANOTOXIN MICROCYSTIN-LR IN THE HARDHEAD CATFISH AND GULF KILLIFISH.

    Science.gov (United States)

    The cyanobacterial toxin, microcystin-LR (MC-LR), causes liver damage in several freshwater fish species. The damage appears to be acute and irreversible. In the present study, two estuarine species, hardhead catfish, Arius felis, and gulf killifish, Fundulus grandis, were inject...

  11. Toxoplasmosis and other intestinal coccidial infections in cats and dogs

    Science.gov (United States)

    Much needs to be learned concerning the pathogenesis of clinical coccidiosis in dogs. Why does coccidiosis occurs after shipping, and nothing is known of biologic differences among isolates of Isospora species of dogs and cats. Transmission of Isospora felis in cats in breeding colonies despite of s...

  12. Teaching A-level Genetics: The Coat Colours of the Domestic Cat.

    Science.gov (United States)

    Talbot, D. J.; Talbot, C. D.

    1992-01-01

    The authors provide an introduction to the inheritance of coat colors in cats and suggest strategies designed to integrate the domestic cat (Felis domesticus or catus) into the teaching of genetics. Provides examples to illustrate dominance, recessiveness, epistasis, multiple allelism, environmental effect of phenotype, incomplete dominance,…

  13. Chronic intermittent diarrhea in a 14-month-old Abyssinian cat

    OpenAIRE

    Pham, Dorothy

    2009-01-01

    A 14-month-old intact, female Abyssinian cat was presented for chronic intermittent diarrhea and bilateral enlargement of the mammary glands. Gastrointestinal coccidiosis was diagnosed; therapy with sulfadi-methoxine was unsuccessful in the elimination of Isospora felis and clinical signs. Infection with Tritrichomonas foetus was diagnosed by fecal polymerase chain reaction (PCR) and successfully treated with ronidazole and dietary modification.

  14. Real-Time Detection and Identification of Chlamydophila Species in Veterinary Specimens by Using SYBR Green-Based PCR Assays

    DEFF Research Database (Denmark)

    Nordentoft, Steen; Kabell, Susanne; Pedersen, Karl

    2011-01-01

    Chlamydiaceae and differentiate the most prevalent veterinary Chlamydophila species: Cp. psittaci, Cp. abortus, Cp. felis, and Cp. caviae. By adding bovine serum albumin to the master mixes, target DNA could be detected directly in crude lysates of enzymatically digested conjunctival or pharyngeal swabs or...

  15. Identification and estimation of size from the beaks of 18 species of cephalopods from the Pacific Ocean

    OpenAIRE

    Wolff, Gary A.

    1984-01-01

    A method of identifying the beaks and estimating body weight and mantle length of 18 species of cephalopods from the Pacific Ocean is presented. Twenty specimens were selected from each of the following cephalopod species: Symplectoteuthis oualaniensis, Dosidicus gigas, Ommastrephes bartramii, S. luminosa, Todarodes pacificus, Nototodarus hawaiiensis, Ornithoteuthis volalilis, Hyaloteuthis pelagica, Onychoteuthis banksii, Pterygioteuthis giardi, Abraliopsis affinis, A. felis, Liocranchia r...

  16. Rickettsia and Bartonella Species in Fleas from Reunion Island

    Science.gov (United States)

    Dieme, Constentin; Parola, Philippe; Guernier, Vanina; Lagadec, Erwan; Le Minter, Gildas; Balleydier, Elsa; Pagès, Frederic; Dellagi, Koussay; Tortosa, Pablo; Raoult, Didier; Socolovschi, Cristina

    2015-01-01

    Rickettsia felis, Rickettsia typhi, and Bartonella DNA was detected by molecular tools in 12% of Rattus rattus fleas (Xenopsylla species) collected from Reunion Island. One-third of the infested commensal rodents captured during 1 year carried at least one infected flea. As clinical signs of these zoonoses are non-specific, they are often misdiagnosed. PMID:25646263

  17. 75 FR 61513 - Receipt of Applications for Endangered Species Permits

    Science.gov (United States)

    2010-10-05

    ... ensure agency activities contribute to species recovery efforts. This activity will take place across... to take the Florida panther (Felis concolor coryi) for the purpose of species recovery activities... authorization to take the Florida panther for the purpose of species recovery activities. Such...

  18. Serological response of cats to experimental Besnoitia darlingi and Besnoitia neotomofelis infections and prevalence of antibodies to these parasites in cats from Virginia and Pennsylvania

    Science.gov (United States)

    Besnoitia darlingi and B. neotomofelis are tissue cyst-forming apicomplexan parasite that use domestic cats (Felis domesticus) as definitive hosts and opossums (Didelphis virginiana) and southern planes woodrats (Neotoma micropus) as intermediate hosts, respectively. Nothing is known about the preva...

  19. Dicty_cDB: SFH636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ra acutorostrata CYP2C78... 60 3e-08 AB109547_1( AB109547 |pid:none) Balaenoptera a...98058 |pid:none) Felis catus CYP2E2 variant 1 mRNA ... 60 2e-08 AB290008_1( AB290008 |pid:none) Balaenopte

  20. Estudios sobre Educacion, 2002 (Studies on Education, 2002).

    Science.gov (United States)

    Estudios sobre Educacion, 2002

    2002-01-01

    This scholarly journal deals with the study of education. Articles in this second issue are: "La Vertebracion Academica de la Formacion Inicial del Profesorado" (The Academic Backbone of the Initial Formation of Teachers) (Jose M. Esteve); "Deficiencia Visual en el Nino" (Visual Deficiency in the Young Child) (Feli Peralta; Juan Narbona); "The…

  1. Will a hiding box provide stress reduction for shelter cats?

    NARCIS (Netherlands)

    Vinke, Claudia; Godijn, L.M.; van der Leij, Ruth

    2014-01-01

    Domestic cats (Felis sylvestris catus) can experience serious stress in shelters. Stressful experiences can have a major impact on the cats’ welfare and may cause higher incidences of infectious diseases in the shelters due to raised cortisol levels causing immuno deficiency.Though several studies s

  2. 77 FR 20059 - License Amendment To Increase the Maximum Reactor Power Level, Florida Power & Light Company...

    Science.gov (United States)

    2012-04-03

    ... Puma concolor mountain lion\\(b)\\..... T/SA Felis concolor coryi Florida panther........ E Trichechus manatus West Indian manatee.... E Reptiles Alligator mississippiensis..... American alligator..... T/SA... draft EA and FONSI for the proposed action on November 17, 2011 (76 FR 71379), and established...

  3. A novel candidate vaccine for cytauxzoonosis inferred from comparative apicomplexan genomics.

    Directory of Open Access Journals (Sweden)

    Jaime L Tarigo

    Full Text Available Cytauxzoonosis is an emerging infectious disease of domestic cats (Felis catus caused by the apicomplexan protozoan parasite Cytauxzoon felis. The growing epidemic, with its high morbidity and mortality points to the need for a protective vaccine against cytauxzoonosis. Unfortunately, the causative agent has yet to be cultured continuously in vitro, rendering traditional vaccine development approaches beyond reach. Here we report the use of comparative genomics to computationally and experimentally interpret the C. felis genome to identify a novel candidate vaccine antigen for cytauxzoonosis. As a starting point we sequenced, assembled, and annotated the C. felis genome and the proteins it encodes. Whole genome alignment revealed considerable conserved synteny with other apicomplexans. In particular, alignments with the bovine parasite Theileria parva revealed that a C. felis gene, cf76, is syntenic to p67 (the leading vaccine candidate for bovine theileriosis, despite a lack of significant sequence similarity. Recombinant subdomains of cf76 were challenged with survivor-cat antiserum and found to be highly seroreactive. Comparison of eleven geographically diverse samples from the south-central and southeastern USA demonstrated 91-100% amino acid sequence identity across cf76, including a high level of conservation in an immunogenic 226 amino acid (24 kDa carboxyl terminal domain. Using in situ hybridization, transcription of cf76 was documented in the schizogenous stage of parasite replication, the life stage that is believed to be the most important for development of a protective immune response. Collectively, these data point to identification of the first potential vaccine candidate antigen for cytauxzoonosis. Further, our bioinformatic approach emphasizes the use of comparative genomics as an accelerated path to developing vaccines against experimentally intractable pathogens.

  4. Malaria in the colombian regions of Uraba and Bajo Cauca, province of Antioquia: an overwiew to interpret the antimalarial therapeutic failure La malaria en Colombia, Antioquia y las zonas de Urabá y Bajo Cauca: panorama para interpretar la falla terapéutica antimalárica. Parte 2

    Directory of Open Access Journals (Sweden)

    Jaime Carmona Fonseca

    2004-01-01

    Full Text Available Problem: in the past 5 years we have studied the treatment response to antimalarials and their combinations in the Antioquia region (Turbo, Zaragoza and El Bagre municipalities. The interpretation and better understanding of the treatment outcome (adequate clinical response, early treatment failure or late treatment failure require further information since this response depends on host’s and parasite’s factors, independently of the characteristics of the antimalarial administered. Objectives: to define an adequate reference frame which allows for interpretation of results obtained during antimalarials treatment assessment studies. This would include demography, epidemiology, climatic and social-economic information about Colombia, Antioquia, the regions of Uraba, Bajo Cauca and the municipalities of Turbo and El Bagre. Methodology: research of secondary information (publications reports and internet resources, and some primary information (taken from Sistema de Vigilancia Epidemiológica de Antioquia (Sivigila of Dirección Seccional de Salud de Antioquia DSSA. Data about treatment response were primary information (produced by Grupo Malaria, Universidad de Antioquia, or obtained from other authors. With the gathered data, tables and graphs were produced and calculations were carried out using other variables. Results: the frequency of malaria is presented for Colombia during the period 1960-2002 and the results of the malaria eradication and control programs, and their failure, are described. Similarly, the frequency of malaria in Antioquia during 1959-2003 is discussed and presented in terms of incidence rates and parasite annual indexes (PAI. Non adjusted and adjusted rates and PAI were obtained, therefore adjusted rates are presented by exposed population, which is less of 20%. Adjusted results are 5-6 fold higher that non-adjusted values in Antioquia. However this is not true for the Uraba and Bajo Cauca regions, where 100% of the

  5. IN SITU IMMUNE RESPONSE EVALUATION VIA IMMUNOHISTOCHEMISTRY IN SKIN BIOPSIES FROM PATIENTS AFFECTED BY AUTOIMMUNE BLISTERING DISEASES

    Directory of Open Access Journals (Sweden)

    Ana Maria Abreu Velez

    2013-11-01

    Full Text Available Introduction: The in situ immune response in skin biopsies from patients affected by autoimmune skin blistering diseases (ABD is not well characterized. Aim: Our investigation attempts to immunophenotype cells in lesional skin in several ABD, utilizing immunohistochemistry (ICH. Methods: We tested by IHC for CD4, CD8, CD19, CD20, CD45, CD56/NCAM, PAX-5, granzyme B, myeloperoxidase, neutrophil elastase, LAT and ZAP-70 in patients affected by ABD. We tested 30 patients with endemic pemphigus foliaceus (EPF, 15 controls from the EPF endemic area, and 15 biopsies from healthy controls from the USA. We also tested archival biopsies from patients with selected ABD, including 30 patients with bullous pemphigoid, 20 with pemphigus vulgaris, 8 with pemphigus foliaceus and 14 with dermatitis herpetiformis. Results: We found a predominantly CD8 positive/CD45 positive T cell infiltrate in all ABD. Our skin biopsies demonstrated consistently positive staining for myeloperoxidase, but negative staining for neutrophil elastase. Most ABD biopsies displayed negative staining for CD4 and B cell markers; natural killer cell markers were also rarely seen. ZAP-70 and LAT were frequently detected. In El Bagre-EPF, a significant fragmentation of T cells in lesional skin was noted, as well as autoreactivity to lymph nodes. Conclusions: The documented T cell and myeloperoxidase staining are indicative of the role of T lymphocytes and neutrophils in lesional biopsies in patients with ABD, in addition to previously documented deposition of B cells, immunoglobulins and complement in situ. In El Bagre-EPF, T cells could also target lymph nodes; however, further studies are needed to confirm this possibility.

  6. Electrophoretic study on intraspecific variations and interspecific relationships of marine catfishes (Siluriformes, Ariidae of Cananéia (São Paulo, Brazil: 1. General proteins of eye-lens and skeletic muscle

    Directory of Open Access Journals (Sweden)

    Hana Suzuki

    1990-06-01

    Full Text Available Cellulose acetate electrophoresis of eye-lens proteins and Polyacrylamide flat gel electrophoresis of skeletic muscle proteins of six species of marine catfishes were carried out. Genetic polymorphism only occured at one locus of the electropherograms of eye-lens of Cathorops spixii. Ontogenetic variations in the relative concentration of bands were found in the electropherograms of eye-lens and skeletic muscle proteins. The six species of catfishes can be identified by means of quantitative and qualitative differences in the electropherograms. Coefficients of similarity were determined by the band-counting method and UPGMA dendrograms were constructed to illustrate the interspecific relationships among the species.Eletroforeses de proteínas gerais de cristalinos e de músculo esquelético de seis espécies de bagres marinhos foram realizadas, respectivamente, em membranas de acetato de celulose e em géis de poliacrilamida. Polimorfismo genético ocorreu apenas em um locus de eletroferogramas do cristalino de Cathorops spixii. Variações ontogenéticas nas concentrações relativas das bandas foram observadas nos eletroferogramas do cristalino e do músculo esquelético. As seis espécies de bagres marinhos podem ser identificadas através das diferenças quantitativas e qualitativas nos eletroferogramas. Coeficientes de similaridade foram determinadas pelo método de contagem de bandas e dendrogramas UPGMA foram construídos para ilustrar as relações interespecíficas entre as espécies.

  7. Malaria, desnutrición y parasitosis intestinal en los niños colombianos: interrelaciones interrrelations between malaria, malnutrition and intestinal parasitism in colombian children

    Directory of Open Access Journals (Sweden)

    Jaime Carmona Fonseca

    2004-09-01

    Full Text Available Este trabajo resume datos colombianos y los hallazgos del Grupo Malaria (Universidad de Antioquia sobre las relaciones entre malaria, desnutrición y funcionamiento inmunitario, trabajos realizados en niños (4-11 años de las poblaciones antioqueñas de Turbo, El Bagre y Zaragoza. Se hace énfasis en las relaciones malaria, parásitos intestinales y desnutrición (desnutrición crónica, hipovitaminosis A, las cuales se exploran a través de su articulación en el sistema inmunitario. Se formulan recomendaciones para la aplicación clínica (individual y epidemiológica (colectiva con respecto a la formulación de suplemento de vitamina A y antihelmínticos de amplio espectro. En Turbo y en El Bagre y Zaragoza: 1 la frecuencia de malaria registra índices parasitarios anuales de 39 (Turbo y 156 casos por cada mil sujetos expuestos (El Bagre-Zaragoza en 1996-2000; 2 el riesgo de desnutrición crónica (índice talla/ edad es de 63% en los niños de 3-11 años; 3 se encontró anemia en el 26% de los palúdicos y 17% de los no palúdicos; 4 el 65% de los niños con malaria y el 35% de aquellos sin malaria mostraron valores de retinol bajos (<0,3 µg/mL; 5 se hallaron niveles anormalmente bajos de apoproteína A-1, tanto en los niños sin malaria como, sobre todo, en los que sí la tenían; 6 el 96% de los niños (4-9 años con malaria mostraron títulos de interleuquina 10 (IL10 muy altos con relación a lo normal y estadísticamente superiores a los exhibidos por los niños sin malaria; 7 los títulos de IgE total y específica anti-Plasmodium estuvieron anormalmente altos en los niños de ambos municipios e igual sucedió con los niveles de FNT-; 8 en estudiantes y docentes de enfermería, aparentemente sanos, con edades de 18-44 años, hallamos parásitos intestinales en el 97% y parásitos intestinales patógenos en el 42%. En menores de 5 años de Turbo hay parásitos intestinales patógenos en un 30-35% de los niños, con predominio de G

  8. Avaliação de alguns parâmetros ecocardiográficos do gato-do-mato (Leopardus tigrinus, mantido em cativeiro e submetido à anestesia com xilazina e quetamina Evaluation of some echocardiographic parameters of Oncilla (L. tigrinus, kept in captivity and submitted to anesthesia with xilazine and ketamine

    Directory of Open Access Journals (Sweden)

    P.S.L. Carvalho

    2007-06-01

    Full Text Available Avaliaram-se alguns parâmetros ecocardiográficos em modos B, M e Doppler de 27 gatos-do-mato, Leopardus tigrinus, pequeno felídeo selvagem, mantidos em cativeiro e submetidos à anestesia com 1 a 2mg/kg de xilazina e 10mg/kg de quetamina. Observaram-se alterações dos parâmetros cardiovasculares quando os resultados foram comparados aos do gato doméstico (Felis catus não anestesiado.Some echocardiographic parameters in B, M-mode and Doppler of 27 Oncillas, Leopardus tigrinus, a wild little feline, kept in captivity and submitted to anesthesia with 1 to 2mg/kg of xilazine and 10mg/kg of ketamine, had been evaluated. Changes of the cardiovascular parameters were observed when the results were compared to non anesthetized domestic cat (Felis catus.

  9. Parasites of domestic and wild canids in the region of Serra do Cipó National Park, Brazil Parasitos de canídeos domésticos e silvestres na região do Parque Nacional da Serra do Cipó - Brasil

    Directory of Open Access Journals (Sweden)

    Juliana Lúcia Costa Santos

    2012-09-01

    Full Text Available Over recent decades, diseases have been shown to be important causes of extinctions among wild species. Greater emphasis has been given to diseases transmitted by domestic animals, which have been increasing in numbers in natural areas, along with human populations. This study had the aim of investigating the presence of intestinal helminths in wild canids (maned wolf, Chrysocyon brachyurus, and crab-eating fox, Cerdocyon thous in the Serra do Cipó National Park (43-44º W and 19-20º S and endo and ectoparasites of domestic dogs in the Morro da Pedreira Environmental Protection Area (an area surrounding the National Park. The Serra do Cipó is located in the state of Minas Gerais, Brazil. Among the enteroparasites found in domestic and wild canids, the following taxons were identified: Ancylostomidae, Trichuridae, Toxocara sp., Spirocerca sp., Physaloptera sp., Strongyloides sp., Cestoda, Dipylidium caninum, Diphyllobothriidae, Hymenolepidae, Anoplocephalidae, Trematoda, Acanthocephala and Isospora sp. Domestic dogs were positive for leishmaniasis and Babesia canis in serological tests. Among the ectoparasites, Rhipicephalus sanguineus, Amblyomma cajennense and Ctenocephalides felis felis were observed in domestic dogs. Variations in the chaetotaxy of the meta-episternum and posterior tibia were observed in some specimens of C. felis felis.Nas últimas décadas, as doenças têm sido apontadas como importantes causas de extinção de espécies silvestres. Maior ênfase tem sido dada às doenças transmitidas por animais domésticos que crescem em número, bem como as populações humanas, em áreas naturais. O presente estudo objetivou verificar a presença de helmintos intestinais de canídeos silvestres (lobo-guará - Chrysocyon brachyurus e cachorro-do-mato - Cerdocyon thous do Parque Nacional da Serra do Cipó (43-44º W e 19-20º S e endo e ectoparasitos de cães domésticos da Área de Proteção Ambiental Morro da Pedreira (entorno do

  10. Insecticide Resistance in Fleas.

    Science.gov (United States)

    Rust, Michael K

    2016-01-01

    Fleas are the major ectoparasite of cats, dogs, and rodents worldwide and potential vectors of animal diseases. In the past two decades the majority of new control treatments have been either topically applied or orally administered to the host. Most reports concerning the development of insecticide resistance deal with the cat flea, Ctenocephalides felis felis. Historically, insecticide resistance has developed to many of the insecticides used to control fleas in the environment including carbamates, organophosphates, and pyrethroids. Product failures have been reported with some of the new topical treatments, but actual resistance has not yet been demonstrated. Failures have often been attributed to operational factors such as failure to adequately treat the pet and follow label directions. With the addition of so many new chemistries additional monitoring of flea populations is needed. PMID:26999217

  11. Faecal helminth egg and oocyst counts of a small population of African lions (Panthera leo in the southwestern Kalahari, Namibia : research communication

    Directory of Open Access Journals (Sweden)

    Y. Smith

    2006-09-01

    Full Text Available An endoparasite survey of a small pride of African lions (Panthera leo was conducted at Intu Afrika Kalahari Game Reserve, southwestern Namibia, during winter and summer of 2003 and 2004, respectively. Overall, 23 fresh lion scats were collected opportunistically during fieldwork trials. A flotation technique was employed for the diagnosis of parasites. Three nematodes, Ancylostoma braziliense, Gnathostoma spinigerum and Uncinaria stenocephala and two coccidians, Toxoplasma gondii and Isospora felis were recorded. By using the McMaster method for quantification, a maximum number of 14 866 oocysts per gram of faeces was obtained for I. felis during winter 2003. Endoparasite taxa carried by the different individuals in the pride were found to be related to their levels of association. Rates of infection were relatively low as a result of the habitat, semi-captive conditions and earlier sporadic deworming.

  12. EST Table: BJ985655 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BJ985655 E_FL_mxg-_19A07_F_0 10/09/28 35 %/132 aa gb|AAD21841.1| trypsin-like serine protease [Ctenocephalid...es felis] 10/08/28 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS930815 mxg- ...

  13. Dicty_cDB: CHG233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 66 2e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...pighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, ...mRNA sequence. 90 9e-14 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  14. Dicty_cDB: SHG302 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ;, mRNA sequence. 66 3e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...ighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, m...RNA sequence. 82 3e-11 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  15. EST Table: FS741218 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ike protein 1 [Ctenocephalides felis] 10/09/07 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low ...FS741218 E_FL_bmmt_19G24_R_0 11/12/09 n.h 10/09/28 30 %/275 aa gb|AAQ88394.1| SV2-l

  16. Dicty_cDB: SHA868 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 66 3e-18 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides...bule subtracted cDNA library Ctenocephalides felis cDNA clone 2193-94, mRNA seque...nce. 90 1e-13 1 BM058379 |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  17. Comparative anatomy of the cardiac foramen ovale in cats (Felidae), dogs (Canidae), bears (Ursidae) and hyaenas (Hyaenidae).

    OpenAIRE

    Macdonald, A A; Johnstone, M.

    1995-01-01

    The structure of the foramen ovale from 16 species representing 4 carnivore families, the Felidae, Canidae, Ursidae and Hyaenidae, was studied using the scanning electron microscope. The Felidae were represented by 9 domestic cat fetuses (Felis catus), 2 snow leopard neonates (Uncia uncia), an ocelot neonate (Leopardus pardalis), 2 lion neonates (Panthera leo), a panther neonate (Panthera pardus) and 3 tigers (Neofelis tigris), comprising 2 fetuses and a neonate. The Canidae were represented ...

  18. Mapping trends of large and medium size carnivores of conservation interest in Romania

    OpenAIRE

    Mihai Cristian Adamescu; Constantin Cazacu; Ovidiu Ionescu; Georgeta Ionescu; Ramon Jurj; Marius Popa; Roxana Cazacu; Ancuta Cotovelea

    2014-01-01

    We analysed yearly estimates of population size data during 2001-2012 for five carnivores species of conservation interest (Ursus arctos, Canis lupus, Lynx lynx, Felis silvestris and Canis aureus). Population size estimations were done by the game management authorities and integrated by the competent authorities on the Ministry of Environment and Climate Change. Trends in data were detected using non-parametric Mann-Kendall test. This test was chosen considering the short length of data seri...

  19. AcEST: BP918525 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 8 0.028 sp|P02836|HMEN_DROME Segmentation polarity homeobox protein engr... 36 0.10 sp|Q7XC27|CNBL1_ORYSJ Ca...ing protein 2 OS=Felis silve... 32 2.0 sp|P09145|HMEN_DROVI Segmentation polarity homeobox protein engr... 3...SSNTTPTSTTF 287 Query: 188 FGSVPSAA 165 + PS A Sbjct: 288 TTTSPSTA 295 >sp|P02836|HMEN_DROME Segmentation

  20. First report of Cytauxzoon sp. infection in a domestic cat from Portugal

    OpenAIRE

    Alho, Ana Margarida; Silva, Joana; Fonseca, Maria João; Santos, Filipa; Nunes, Cláudia; de Carvalho, Luís Madeira; Rodrigues, Manuel; Cardoso, Luís

    2016-01-01

    Background Cytauxzoonosis is an emerging and life-threatening tick-borne feline disease caused by haemoprotozoan parasites of the genus Cytauxzoon. Information regarding epidemiological and clinical presentation of infections by species other than Cytauxzoon felis is scant. A case of Cytauxzoon sp. infection is described in a 2-year-old mixed breed male domestic cat from Portugal, presenting a history of acute lethargy, anorexia and pyrexia. Results Complete blood count revealed a severe anae...

  1. Serosurvey of Smooth Brucella, Leptospira spp. and Toxoplasma gondii in Free-Ranging Jaguars (Panthera onca) and Domestic Animals from Brazil

    OpenAIRE

    Mariana Malzoni Furtado; Solange Maria Gennari; Cassia Yumi Ikuta; Anah Tereza de Almeida Jácomo; Zenaide Maria de Morais; Hilda Fátima de Jesus Pena; Grasiela Edith de Oliveira Porfírio; Leandro Silveira; Rahel Sollmann; Gisele Oliveira de Souza; Natália Mundim Tôrres; José Soares Ferreira Neto

    2015-01-01

    This study investigated the exposure of jaguar populations and domestic animals to smooth Brucella, Leptospira spp. and Toxoplasma gondii in the Cerrado, Pantanal and Amazon biomes of Brazil. Between February 2000 and January 2010, serum samples from 31 jaguars (Panthera onca), 1,245 cattle (Bos taurus), 168 domestic dogs (Canis lupus familiaris) and 29 domestic cats (Felis catus) were collected and analysed by rose bengal test for smooth Brucella, microscopic agglutination test for Leptospir...

  2. Feline Leukemia Virus and Other Pathogens as Important Threats to the Survival of the Critically Endangered Iberian Lynx (Lynx pardinus)

    OpenAIRE

    Meli, Marina L; Cattori, Valentino; Martínez, Fernando; López, Guillermo; Vargas, Astrid; Simón, Miguel A.; Zorrilla, Irene; Muñoz, Alvaro; Palomares, Francisco; López-Bao, José V.; Pastor, Josep; Tandon, Ravi; Willi, Bárbara; Hofmann-Lehmann, R.; Lutz, Hans

    2009-01-01

    Background: the Iberian lynx (Lynx pardinus) is considered the most endangered felid species in the world. In order to save this species, the Spanish authorities implemented a captive breeding program recruiting lynxes from the wild. In this context, a retrospective survey on prevalence of selected feline pathogens in free-ranging lynxes was initiated. Methodology/ Principal Findings: we systematically analyzed the prevalence and importance of seven viral, one protozoan (Cytauxzoon felis), an...

  3. Feline leukemia virus and other pathogens as important threats to the survival of the critically endangered Iberian lynx (Lynx pardinus)

    OpenAIRE

    Meli, M. L.; Cattori, V; F Martínez; López, G.; Vargas, A.(Benemérita Universidad Autónoma de Puebla, Puebla, Mexico); Simón, M. A.; Zorrilla, I; A. Muñoz; Palomares, F; J.V. López-Bao; Pastor, J.; Tandon, R.; Willi, B; Hofmann-Lehmann, R.; Lutz, H.

    2009-01-01

    BACKGROUND: The Iberian lynx (Lynx pardinus) is considered the most endangered felid species in the world. In order to save this species, the Spanish authorities implemented a captive breeding program recruiting lynxes from the wild. In this context, a retrospective survey on prevalence of selected feline pathogens in free-ranging lynxes was initiated. METHODOLOGY/ PRINCIPAL FINDINGS: We systematically analyzed the prevalence and importance of seven viral, one protozoan (Cytauxzoon felis), an...

  4. Feline leukemia virus and other pathogens as important threats to the survival of the critically endangered Iberian lynx (Lynx pardinus)

    OpenAIRE

    Meli, Marina L; Cattori, Valentino; Martínez, Fernando; López, Guillermo; Vargas, Ástrid; Simón, Miguel A.; Zorrilla, Irene; Muñoz, Álvaro; Palomares, Francisco; López-Bao, José V.; Pastor Milán, Josep; Tandon, Ravi; Willi, Barbara; Hofmann-Lehmann, Regina; Lutz, Hans

    2009-01-01

    Background: the Iberian lynx (Lynx pardinus) is considered the most endangered felid species in the world. In order to save this species, the Spanish authorities implemented a captive breeding program recruiting lynxes from the wild. In this context, a retrospective survey on prevalence of selected feline pathogens in free-ranging lynxes was initiated. Methodology/ Principal Findings: we systematically analyzed the prevalence and importance of seven viral, one protozoan (Cytauxzoon felis), an...

  5. Retrovirus infections and Brazilian wild felids

    OpenAIRE

    Filoni, C.; Catão-Dias, J L; Lutz, H.; Hofmann-Lehmann, R.

    2008-01-01

    Feline leukemia virus (FeLV) and Feline immunodeficiency virus (FIV) are two retroviruses that are deadly to the domestic cat (Felis catus) and important to the conservation of the threatened wild felids worldwide. Differences in the frequencies of occurrence and the existence of varying related viruses among felid species have incited the search for understanding the relationships among hosts and viruses into individual and population levels. Felids infected can die of related diseases or co...

  6. Dynamics of two feline retroviruses (FIV and FeLV) within one population of cats.

    OpenAIRE

    Courchamp, F; Suppo, C; Fromont, E; Bouloux, C

    1997-01-01

    We present a deterministic model of the dynamics of two microparasites simultaneously infecting a single host population. Both microparasites are feline retroviruses, namely Feline Immunodeficiency Virus (FIV) and Feline Leukaemia Virus (FeLV). The host is the domestic cat Felis catus. The model has been tested with data generated by a long-term study of several natural cat populations. Stability analysis and simulations show that, once introduced in a population, FIV spreads and is maintaine...

  7. Prävalenz von hämotrophen Mycoplasma spp., Bartonella spp., Anaplasma phagocytophilum und Borrelia burgdorferi bei Katzen im Raum Berlin/Brandenburg

    OpenAIRE

    Morgenthal, Dinah

    2014-01-01

    Arthropod-borne infectious agents in the cat include Bartonella (B.) henselae, Bartonella (B.) clarridgeiae, Bartonella (B.) quintana, Anaplasma (A.) phagocytophilum and Borrelia (B.) burgdorferi. Moreover infections with Mycoplasma (M.) haemofelis, Candidatus Mycoplasma (C. M.) turicensis and Candidatus Mycoplasma (C. M.) haemominutum occur in the cat. The cat flea (Ctenocephalides felis) is supposed to be the main vector for Mycoplasma spp.; moreover, transmission via blood transfusion and ...

  8. Genetic and phylogenetic divergence of feline immunodeficiency virus in the puma (Puma concolor).

    OpenAIRE

    Carpenter, M.A.; Brown, E. W.; Culver, M; Johnson, W E; Pecon-Slattery, J; Brousset, D; O'Brien, S J

    1996-01-01

    Feline immunodeficiency virus (FIV) is a lentivirus which causes an AIDS-like disease in domestic cats (Felis catus). A number of other felid species, including the puma (Puma concolor), carry a virus closely related to domestic cat FIV. Serological testing revealed the presence of antibodies to FIV in 22% of 434 samples from throughout the geographic range of the puma. FIV-Pco pol gene sequences isolated from pumas revealed extensive sequence diversity, greater than has been documented in th...

  9. Epidemiological survey of anti-flea IgE in dogs in Japan by using an antigen-specific IgE quantitative measurement method

    OpenAIRE

    Ichikawa Y.; Beugnet F.

    2012-01-01

    In Japan, an epidemiological survey was performed in dogs from October to December 2008 by using a quantitative measurement method for antigen-specific IgE towards specific Ctenocephalides felis antigens. 214 dogs from 22 veterinary clinics were included. These clinics were located as follows, from North to South: Hokkaido, Aomori, Fukushima, Tochigi, Saitama, Chiba, Tokyo (Tama-City and Ota-ku), Kanagawa, Gifu, Niigata, Kyoto, Nara, Osaka, Hyogo, Kagawa, Ehime, Hiroshima, Yamaguchi, Fukuoka,...

  10. Localization of Helicobacter spp. in the fundic mucosa of laboratory Beagle dogs: an ultrastructural study

    Directory of Open Access Journals (Sweden)

    Lanzoni Anna

    2011-03-01

    Full Text Available Abstract In dogs Helicobacter spp. are found in all gastric regions usually localized in the surface mucus, gastric glands and parietal cells. The aim of this study was to detail the distribution of Helicobacter spp. in the fundic mucosa of asymptomatic Beagle dogs and their intracellular localization within parietal cells, in order to evaluate species-specific pathogenetic effects on gastric cells. The presence of Helicobacter spp. was investigated by immunohistochemistry, TEM, and PCR in the fundic mucosa of six Beagle dogs. Helicobacter spp. were found in all dogs examined, and H. bizzozeronii and H. felis were identified by PCR and confirmed by TEM. In the lumen of the fundic glands, co-localization was common. H. bizzozeronii was present in larger numbers than H. felis in both intraluminal and intraparietal localization. The amounts of H. bizzozeronii were similar in superficial and basal portions of the glands. H. felis was predominantly localized in the superficial portions of gastric glands but almost absent from the base. Within parietal cells, most Helicobacter organisms were intracanalicular, but intact and degenerate Helicobacter organisms were also visualized free in the cytoplasm or in secondary lysosomes. No specific degenerative lesions were found in infected parietal cells. Helicobacter organisms were also observed within macrophages in the lamina propria. In conclusion, there is a differential distribution of H. bizzozeronii and H. felis in the fundic mucosa of Beagle dogs, and their intracellular localization in parietal cells and macrophages suggests novel pathogenic scenarios for the development of immune response and maintenance of chronic gastritis in dogs.

  11. Paraziti koček

    OpenAIRE

    Poláková, Zuzana

    2012-01-01

    SUMMARY Cat parasites This thesis is based on scientific literature and discusses the most important representatives of cat parasites. I selected three representatives of the protozoan parasites in cats: Toxoplasma gondii, Giardia felis and Cryptosporidium parvum. They have large zoonotic potential. From the group of trematodes, I chose the lung fluke (Paragonimus westermani). From the species of cestoda, I picked the cucumber tapeworm (Dipylidium caninum), the cat tapeworm (Taenia taen...

  12. Competition and intraguild predation among three sympatric carnivores

    OpenAIRE

    Fedriani, José M.; Fuller, Todd K.; Sauvajot, Raymond M.; York, Eric C.

    2000-01-01

    We examined the relative roles of dominance in agonistic interactions and energetic constraints related to body size in determining local abundances of coyotes (Canis latrans, 8-20 kg), gray foxes (Urocyon cinereoargenteus, 3-5 kg) and bobcats (Felis rufus, 5-15 kg) at three study sites (hereafter referred to as NP, CP, and SP) in the Santa Monica Mountains of California. We hypothesized that the largest and behaviorally dominant species, the coyote, would exploit a wider range of resources (...

  13. Stable individual differences in separation calls during early development in cats and mice

    OpenAIRE

    Hudson, Robyn; Rangassamy, Marylin; Saldaña, Amor; Bánszegi, Oxána; Rödel, Heiko G

    2015-01-01

    Background The development of ethologically meaningful test paradigms in young animals is an essential step in the study of the ontogeny of animal personality. Here we explore the possibility to integrate offspring separation (distress) calls into the study of consistent individual differences in behaviour in two species of mammals, the domestic cat (Felis silvestris catus) and the mound-building mouse (Mus spicilegus). Such vocal responses in young mammals are a potentially useful test optio...

  14. Inhibition of acid secretion from parietal cells by non-human-infecting Helicobacter species: a factor in colonization of gastric mucosa?

    OpenAIRE

    Vargas, M; Lee, A; Fox, J.G.; Cave, D. R.

    1991-01-01

    Helicobacter pylori has been shown to produce a protein that inhibits acid secretion from parietal cells. We have examined other non-human-infecting Helicobacter species for this property by measuring the uptake of [14C]aminopyrine into rabbit parietal cells as an indirect assessment of acid secretion. Helicobacter felis and an isolate from a rhesus monkey were shown to inhibit acid secretion. Isolates of Helicobacter mustelae gave variable responses. Whole bacteria and cell-free sonicates im...

  15. The Role of Antigenic Drive and Tumor-Infiltrating Accessory Cells in the Pathogenesis of Helicobacter-Induced Mucosa-Associated Lymphoid Tissue Lymphoma

    OpenAIRE

    Mueller, Anne; O’Rourke, Jani; Chu, Pauline; Chu, Amanda; Michael F. Dixon; Bouley, Donna M.; Lee, Adrian; Falkow, Stanley

    2005-01-01

    Gastric B-cell lymphoma of mucosa-associated lymphoid tissue type is closely linked to chronic Helicobacter pylori infection. Most clinical and histopathological features of the tumor can be reproduced by prolonged Helicobacter infection of BALB/c mice. In this study, we have addressed the role of antigenic stimulation in the pathogenesis of the lymphoma by experimental infection with Helicobacter felis, followed by antibiotic eradication therapy and subsequent re-infection. Antimicrobial the...

  16. Parenteral Adjuvant Activities of Escherichia coli Heat-Labile Toxin and Its B Subunit for Immunization of Mice against Gastric Helicobacter pylori Infection

    OpenAIRE

    Weltzin, Richard; Guy, Bruno; Thomas, William D.; Giannasca, Paul J.; Monath, Thomas P.

    2000-01-01

    The heat-labile toxin (LT) of Escherichia coli is a potent mucosal adjuvant that has been used to induce protective immunity against Helicobacter felis and Helicobacter pylori infection in mice. We studied whether recombinant LT or its B subunit (LTB) has adjuvant activity in mice when delivered with H. pylori urease antigen via the parenteral route. Mice were immunized subcutaneously or intradermally with urease plus LT, recombinant LTB, or a combination of LT and LTB prior to intragastric c...

  17. Estimating free-roaming cat densities in urban areas: comparison of mark-resight and distance sampling

    OpenAIRE

    Schmidt, P. M.; Lopez, R. R.; Pierce, B. L.

    2007-01-01

    Obtaining reliable population estimates is imperative in managing wildlife populations, particularly when attempting to implement nuisance control measures. Free-roaming cats (Felis catus) impact wildlife worldwide through predation, competition and disease transmission. Ideally, measures of controlling free-roaming cat populations should be evaluated a priori, which requires obtaining population estimates for use in population control programs (e.g., euthanasia, trap/treat/neuter/release). W...

  18. Journal of Parasitology

    OpenAIRE

    Hsu, V; Grant, D.C.; Dubey, J.P.; Zajac, A. M.; Lindsay, D S

    2010-01-01

    Sarcocystis neurone, is best known as the causative agent of equine protozoal myeloencephalitis of horses in the Americas. Domestic cats (Felis domesticus) were the first animals described as an intermediate host for S. neurone,. However, S. neurona-associated encephalitis has also been reported in naturally infected cats in the United States. Thus, cats can be implicated in the life cycle of S. neurona as natural intermediate hosts. The present study examined the seroprevalence of IgG antibo...

  19. Protective immunity against Helicobacter is characterized by a unique transcriptional signature

    OpenAIRE

    Mueller, Anne; O'Rourke, Jani; Chu, Pauline; Kim, Charles C; Sutton, Philip; Lee, Adrian; Falkow, Stanley

    2003-01-01

    Immunization with a whole-cell sonicate vaccine of Helicobacter felis in conjunction with cholera toxin as a mucosal adjuvant induces long-term protective immunity in a majority of laboratory mice. We have combined gene expression profiling and immunohistochemical analysis on a set of immunized animals to better understand the mechanism of protection. The stomachs of protected animals exhibited a strikingly different transcriptional profile compared with those of nonprotected or control mice,...

  20. Flea-borne rickettsioses: ecologic considerations.

    OpenAIRE

    Azad, A F; Radulovic, S; Higgins, J. A.; Noden, B. H.; Troyer, J. M.

    1997-01-01

    Ecologic and economic factors, as well as changes in human behavior, have resulted in the emergence of new and the reemergence of existing but forgotten infectious diseases during the past 20 years. Flea-borne disease organisms (e.g., Yersinia pestis, Rickettsia typhi, R. felis, and Bartonella henselae) are widely distributed throughout the world in endemic-disease foci, where components of the enzootic cycle are present. However, flea-borne diseases could reemerge in epidemic form because of...

  1. Survey of Helicobacter infection in domestic and feral cats in Korea

    OpenAIRE

    Ghil, Heh-Myung; Yoo, Jong-Hyeon; Jung, Woo-Sung; CHUNG, Tae-Ho; Youn, Hwa-Young; Hwang, Cheol-Yong

    2009-01-01

    Discovery of Helicobacter (H.) pylori has led to a fundamental change in our understanding of gastric diseases in humans. Previous studies have found various Helicobacter spp. in dogs and cats, and pets have been questioned as a zoonotic carrier. The present study surveyed the Helicobacter infections and investigated the presence of H. felis and H. pylori infections in domestic and feral cats in Korea. Sixty-four domestic cats and 101 feral cats were selected from an animal shelter. Saliva an...

  2. Post-immunisation gastritis and Helicobacter infection in the mouse: a long term study

    OpenAIRE

    Sutton, P.; Danon, S; Walker, M.; Thompson, L.; Wilson, J.; Kosaka, T; Lee, A.

    2001-01-01

    BACKGROUND AND AIMS—Helicobacter pylori is a major cause of peptic ulcers and gastric cancer. Vaccine development is progressing but there is concern that immunisation may exacerbate Helicobacter induced gastritis: prophylactic immunisation followed by challenge with H felis or H pylori can induce a more severe gastritis in mice than seen with infection alone. The aim of this study was to investigate the relationship between immunity to Helicobacter infection and post-immunisation gastritis.
...

  3. Mucosal Immunization with Helicobacter, CpG DNA, and Cholera Toxin Is Protective

    OpenAIRE

    Jiang, Weiwen; Baker, Henry J.; Smith, Bruce F.

    2003-01-01

    The mucosal delivery of antigens requires an effective adjuvant to induce mucosal immunity. Current mucosal adjuvants include cholera toxin (CT) and Escherichia coli heat-labile toxin. Unmethylated CpG immunostimulatory oligodeoxynucleotides (ODNs) have been proposed as novel mucosal adjuvants. In this study, mice were immunized with sonicated Helicobacter felis with CT and/or CpG ODN adjuvants. All groups receiving either adjuvant singly or in combination developed increased serum anti-H. fe...

  4. Survey of Helicobacter infection in domestic and feral cats in Korea.

    Science.gov (United States)

    Ghil, Heh-Myung; Yoo, Jong-Hyeon; Jung, Woo-Sung; Chung, Tae-Ho; Youn, Hwa-Young; Hwang, Cheol-Yong

    2009-03-01

    Discovery of Helicobacter (H.) pylori has led to a fundamental change in our understanding of gastric diseases in humans. Previous studies have found various Helicobacter spp. in dogs and cats, and pets have been questioned as a zoonotic carrier. The present study surveyed the Helicobacter infections and investigated the presence of H. felis and H. pylori infections in domestic and feral cats in Korea. Sixty-four domestic cats and 101 feral cats were selected from an animal shelter. Saliva and feces were evaluated by Helicobacter genus-specific polymerase chain reaction (PCR). Genus-specific PCR positive samples were further evaluated for H. felis and H. pylori using specific primer pairs. Thirty-six of 64 (56.3%) samples from domestic cats and 92 of 101 (91.1%) samples from feral cats were PCR positive; the positive rate of feces samples was higher than that of saliva samples in both groups. H. felis and H. pylori species-specific PCR was uniformly negative. The prevalence of Helicobacter spp. in feral cats was approximately two-fold higher than that of domestic cats. The fecal-oral route may be more a common transmission route not only between cats but also in humans. PMID:19255526

  5. IMMUNOHISTOCHEMISTRY VERSUS IMMUNOFLUORESENCE IN THE DIAGNOSIS OF AUTOIMMUNE BLISTERING DISEASES

    Directory of Open Access Journals (Sweden)

    Ana Maria Abreu Velez

    2013-11-01

    Full Text Available Introduction: In patients with autoimmune skin blistering diseases (ABDs, the diagnostic gold standard has classically been direct and indirect immunofluorescence (DIF and IIF, despite inherent technical problems of autofluorescence. Aim: We sought to overcome autofluorescence issues and compare the reliability of immunofluorescence versus immunohistochemistry (IHC staining in the diagnoses of these diseases. Methods: We tested via IHC for anti-human IgG, IgM, IgA, IgD, IgE, Kappa light chains, Lambda light chains, Complement/C3c, Complement/C1q, Complement/C3d, albumin and fibrinogen in 30 patients affected by a new variant of endemic pemphigus foliaceus in El Bagre, Colombia (El Bagre-EPF, and 30 control biopsies from the endemic area. We also tested archival biopsies from patients with ABDs whose diagnoses were made clinically, histopathologically and by DIF/IIF studies from 2 independent dermatopathology laboratories in the USA. Specifically, we tested 34 patients with bullous pemphigoid (BP, 18 with pemphigus vulgaris (PV, 8 with pemphigus foliaceus (PF, 14 with dermatitis herpetiformis (DH and 30 control skin samples from plastic esthetic surgery reduction surgeries. Results: The diagnostic correlation between IHC and DIF-IIF was almost 98% in most cases. IHC revealed evidence of autofluorescence around dermal blood vessels, dermal eccrine glands and neurovascular packages feeding skin appendices in ABDs; this autofluorescence may represent a non-specific immune response. Strong patterns of positivity were seen also in endothelial-mesenchymal cell junction-like structures, as well as between dermal fibrohistiocytic cells. In PV, we noted strong reactivity to neurovascular packages supplying sebaceous glands, as well as apocrine glands with edematous changes. Conclusions: We suggest that IHC is as reliable as DIF or IIF for the diagnosis of ABDs; our findings further suggest that what has previously been considered DIF/IIF autofluorescence

  6. Aerobic bacteria from mucous membranes, ear canals, and skin wounds of feral cats in Grenada, and the antimicrobial drug susceptibility of major isolates.

    Science.gov (United States)

    Hariharan, Harry; Matthew, Vanessa; Fountain, Jacqueline; Snell, Alicia; Doherty, Devin; King, Brittany; Shemer, Eran; Oliveira, Simone; Sharma, Ravindra N

    2011-03-01

    In a 2-year period 54 feral cats were captured in Grenada, West Indies, and a total of 383 samples consisting of swabs from rectum, vagina, ears, eyes, mouth, nose and wounds/abscesses, were cultured for aerobic bacteria and campylobacters. A total of 251 bacterial isolates were obtained, of which 205 were identified to species level and 46 to genus level. A commercial bacterial identification system (API/Biomerieux), was used for this purpose. The most common species was Escherichia coli (N=60), followed by Staphylococcus felis/simulans (40), S. hominis (16), S. haemolyticus (12), Streptococcus canis (9), Proteus mirabilis (8), Pasteurella multocida (7), Streptococcus mitis (7), Staphylococcus xylosus (7), S. capitis (6), S. chromogenes (4), S. sciuri (3), S. auricularis (2), S. lentus (2), S. hyicus (2), Streptococcus suis (2) and Pseudomonas argentinensis (2). Sixteen other isolates were identified to species level. A molecular method using 16S rRNA sequencing was used to confirm/identify 22 isolates. Salmonella or campylobacters were not isolated from rectal swabs. E. coli and S. felis/simulans together constituted 50% of isolates from vagina. S. felis/simulans was the most common species from culture positive ear and eye samples. P. multocida was isolated from 15% of mouth samples. Coagulase-negative staphylococci were the most common isolates from nose and wound swabs. Staphylococcus aureus, or S. intemedius/S. pseudintermedius were not isolated from any sample. Antimicrobial drug resistance was minimal, most isolates being susceptible to all drugs tested against, including tetracycline. PMID:20627391

  7. Molecular characterization of Cryptosporidium spp. from HIV infected patients from an urban area of Brazil Caracterização molecular de Cryptosporidium spp. de pacientes de área urbana do Brasil infectados por HIV

    Directory of Open Access Journals (Sweden)

    Patrícia de Lucca

    2009-12-01

    Full Text Available Cryptosporidium spp. are important cause of enteric disease in humans, but may also infect animals. This study describes the relative frequency of several Cryptosporidium species found in human specimens from HIV infected patients in the São Paulo municipality obtained from January to July 2007. Sequence analysis of the products of nested-PCR based on small subunit rRNA and Cryptosporidium oocyst wall protein coding genes revealed 17 (63.0% isolates of C. hominis, four (14.8% C. parvum, five (18.5% C. felis and one (3.7% C. canis. These findings suggest that, in urban environments of Brazil, the cat adapted C. felis may play a potential role in the zoonotic transmission of cryptosporidiosis whereas the anthroponotic transmission of cryptosporidiosis caused by C. hominis seems to predominate.Cryptosporidium spp. são importantes causas de doenças entéricas em humanos, mas podem também ser encontrados em animais. O presente estudo descreve a frequência relativa de diversas espécies de Cryptosporidium em amostras de humanos da cidade de São Paulo, Brasil, obtidas de janeiro a julho de 2007. Análises de sequências de produtos de nested PCR direcionadas ao genes codificadores da menor unidade ribosomal e da proteina de parede de oocistos revelaram 17 (63,0% isolados de C. hominis, quatro (14,8% C. parvum, cinco (18,5% C. felis, e um (3,7% C. canis. Estes resultados sugerem que, em ambientes urbanos no Brasil, o genótipo adaptado ao gato pode desempenhar potencial papel na transmissão zoonótica de criptosporidiose, enquanto a transmissão antroponótica da criptosporidiose causada pelo C. hominis parece predominar.

  8. Molecular Detection of Zoonotic Rickettsiae and Anaplasma spp. in Domestic Dogs and Their Ectoparasites in Bushbuckridge, South Africa.

    Science.gov (United States)

    Kolo, Agatha O; Sibeko-Matjila, Kgomotso P; Maina, Alice N; Richards, Allen L; Knobel, Darryn L; Matjila, Paul T

    2016-04-01

    Members of the order Rickettsiales are small, obligate intracellular bacteria that are vector-borne and can cause mild to fatal diseases in humans worldwide. There is little information on the zoonotic rickettsial pathogens that may be harbored by dogs from rural localities in South Africa. To characterize rickettsial pathogens infecting dogs, we screened 141 blood samples, 103 ticks, and 43 fleas collected from domestic dogs in Bushbuckridge Municipality, Mpumalanga Province of South Africa, between October 2011 and May 2012 using the reverse line blot (RLB) and Rickettsia genus and species-specific quantitative real-time PCR (qPCR) assays. Results from RLB showed that 49% of blood samples and 30% of tick pools were positive for the genus-specific probes for Ehrlichia/Anaplasma; 16% of the blood samples were positive for Ehrlichia canis. Hemoparasite DNA could not be detected in 36% of blood samples and 30% of tick pools screened. Seven (70%) tick pools and both flea pools were positive for Rickettsia spp; three (30%) tick pools were positive for Rickettsia africae; and both flea pools (100%) were positive for Rickettsia felis. Sequencing confirmed infection with R. africae and Candidatus Rickettsia asemboensis; an R. felis-like organism from one of the R. felis-positive flea pools. Anaplasma sp. South Africa dog strain (closely related to Anaplasma phagocytophilum), A. phagocytophilum, and an Orientia tsutsugamushi-like sequence were identified from blood samples. The detection of emerging zoonotic agents from domestic dogs and their ectoparasites in a rural community in South Africa highlights the potential risk of human infection that may occur with these pathogens. PMID:26974185

  9. Dicty_cDB: AHA677 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ;, mRNA sequence. 66 4e-15 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides... |BM058379.1 2191-29 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDNA clone ...2191-29, mRNA sequence. 90 7e-14 1 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides

  10. EST Table: DC550282 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC550282 E_FL_phe-_20L24_F_0 10/09/28 38 %/139 aa gb|AAD21841.1| trypsin-like serine protease [Ctenocephalid...es felis] 10/09/02 n.h 10/08/28 n.h 10/09/10 32 %/143 aa AGAP004318-PA Protein|2R:54406026:54412612:-1|gene:CLIPC3 10/09/10 n.h 10/09/10 n.h FS930815 phe- ...

  11. EST Table: FY738641 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY738641 E_FL_famL_06F07_F_0 11/11/04 39 %/172 aa gb|AAD21841.1| trypsin-like serine protease [Ctenocephalid...es felis] 11/11/04 n.h 11/11/04 n.h 11/11/04 32 %/142 aa AGAP004318-PA Protein|2R:54406026:54412612:-1|gene:CLIPC3 11/11/04 n.h 11/11/04 n.h FS930815 famL ...

  12. AcEST: BP920045 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1_SCHPO Putative regulator of V-ATPase in vacuolar membrane protein 1 OS=Schizosaccharomyces pombe GN=ra...nt) OS=Felis silves... 33 7.0 >tr|B6NT37|B6NT37_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma florida...YN3|B6NYN3_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_239184 ...B6LHB2_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae GN=BRAFLDRAFT_206286 PE=4...DECSGANGGCAQACANTISSFYCSC 922 >tr|B6KZ70|B6KZ70_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae

  13. Sarcocystis leporum in cottontail rabbits and its transmission to carnivores.

    Science.gov (United States)

    Fayer, R; Kradel, D

    1977-04-01

    Muscle from Sarcocystis-infected cottontail rabbits (Sylvilagus floridanus) was fed to coccidia-free cats (Felis domestica) and dogs (Canis familiaris). Only cats became infected and shed sporocysts in their feces. The prepatent period ranged from 10 to 25 days and the patent period from 3 to 46 days. Sporocysts were fully sporulated when shed. They contained 4 sporozoites and a coarse granular residuum and averaged 9.4 by 13.6 micron (N=55). Doses of 200-75,000 sporocysts were orally administered to 5 domestic rabbits (Oryctolagus cuniculus). Domestic rabbits did not become infected, suggesting a strict host specificity for the intermediate host S. floridanus. PMID:405509

  14. Sarcocystis and related organisms in Australian Wildlife: IV. Studies on Sarcocystis cuniculi in European rabbits (Oryctolagus cuniculus).

    Science.gov (United States)

    Munday, B L; Smith, D D; Frenkel, J K

    1980-04-01

    The role of the cat (Felis domestica) as a definitive host for Sarcocystis cuniculi of European rabbits (Oryctolagus cuniculus) was confirmed. It was shown that after dosing with sporocysts from cats, rabbits developed sarcocysts and these became infective for cats at not less than 93 days post-infection (p.i.). The earliest infection detected was at 142 days p.i. Infected muscle from an experimental rabbit did not transmit Sarcocystis when fed to other rabbits. Microscopically, sarcocysts in European rabbits (O. cuniculus) were morphologically indistinguishable from those in cottontail rabbits (Sylvilagus floridanus). PMID:6776293

  15. Gastrointestinal parasites of cats in Denmark assessed by necropsy and concentration McMaster technique

    DEFF Research Database (Denmark)

    Takeuchi-Storm, Nao; Mejer, H.; Al-Sabi, Mohammad Nafi Solaiman; Olsen, C. S.; Thamsborg, S. M.; Enemark, Heidi

    The large population of feral cats in Denmark may potentially transmit pathogens to household cats and zoonotic parasites to humans. A total of 99 euthanized cats; feral cats (n = 92) and household cats with outdoor access (n = 7), were collected from March to May 2014 from the Zealand region...... and worm burdens of this species. Rural cats had a higher prevalence and worm burden of A. putorii than urban cats. By c-McMaster, ascarid, capillarid, strongylid or taeniid type eggs were found in 77.9% of the cats while Cystoisospora felis was found in 2.1%. The sensitivity of the c-McMaster was 82...

  16. Evolutionary conservation of ten microsatellite loci in four species of Felidae.

    Science.gov (United States)

    Menotti-Raymond, M A; O'Brien, S J

    1995-01-01

    Short tandem repeat polymorphisms (STRP), or microsatellites, are widespread among vertebrate genomes and are useful in gene mapping and population studies due to a high level of length polymorphism. We describe here the isolation, characterization, and PCR amplification of 10 microsatellite loci from the domestic cat, Felis catus. The flanking primer sequences were conserved among other Felidae species, and amplification products demonstrated abundant polymorphism in puma, lion, cheetah, and domestic cat. The cheetah sample exhibited the lowest level of polymorphism for these loci among felid species. PMID:7658003

  17. Diseño de una red de corredores ecológicos para carnívoros forestales en la Comunidad Valenciana

    OpenAIRE

    Terrones Contreras, Beatriz; Bonet Jornet, Andreu

    2014-01-01

    El presente trabajo pretende sentar las bases para la creación de una red de corredores ecológicos entre las áreas de la Red Natura 2000 en la Comunidad Valenciana. Con este objetivo se han desarrollado modelos de conectividad ecológica para la creación de corredores destinados a un grupo funcional específico formado por carnívoros forestales presentes en la Comunidad Valenciana, como el zorro rojo Vulpes vulpes, la garduña Martes foina, la gineta Genetta genetta y el gato montés europeo Feli...

  18. Discovery of sarolaner: A novel, orally administered, broad-spectrum, isoxazoline ectoparasiticide for dogs.

    Science.gov (United States)

    McTier, Tom L; Chubb, Nathan; Curtis, Michael P; Hedges, Laura; Inskeep, Gregory A; Knauer, Christopher S; Menon, Sanjay; Mills, Brian; Pullins, Aleah; Zinser, Erich; Woods, Debra J; Meeus, Patrick

    2016-05-30

    The novel isoxazoline ectoparasiticide, sarolaner, was identified during a lead optimization program for an orally-active compound with efficacy against fleas and ticks on dogs. The aim of the discovery program was to identify a novel isoxazoline specifically for use in companion animals, beginning with de novo synthesis in the Zoetis research laboratories. The sarolaner molecule has unique structural features important for its potency and pharmacokinetic (PK) properties, including spiroazetidine and sulfone moieties. The flea and tick activity resides in the chirally pure S-enantiomer, which was purified to alleviate potential off-target effects from the inactive enantiomer. The mechanism of action was established in electrophysiology assays using CHO-K1 cell lines stably expressing cat flea (Ctenocephalides felis) RDL (resistance-to-dieldrin) genes for assessment of GABA-gated chloride channel (GABACls) pharmacology. As expected, sarolaner inhibited GABA-elicited currents at both susceptible (CfRDL-A285) and resistant (CfRDL-S285) flea GABACls with similar potency. Initial whole organism screening was conducted in vitro using a blood feeding assay against C. felis. Compounds which demonstrated robust activity in the flea feed assay were subsequently tested in an in vitro ingestion assay against the soft tick, Ornithodoros turicata. Efficacious compounds which were confirmed safe in rodents at doses up to 30mg/kg were progressed to safety, PK and efficacy studies in dogs. In vitro sarolaner demonstrated an LC80 of 0.3μg/mL against C. felis and an LC100 of 0.003μg/mL against O. turicata. In a head-to-head comparative in vitro assay with both afoxolaner and fluralaner, sarolaner demonstrated superior flea and tick potency. In exploratory safety studies in dogs, sarolaner demonstrated safety in dogs≥8 weeks of age upon repeated monthly dosing at up to 20mg/kg. Sarolaner was rapidly and well absorbed following oral dosing. Time to maximum plasma concentration

  19. Assessing Risks to Non-Target Species during Poison Baiting Programs for Feral Cats

    OpenAIRE

    Tony Buckmaster; Dickman, Christopher R.; Johnston, Michael J

    2014-01-01

    Poison baiting is used frequently to reduce the impacts of pest species of mammals on agricultural and biodiversity interests. However, baiting may not be appropriate if non-target species are at risk of poisoning. Here we use a desktop decision tree approach to assess the risks to non-target vertebrate species in Australia that arise from using poison baits developed to control feral house cats (Felis catus). These baits are presented in the form of sausages with toxicant implanted in the ba...

  20. Large Scale Magnetic Separation of Solanum tuberosum Tuber Lectin from Potato Starch Waste Water

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Horská, Kateřina; Martinez, L. M.; Šafaříková, Miroslava

    Melville : American institute of physics, 2010 - (Häfeli, U.; Schütt, W.; Zborowski, M.), s. 146-151 ISBN 978-0-7354-0866-1. ISSN 0094-243X. - (AIP Conference Proceedings. 1311). [International Conference on the Scientific and Clinical Applications of Magnetic Carriers /8./. Rostock (DE), 25.05.2010-29.05.2010] Institutional research plan: CEZ:AV0Z60870520 Keywords : drug delivery * magnetic microspheres and ferrofluids * magnetic nanospheres * molecular biology * stem cell separation * starch production * potato waste water * magnetic separation * chitosan * lectin * Solanum tuberosum Subject RIV: EH - Ecology, Behaviour

  1. Molecular Identification of Pathogenic Bacteria in Eschars from Acute Febrile Patients, Senegal

    OpenAIRE

    Mediannikov, O.; Socolovschi, C.; Million, M; Fenollar, F.; H. Bassene; G. Diatta; Sokhna, C.S.; Raoult, D.

    2014-01-01

    Fever caused by Rickettsia fells was recently shown to play an important role in infectious diseases morbidity in sub-Saharan Africa. We collected 68 cotton swabs from fever-associated eschars in four different regions of Senegal. In 5 of 68 eschar samples (7.4%), we have identified DNA from R. felis. In 49 of 68 eschar samples (72.1%), we have identified DNA from Staphylococcus aureus. In 35 of 68 eschar samples (51.5%), we have identified DNA from Streptococcus pyogenes, and in 4 of 68 esch...

  2. Étude d'une grotte à Ours du Pléistocène moyen en Dordogne : la Grotte XIV.

    OpenAIRE

    Guadelli, Jean-Luc

    1997-01-01

    La Grotte XIV (Dordogne, France) a livré des restes attribuables à des espèces d'âge pléistocène moyen ancien : Dinobatis, Panthera gombaszoegensis, Panthère, Felis (de grande taille) ou Lynx (de petite taille), Ursus cf. deningeri, Canis cf. etruscus, Hemitragus, Cervus, Capreolus, Dicerorhinus,... Les restes d'Ours présentent des caractères très primitifs (entoconide des M1 très simple, faible torsion de l'articulation distale des tibias, ...) ce qui pose la question de l'identification pré...

  3. A Case of Human Infection by Rickettsia slovaca in Greece.

    Science.gov (United States)

    Kostopoulou, Vasiliki; Chochlakis, Dimosthenis; Kanta, Chrysoula; Katsanou, Andromachi; Rossiou, Konstantina; Rammos, Aidonis; Papadopoulos, Spyridon-Filippos; Katsarou, Theodora; Tselentis, Yannis; Psaroulaki, Anna; Boukas, Chrysostomos

    2016-07-22

    Although tick-borne rickettsiosis is endemic in Greece, until recently, human samples arriving at the National Reference Centre under suspicion of rickettsial infection were routinely tested only for Rickettsia typhi and R. conorii. However, identification of additional rickettsia species in ticks prompted revision of the protocol in 2010. Until that year, all human samples received by the laboratory were tested for antibodies against R. conorii and R. typhi only. Now, tests for R. slovaca, R. felis, and R. mongolotimonae are all included in routine analysis. The current description of a human R. slovaca case is possible as a result of these changes in routine testing. PMID:26370429

  4. Freqüência de parasitas intestinais em felinos mantidos em zoológicos Frequency of intestinal parasites in felines kept in zoos

    Directory of Open Access Journals (Sweden)

    G.C.K. Müller

    2005-08-01

    Full Text Available The endoparasites occurrence in felines confined in two Zoos, between December 1999 and April 2000, was studied. Fecal samples of 18 felines (Panthera tigris, Panthera leo, Felis serval, Panthera onca, Puma concolor, Leopardus tigrinus and Leopardus wiedii were collected and the methods of Faust, modified Baermann and Hoffmann, were used for fecal analyses. Three genera were identified in the feces: Trichuris spp., Toxocara spp. and Giardia spp. In the zoo of Pomerode, six animals (46% were infected by Trichuris spp. and/or Giardia spp. and all samples from the zoo of Brusque were infected by Trichuris spp., Toxocara spp. and Giardia spp.

  5. Age, sex, reproduction, and spatial organization of lynxes colonizing northeastern Minnesota

    Science.gov (United States)

    Mech, L.D.

    1980-01-01

    From 1972 through 1978, lynxes (Felis lynx) emigrating from Canada were studied in northeastern Minnesota. Fourteen individuals were radio-tracked, 8 wefe ear-tagged, and 49 carcasses were examined. Sex ratios of the samples were equal during the first years of the study, but females predominated later. At least half of the radiotagged lynxes were killed by humans; no natural mortality was detected. Home range sizes ranged from 51 to 122 km2 for females and 145 to 243 km2 for males, up to 10 times the sizes of those reported by other workers. Ranges of females tended to overlap. Males and females appeared to be segregated in the population.

  6. Extracellular and intracellular magnetic heating by core-shell La.sub.0.75./sub.Sr.sub.0.25./sub.MnO.sub.3./sub. . SiO.sub.2./sub. nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Veverka, Pavel; Kaman, Ondřej; Pollert, Emil; Maryško, Miroslav; Veverka, Miroslav; Kupčík, Jaroslav; Jendelová, Pavla; Herynek, V.; Burian, M.; Kašpar, P.

    Vancouver : Urs Häfeli, Faculty of Pharmaceutical Sciences, UBC, 2010. s. 172. ISBN N. [International Conference on the Scientific and Clinical Applications of Magnetic Carriers /8./. 25.05.2010-29.05.2010, Rostock] R&D Projects: GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z40720504; CEZ:AV0Z60870520 Keywords : manganese perovskite * core-shell nanoparticles * magnetic heating * in-vitro examinations Subject RIV: BM - Solid Matter Physics ; Magnetism

  7. Efecto clínico de la inyección intramuscular de alfaxalona sola o en combinación con dexmedetomidina y estudio farmacocinético-farmacodinámico en la especie felina

    OpenAIRE

    Rodrigo Mocholí, Diego

    2016-01-01

    Los objetivos planteados en esta Tesis son: • Estudiar el efecto sedante y/o anestésico de la alfaxalona administrada sola o en combinación con dexmedetomidina por vía intramuscular en la especie felina. • Determinar los efectos a nivel cardiorrespiratorio observados en gatos tras el empleo intramuscular de estas combinaciones. • Efectuar un estudio farmacocinético y farmacodinámico comparativo tras la administración de alfaxalona por vía intramuscular y endovenosa en la especie feli...

  8. Serosurvey of Rickettsia spp. in dogs and humans from an endemic area for Brazilian spotted fever in the State of São Paulo, Brazil Sorologia para Rickettsia spp. em cães e humanos de uma área endêmica para febre maculosa brasileira no Estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Adriano Pinter

    2008-02-01

    Full Text Available The present study provides a rickettsial serosurvey in 25 dogs and 35 humans in an endemic area for Brazilian spotted fever in the State of São Paulo, where the tick Amblyomma aureolatum is the main vector. Testing canine and human sera by indirect immunofluorescence against four Rickettsia antigens (R. rickettsii, R. parkeri, R. felis and R. bellii showed that 16 (64% of canine sera and 1 (2.8% of human sera reacted to at least one of these rickettsial antigens with titers ³ 64. Seven canine sera and the single reactive human serum showed titers to R. rickettsii at least four times those of any of the other three antigens. The antibody titers in these 7 animals and 1 human were attributed to stimulation by R. rickettsii infection. No positive canine or human serum was attributed to stimulation by R. parkeri, R. felis, or R. bellii. Our serological results showed that dogs are important sentinels for the presence of R. rickettsii in areas where the tick A. aureolatum is the main vector of Brazilian spotted fever.Este estudo avaliou a ocorrência de anticorpos anti-Rickettsia em 25 cães e 35 humanos, em uma área endêmica para a febre maculosa brasileira no Estado de São Paulo, onde o principal vetor é o carrapato Amblyomma aureolatum. Soros dos cães e humanos foram testados pela técnica de imunofluorescência indireta contra quatro antígenos de riquétsias (R. rickettsii, R. parkeri, R. felis, R. bellii, mostrando que soros de 16 (64% cães e 1 (2,8% humano reagiram com títulos ³ 64 para pelo menos um dos antígenos de riquétsias. Sete soros caninos e o único soro humano reativo demonstraram títulos para R. rickettsii no mínimo quatro vezes maior do que aqueles para os outros antígenos de riquétsias. Os títulos de anticorpos nesses cães e um humano foram considerados homólogos a R. rickettsii, enquanto que nenhum soro de cão ou humano foi considerado reativamente homólogo para R. parkeri, R. felis ou R. bellii. Os

  9. Al este de la campana de Gauss. Una aproximación desde la docencia a las altas capacidades. Aprendizajes significativos desde su hipersensibilidad e hiperestesia

    OpenAIRE

    Fernández Bascaran, Eva

    2013-01-01

    Mi investigación se basa en tratar de obtener aprendizajes significativos en alumnado con altas capacidades tomando como aliado a su favor su hipersensibilidad e hiperestesia, su alto sentido de la justicia y su empatía. Investigar la habilidad del alumnado con altas capacidades no solo en el plano cognitivo, sino también desde el plano sensitivo-afectivo-emocional. Utilizar su hipersensibilidad y empatía para ayudar a sus compañeros (aprendizaje cooperativo) y reforzar su personalidad y feli...

  10. Isolation of Microsporum gypseum from the haircoat of health wild felids kept in captivity in Brazil

    OpenAIRE

    Bentubo Henri Donnarumma Levy; Fedullo José Daniel Luzes; Corrêa Sandra Helena Ramiro; Teixeira Rodrigo Hidalgo Friciello; Coutinho Selene Dall' Acqua

    2006-01-01

    Dermatophytes are fungi that cause superficial mycoses in animals and humans. While studies have shown that domestic cats (Felis catus) are often asymptomatic carriers of dermatophytes, and thus a significant source of infection, this aspect has not been studied in relation to their wild relatives. The present study was aimed at determining the presence of dermatophytes on the haircoat of healthy wild felids, kept in captivity at "Fundação Parque Zoológico de São Paulo". Samples were taken fr...

  11. Isolation of Microsporum gypseum from the haircoat of health wild felids kept in captivity in Brazil Isolamento de Microsporum gypseum do pelame de felídeos selvagens sadios mantidos em cativeiro no Brasil

    OpenAIRE

    Henri Donnarumma Levy Bentubo; José Daniel Luzes Fedullo; Sandra Helena Ramiro Corrêa; Rodrigo Hidalgo Friciello Teixeira; Selene Dall' Acqua Coutinho

    2006-01-01

    Dermatophytes are fungi that cause superficial mycoses in animals and humans. While studies have shown that domestic cats (Felis catus) are often asymptomatic carriers of dermatophytes, and thus a significant source of infection, this aspect has not been studied in relation to their wild relatives. The present study was aimed at determining the presence of dermatophytes on the haircoat of healthy wild felids, kept in captivity at "Fundação Parque Zoológico de São Paulo". Samples were taken fr...

  12. Salida de campo al monte de El Alambrado (Quintanilla de Onésimo, Valladolid) el 29 de junio de 1952

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Salida de campo al monte de El Alambrado, en Quintanilla de Onésimo (Valladolid), el 29 de junio de 1952, de la que se anotaron observaciones sobre vegetación, renacuajos, una sapo tiñoso (sin concretar la especie), culebras, lagartijas, Timon lepidus (Lagarto ocelado, llamado Lacerta lepida o Lacerta ocellata por el autor), grillos, mariposas, los siguientes mamíferos: Ardilla (pudiendo ser Sciurus vulgaris o Atlantoxerus getulus), Felis silvestris (Gato montés), Lirón (pudiendo ser Eliomys ...

  13. Dicty_cDB: Contig-U11533-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 382131 |pid:none) Yarrowia lipolytica strain CLIB1... 74 6e-12 ( Q02724 ) RecName: Full=Ubiquitin-li...thetical protei... 43 0.011 CR382129_134( CR382129 |pid:none) Yarrowia lipolytica strain CLIB1....40 0.056 AM437443_1( AM437443 |pid:none) Vitis vinifera contig VV78X098019.... 40 0.056 CR382130_849( CR3821...000053_209( CP000053 |pid:none) Rickettsia felis URRWXCal2, comp... 38 0.28 CP001227_810( CP001227 |pid:none...ixxx--- ---xxxx*klemqkrkrsvviivsqnvifsilffiqnfvmiiilttmkkledgqleliyl kwiklsfqfiwviigvwl*lilkqnnlnimivy*vqikn

  14. Información proporcionada por cazadores sobre la fauna de Vadocondes (Burgos) el 13 de noviembre de 1953

    OpenAIRE

    Valverde Gómez, José Antonio, 1926-2003

    2008-01-01

    Información proporcionada al autor por cazadores, sobre la fauna de Vadocondes (Burgos), a 13 de noviembre de 1953, que incluye a los siguientes anfibios: Alytes sp. (Sapo partero), Bufo sp. (Sapo) y "Molge sp." (puede referirse a Triturus marmoratus o a Pleurodeles waltl), los siguientes mamíferos: Ardilla (pudiendo ser, Sciurus vulgaris o Atlantoxerus getulus), Canis lupus (Lobo), Erizo (pudiendo ser Erinaceus europaeus o Atelerix algirus), Felis silvestris (Gato montés), Lirón (pudiendo se...

  15. Determinants of FIV and HIV Vif sensitivity of feline APOBEC3 restriction factors

    OpenAIRE

    Zhang, Zeli; Gu, Qinyong; Jaguva Vasudevan, Ananda Ayyappan; Hain, Anika; Kloke, Björn-Philipp; Hasheminasab, Sascha; Mulnaes, Daniel; Sato, Kei; Cichutek, Klaus; Häussinger, Dieter; Bravo, Ignacio G; Smits, Sander H. J.; Gohlke, Holger; Münk, Carsten

    2016-01-01

    Background Feline immunodeficiency virus (FIV) is a global pathogen of Felidae species and a model system for Human immunodeficiency virus (HIV)-induced AIDS. In felids such as the domestic cat (Felis catus), APOBEC3 (A3) genes encode for single-domain A3Z2s, A3Z3 and double-domain A3Z2Z3 anti-viral cytidine deaminases. The feline A3Z2Z3 is expressed following read-through transcription and alternative splicing, introducing a previously untranslated exon in frame, encoding a domain insertion ...

  16. Ecología e impacto de los mamíferos invasores en ecosistemas insulares: la isla de Corvo, Archipiélago de las Azores

    OpenAIRE

    Hervías Parejo, Sandra

    2014-01-01

    Tesis por compendio de publicaciones Esta investigación se ha centrado en analizar el impacto directo e indirecto de los tres mamíferos invasores más comunes en los ecosistemas insulares (el ratón casero Mus domesticus, la rata negra Rattus rattus y el gato Felis silvestris catus), sobre la pardela cenicienta (Calonectris diomedea borealis). El trabajo se ha desarrollado en Corvo, que es la isla más remota del Archipiélago de las Azores y la última en ser descubierta y colonizada, por lo q...

  17. A new species of Xyliphius, a rarely sampled banjo catfish (Siluriformes: Aspredinidae from the rio Tocantins-Araguaia system

    Directory of Open Access Journals (Sweden)

    Carlos A Figueiredo

    2010-03-01

    Full Text Available Xyliphius anachoretes, a new species of aspredinid catfish is described from the Tocantins-Araguaia River system. Xyliphius anachoretes is diagnosed by the presence of six developed retrorse serrae on posterior border of pectoral-fin spine, presence of papillae on the lower lip bearing minute branches, and only two dorsal procurrent rays. Comments about the informativeness of character-state variation among Xyliphius species and aspredinid related genera are furnished. Also, a brief discussion about conservation status of the new taxon is made.Xyliphius anachoretes, uma nova espécie de bagre aspredinídeo é descrita para o sistema Tocantins-Araguaia. Xyliphius anachoretes é diagnosticado pela presença de seis serras retrorsas desenvolvidas na borda posterior do espinho da nadadeira peitoral, presença de papilas no lábio inferior apresentando minúsculas ramificações, e somente dois raios pró-correntes dorsais. Comentários sobre a informação contida na variação de estados de caráter entre as espécies de Xyliphius são fornecidos. Além disso, uma breve discussão sobre o estado de conservação do novo táxon é feita.

  18. Malaria in gold-mining areas in Colombia.

    Science.gov (United States)

    Castellanos, Angélica; Chaparro-Narváez, Pablo; Morales-Plaza, Cristhian David; Alzate, Alberto; Padilla, Julio; Arévalo, Myriam; Herrera, Sócrates

    2016-01-01

    Gold-mining may play an important role in the maintenance of malaria worldwide. Gold-mining, mostly illegal, has significantly expanded in Colombia during the last decade in areas with limited health care and disease prevention. We report a descriptive study that was carried out to determine the malaria prevalence in gold-mining areas of Colombia, using data from the public health surveillance system (National Health Institute) during the period 2010-2013. Gold-mining was more prevalent in the departments of Antioquia, Córdoba, Bolívar, Chocó, Nariño, Cauca, and Valle, which contributed 89.3% (270,753 cases) of the national malaria incidence from 2010-2013 and 31.6% of malaria cases were from mining areas. Mining regions, such as El Bagre, Zaragoza, and Segovia, in Antioquia, Puerto Libertador and Montelíbano, in Córdoba, and Buenaventura, in Valle del Cauca, were the most endemic areas. The annual parasite index (API) correlated with gold production (R2 0.82, p gold produced, the API increased by 0.54 cases per 1,000 inhabitants. Lack of malaria control activities, together with high migration and proliferation of mosquito breeding sites, contribute to malaria in gold-mining regions. Specific control activities must be introduced to control this significant source of malaria in Colombia. PMID:26814645

  19. Feeding ecology of Auchenipterichthys longimanus (Siluriformes: Auchenipteridae in a riparian flooded forest of Eastern Amazonia, Brazil

    Directory of Open Access Journals (Sweden)

    Tiago Magalhães da Silva Freitas

    2011-01-01

    Full Text Available Feeding habits of the midnight catfish Auchenipterichthys longimanus collected in rivers of the Caxiuanã National Forest (Eastern Amazonia, Brazil were investigated through the different hydrological periods (dry, filing, flood and drawdown. A total of 589 specimens were collected throughout seven samplings between July 2008 and July 2009, of which 74 were young males, 177 adult males, 89 young females and 249 adult females. The diet composition (Alimentary index - Ai% was analyzed by a non-metric multidimensional scaling (nMDS and by the analysis of similarity (ANOSIM, which included 37 items grouped into nine categories (Aquatic insects, Other aquatic invertebrates, Arthropods fragment, Fish, Plant fragment, Seeds, Terrestrial insects, Other terrestrial invertebrates, and Terrestrial vertebrates. We also calculated the niche breadth (Levins index and the repletion index (RI%. Differences in the diet composition between hydrological seasons were registered, primarily on diet composition between dry and flood season, but changes related with sex and maturity were not observed. The midnight catfish showed more specialists feeder habit in the flood period (March 2009 and more generalist habits in the dry season (November 2008. The amount of food eaten by A. longimanus based on repletion index (RI%, did not differ significantly from sex and maturity. However, we evidenced differences in RI% when comparing the studied months. These results provide important biological information about the trophic ecology of auchenipterids fish. In view of the higher occurrence of allochthonous items, this research also underpins the importance of riparian forests as critical environments in the maintenance and conservation of wild populations of fish in the Amazon basin.Neste estudo foram investigados os hábitos alimentares do bagre Auchenipterichthys longimanus coletados em rios da Floresta Nacional de Caxiuanã (Amazônia Oriental, Brasil ao longo de diferentes

  20. Malaria in gold-mining areas in Colombia

    Directory of Open Access Journals (Sweden)

    Angélica Castellanos

    2016-01-01

    Full Text Available Gold-mining may play an important role in the maintenance of malaria worldwide. Gold-mining, mostly illegal, has significantly expanded in Colombia during the last decade in areas with limited health care and disease prevention. We report a descriptive study that was carried out to determine the malaria prevalence in gold-mining areas of Colombia, using data from the public health surveillance system (National Health Institute during the period 2010-2013. Gold-mining was more prevalent in the departments of Antioquia, Córdoba, Bolívar, Chocó, Nariño, Cauca, and Valle, which contributed 89.3% (270,753 cases of the national malaria incidence from 2010-2013 and 31.6% of malaria cases were from mining areas. Mining regions, such as El Bagre, Zaragoza, and Segovia, in Antioquia, Puerto Libertador and Montelíbano, in Córdoba, and Buenaventura, in Valle del Cauca, were the most endemic areas. The annual parasite index (API correlated with gold production (R2 0.82, p < 0.0001; for every 100 kg of gold produced, the API increased by 0.54 cases per 1,000 inhabitants. Lack of malaria control activities, together with high migration and proliferation of mosquito breeding sites, contribute to malaria in gold-mining regions. Specific control activities must be introduced to control this significant source of malaria in Colombia.

  1. Genotoxicity and mutagenicity of water contaminated with tannery effluents, as evaluated by the micronucleus test and comet assay using the fish Oreochromis niloticus and chromosome aberrations in onion root-tips

    Directory of Open Access Journals (Sweden)

    Silvia Tamie Matsumoto

    2006-01-01

    Full Text Available Cytotoxicity of metals is important because some metals are potential mutagens able to induce tumors in humans and experimental animals. Chromium can damage DNA in several ways, including DNA double strand breaks (DSBs which generate chromosomal aberrations, micronucleus formation, sister chromatid exchange, formation of DNA adducts and alterations in DNA replication and transcription. In our study, water samples from three sites in the Córrego dos Bagres stream in the Franca municipality of the Brazilian state of São Paulo were subjected to the comet assay and micronucleus test using erythrocytes from the fish Oreochromis niloticus. Nuclear abnormalities of the erythrocytes included blebbed, notched and lobed nuclei, probably due to genotoxic chromium compounds. The greatest comet assay damage occurred with water from a chromium-containing tannery effluent discharge site, supporting the hypothesis that chromium residues can be genotoxic. The mutagenicity of the water samples was assessed using the onion root-tip cell assay, the most frequent chromosomal abnormalities observed being: c-metaphases, stick chromosome, chromosome breaks and losses, bridged anaphases, multipolar anaphases, and micronucleated and binucleated cells. Onion root-tip cell mutagenicity was highest for water samples containing the highest levels of chromium.

  2. TISSUE INHIBITOR OF METALLOPROTEINASE 1, MATRIX METALLOPROTEINASE 9, ALPHA-1 ANTITRYPSIN, METALLOTHIONEIN AND UROKINASE TYPE PLASMINOGEN ACTIVATOR RECEPTOR IN SKIN BIOPSIES FROM PATIENTS AFFECTED BY AUTOIMMUNE BLISTERING DISEASES

    Directory of Open Access Journals (Sweden)

    Ana Maria Abreu Velez

    2013-07-01

    Full Text Available Introduction: Proteinases and proteinase inhibitors have been described to play a role in autoimmune skin blistering diseases. We studied skin lesional biopsies from patients affected by several autoimmune skin blistering diseases for proteinases and proteinase inhibitors. Methods: We utilized immunohistochemistry to evaluate biopsies for alpha-1-antitrypsin, human matrix metalloproteinase 9 (MMP9, human tissue inhibitor of metalloproteinases 1 (TIMP-1, metallothionein and urokinase type plasminogen activator receptor (uPAR. We tested 30 patients affected by endemic pemphigus, 30 controls from the endemic area, and 15 normal controls. We also tested 30 biopsies from patients with bullous pemphigoid (BP, 20 with pemphigus vulgaris (PV, 8 with pemphigus foliaceus, and 14 with dermatitis herpetiformis (DH. Results: Contrary to findings in the current literature, most autoimmune skin blistering disease biopsies were negative for uPAR and MMP9. Only some chronic patients with El Bagre-EPF were positive to MMP9 in the dermis, in proximity to telocytes. TIMP-1 and metallothionein were positive in half of the biopsies from BP patients at the basement membrane of the skin, within several skin appendices, in areas of dermal blood vessel inflammation and within dermal mesenchymal-epithelial cell junctions.

  3. Biogeography of the Pistia clade (Araceae): based on chloroplast and mitochondrial DNA sequences and Bayesian divergence time inference.

    Science.gov (United States)

    Renner, Susanne S; Zhang, Li-Bing

    2004-06-01

    Pistia stratiotes (water lettuce) and Lemna (duckweeds) are the only free-floating aquatic Araceae. The geographic origin and phylogenetic placement of these unrelated aroids present long-standing problems because of their highly modified reproductive structures and wide geographical distributions. We sampled chloroplast (trnL-trnF and rpl20-rps12 spacers, trnL intron) and mitochondrial sequences (nad1 b/c intron) for all genera implicated as close relatives of Pistia by morphological, restriction site, and sequencing data, and present a hypothesis about its geographic origin based on the consensus of trees obtained from the combined data, using Bayesian, maximum likelihood, parsimony, and distance analyses. Of the 14 genera closest to Pistia, only Alocasia, Arisaema, and Typhonium are species-rich, and the latter two were studied previously, facilitating the choice of representatives that span the roots of these genera. Results indicate that Pistia and the Seychelles endemic Protarum sechellarum are the basalmost branches in a grade comprising the tribes Colocasieae (Ariopsis, Steudnera, Remusatia, Alocasia, Colocasia), Arisaemateae (Arisaema, Pinellia), and Areae (Arum, Biarum, Dracunculus, Eminium, Helicodiceros, Theriophonum, Typhonium). Unexpectedly, all Areae genera are embedded in Typhonium, which throws new light on the geographic history of Areae. A Bayesian analysis of divergence times that explores the effects of multiple fossil and geological calibration points indicates that the Pistia lineage is 90 to 76 million years (my) old. The oldest fossils of the Pistia clade, though not Pistia itself, are 45-my-old leaves from Germany; the closest outgroup, Peltandreae (comprising a few species in Florida, the Mediterranean, and Madagascar), is known from 60-my-old leaves from Europe, Kazakhstan, North Dakota, and Tennessee. Based on the geographic ranges of close relatives, Pistia likely originated in the Tethys region, with Protarum then surviving on the

  4. Mapping trends of large and medium size carnivores of conservation interest in Romania

    Directory of Open Access Journals (Sweden)

    Mihai Cristian Adamescu

    2014-07-01

    Full Text Available We analysed yearly estimates of population size data during 2001-2012 for five carnivores species of conservation interest (Ursus arctos, Canis lupus, Lynx lynx, Felis silvestris and Canis aureus. Population size estimations were done by the game management authorities and integrated by the competent authorities on the Ministry of Environment and Climate Change. Trends in data were detected using non-parametric Mann-Kendall test. This test was chosen considering the short length of data series and its usefulness for non-normal distributed data. The trend was tested at three spatial scales: game management units (n=1565, biogeographical region (n=5 and national. Trends depicted for each game management unit were plotted using ArcGIS, resulting species trend distribution maps. For the studied period increasing population trends were observed for Ursus arctos, Canis lupus, Canis aureus and Lynx lynx, while for Felis silvestris there was no trend recorded. Such an analysis in especially useful for conservation proposes, game management and reporting obligations under article 17 of the EC Habitat Directive, using population trend as a proxy for population dynamics. We conclude that the status of the five carnivore species is favourable during the study period.

  5. N-acetylcysteine, a novel treatment for Helicobacter pylori infection.

    Science.gov (United States)

    Huynh, Hien Quoc; Couper, Richard T L; Tran, Cuong D; Moore, Lynette; Kelso, Richard; Butler, Ross N

    2004-01-01

    N-Acetylcysteine (NAC), being both a mucolytic agent and a thiol-containing antioxidant, may affect the establishment and maintenance of H. pylori infection within the gastric mucus layer and mucosa. Agar and broth dilution susceptibility tests determined the MIC of H. pylori strain SSI to NAC. H. pylori load in SSI strain-infected C57BL mice was determined as colony forming units per gram of gastric tissue. Gastritis assessment was scored and gastric surface hydrophobicity was determined by contact angle measurement. MICs of NAC were 5 to 10 and 10 to 15 mg/ml using the agar dilution and broth dilution methods, respectively. NAC (120 mg per day for 14 days) reduced the H. pylori load in mice by almost 1 log compared with sham treatment. Pretreatment with NAC (40 mg/day) also significantly reduced the H. pylori load but did not prevent H. pylori colonization. Both H. pylori infection and NAC reduced the surface hydrophobicity of murine gastric mucosa. No significant differences were observed in the gastritis scores of H. felis- or H. pylori-infected mice receiving either NAC or sham treatments. This study demonstrates that NAC inhibits the growth of H. pylori in both agar and broth susceptibility tests and in H. pylori-infected mice. NAC did not alter the severity of H. pylori- or H. felis-induced gastritis. PMID:15628716

  6. Parásitos en perros de San Juan Bautista, Isla Robinson Crusoe, Chile Parasites in dogs from San Juan Bautista, Robinson Crusoe Island, Chile

    Directory of Open Access Journals (Sweden)

    D González-Acuña

    2008-01-01

    Full Text Available Se estudió la fauna parasitaria de 40 perros en el poblado de San Juan Bautista, Isla Robinson Crusoe, Chile. El 50% (n = 20 de los perros presentó huevos de tipo Ancylostomideos, Strongyloideos y/o de especies Isospora sp. y Cystoisospora canis. No se encontraron muestras positivas a cestodos. El 100% de los perros presentó alguno de los siphonapteros Ctenocephalides canis, C. felis y/o Pulex irritans. En un perro se aisló un ejemplar de la garrapata café del perro Rhipicephalus sanguineus (2,5%. Se discute la importancia de los presentes resultados.The parasitological fauna of 40 dogs was studied in San Juan Bautista, Robinson Crusoe Island, Chile. 50% (n = 20 of the dogs had eggs of the Ancylostomid, Strongylid type and/or the oocysts of Isospora sp. and Cystoisospora canis. No positive samples of cestodes were found. 100% of the dogs were parasited by the fleas Ctenocephalides canis, C. felis and/or Pulex irritans. One brown dog tick, Rhipicephalus sanguineus, was found in one dog (2.5%. The importance of these findings is discussed.

  7. Cat, cougar, and jaguar spermatogenesis: a comparative analysis

    Directory of Open Access Journals (Sweden)

    Deiler Sampaio Costa

    2006-09-01

    Full Text Available This work presents a comparative review about the spermatogenic process in cats (Felis domestica, jaguars (Panthera onca and cougars (Puma concolor, with emphasis on testicular biometry, gonadossomatic index, volumetric proportion of testicular parenchyma components, tubular diameter, seminiferous epithelial height and seminiferous tubule length. It was an approach of the differences among the cell proportions that allowed conclusions about the overall yield of spermatogenic process and Sertoli cell index in three feline species.O processo espermatogênico do gato doméstico (Felis domestica, da onça-pintada (Panthera onca e da onça-parda (Puma concolor são analisados de forma comparativa, dando-se ênfase à biometria testicular, ao índice gonadossomático, à proporção volumétrica dos constituintes do parênquima testicular, ao diâmetro tubular, à altura do epitélio seminífero e ao comprimento dos túbulos seminíferos. Abordam-se ainda as diferenças entres as razões celulares que permitem conclusões sobre o rendimento do processo espermatogênico e índices de células de Sértoli das três espécies.

  8. Ectoparasites of Nasua nasua (Carnivora, Procyonidae from an urban forest in Southeastern Brazil Ectoparasitos de quatis Nasua nasua (Carnivora, Procyonidae em uma floresta urbana no sudeste brasileiro

    Directory of Open Access Journals (Sweden)

    A.F.S.F. Rodrigues

    2006-10-01

    Full Text Available Em um fragmento de mata na área urbana de Juiz de Fora (MG foram capturados 15 quatis com armadilha e ceva, para estudo dos seus ectoparasitos. Outros quatro animais, atropelados no entorno, foram também examinados imediatamente após o atropelamento, e incluídos na análise. Os ectoparasitos foram removidos com a utilização de pinça e pente-fino e acondicionados em etanol 70°GL. Pulgas e piolhos foram clarificados e montados para análise em microscopia. Os ixodídeos foram identificados sob estereoscopia. Não foram encontrados carrapatos adultos. Larvas e ninfas de carrapatos foram encontradas, respectivamente, em 36,8% e 63,1% dos hospedeiros examinados. Ninfas que sofreram muda foram identificadas como Amblyomma cajenennse. A espécie de piolho Neotrichodectes pallidus foi obtida em 52,6% dos quatis. As pulgas Ctenocephalides felis felis e Rhopalopsyllus lutzi lutzi apresentaram, respectivamente, as seguintes prevalências: 36,8% e 35,1%. O estudo mostra que no fragmento de mata na área urbana os quatis podem manter espécies de ectoparasitos comuns a estes hospedeiros, bem como intercambia-las entre o ambiente silvestre e urbano.

  9. Contribution to the knowledge of helminthofauna of wild mammals of Somalia.

    Science.gov (United States)

    Iori, A; Lanfranchi, P

    1996-12-01

    Within a survey of parasitic infections in wild mammals of Somalia, during the first semester of 1983 and the second of 1984, endoparasites were collected from 11 host species: Gazella soemmeringi, Gazella spekei, Madoqua saltiana, Phacochoerus aethiopicus, Xerus rutilus, Lepus sp., Genetta genetta, Herpestes (Galerella) sanguineus, Felis sylvestris libyca, Felis caracal, Canis mesomelas. A total of 22 species of helminths (20 nematode and 2 metacestode species) were identified. Lepus sp. is a new host for Heteroxinema (P.) proboscidiphora and Herpestes sanguineus for Oxinema sp. Teladorsagia hamata had not been previously reported in G. spekei; the genital cone and the corresponding supporting apparatus of this nematode are described. Two metacestodes were collected from the mesenteric membranes of a P. aethiopicus. The shape, number and length of their rostellar hooks, the size of the larvocysts, the occurrence of pseudostrobilum, are similar to those of the Taenia regis metacestode: but the size and shape of the hooks of the Somalian warthog larvocysts are slightly different and they have not been recovered from the musculature as previously reported in the intermediate hosts of T. regis. PMID:9257339

  10. Seroprevalence of antibodies to Rickettsia typhi in the Waikato region of New Zealand.

    Science.gov (United States)

    Lim, M Y; Weinstein, P; Bell, A; Hambling, T; Tompkins, D M; Slaney, D

    2016-08-01

    The first reported New Zealand-acquired case of murine typhus occurred near Auckland in 1989. Since then, 72 locally acquired cases have been recorded from northern New Zealand. By 2008, on the basis of the timing and distribution of cases, it appeared that murine typhus was escalating and spreading southwards. To explore the presence of Rickettsia typhi in the Waikato region, we conducted a seroprevalence study, using indirect immunofluorescence, Western blot, and cross-adsorption assays of blood donor samples. Of 950 human sera from Waikato, 12 (1·3%) had R. typhi antibodies. The seroprevalence for R. typhi was slightly higher in northern Waikato (1·4%) compared to the south (1·2%; no significant difference, χ 2 P = 0·768 at P < 0·05). Our results extend the reported southern range of R. typhi by 140 km and indicate it is endemic in Waikato. Evidence of past Rickettsia felis infections was also detected in six sera. Globally, R. felis is an emerging disease of concern and this pathogen should also be considered when locally acquired rickettsiosis is suspected. If public health interventions are to be implemented to reduce the risk of rickettsioses as a significant public health problem, improvements in rickettsial diagnostics and surveillance will be necessary. PMID:27040715

  11. Epidemiologic evaluation of multiple respiratory pathogens in cats in animal shelters.

    Science.gov (United States)

    Bannasch, Michael J; Foley, Janet E

    2005-04-01

    Upper respiratory tract infection (URI) propagates readily within cats in shelters and often results in euthanasia of affected cats. In a case-control evaluation of 573 cats in eight shelters in California in 2001 and 2002, the prevalence of feline calicivirus (FCV) was from 13 to 36%, feline herpesvirus (FHV) was from 3 to 38%, and prevalence of Bordetella bronchiseptica, Chlamydophila felis, and Mycoplasma species was from 2 to 14%. Cats with URI tended to be housed in isolation, dehydrated, and younger than cats without URI, and infected with FHV, Mycoplasma species, FCV, or C felis. Shelters differed in the prevalence of pathogens and many cats appeared positive for infection after about 1 week of sheltering. It is helpful for shelters to understand the risk factors associated with URI in order to evaluate the costs and benefits of treatment and improve their procedures to decrease the incidence of URI within their facilities. Antiherpetics and antimycoplasmal drugs may be beneficial for individual animal care. Results document the utility of comprehensive URI surveillance and herd management for specific pathogens typical in that shelter. PMID:15771947

  12. Phylogeography of the Neotropical catfish Pimelodus albicans (Siluriformes: Pimelodidae from río de la Plata basin, South America, and conservation remarks

    Directory of Open Access Journals (Sweden)

    Julia Vergara

    2008-03-01

    Full Text Available Pimelodus albicans Valenciennes, 1840 (common name "moncholo" or "bagre blanco" is an endemic species of the family Pimelodidae in the río de la Plata basin. Phylogenetic approach based on cytochrome b sequences was performed to test the existence of a unique evolutionary lineage in P. albicans and to discriminate populations units or subpopulations related to a migration behavior of this taxon in the río de la Plata basin. This study included 34 samples of P. albicans of different collecting sites in the río de la Plata estuary and in the río Arrecifes belonging to the río Paraná basin. Among 614 base pairs in the cytochrome b sequence data set, 203 were variable and 120 were phylogenetically informative sites in P. albicans. A total of twenty haplotypes, nucleotide diversity (p = 0.032 and haplotype diversity = 0.941 were found. Tajima's test showed significant value D= -1.88 (pPimelodus albicans Valenciennes, 1840 (popularmente conhecida como moncholo ou bagre branco é uma espécie endêmica da família Pimelodidae na bacia do rio da Prata. Estudos filogeográficos baseados nas seqüências do citocromo b mitocondrial foram realizados para testar a existência de uma única linhagem evolutiva in P. albicans e para discriminar unidades populacionais relacionadas ao comportamento migratório desse táxon na bacia do rio da Prata. Um total de 34 amostras de P. albicans provenientes de diferentes lugares de coleta no estuário do rio da Prata e rio Arrecifes na bacia do rio Paraná foram analisados. Entre as 614 pares de bases do citocromo b no conjunto de dados, 203 deles variaram e 120 foram sítios filogeneticamente informativos para P. albicans. No presente estudo foi encontrado um total de vinte haplótipos, diversidade de nucleotídeos (p = 0,032 e diversidade de haplótipos = 0,941. O teste de Tajima mostrou valores significativos D= -1,88 (p<0,05 rejeitando a hipótese de mutação neutra para os dados de P. albicans. Todas as an

  13. Línea de base para evaluar el impacto de una planta de celulosa en el Río Uruguay

    Directory of Open Access Journals (Sweden)

    Carlos Saizar

    2011-05-01

    Full Text Available Como parte del proceso de evaluación del impacto ambiental ante la puesta en funcionamiento de la planta de pulpa de celulosa Kraft Botnia (actual UPM, se realizaron estudios de línea de base entre los años 2005 y 2007. El diseño de muestreo incluyó tres transectas perpendiculares a la línea de costa, en tres sitios: Nuevo Berlín, Fray Bentos y Las Cañas. Se realizaron estudios de parámetros físico-químicos del agua (nutrientes, sustancias orgánicas, metales, compuestos orgánicos adsorbibles (AOX, dioxinas y furanos, materia orgánica y granulometría del sedimento, estudios biológicos de las comunidades planctónicas, zoobentónicas e ícticas y bioacumulación de dioxinas en peces. El fósforo en la columna de agua presentó en promedio valores por encima de lo recomendado por la normativa nacional, mientras los contaminantes orgánicos (AOX, clorofenoles, ácidos resínicos, fitosteroles, dioxinas y furanos se mantuvieron por debajo de los valores guía recomendados a nivel internacional. Las comunidades planctónicas variaron significativamente entre muestreos, la de peces entre sitios y muestreos, mientras que la de bentos no presentó variaciones significativas espaciales ni temporales. El bagre trompudo (Iheringichthys labrosus es propuesto como especie a sermonitoreada debido a su ubicuidad y abundancia. Este trabajo ofrece una visión general de los estudios de línea de base, destacando la multiplicidad y la periodicidad de los parámetros en dos años de estudio.

  14. Harttia merevari, a new species of catfish (Siluriformes: Loricariidae from Venezuela

    Directory of Open Access Journals (Sweden)

    Francisco Provenzano R.

    2005-12-01

    Full Text Available Harttia merevari, a new species of loricariid catfish, is described from eight specimens captured in the upper Caura River, Orinoco River basin, Venezuela. The new species is recognized by the following combination of characters: abdomen naked; two or three preanal plates; a bony plate before each branchial opening; seven lateral plates between the pectoral and pelvic fins; maxillary barbel short and attached to the oral disk by a fleshy fold; head dorsal surface and anterior portion of the body light or dark yellow with numerous, round black spots; posterior region of the body light or dark yellow with five black transverse bands, dorsal central area of the two anterior bands diffused. The discovery of this new species extends the distribution of the genus northwest to include the Orinoco River basin on the northern slope of the Guyana shield.Harttia merevari, uma espécie nova de bagre loricarideo é descrita com base em oito exemplares capturados no alto rio Caura, bacia do rio Orinoco, Venezuela. A espécie nova se distingue pela seguinte combinação de caracteres: abdome nu; duas ou três placas preanais; presença de uma placa óssea anterior a cada abertura branquial; sete placas laterais entre as nadadeiras peitorais e pélvicas; barbilhão maxilar curto e unido ao disco oral por uma dobra carnosa; superfície dorsal da cabeça e região anterior do corpo amarelo escuro ou marrom claro com numerosos pontos negros arredondados, região dorsal e posterior do corpo amarelo escuro ou marrom claro com cinco bandas transversais negras, as duas bandas anteriores com a parte dorsocentral difusa. A descoberta desta espécie nova estende a distribuição do gênero ao noroeste incluindo a bacia do rio Orinoco na vertente norte do Escudo das Guianas.

  15. A preliminary inventory of the catfishes of the lower Rio Nhamundá, Brazil (Ostariophysi, Siluriformes

    Directory of Open Access Journals (Sweden)

    Rupert Collins

    2015-04-01

    O Rio Nhamundá é um rio de água clara, pouco conhecido, que drena parte do Escudo das Guianas em território brasileiro. Nesse estudo, nós reportamos os resultados de um levantamento ictiofaunístico preliminar dessa área, tendo como foco os bagres (Siluriformes. Nós identificamos um total de 36 espécies (31 gêneros, sete famílias provenientes de nossa coleta, e adicionamos 11 espécies já conhecidas para o rio. De maneira geral, os resultados de nossa pesquisa mostram que mesmo levantamentos rápidos podem gerar informações importantes sobre a biodiversidade de peixes amazônicos, sugerindo potenciais espécies novas, ampliando a área de distribuição de espécies, além de apontar a necessidade de revisões taxonômicas e estudos genéticos para alguns taxa. Para além das formas tradicionais de dados coletados em pesquisas de biodiversidade (i.e. espécimes preservados, nosso estudo fornece "novas" formas de dados, como DNA barcodes e imagens com o padrão de coloração dos espécimes vivos, informações essas que serão de valor inestimável para futuros estudos que abordem grupos taxonômicos difíceis.

  16. Endemic pemphigus foliaceus over a century: Part I

    Directory of Open Access Journals (Sweden)

    Ana María Abréu-Vélez

    2010-02-01

    Full Text Available Background: Endemic pemphigus foliaceus (EPF is the only known autoimmune disease presenting in circumscribed geographic areas. Aim: We aim to provide information concerning the natural course of EPF, including systemic compromise in the presteroid era, which has been largely unavailable in the current medical literature. Material & Methods: By a retrospective review of the literature we aim to compile and compare the focus of EPF and the current knowledge about them. The main aim of this review is to summarize our current knowledge of EPF, including data described almost one century ago; and, to include several unindexed reports, which may have not been available to many current scientists and health care personnel. Results: Foci of EPF have been described in several Central American and South American countries, affecting predominately young people and Amerindians, with an additional female predilection. Although most cases have occurred in Brazil, some cases have been reported in Peru, Paraguay, El Salvador, and Venezuela. Another variant of EPF has been described in El Bagre, Colombia, affecting older men and a few post-menopausal females. Finally, another type of EPF was described in nomadic tribes affecting females of child bearing age in Tunisia, Africa. Conclusion: Our understanding of EPF has been hampered by a lack of government attention to these diseases, especially in some South and Central American countries. Other factors that have made past studies of EPF difficult include 1 that the disease foci are often located in rural areas bordering the rain forest of underdeveloped countries; and 2 military conflicts in some of these areas.

  17. Endemic pemphigus foliaceus over a century: Part I

    Directory of Open Access Journals (Sweden)

    Ana María Abréu-Vélez

    2010-01-01

    Full Text Available Background : Endemic pemphigus foliaceus (EPF is the only known autoimmune disease presenting in circumscribed geographic areas. Aim : We aim to provide information concerning the natural course of EPF, including systemic compromise in the presteroid era, which has been largely unavailable in the current medical literature. Material & Methods : By a retrospective review of the literature we aim to compile and compare the focus of EPF and the current knowledge about them. The main aim of this review is to summarize our current knowledge of EPF, including data described almost one century ago; and, to include several unindexed reports, which may have not been available to many current scientists and health care personnel. Results : Foci of EPF have been described in several Central American and South American countries, affecting predominately young people and Amerindians, with an additional female predilection. Although most cases have occurred in Brazil, some cases have been reported in Peru, Paraguay, El Salvador, and Venezuela. Another variant of EPF has been described in El Bagre, Colombia, affecting older men and a few post-menopausal females. Finally, another type of EPF was described in nomadic tribes affecting females of child bearing age in Tunisia, Africa. Conclusion : Our understanding of EPF has been hampered by a lack of government attention to these diseases, especially in some South and Central American countries. Other factors that have made past studies of EPF difficult include 1 that the disease foci are often located in rural areas bordering the rain forest of underdeveloped countries; and 2 military conflicts in some of these areas.

  18. Estudos de cestóides de peixes do Brasil

    Directory of Open Access Journals (Sweden)

    A. Arandas Rego

    1974-01-01

    Full Text Available Os autores iniciam com este trabalho um estudo sistemático de determinação dos cestóides de peixes depositados na Coleção helmintológica do Instituto Oswaldo Cruz. São referidas ou descritas as seguintes espécies e seus hospedeiros: Schizochoerus liguloideus (Diesing, 1850 e Nesolecithus janicki Posche, 1922, ambas de Arapaima gigas (Cuvier, (piracuru; Gyrocotyle meandrica Herrera, 1946, de Callorhynchus callorhynchus (L., (quimera; Acanthobothrium dasybati Yamaguti, 1934 e Pterobothriidae não identificado, de uma arraia não determinada; três tipos larvares de trypanorrhyncha e um de Proteocephalidea, de Cynoscion striatus (Cuv. e C. leiarchus (pescadinha; Proteocephalus jandia Woodland, 1934, de um bagre não determinado. Monticellia siluri (Fuhrmann, 1916 e Amphoteromorphus praeputialis sp. n. de Cetopsis caecutiens e Nomimoscolex magna sp. n. de Pimelodus clarias (mandi.The authors start, with this note, a systematic study for determination of cestodes of fishes of the Helminthological Collection of the Instituto Oswaldo Cruz. The following species and hosts are refered and described: Schizochoerus liguloideus (Diesing, 1850 and Nesolecithus janicki poche, 1922 both of Arapaima gigas (Cuvier; Gyrocotyle meandrica Herrera, 1946 of Callorhynchus callorhynchus (L.,Acanthobothrium dasybati Yamaguti, 1934 and Pterobothriidae unidentified, of an indeterminate ray; three types of larvae of Trypanorrhyncha and type of Proteocephalidea, of Cynoscion striatus (Cuv. and C. leiarchus; Proteocephalus jandia Woodland, 1934 of an indeterminate catfish; Monticellia siluri (Furhrmann, 1916 and Amphoteromorphus praeputialis sp. n. of Cetopsis caecutiens and Nomimoscolex magna sp. n. of Pimelodus clarias.

  19. Evolution of opercle bone shape along a macrohabitat gradient: species identification using mtDNA and geometric morphometric analyses in neotropical sea catfishes (Ariidae).

    Science.gov (United States)

    Stange, Madlen; Aguirre-Fernández, Gabriel; Cooke, Richard G; Barros, Tito; Salzburger, Walter; Sánchez-Villagra, Marcelo R

    2016-08-01

    Transitions between the marine and freshwater macrohabitat have occurred repeatedly in the evolution of teleost fishes. For example, ariid catfishes have moved from freshwater to marine environments, and vice versa. Opercles, a skeletal feature that has been shown to change during such transitions, were subjected to 2D geometric morphometric analyses in order to investigate evolutionary shape changes during habitat transition in ariid catfishes and to test the influence of habitat on shape changes. A mtDNA marker, which proved useful in previous studies, was used to verify species identities. It greatly improved the assignment of specimens to a species, which are difficult to assign by morphology alone. The application of a mtDNA marker confirmed the occurrence of Notarius biffi in Central America, South of El Salvador. Molecular identification together with principal component analysis (PCA) and further morphological inspection of neurocrania indicated the existence of a cryptic species within Bagre pinnimaculatus. Principal component (PC) scores of individual specimens clustered in morphospace by genus rather than by habitat. Strong phylogenetic structure was detected using a permutation test of PC scores of species means on a phylogenetic tree. Calculation of Pagel's λ suggested that opercle shape evolved according to a Brownian model of evolution. Yet canonical variate analysis (CVA) conducted on the habitat groups showed significant differences in opercle shapes among freshwater and marine species. Overall, opercle shape in tropical American Ariidae appears to be phylogenetically constrained. This verifies the application of opercle shape as a taxonomic tool for species identification in fossil ariid catfishes. At the same time, adaptation to freshwater habitats shows characteristic opercle shape trajectories in ariid catfishes, which might be used to detect habitat preferences in fossils. PMID:27547357

  20. Ciclo reprodutivo de Parauchenipterus striatulus (Pisces - Auchenipteridae na represa de Ribeirão das Lajes - RJ

    Directory of Open Access Journals (Sweden)

    Araújo F.G.

    2000-01-01

    Full Text Available Este trabalho teve como objetivo avaliar o ciclo reprodutivo do bagre de água doce Parauchenipterus striatulus, na represa de Ribeirão das Lajes, Rio de Janeiro. Foram descritos aspectos morfológicos dos estádios de maturação gonadal bem como variações no índice gonadossomático, relação peso:comprimento, fator de condição e condição gonadal. A amostragem dos peixes foi feita bimestralmente entre abril de 1996 e maio de 1997 com o uso de redes de espera de 100m de comprimento, 4m de altura e com malha entre 25 e 65mm de distância entrenós. Os 339 indivíduos capturados ao longo do período de amostragem corresponderam a 40% do total de peixes. Cinco estádios de maturação gonadal foram determinados por meio de análise macroscópica para ambos os sexos: imaturo, maturação I, maturação II, maduro, desovado (fêmeas e esvaziado (machos. O índice gonadossomático foi mais elevado entre outubro e março para ambos os sexos, sugerindo amplo período de desova enquanto o fator de condição atingiu seu máximo entre fevereiro e junho, mostrando uma relação inversa entre essas duas características. A relação peso-comprimento para machos foi de W= 0,0095L3,0862 e fêmeas de W= 0,0116L3,0126, não tendo sido encontradas diferenças significativas entre os coeficientes de alometria para ambos os sexos.

  1. Malaria vivax en niños: aspectos clínicos y respuesta a la cloroquina.

    Directory of Open Access Journals (Sweden)

    Jaime Carmona Fonseca

    2009-12-01

    Full Text Available Introducción: En Colombia, no hay información actualizada sobre malaria vivax en niños. Objetivo: Describir el cuadro clínico-paraclínico de la enfermedad y evaluar la eficacia de la cloroquina (dosis estándar para curar el ataque agudo de paludismo vivax en niños (4-10 años. Metodología: Diseño experimental, balanceado, no ciego; 82 pacientes, residentes en Turbo o El Bagre. Seguimiento, 30 días. Resultados: Los síntomas y signos concordaron con la literatura. Hubo desnutrición de largo plazo en 62%, anemia en 53%, retinol bajo (19 μg/dl, recuento leucocitario normal, pruebas hepáticas y creatinina normales. A los 25-28 días postratamiento todas las alteraciones, excepto la desnutrición, habían desaparecido. Falla de la cloroquina: dos posibles fallas tardías. Proporción de falla según tres técnicas de análisis según la intención de tratar: 2.4% (0 a 24%, según el protocolo 2.6% (0 a 25%, según el peor escenario 7.3% (0 a 29%. Conclusión: El cuadro clínico-paraclínico fue similar al de los adultos. El paludismo, más que la desnutrición, fue responsable de las alteraciones clínicas-paraclínicas. La cloroquina sola, sin primaquina, resultó altamente eficaz para el ataque agudo de malaria vivax en niños y debe conservarse como primera opción terapéutica.

  2. Therapeutic efficacy test in malaria falciparum in Antioquia, Colombia

    Directory of Open Access Journals (Sweden)

    Álvarez Tania

    2006-02-01

    Full Text Available Abstract Objective Evaluate the frequency of failure of eight treatments for non-complicated malaria caused by Plasmodium falciparum in patients from Turbo (Urabá region, El Bagre and Zaragoza (Bajo Cauca region, applying the 1998 protocol of the World Health Organization (WHO. Monotherapies using chloroquine (CQ, amodiaquine (AQ, mefloquine (MQ and sulphadoxine-pyrimethamine (SP, and combinations using chloroquine-sulphadoxine-pyrimethamine (CQ-SP, amodiaquine-sulphadoxine-pyrimethamine (AQ-SP, mefloquine-sulphadoxine-pyrimethamine (MQ-SP and artesunate-sulphadoxine-pyrimethamine (AS-SP, were examined. Methodology A balanced experimental design with eight groups. Samples were selected based on statistical and epidemiological criteria. Patients were followed for 21 to 28 days, including seven or eight parasitological and clinical evaluations, with an active search for defaulting patients. A non-blinded evaluation of the antimalarial treatment response (early failure, late failure, adequate response was performed. Results Initially, the loss of patients to follow-up was higher than 40%, but the immediate active search for the cases and the monetary help for transportation expenses of patients, reduced the loss to 6%. The treatment failure was: CQ 82%, AQ 30%, MQ 4%, SP 24%, CQ-SP 17%, AQ-SP 2%, MQ-S-P 0%, AS-SP 3%. Conclusion The characteristics of an optimal epidemiological monitoring system of antimalarial treatment response in Colombia are discussed. It is proposed to focus this on early failure detection, by applying a screening test every two to three years, based on a seven to 14-day follow-up. Clinical and parasitological assessment would be carried out by a general physician and a field microscopist from the local hospital, with active measures to search for defaulter patients at follow-up.

  3. Prevalência da infecção pelo Toxoplasma gondii em animais domésticos, silvestres e grupamentos humanos da Amazônia

    Directory of Open Access Journals (Sweden)

    José João Ferraroni

    1980-01-01

    Full Text Available Através de Reação de Hemaglutinação Indireta para toxoplasmose foram examinadas amostras de sangue de dez diferentes espécies de animais domésticos e silvestres, de um grupamento humano da cidade de Manaus-Amazonas e de um grupamento humano indígena de área distante, no território de Roraima. Em 108 animais domésticos, o exame sorológico foi reagente em 90,6% dos gatos (Felis catus, 68,4% dos cães (Canis familiaris, 60,0% dos bovinos (Bos sp, 41,2% dos galináceos (Gallus sp e 40,0% dos palmípedes (Cairina sp. Nos 104 animais silvestres foram reagentes 75,0% dos felídeos (Felis sp, 63,6% dos marsupiais (Didelphis marsupialis e Marmosa sp, 63,3% dos primatas (Saimiri sp e 61,1% dos roedores (Proechimys. Entre os dois grupos humanos a prevalência foi de 70,6% nos 51 habitantes da área de Manaus, 64,8% nos 37 silvícolas de Roraima. Os autores discutem os resultados obtidos, assim como os diversos aspectos envolvidos na epidemiologia da toxoplasmose e chamam a atenção para a existência de mecanismos de transmissão ainda não esclarecidos, enfatizando a necessidade de maiores estudos dessa zoonose.Serological examination for Toxoplasma gondii in human blood samples and in blood samples from ten different species of animals obtained in Manaus, State of Amazonas-Brazil, are compared with results obtained from similar examinations of blood from humans living in other areas of the Amazon basin. The domestic cat (Felis catus showed the highest levels of antibody for Toxoplasma gondii, whereas the domestic chicken (Gallus domesticus and duck (Cairina sp the lowest. The other animals showed similar intermediate levels of antibody to this protozoa. The authors discuss the results and several aspects of the involvement in epidemiology of toxoplasmosis and call attention to some transmission mechanisms not yet elucidated.

  4. Rickettsioses in Latin America, Caribbean, Spain and Portugal

    Directory of Open Access Journals (Sweden)

    Marcelo B. Labruna

    2011-05-01

    Full Text Available Data on genus and infectious by Rickettsia were retrospectively compiled from the critical review literature regarding all countries in Latin America, Caribbean islands, Portugal and Spain. We considered all Rickettsia records reported for human and/or animal hosts, and/or invertebrate hosts considered being the vector. In a few cases, when no direct detection of a given Rickettsia group or species was available for a given country, the serologic method was considered. A total of 13 Rickettsia species have been recorded in Latin America and the Caribbean. The species with the largest number of country confirmed records were Rickettsia felis (9 countries, R. prowazekii (7 countries, R. typhi (6 countries, R. rickettsii (6 countries, R. amblyommii (5 countries, and R. parkeri (4 countries. The rickettsial records for the Caribbean islands (West Indies were grouped in only one geographical area. Both R. bellii, R. akari, and Candidatus ‘R. andeane’ have been recorded in only 2 countries each, whereas R. massiliae, R. rhipicephali, R.monteiroi, and R. africae have each been recorded in a single country (in this case, R. africae has been recorded in nine Caribbean Islands. For El Salvador, Honduras, and Nicaragua, no specific Rickettsia has been reported so far, but there have been serological evidence of human or/and animal infection. The following countries remain without any rickettsial records: Belize, Venezuela, Guyana, Surinam, and Paraguay. In addition, except for a few islands, many Caribbean islands remain without records. A total of 12 Rickettsia species have been reported in Spain and Portugal: R. conorii, R. helvetica, R. monacensis, R. felis, R. slovaca, R. raoultii, R. sibirica, R. aeschlimannii, R. rioja, R. massiliae, R. typhi, and R. prowazekii. Amongst these Rickettsia species reported in Spain and Portugal, only R. prowazekii, R. typhi, R. felis, and R. massiliae have also been reported in Latin America. This study summarizes

  5. Organochlorine pesticide residues in animals of Tasmania, Australia-1975-77.

    Science.gov (United States)

    Bloom, H; Taylor, W; Bloom, W R; Ayling, G M

    1979-12-01

    Animals taken in Tasmania including duck (Anas superciliosa), eel (Anguilla australis), English perch (Perca fluviatilis), white-faced heron (Ardea pacifica), brown trout (Salmo trutta), European starling (Strunus vulgaris), cat (Felis cattus), cormorant (Phalacrocorax sp.), mutton bird (Puffinus tenuirostris), Tasmanian devil (Sarcophilus harrisii), rainbow trout (Salmo gairdnerii), Tasmanian raven (Corvus mellori), tench (Tinca tinca), and quail (Coturnix sp.) were sampled for p,p'-DDE, pp,p'-TDE, p,p'-DDT, lindane, dieldrin, and hexachlorobenzene. Pesticide residue levels exceeded 0.1 ppm in at least one animal from each area and in the majority of animals sampled from all areas. Pesticide sources could not be determined, partly because migratory species such as ducks, mutton birds, cormorants, and eels may have ingested pesticides outside of Tasmania. PMID:537866

  6. Dicty_cDB: Contig-U09523-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available N10240.b1_O16.ab1:P Triphysaria pusilla root t... 52 0.039 1 ( AC098007 ) Rattus norvegicus clone CH230-105P...8 0.61 1 ( ED032154 ) SBA031_I01.f Sugar beet BAC library USH20 (Code S... 36 1.1 3 ( AU060144 ) Dictyosteli...0.26 CR548612_341( CR548612 |pid:none) Paramecium tetraurelia macronucl... 39 0.26 AY394509_1( AY394509 |pid:none) Str...9 0.33 CR382399_52( CR382399 |pid:none) Plasmodium falciparum chromosome ... 39 0.33 AB220160_1( AB220160 |pid:none) Tetr...( CR382401 |pid:none) Plasmodium falciparum chromosome ... 38 0.44 EF028068_1( EF028068 |pid:none) Felis catus centrosomal prot

  7. Dicty_cDB: Contig-U11992-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-37 AP009484_1599( AP009484 |pid:none) Macrococcus caseolyticus JCSC54... 159 2e-37 CP000083_269( CP000083 |pid:none) Colwelli...klnnlkqillr*ih*kmetlkntmkrmikyqgyh*hnyr*iks mv*kvqslrsyl*kghpilwqrk**nhyfpitgkrillnfesfyvyllfsfqn**i*vyl *ylki*li...:none) Ralstonia metallidurans CH34, co... 196 2e-48 CP000053_1057( CP000053 |pid:none) Rickettsia feli...652, comple... 214 4e-54 CP000524_458( CP000524 |pid:none) Bartonella bacilliform... c... 196 1e-48 CP000087_1092( CP000087 |pid:none) Rickettsia bellii RML369-C, com... 196 1e-48 CP000352_391( CP000352 |pid

  8. Contribuição para o estudo da prevalência da infecção por Leishmania infantum em gatos domésticos e errantes nos distritos de Lisboa e Viseu

    OpenAIRE

    Garrido, Joana Margarida da Cruz Baptista Galvão

    2012-01-01

    A Leishmaniose visceral zoonótica causada por Leishmania infantum é considerada uma doença endémica no nosso País. Sabe-se que o cão é o principal hospedeiro reservatório, no entanto, o papel do gato (Felis catus) na epidemiologia da doença têm vindo adquirir um interesse crescente. A presente dissertação baseia-se em um rastreio epidemiológico da infecção por Leishmania infantum em gatos dos distritos de Lisboa e Viseu. A amostra total foi de 80 gatos correspondendo 40 animais a cada área ge...

  9. ВИДОВОЙ СОСТАВ И ОСОБЕННОСТИ РАСПРОСТРАНЕНИЯ КИШЕЧНЫХ ПРОСТЕЙШИХ У МЕЛКИХ ДОМАШНИХ ЖИВОТНЫХ ГОРОДА МОСКВЫ

    OpenAIRE

    Курносова, О.

    2013-01-01

    Изучен видовой состав кишечных простейших у собак, кошек, грызунов и приматов г. Москвы. У них выявлены Cystoisospora ohioensis, C. canis, C. felis, C. rivolta, Eimeria sp., Sarcocystis sp., Giardia sp., ооцисты подсемейства Toxoplasmatinae, простейшие семейства Trichomonalidae, Blastocystis sp., Balantidium coli.

  10. Dicty_cDB: Contig-U12409-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n-3; AltName: Full=Myosin heavy chai... 307 1e-81 AB303687_1( AB303687 |pid:none) Hypop...85_1( AB303685 |pid:none) Hypophthalmichthys molitrix MYH sc... 299 3e-79 BX510649_10( BX510649 |pid:none) Z...-81 BC073455_1( BC073455 |pid:none) Xenopus laevis hypothetical protei... 305 5e-81 U75357_1( U75357 |pid:none) Schizosaccharomyces...( AF042349 |pid:none) Loligo pealei myosin heavy chain i... 320 1e-85 T16416( T16416 )hypothetical protein F... U51472 |pid:none) Felis catus superfast myosin heavy cha... 308 6e-82 AB058959_1( AB058959 |pid:none) Patinopecten yessoensi

  11. Tick and flea infestation in a captive Margay Leopardus wiedii (Schinz, 1821 (Carnivora: Felidae: Felinae in Peru

    Directory of Open Access Journals (Sweden)

    M. Quevedo

    2014-02-01

    Full Text Available Interaction between wild and domestic animals can increase the risk for transmission of parasites in both directions, and thus, affects the ecology of diseases. Wild felids have been proven to be sensitive to infectious agents commonly found in domestic animals, and those agents have had detrimental effects on wildlife conservation. A margay Leopardus wiedii which had been kept captive as a pet for about fifteen days, was found moderately infested with the brown dog tick Rhipicephalus sanguineus and the cat flea Ctenocephalides felis. Considering that the captive Margay lived close to domestic dogs and cats, this interaction might be the source of that infestation. Based on this finding, careful attention should be paid to wildlife and domestic animals interactions as ectoparasites can be easily transmitted and new host-pathogen interactions are possible.

  12. AcEST: DK954853 [AcEST

    Lifescience Database Archive (English)

    Full Text Available terized protein OS=Zea m... 105 1e-21 tr|B2CM19|B2CM19_SOLCH Copper chaperone OS=Solanum chacoen...64 Query: 181 SFWPSEGSTA 210 SFW +E T+ Sbjct: 65 SFWEAEAVTS 74 >tr|A9PIL5|A9PIL5_POPJC Putative uncharacteri...9WUC4|ATOX1_RAT Copper transport protein ATOX1 OS=Rattus nor... 53 7e-07 sp|P38636|ATX1_YEAST Metal homeostasis factor ATX1 OS=Sac...ter feli... 38 0.018 sp|O32221|COPZ_BACSU Copper chaperone copZ OS=Bacillus subtilis ... 38 0.023 sp...tor ATX1 OS=Saccharomyces cerevisiae GN=ATX1 PE=1 SV=1 Length = 73 Score = 45.1 bits (105), Exp

  13. Evidence of feline immunodeficiency virus, feline leukemia virus, and Toxoplasma gondii in feral cats on Mauna Kea, Hawaii

    Science.gov (United States)

    Danner, R.M.; Goltz, Dan M.; Hess, S.C.; Banko, P.C.

    2007-01-01

    We determined prevalence to feline immunodeficiency virus (FIV) antibodies, feline leukemia virus (FeLV) antigen, and Toxoplasma gondii antibodies in feral cats (Felis catus) on Mauna Kea Hawaii from April 2002 to May 2004. Six of 68 (8.8%) and 11 of 68 (16.2%) cats were antibody positive to FIV and antigen positive for FeLV, respectively; 25 of 67 (37.3%) cats were seropositive to T. gondii. Antibodies to FeLV and T. gondii occurred in all age and sex classes, but FIV occurred only in adult males. Evidence of current or previous infections with two of these infectious agents was detected in eight of 64 cats (12.5%). Despite exposure to these infectious agents, feral cats remain abundant throughout the Hawaiian Islands. ?? Wildlife Disease Association 2007.

  14. Caracterização da população de ectoparasitos em cães de núcleos de expansão urbana de Juiz de Fora, Minas Gerais, Brasil Characterization of ectoparasites on dogs in the nucleus of urban expansion of Juiz de Fora, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Denise F. Rodrigues

    2008-12-01

    Full Text Available No presente trabalho caracterizou-se a população de ectoparasitos em cães de núcleo de expansão urbana de Juiz de Fora, MG. As coletas foram realizadas de julho a setembro de 2003, examinando-se 101 cães SRD (sem raça definida. Os ectoparasitos foram coletados através de inspeção visual e tátil dos animais e acondicionados em frascos com etanol 70°GL e identificados sob estereoscopia. Espécimes foram clarificados e montados para análise em microscopia fotônica. Dentre os sifonápteros, Ctenocephalides felis foi mais prevalente (64,35% com intensidade média de 6,12 ± 5,37 sifonápteros/cão, seguido por Rhopalopsyllus lutzi (3,96%, híbrida C. felis X C. canis (1,98%, Tunga penetrans (1,98%. Aúnica espécie de fitiráptero encontrada foi Trichodectes canis (7,92% com 1,3 ± 0,51 fitiráptero/cão. Dentre os ixodídeos, Rhipicephalus sanguineus foi a espécie mais prevalente (49,50% com intensidade média de 6,44 ± 10,2 ixodídeos/ cão, seguido por Amblyomma cajennense (3,96%, Boophilus microplus (2,97%, A. ovale (1% e A. aureolatum (1%. As ninfas de ixodídeos foram separadas em ninfas de Amblyomminae (58,41% com 10,11 ± 10,09 ninfas/cão e ninfas Rhipicephalinae (24,75% com 2,64 ± 3,25 ninfas/cão. Em 3,96 % dos cães foram encontradas larvas de ixodídeo.The present work studied the characterization of ectoparasites on dogs in the nucleus of expansão urbana of Juiz de Fora, Minas Gerais, Brazil. The collections were conducted from July to September 2003, examining 101 dogs of no defined breed. The ectoparasites were collected through visual and tactile inspection of the animals' bodies, and were then placed in bottles with 70° GL ethanol and identified under a stereomicroscope. Specimens were clarified and mounted on slides for analysis under a photonic microscope. Among the siphonaptera, Ctenocephalides felis was the most prevalent (64.35%, with mean intensity of 6.12 ± 5.37 siphonaptera/dog, followed by Rhopalopsyllus

  15. Toxoplasmose em animais silvestres e domésticos da região de Botucatu, estado de São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Ednir Salata

    1985-02-01

    Full Text Available Os Autores analisaram soros de 47 Cannis familiaris, de 9 Felis cattus, de 64 Didelphis marsupialis aurita, de 9 Dasypus novemcinctus, de 4 Cabassous tatouay e de 29 Rattus rattus, através da reação de imunofluorescência indireta, para pesquisar a presença de anticorpos anti Toxoplasma gondii. Estes foram encontrados apenas em C. familiaris (63,8% e em D. m. aurita (4,7%. Frente aos resultados obtidos, os Autores sugerem que novas pesquisas nesta área sejam realizadas, para que se conheça melhor a importância epidemiológica de várias espécies animais na disseminação da toxoplasmose.

  16. Frequency of parasites and Salmonella infection in captive maned-wolf, Chrysocyon brachyurus, kept in Zoos at the State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Gilioli R.

    2000-01-01

    Full Text Available Thirty-one captive maned wolves (Chrysocyon brachyurus, Illiger 1815 from 11 Zoos at the State of São Paulo, Brazil, were screened to investigate the presence of parasites and Salmonella infection by parasitological diagnostic methods and fecal selective culture. The most frequent ecto and endoparasites found were Ctenocephalides felis (56.2%, Rhipicephalus sanguineus (12.5%, Ancylostoma caninum (45.1%, Strongyloides sp. (29.0%, Uncinaria stenocephala (3.2%, Capillaria sp. (3.2%, Entamoeba sp. (22.9%, Sarcocystis sp. (29.0%, Cryptosporidium sp. (19.3%, Eimeria sp. (19.3%, Giardia sp. (9.6% and Isospora sp. (3.2%. Four different serotypes of Salmonella were identified in six animals (25%. Only one infected animal showed clinical signs of diarrhea. The ability to harbor Salmonella spp. as normal nonpathogenic bacteria of the gastrointestinal tract may be a physiological adaptation of this specie.

  17. Atypical Toxoplasma gondii genotype in feral cats from the Fernando de Noronha Island, northeastern Brazil.

    Science.gov (United States)

    Melo, R P B; Almeida, J C; Lima, D C V; Pedrosa, C M; Magalhães, F J R; Alcântara, A M; Barros, L D; Vieira, R F C; Garcia, J L; Mota, R A

    2016-07-15

    Toxoplasma gondii isolates from Brazil have a different phenotypic and genotypic pattern, with predominance of virulent isolates and recombinant genotypes, compared to the North Hemisphere. Considering that a new T. gondii genotype, non-pathogenic to mice, was previously identified from free-range chickens from the Fernando de Noronha Island, Brazil, this study aimed to identify genotypes of this parasite in tissue samples of feral cats (Felis catus) from this Brazilian Island. Anti-T. gondii IgG antibodies were detected in 18/31 (58%) feral cats. Two non-virulent T. gondii isolates were obtained by mouse bioassay. Genotyping was performed by PCR-RFLP using 10 genetic markers (SAG1, SAG2, SAG3, BTUB, GRA6, c22-8, c29-2, PK1, L358 and Apico) and an atypical strain of T. gondii (ToxoDB #146) was identified. This is the first report of this genotype in feral cats. PMID:27270396

  18. Prevalence of antibodies to Sarcocystis neurona in cats from Virginia and Pennsylvania.

    Science.gov (United States)

    Hsu, Vasha; Grant, David C; Dubey, J P; Zajac, Anne M; Lindsay, David S

    2010-08-01

    Sarcocystis neurona is best known as the causative agent of equine protozoal myeloencephalitis of horses in the Americas. Domestic cats ( Felis domesticus ) were the first animals described as an intermediate host for S. neurona . However, S. neurona -associated encephalitis has also been reported in naturally infected cats in the United States. Thus, cats can be implicated in the life cycle of S. neurona as natural intermediate hosts. The present study examined the seroprevalence of IgG antibodies to merozoites of S. neurona in populations of domestic cats from Virginia and Pennsylvania. Overall, sera or plasma from 441 cats (Virginia = 232, Pennsylvania = 209) were tested by an indirect immunofluorescent assay at a 1ratio50 dilution. Antibodies to S. neurona were found in 32 (7%) of 441 cats. Of these, 22 (9%) of the 232 cats from Virginia and 10 (5%) of the 209 cats from Pennsylvania were seropositive for S. neurona . PMID:20476809

  19. Activity report for feasibility study on PKI authentication method with IC card in authentication system sub group of J-PARC information system group

    International Nuclear Information System (INIS)

    The Authentication System Sub Group of J-PARC Information System Group completed the mapping of the several authentication methods in terms of the level of security. Of the methods, the PKI authentication method with IC card provides the Super High Security Level and will be adopted as the authentication method of several J-PARC Information Systems. We study the feasibility of this method with following four examples; (1) 'The EAP-TLS wireless LAN authentication method'. (2) 'The Web-SSL client authentication method in SSL-VPN connection'. (3) 'The PKI authentication method with a certificate issued by NAREGI-CA software stored in IC card.' (4) 'The PKI authentication method with Dual interface FeliCa card'. In each example, we confirmed the feasibility of the method in a practical way. In this report we present the details of the study. (author)

  20. Trichinella infection in wildlife of the southwestern United States.

    Science.gov (United States)

    Pozio, E; Pence, D B; La Rosa, G; Casulli, A; Henke, S E

    2001-10-01

    Several potential mammalian reservoirs of sylvatic species of Trichinella were examined from Texas, New Mexico, and Arizona. During 1998-99, tongues were collected from a black bear (Ursus americanus) in Arizona; from 9 black bears, a coyote (Canis latrans), and a mountain lion (Felis concolor) in New Mexico; and from 154 coyotes, 32 raccoons (Procyon lotor), 13 opossums (Didelphis marsupialis), 4 ocelots (Leopardus pardalis), 3 bobcats (Lynx rufus), and 5 feral hogs (Sus scrofa) in southern Texas. Larvae of Trichinella murrelli were identified by a multiple-polymerase chain reaction analysis in 1 black bear (11.1%) from New Mexico and in 7 coyotes (4.5%) of Texas, whereas Trichinella spiralis larvae were detected in the black bear of Arizona. This is the first report of Trichinella infection in wildlife of New Mexico and Texas and extends the distribution of T. murrelli into the southwestern United States near the border of Mexico. PMID:11695403

  1. Aspectos Básicos del Manejo Médico de los Pequeños Felinos del Neotrópico

    OpenAIRE

    Nestor Varela

    2009-01-01

    Los félidos son un grupo diverso de carnívoros altamente especializados, su sistemática es aun debatida y controversial, por ejemplo los pequeños félidos antiguamente estaban agrupados bajo el género Felis, sin embargo, actualmente se han descrito cinco géneros y ocho especies presentes en América: Leopardus spp (3 especies), que compendia al ocelote (L. pardalis – peso promedio en kilogramos [pmKg] de 10,1); el margay (L. wiedii – pmKg 3,4); y la oncilla o tigrillo (L. tigrinus – pmKg 2,4); ...

  2. Dicty_cDB: Contig-U13888-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-130 BC013458_1( BC013458 |pid:none) Mus musculus phenylalanine hydroxy... 306 e-128 ( P17276 ) RecName: F...s... 298 e-118 Y16353_1( Y16353 |pid:none) Godia cydonium mRNA for phenylalanine ... 278 e-117 (Q8CGV2) RecNam...odnii SP-6, comp... 116 5e-25 (Q98D72) RecName: Full=Phenylalanine-4-hydroxylase; Sho... 117 5e-25 M28000_1( M28000 |pid..... 114 1e-23 (Q9A7V7) RecName: Full=Phenylalanine-4-hydroxylase; Sho... 112 2e-23 CP000629_949( CP000629 |pid... felis Fe/C-56 DNA,... 77 2e-12 (Q9Z6L3) RecName: Full=Probable aromatic amino acid hydroxylase;... 76 3e

  3. Rickettsiae in arthropods collected from the North African Hedgehog (Atelerix algirus) and the desert hedgehog (Paraechinus aethiopicus) in Algeria.

    Science.gov (United States)

    Khaldi, Mourad; Socolovschi, Cristina; Benyettou, Meryam; Barech, Ghania; Biche, Mohamed; Kernif, Tahar; Raoult, Didier; Parola, Philippe

    2012-03-01

    Hedgehogs have become a popular pet despite their potential role in zoonotic disease transmission. We conducted an entomological study in a mountainous region of northeast Algeria in which we collected 387 fleas (Archeopsylla erinacei) and 342 ticks (Rhipicephalus sanguineus and Haemaphysalis erinacei) from Paraechinus aethiopicus and Atelerix algirus hedgehogs. Of the hedgehogs sampled, 77.7% and 91% were infested with fleas and ticks, respectively. Significantly more ticks and fleas were collected from A. algirus than from P. aethiopicus. Rickettsia felis was detected in 95.5% of fleas and R. massiliae was detected in 6.25% of Rh. sanguineus ticks by molecular tools. A new Rickettsia species of the spotted fever group was detected in 11.25% of Rh. sanguineus and in 77% of H. erinacei ticks. Overall, we show that hedgehogs can act as hosts for ectoparasites infected with several rickettsial agents. These data justify a more detailed investigation of animal reservoirs for Rickettsiae. PMID:22222114

  4. Incidence of Old World screw-worm fly, Chrysomya bezziana in Iraq

    International Nuclear Information System (INIS)

    The Old World screw-worm fly (OWSWF), Chrysomya bezziana Villenuve, is a member of the insect family Calliphoridae and is an obligate parasite of warm-blooded animals in the tropics and sub-tropics (Norris and Murray 1964). Flies lay their eggs on the edge of wounds or body orifices; the resulting larvae invade the host tissues and produce lesions and infertility if the genitals become infested (Humphrey et al. 1980). Recorded hosts include cattle (Bos indicus), sheep (Ovis aries), goats (Caprus hircus), dogs (Canis familiaris), cats (Felis domesticus) and man (Homo sapiens) (Patton 1920, 1922, Stoddar and Peck 1962, Norris and Murray 1964). This investigation describes the incidence of myiasis caused by C. bezziana in Iraq from September 1996 to March 1998

  5. Dicty_cDB: Contig-U12096-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58 7e-10 A84780( A84780 ) probable ABC transporter [imported] - Arabidopsis... 53 7e-10 CU928174_233( CU928174 |pid:none) Zygosacch...cultivar... 64 2e-08 D85197_1( D85197 |pid:none) Schizosaccharomyces pombe stil+ gene, ... 64 2e-08 FM992695...P000053_1394( CP000053 |pid:none) Rickettsia felis URRWXCal2, com... 61 2e-07 CU928175_316( CU928175 |pid:none) Zygosacch...-06 CU928178_374( CU928178 |pid:none) Zygosaccharomyces rouxii strain ... 44 7e-06 AM461949_3( AM461949 |pid...sp. PCC 7424, comple... 55 9e-06 AM989986_14( AM989986 |pid:none) Zygosaccharomyc

  6. Dicty_cDB: Contig-U15541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gene. 214 3e-77 CR382130_499( CR382130 |pid:none) Yarrowia lipolytica strain CLI...32_607( CR382132 |pid:none) Yarrowia lipolytica strain CLIB1... 58 2e-06 ( P40069 ) RecName: Full=Importin s...382131 |pid:none) Yarrowia lipolytica strain CLIB1... 52 9e-05 (Q54EW3) RecName: Full=Probable importin-5 ho...ne) Homo sapiens cDNA FLJ58732 complet... 49 8e-04 CR382132_72( CR382132 |pid:none) Yarrowia lipolytica stra...928167_261( CU928167 |pid:none) Kluyveromyces thermotolerans str... 45 0.019 CP000053_1122( CP000053 |pid:none) Rickettsia feli

  7. Dicty_cDB: Contig-U13410-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AJ720555_1( AJ720555 |pid:none) Gallus gallus mRNA for hypothetica... 34 7.2 CP000053_657( CP000053 |pid:none) Rickettsia feli...|pid:none) Zygosaccharomyces rouxii strain ... 62 3e-20 CR382127_570( CR382127 |pid:none) Yarrowia lipolytic...0C6, comple... 42 0.013 6 ( AC117070 ) Dictyostelium discoideum chromosome 2 map 2097701... 34 0.014 10 ( AB263749 ) Ipo.... 34 0.030 10 ( EF568108 ) Glossina pallidipes salivary gland hypertrophy vi... 36 0.032 13 ( AC116963 ) Dictyosteli...frinfiifn*n*ry*fi*kni*sikdill*l*inyctini risnywfefneiiskt*nirip*rn*inri**fr*lih*ipiig*kinyrgvviiklfnq dlvyhqniikfsli

  8. Dicty_cDB: Contig-U12761-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 499( CR382130 |pid:none) Yarrowia lipolytica strain CLIB1... 83 7e-15 CU928173_528( CU928173 |pid:none) Zygo...( CR382132 |pid:none) Yarrowia lipolytica strain CLIB1... 54 5e-06 CR382135_476( CR382135 |pid:none) Debaryo...131_506( CR382131 |pid:none) Yarrowia lipolytica strain CLIB1... 49 2e-04 CP001324_701( CP001324 |pid:none) ...9) RecName: Full=UPF0274 protein CGSHiGG_06450; &CP000672... 36 1.00 CP000053_1122( CP000053 |pid:none) Rickettsia feli...uences producing significant alignments: (bits) Value N ( BJ336552 ) Dictyosteliu

  9. Dicty_cDB: SSJ468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available brary Ctenocephalides felis cDNA clone 3154-21, mRNA sequence. 66 5e-07 1 BD282065 |BD2...-18 CR382131_125( CR382131 |pid:none) Yarrowia lipolytica strain CLIB1... 94 1e-1...0030A10C02.5 Bee Brain Normalized/Subtracted Library, BB17 Apis mellifera cDNA cl...Subtracted Library, BB17 Apis mellifera cDNA clone BB170030B10B09 5', mRNA sequence. 56 6e-10 2 E16037 |E160...lue (Q86IA3) RecName: Full=Protein disulfide-isomerase 1; S... 100 3e-20 AF019112_1( AF019112 |pid:none) Dictyosteli

  10. Dicty_cDB: VHF121 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VFM192 (VFM192Q) /CSM/VF/VFM1-D/VFM192Q.Seq.d/ 561 e-159 own update 2002.12.26 Homology vs DNA Score E Sequences producing signific...vnsttlkshqtivshllltpfqs*ec tftlvswtisslnlgyqeltvnllvhglpsfsllsflnskkplevf*k Homology vs CSM-cDNA Sco...08132.1 SB_BBc07-L15.R SB_BBc Sorghum bicolor genomic 3', genomic survey sequence. 46 0.64 1 AC183870 |AC183870.3 Felis catus clo...a Sheared DNA Entamoeba histolytica genomic, genomic survey sequence. 32 6.3 2 dna update 2007. 9. 3 Homolog...nhen vlshwylglyxl*ilgtkn*psicwfmvchlflcylf*trknx*kyfr Frame B: ---XVMFCQFTPPFVGLCXICHNVPIGPRCVHXHGQLYNSQITSD

  11. PREVALENCE OF ANTIBODIES TO SELECTED VIRUSES AND PARASITES IN INTRODUCED AND ENDEMIC CARNIVORES IN WESTERN MADAGASCAR.

    Science.gov (United States)

    Pomerantz, Julie; Rasambainarivo, Fidisoa T; Dollar, Luke; Rahajanirina, Leon Pierrot; Andrianaivoarivelo, Radosoa; Parker, Patricia; Dubovi, Edward

    2016-07-01

    Introduced animals impact endemic populations through predation, competition, and disease transmission. Populations of endemic carnivores in Madagascar are declining, and pathogens transmitted from introduced species may further endanger these unique species. We assessed the exposure of introduced and endemic carnivores to common viral and parasitic pathogens in two national parks of Madagascar (Kirindy Mitea National Park and Ankarafantsika National Park) and their neighboring villages. We also identified variables associated with the presence of antibodies to these pathogens in fosa ( Cryptoprocta ferox ). Introduced and endemic species were exposed to canine parvovirus, canine herpesvirus, feline calicivirus, and Toxoplasma gondii . Domestic dogs ( Canis familiaris ) and cats ( Felis catus ) may be sources of infection for these pathogens. Prevalence of antibodies to Toxoplasma in captured fosa was >93%, and adults were more likely to be exposed than immature individuals. Our data provide a basis upon which to evaluate and manage risks of pathogen transmission between species. PMID:27195685

  12. Rickettsial pathogens and arthropod vectors of medical and veterinary significance on Kwajalein Atoll and Wake Island

    Directory of Open Access Journals (Sweden)

    Durden, L.

    2012-05-01

    Full Text Available Modern surveys of ectoparasites and potential vector-borne pathogens in the Republic of the Marshall Islands and Wake Island are poorly documented. We report on field surveys of ectoparasites from 2010 with collections from dogs, cats, and rats. Five ectoparasites were identified: the cat flea Ctenocephalides felis, a sucking louse Hoplopleura pacifica, the mites Laelaps nuttalli and Radfordia ensifera, and the brown dog tickRhipicephalus sanguineus. Ectoparasites were screened for rickettsial pathogens. DNA from Anaplasma platys, a Coxiella symbiont of Rhipicephalus sanguineus, anda Rickettsia sp. were identified by PCR and DNA sequencing from ticks and fleas on Kwajalein Atoll. An unidentified spotted fever group Rickettsia was detected in a pool of Laelaps nuttalli and Hoplopleura pacifica from Wake Island. The records of Hoplopleura pacifica, Laelaps nuttalli, and Radfordia ensifera and the pathogens are new for Kwajalein Atoll and Wake Island.

  13. Fleas infesting pets in the era of emerging extra-intestinal nematodes.

    Science.gov (United States)

    Traversa, Donato

    2013-01-01

    Modifications in climatic conditions, movements of hosts and goods, changes in animal phenology and human behaviour and increase of wildlife, are presently concurring in the geographic spread of vectors and cardio-respiratory nematodes, e.g. Dirofilaria immitis, Angiostrongylus vasorum, Aelurostrongylus abstrusus and Capillaria aerophila. All these factors may also influence dispersion and clinical significance of fleas, thus posing relevant challenges in those regions where other parasites are emerging at the same time. Ctenocephalides felis, Ctenocephalides canis and Pulex irritans cause discomfort, nuisance, allergic reactions, anaemia, and may transmit several pathogens, some of them are of importance for public health. The present article reviews the importance of fleas in small animal practice and their sanitary relevance for dogs, cats and humans, and discusses current control methods in the present era of emerging extra-intestinal nematodes, towards a possible changing perspective for controlling key parasites affecting companion animals. PMID:23497511

  14. AcEST: BP916139 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_F02 449 Adiantum capillus-veneris mRNA. clone: YMU001_000083_F02. BP916139 CL2906C ... . 30 4.3 sp|P02646|TNNI3_RABIT Troponin I, cardiac muscle ... OS=Oryctolagus ... 29 9.6 sp|P19429|TNNI3_HUMAN Tr ... oponin I, cardiac muscle ... OS=Homo sapiens... 29 9.6 sp|Q863B6|TNNI3_FELCA Tr ... oponin I, cardiac muscle ... OS=Felis silves... 29 9.6 sp|Q8MKD5|TNNI3_CANFA Tr ... oponin I, cardiac muscle ... OS=Canis famili... 29 9.6 sp|P08057|TNNI3_BOVIN Tr ...

  15. TOXOPLASMA GONDII ANTIBODY PREVALENCE AND TWO NEW GENOTYPES OF THE PARASITE IN ENDANGERED HAWAIIAN GEESE (NENE: BRANTA SANDVICENSIS).

    Science.gov (United States)

    Work, Thierry M; Verma, Shiv K; Su, Chunlei; Medeiros, John; Kaiakapu, Thomas; Kwok, Oliver C; Dubey, Jitender P

    2016-04-28

    Toxoplasma gondii is a protozoan parasite transmitted by domestic cats ( Felis catus ) that has historically caused mortality in native Hawaiian birds. To estimate how widespread exposure to the parasite is in nene (Hawaiian Geese, Branta sandvicensis), we did a serologic survey for T. gondii antibody and genetically characterized parasite DNA from the tissues of dead birds that had confirmed infections by immunohistochemistry. Of 94 geese sampled, prevalence on the island of Kauai, Maui, and Molokai was 21% (n=42), 23% (n=31), and 48% (n=21), respectively. Two new T. gondii genotypes (ToxoDB #261 and #262) were identified by PCR-restriction fragment length polymorphism from four geese, and these appeared segregated geographically. Exposure to T. gondii in wild nene is widespread and, while the parasite is not a major cause of death, it could have sublethal or behavioral effects. How to translate such information to implement effective ways to manage feral cats in Hawaii poses challenges. PMID:26967138

  16. Isolation of pathogenic yersiniae from wild animals in Bulgaria.

    Science.gov (United States)

    Nikolova, S; Tzvetkov, Y; Najdenski, H; Vesselinova, A

    2001-04-01

    Pathogenic Yersinia strains were isolated between December 1998 and April 1999 from 37 wild animals: rabbit (Lepus europeus), boar (Sus scrofa scrofa), asiatic jackal (Canis aureus), red fox (Vulpes vulpes), mouflon (Ovis musimon), european river otter (Lutra lutra), beech marten (Martes foina), polecat (Musleta putorius) and wild cat (Felis silvestris). It was established that among the wild animals Y. enterocolitica strains of serotype 0:3 predominated, accompanied by Y. pseudotuberculosis strains of serotype 0:3. In one sample from asiatic jackal and one sample from rabbit, Y. enterocolitica serotype 0:8 was isolated. Yersinia enterocolitica and Y. pseudotuberculosis strains were isolated from tonsils and tongues as well as from the viscera--lung, liver, heart, spleen, kidney and lymph nodes, mainly in young animals (1-2 years of age). The results showed that wild animals are a possible natural reservoir for pathogenic Y. enterocolitica and Y. pseudotuberculosis and are included in the epidemiological chain of yersinioses. PMID:11393816

  17. Helminths of foxes and other wild carnivores from rural areas in Greece.

    Science.gov (United States)

    Papdopoulos, H; Himonas, C; Papazahariadou, M; Antoniadou-Sotiriadou, K

    1997-09-01

    Twenty species of helminth parasites were identified from fox, wolf, jackal and wild cat material collected in Greece. Of the 314 foxes (Vulpes vulpes) examined, 18 helminth species were recovered comprising one trematode, eight cestodes, seven nematodes and two acanthocephalans, with the cestode species Mesocestoides sp. (73.2%), Joyeuxiella echinorhynchoides (24.5%) and the nematode species Uncinaria stenocephala (43.9%), and Toxara canis (28.6%) being the most prevalent. Five cestode and three nematode species were reported from six wolves (CaniS lupus), together with one trematode, three cestode and four nematode species from five jackals (Canis aureus) and two cestode and three nematode species from four wild cats (Felis silvestris) examined. The species J. echinorhynchoides, Taenia crassiceps and Onicola canis and the genera Spirometra, Rictularia and Pachysentis are reported here for the first time in Greece. The results are discussed in the light of the feeding characteristics of wild carnivores in rural areas of Greece. PMID:9705680

  18. On Some Issues of Human-Animal Studies: An Introduction.

    Science.gov (United States)

    Métraux, Alexandre

    2016-03-01

    Animals are "in" - since prehistoric times when humans (or their ancient ancestors) were hunting animals, and when they fabricated the Paleolithic dog as well as the Paleolithic cat. In less general terms, animals are "in" since they received names and were listed, observed, mummified, turned into totems, and, later on, dissected, tortured under laboratory conditions, trained as experimental subjects or "purified" as model organisms. And they are massively "in" again, but now from overtly legal and moral points of view, at least since the last two decades of the twentieth century. This is to say that modern members of the species Homo sapiens have always been connected to animals of the most various kinds - from the human flea (Pulex irritans) and the cat flea (Ctenocephalides felis) to marine mammals, such as dolphins and whales, from horses to parrots, from scallops to worms, and so on. PMID:26903370

  19. On harmonic operation of Shanghai deep UV free electron laser

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    By choosing parameters in the modulator,the dispersive section and the seed laser,the spatial bunching of the electron beam can be correlated to then-th harmonic of ther adiator radiation,instead of the fundamental radiation in conventional high-gain harmonic generation(HGHG).Thus,the radiator undulator is operated at high harmonic mode.In this paper,the possibility of harmonic operation of Shanghai deep ultraviolet(SDUV)free electron laser (FEL)is studied.Discussions on the principle of harmonic operation,the simulation code development,the simulation results.and the proposed experimental procedure for verification of harmonic operation at the SDUV FEL are also presented.

  20. Small mammals of the Addo Elephant National Park

    Directory of Open Access Journals (Sweden)

    P. Swanepoel

    1975-07-01

    Full Text Available A survey of the small mammals of the Addo Elephant National Park resulted in a checklist, as well as information on relative numbers, distribution within the Park, reproductive activity, sex ratios, and body measurements. Forty mammals species occur in the Park, while three re-introduced species probably do not occur any longer. Of the 40 species 28 are considered small mammals comprising 13 rodent, eight carnivore, two shrew, two bat, one primate and one lagomorph species, as well as the aardvark: Crociduraflavescens, C. cyanea infumata, Rousettus aegyptiacus, Eptesicus capensis, Cercopithecus pygerythrus, Canis mesomelas, Ictonyx striatus, Poecilogale albinucha, Genetta sp., Herpestes pulverulentus, Suricata suricatta, Proteles cristatus, Felis caracal, Orycteropus afer, Lepus saxatilis, Cryptomys hottentotus, Hystrix africae-australis, Pedetes capensis, Graphiurus murinus, Aethomys namaquensis, Praomys natalensis, Rhabdomys pumilio, Mus minutoides, Rattus rattus, Saccostomys campestris, Desmodillus auricularis, Otomys irroratus and 0. unisulcatus.

  1. Cryptosporidiosis and giardiasis in dogs and cats: veterinary and public health importance.

    Science.gov (United States)

    Bowman, Dwight D; Lucio-Forster, Araceli

    2010-01-01

    Dogs and cats are the only domestic animals that still routinely reside in the same domicile as their owners around the world, and hence the interest in their role as reservoirs of potentially zoonotic agents. In the case of cryptosporidiosis and giardiasis, current data suggests that dogs and cats do not routinely share their infections with healthy people. Dogs are hosts of Cryptosporidiumcanis and Giardiaduodenalis Assemblages C and D. Cats are hosts to Cryptosporidiumfelis and G. duodenalis Assemblage F. Dogs and cats (and other animals) are sometimes infected with sub-Assemblage AI, an Assemblage also found in people, but people usually have sub-Assemblage AII. Unfortunately, severely immunocompromised individuals and malnourished children can be made ill by infections with C. canis and C. felis. People should practice good sanitation and hygiene to minimize environmental contamination and contact with the infectious (oo)cysts that may be shed by their pets. PMID:19545532

  2. AcEST: BP917809 [AcEST

    Lifescience Database Archive (English)

    Full Text Available protein 10A5 OS=Glycine max ... 35 0.22 sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha ...... 34 0.29 sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha ... 34 0.29 sp|P33083|AX6B_SOYBN Auxin-induced...475 E F Sbjct: 81 EEF 83 >sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus GN...tein OS=Feline leuke... 31 3.2 sp|P68271|MYC_FELCA Myc proto-oncogene protein OS=Felis silvestr... 31 3.2 sp|Q24JP5|T132A_HUMAN Trans...lencing protein 4 OS=Chaet... 30 7.2 sp|Q922P8|T132A_MOUSE Transmembrane protein 132A OS=Mus musculus... 29

  3. Feeding profile of Mepraia spinolai, a sylvatic vector of Chagas disease in Chile.

    Science.gov (United States)

    Chacón, F; Bacigalupo, A; Quiroga, J F; Ferreira, A; Cattan, P E; Ramírez-Toloza, G

    2016-10-01

    American trypanosomiasis is a chronic disease transmitted mainly by vectors. The hematophagous triatomine vectors transmit Trypanosoma cruzi to a wide variety of mammals, which usually are their food source. This study determined the feeding profile of Mepraia spinolai, a sylvatic triatomine vector, present in endemic areas of Chile. Vectors were captured in the north-central area of Chile. Samples of intestinal contents were analyzed by an Enzyme-linked immunosorbent assay (ELISA) that identifies and discriminates the presence of serum antigens from Homo sapiens and nine animal species (Canis familiaris, Felis catus, Capra hircus, Mus musculus, Gallus gallus, Octodon degus, Thylamys elegans, Phyllotis darwini and Oryctolagus cuniculus). Our data indicate the most frequent feeding source in this area was P. darwini, followed by O. degus, O. cuniculus, M. musculus, G. gallus, T. elegans, C. familiaris, F. catus and C. hircus. Mixed food sources were also identified. PMID:27349188

  4. Prevalence and genetic characteristics of Cryptosporidium, Enterocytozoon bieneusi and Giardia duodenalis in cats and dogs in Heilongjiang province, China.

    Science.gov (United States)

    Li, Wei; Li, Yijing; Song, Mingxin; Lu, Yixin; Yang, Jinping; Tao, Wei; Jiang, Yanxue; Wan, Qiang; Zhang, Siwen; Xiao, Lihua

    2015-03-15

    This study investigated 319 fecal specimens of cats (n=52) and dogs (n=267) from Heilongjiang province, China for the prevalence and genetic characteristics of Cryptosporidium, Enterocytozoon bieneusi, and Giardia duodenalis. PCR and DNA sequence analysis of the small subunit rRNA gene identified C. felis and C. parvum in one cat each (3.8%) and C. canis and C. ubiquitum in 6 dogs (2.2%). Polymorphisms in the ribosomal internal transcribed spacer and phylogenetic analysis characterized zoonotic E. bieneusi genotypes D, EbpC, NED1, and NED2 and host-adapted ones NED3, NED4, and PtEb IX in 18 dogs (6.7%) and human-pathogenic genotypes D and IV in 3 cats (5.8%). Genotyping based on the hypermutation of G. duodenalis triosephosphate isomerase gene (TPI) facilitated identification of assemblage F in a cat (1.9%) and assemblages C and E in 12 dogs (4.5%). Subtypes of G. duodenalis isolates were determined by measuring the diversity of both TPI nucleotide and amino acid sequences. C. canis, C. felis, C. parvum, E. bieneusi genotypes D, EbpC, and IV, and G. duodenalis assemblage C identified herein have been documented in human infections in China. C. canis, C. parvum, C. ubiquitum, and E. bieneusi genotypes D, EbpC, and IV carried by cats or dogs also existed in wastewater in China. The finding suggested pet animals could be reservoirs for human cryptosporidiosis, microsporidiosis, and giardiasis and potential sources of water contamination in China. PMID:25665462

  5. Cystinuria Associated with Different SLC7A9 Gene Variants in the Cat.

    Science.gov (United States)

    Mizukami, Keijiro; Raj, Karthik; Osborne, Carl; Giger, Urs

    2016-01-01

    Cystinuria is a classical inborn error of metabolism characterized by a selective proximal renal tubular defect affecting cystine, ornithine, lysine, and arginine (COLA) reabsorption, which can lead to uroliths and urinary obstruction. In humans, dogs and mice, cystinuria is caused by variants in one of two genes, SLC3A1 and SLC7A9, which encode the rBAT and bo,+AT subunits of the bo,+ basic amino acid transporter system, respectively. In this study, exons and flanking regions of the SLC3A1 and SLC7A9 genes were sequenced from genomic DNA of cats (Felis catus) with COLAuria and cystine calculi. Relative to the Felis catus-6.2 reference genome sequence, DNA sequences from these affected cats revealed 3 unique homozygous SLC7A9 missense variants: one in exon 5 (p.Asp236Asn) from a non-purpose-bred medium-haired cat, one in exon 7 (p.Val294Glu) in a Maine Coon and a Sphinx cat, and one in exon 10 (p.Thr392Met) from a non-purpose-bred long-haired cat. A genotyping assay subsequently identified another cystinuric domestic medium-haired cat that was homozygous for the variant originally identified in the purebred cats. These missense variants result in deleterious amino acid substitutions of highly conserved residues in the bo,+AT protein. A limited population survey supported that the variants found were likely causative. The remaining 2 sequenced domestic short-haired cats had a heterozygous variant at a splice donor site in intron 10 and a homozygous single nucleotide variant at a branchpoint in intron 11 of SLC7A9, respectively. This study identifies the first SLC7A9 variants causing feline cystinuria and reveals that, as in humans and dogs, this disease is genetically heterogeneous in cats. PMID:27404572

  6. Tiger, Bengal and Domestic Cat Embryos Produced by Homospecific and Interspecific Zona-Free Nuclear Transfer.

    Science.gov (United States)

    Moro, L N; Jarazo, J; Buemo, C; Hiriart, M I; Sestelo, A; Salamone, D F

    2015-10-01

    The aim of this study was to evaluate three different cloning strategies in the domestic cat (Felis silvestris) and to use the most efficient to generate wild felid embryos by interspecific cloning (iSCNT) using Bengal (a hybrid formed by the cross of Felis silvestris and Prionailurus bengalensis) and tiger (Panthera tigris) donor cells. In experiment 1, zona-free (ZP-free) cloning resulted in higher fusion and expanded blastocyst rates with respect to zona included cloning techniques that involved fusion or injection of the donor cell. In experiment 2, ZP-free iSCNT and embryo aggregation (2X) were assessed. Division velocity and blastocyst rates were increased by embryo aggregation in the three species. Despite fewer tiger embryos than Bengal and cat embryos reached the blastocyst stage, Tiger 2X group increased the percentage of blastocysts with respect to Tiger 1X group (3.2% vs 12.1%, respectively). Moreover, blastocyst cell number was almost duplicated in aggregated embryos with respect to non-aggregated ones within Bengal and tiger groups (278.3 ± 61.9 vs 516.8 ± 103.6 for Bengal 1X and Bengal 2X groups, respectively; 41 vs 220 ± 60 for Tiger 1X and Tiger 2X groups, respectively). OCT4 analysis also revealed that tiger blastocysts had higher proportion of OCT4-positive cells with respect to Bengal blastocysts and cat intracytoplasmic sperm injection blastocysts. In conclusion, ZP-free cloning has improved the quality of cat embryos with respect to the other cloning techniques evaluated and was successfully applied in iSCNT complemented with embryo aggregation. PMID:26332056

  7. ECTOFAUNA PARASITÁRIA DE CÃES URBANOS DOMICILIADOS ATENDIDOS EM CLÍNICAS VETERINÁRIAS PARTICULARES NA CIDADE DE LAVRAS, MG

    Directory of Open Access Journals (Sweden)

    Antonio Marcos Guimarães

    2011-03-01

    Full Text Available The objective of this study was to determine the frequency of ectoparasites in urban domiciled dogs treated at nine private veterinary clinics in the city of Lavras, Minas Gerais, Brazil. Visible and palpable ectoparasites specimens were collected manually from 67 dogs during the period of September 2004 to May 2005, kept in flasks with ethanol 70º GL and identified under a stereomicroscope. In the case of mites that cause mange, performed the analysis of the results obtained from 155 skin scrapings of the same number of dogs with clinical suspicion of parasitic dermatosis was performed, and sent to diagnostic at the Laboratory of Parasitic Diseases of Federal University of Lavras (UFLA, during the period of September 2002 to July 2007. A total of 540 ectoparasites were recorded, and four species were identified: Rhipicephalus sanguineus (60%, Ctenocephalides canis and C. felis (both 36%, and Dermatobia hominis larvae (4%. In scraped skin, positive results were verified in 12.9% (20/155, of which 80.0% with Demodex canis (16/20 and 20.0% with Sarcoptes scabiei var. canis (4/20. After ectoparasites identification a database with the dogs´medical records was made and analyzed by SPSS 12.0. It can be concluded that the predominant species of ectoparasites in dogs treated at private veterinary clinics in the city of Lavras, MG, were Ctenocephalides canis and C. felis (Siphonaptera: Pulicidae and R. sanguineus (Acari: Ixodidae and Demodex canis (Acari: Demodecidae that had a significant predominance (p<0.05 on scraped skin of young animals with suspicion of canine demodicosis.

  8. Gastric Helicobacter infection induces iron deficiency in the INS-GAS mouse.

    Directory of Open Access Journals (Sweden)

    Melanie J Thomson

    Full Text Available There is increasing evidence from clinical and population studies for a role of H. pylori infection in the aetiology of iron deficiency. Rodent models of Helicobacter infection are helpful for investigating any causal links and mechanisms of iron deficiency in the host. The aim of this study was to investigate the effects of gastric Helicobacter infection on iron deficiency and host iron metabolism/transport gene expression in hypergastrinemic INS-GAS mice. INS-GAS mice were infected with Helicobacter felis for 3, 6 and 9 months. At post mortem, blood was taken for assessment of iron status and gastric mucosa for pathology, immunohistology and analysis of gene expression. Chronic Helicobacter infection of INS- GAS mice resulted in decreased serum iron, transferrin saturation and hypoferritinemia and increased Total iron binding capacity (TIBC. Decreased serum iron concentrations were associated with a concomitant reduction in the number of parietal cells, strengthening the association between hypochlorhydria and gastric Helicobacter-induced iron deficiency. Infection with H. felis for nine months was associated with decreased gastric expression of iron metabolism regulators hepcidin, Bmp4 and Bmp6 but increased expression of Ferroportin 1, the iron efflux protein, iron absorption genes such as Divalent metal transporter 1, Transferrin receptor 1 and also Lcn2 a siderophore-binding protein. The INS-GAS mouse is therefore a useful model for studying Helicobacter-induced iron deficiency. Furthermore, the marked changes in expression of gastric iron transporters following Helicobacter infection may be relevant to the more rapid development of carcinogenesis in the Helicobacter infected INS-GAS model.

  9. [Prevalence of intestinal canine and feline parasites in Saitama Prefecture, Japan].

    Science.gov (United States)

    Yamamoto, Norishige; Kon, Marina; Saito, Toshikazu; Maeno, Naohiro; Koyama, Masaya; Sunaoshi, Katsuhiko; Yamaguchi, Masanori; Morishima, Yasuyuki; Kawanaka, Masanori

    2009-05-01

    We studied the prevalence of intestinal parasites in animal companions in Saitama Prefecture, Japan, where no detailed data is currently available. Between May 1999 and December 2007, fecal samples were collected from 906 dogs and 1,079 cats in public animal shelters and examined by microscopy. Overall, prevalence of intestinal parasites in dogs was 38.6% and cats 43.1%. Trichuris vulpis was the most prevalent canine parasite species (22.3%), followed by Toxocara canis (12.5%), Ancylostoma caninum (10.4%), Isospora ohioensis (2.1%), Spirometra erinaceieuropaei (1.0%), Crypstosporidium sp. (0.9%), Giardia intestinalis (0.9%), I. canis (0.6%), Taeniidae (0.3%), Dipylidium caninum (0.2%), Echinostoma sp. (0.1%), and Pentatrichomonas hominis (0.1%). T. cati was the most prevalent feline parasite species (21.8%), followed by A. tubaeforme (13.2%), S. erinaceieuropaei (8.3%), I. felis (4.5%), Cryptosporidium sp. (2.8%), I. rivolta (2.2%), Pharyngostomum cordatum (1.6%), D. caninum (1.4%), Eimeria sp. (0.3%), Taeniidae (0.2%), Trichuris sp. (0.2%), Capillaria sp. (0.1%), Diphyllobothrium nihonkaiense (0.1%), and Metagonimus yokogawai (0.1%). Further molecular analysis to identify canine Taeniidae species and canine and feline Cryptosporidium species identified one canine taeniid positive species as Echinococcus multilocularis. Cryptosporidium species were identified as C. canis and C. felis. Parasites E. multilocularis and Cryptosporidium spp. in animal hosts were the first to be recorded in this prefecture. Compared to previous surveys conducted in the same area, the endemicity of some parasites appeared to have decreased, but some others remain. Given that most of these parasites have zoonotic potential, indicates the importance of having current data on parasite dissemination among animal companions. Government public health agencies should be responsible for educating pet owners about the control and prevention of zoonotic risk from such parasites. PMID:19522305

  10. The novel isoxazoline ectoparasiticide fluralaner: selective inhibition of arthropod γ-aminobutyric acid- and L-glutamate-gated chloride channels and insecticidal/acaricidal activity.

    Science.gov (United States)

    Gassel, Michael; Wolf, Christian; Noack, Sandra; Williams, Heike; Ilg, Thomas

    2014-02-01

    Isoxazolines are a novel class of parasiticides that are potent inhibitors of γ-aminobutyric acid (GABA)-gated chloride channels (GABACls) and L-glutamate-gated chloride channels (GluCls). In this study, the effects of the isoxazoline drug fluralaner on insect and acarid GABACl (RDL) and GluCl and its parasiticidal potency were investigated. We report the identification and cDNA cloning of Rhipicephalus (R.) microplus RDL and GluCl genes, and their functional expression in Xenopus laevis oocytes. The generation of six clonal HEK293 cell lines expressing Rhipicephalus microplus RDL and GluCl, Ctenocephalides felis RDL-A285 and RDL-S285, as well as Drosophila melanogaster RDLCl-A302 and RDL-S302, combined with the development of a membrane potential fluorescence dye assay allowed the comparison of ion channel inhibition by fluralaner with that of established insecticides addressing RDL and GluCl as targets. In these assays fluralaner was several orders of magnitude more potent than picrotoxinin and dieldrin, and performed 5-236 fold better than fipronil on the arthropod RDLs, while a rat GABACl remained unaffected. Comparative studies showed that R. microplus RDL is 52-fold more sensitive than R. microplus GluCl to fluralaner inhibition, confirming that the GABA-gated chloride channel is the primary target of this new parasiticide. In agreement with the superior RDL on-target activity, fluralaner outperformed dieldrin and fipronil in insecticidal screens on cat fleas (Ctenocephalides felis), yellow fever mosquito larvae (Aedes aegypti) and sheep blowfly larvae (Lucilia cuprina), as well as in acaricidal screens on cattle tick (R. microplus) adult females, brown dog tick (Rhipicephalus sanguineus) adult females and Ornithodoros moubata nymphs. These findings highlight the potential of fluralaner as a novel ectoparasiticide. PMID:24365472

  11. Primeiro relato de Strongyloides sp. (Nematoda, Strongyloididae em Leopardus tigrinus (Carnivora: Felidae do município de Botucatu, Estado de São Paulo, Brasil First report of Strongyloides sp. (Nematoda, Strongyloididae in Leopardus tigrinus (Carnivora: Felidae in the municipality of Botucatu, State of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Karina R. dos Santos

    2009-12-01

    Full Text Available O presente estudo reporta o primeiro caso de infecção por Strongyloides sp. em Leopardus tigrinus no município de Botucatu, Estado de São Paulo, Brasil. Fezes do exemplar parasitado de L. tigrinus foram cultivadas em fezes eqüinas esterilizadas e foi realizada infecção experimental em gato (Felis catus domesticus com três mil larvas L3 infectantes por via subcutânea, para a identificação da espécie de Strongyloides envolvida no parasitismo. As fêmeas partenogenéticas obtidas do animal experimental foram analisadas porém a comparação dos dados biométricos encontrados com os dados da literatura não permitiu a identificação da espécie. Este é o primeiro relato sobre a ocorrência de Strongyloides sp. Em L. tigrinusThe present study reports the first case of infection by Strongyloides sp. in Leopardus tigrinus in the municipality of Botucatu, State of São Paulo, Brazil. Feces of the infected L. tigrinus specimen were cultivated in sterilized equine feces and a cat (Felis catus domesticus was experimentally infected with three thousand infective L3 subcutaneous route, in order to identify the Strongyloides species involved in the parasitism. Parthenogenetic females recovered from the experimental animals were analyzed but comparison between the biometric data found and the data in the literature did not enable identification of the species. This is the first report on the occurrence of Strongyloides sp. in L. tigrinus.

  12. Cystinuria Associated with Different SLC7A9 Gene Variants in the Cat

    Science.gov (United States)

    Raj, Karthik; Osborne, Carl; Giger, Urs

    2016-01-01

    Cystinuria is a classical inborn error of metabolism characterized by a selective proximal renal tubular defect affecting cystine, ornithine, lysine, and arginine (COLA) reabsorption, which can lead to uroliths and urinary obstruction. In humans, dogs and mice, cystinuria is caused by variants in one of two genes, SLC3A1 and SLC7A9, which encode the rBAT and bo,+AT subunits of the bo,+ basic amino acid transporter system, respectively. In this study, exons and flanking regions of the SLC3A1 and SLC7A9 genes were sequenced from genomic DNA of cats (Felis catus) with COLAuria and cystine calculi. Relative to the Felis catus-6.2 reference genome sequence, DNA sequences from these affected cats revealed 3 unique homozygous SLC7A9 missense variants: one in exon 5 (p.Asp236Asn) from a non-purpose-bred medium-haired cat, one in exon 7 (p.Val294Glu) in a Maine Coon and a Sphinx cat, and one in exon 10 (p.Thr392Met) from a non-purpose-bred long-haired cat. A genotyping assay subsequently identified another cystinuric domestic medium-haired cat that was homozygous for the variant originally identified in the purebred cats. These missense variants result in deleterious amino acid substitutions of highly conserved residues in the bo,+AT protein. A limited population survey supported that the variants found were likely causative. The remaining 2 sequenced domestic short-haired cats had a heterozygous variant at a splice donor site in intron 10 and a homozygous single nucleotide variant at a branchpoint in intron 11 of SLC7A9, respectively. This study identifies the first SLC7A9 variants causing feline cystinuria and reveals that, as in humans and dogs, this disease is genetically heterogeneous in cats. PMID:27404572

  13. Directory of Open Access Journals (Sweden)

    Leandro Villa-Verde

    2013-03-01

    Full Text Available The genus Listrura, Glanapteryginae, currently comprises six valid species of small and elongated trichomycterid catfishes that inhabit coastal plains of Southern and Southeastern Brazil. As primarily fossorial dwellers, species of the genus display unusual morphological adaptations and restricted habitats, which make these fishes particularly susceptible to environmental disturbance. Listrura camposi is poorly known and ranked as a Critically Endangered catfish species, according to current Brazilian list of threatened species. Description of the species was based on a single specimen collected in 1940, and for seven decades no additional specimens were reported. As a consequence, basic information about the species is unavailable. Recently, a population of L. camposi was found inhabiting a small stream tributary to rio Ribeira de Iguape basin, São Paulo State, relatively close to the type locality. On the basis of newly collected material, the species is redescribed and the first data on its habitat and ecology are presented. Conservation status is also discussed.O gênero Listrura, Glanapteryginae, compreende atualmente seis espécies válidas de bagres pequenos e alongados que habitam as baixadas costeiras do Sul e Sudeste do Brasil. Principalmente de hábitos fossoriais, as espécies do gênero apresentam adaptações morfológicas incomuns e habitat restrito, o que torna estes peixes particularmente suscetíveis a distúrbios ambientais. Listrura camposi é pouco conhecida e considerada uma espécie Criticamente em Perigo, segundo as mais recentes listas brasileiras de espécies ameaçadas. A descrição da espécie foi baseada em um único exemplar coletado em 1940 e por sete décadas nenhum espécime adicional foi relatado. Como consequência, informações básicas sobre a espécie estão indisponíveis. Recentemente, uma população de L. camposi foi encontrada habitando um pequeno córrego tributário da bacia rio Ribeira de Iguape

  14. Mercury contamination from artisanal gold mining in Antioquia, Colombia: The world's highest per capita mercury pollution.

    Science.gov (United States)

    Cordy, Paul; Veiga, Marcello M; Salih, Ibrahim; Al-Saadi, Sari; Console, Stephanie; Garcia, Oseas; Mesa, Luis Alberto; Velásquez-López, Patricio C; Roeser, Monika

    2011-12-01

    The artisanal gold mining sector in Colombia has 200,000 miners officially producing 30tonnes Au/a. In the Northeast of the Department of Antioquia, there are 17 mining towns and between 15,000 and 30,000 artisanal gold miners. Guerrillas and paramilitary activities in the rural areas of Antioquia pushed miners to bring their gold ores to the towns to be processed in Processing Centers or entables. These Centers operate in the urban areas amalgamating the whole ore, i.e. without previous concentration, and later burn gold amalgam without any filtering/condensing system. Based on mercury mass balance in 15 entables, 50% of the mercury added to small ball mills (cocos) is lost: 46% with tailings and 4% when amalgam is burned. In just 5 cities of Antioquia, with a total of 150,000 inhabitants: Segovia, Remedios, Zaragoza, El Bagre, and Nechí, there are 323 entables producing 10-20tonnes Au/a. Considering the average levels of mercury consumption estimated by mass balance and interviews of entables owners, the mercury consumed (and lost) in these 5 municipalities must be around 93tonnes/a. Urban air mercury levels range from 300ng Hg/m(3) (background) to 1million ng Hg/m(3) (inside gold shops) with 10,000ng Hg/m(3) being common in residential areas. The WHO limit for public exposure is 1000ng/m(3). The total mercury release/emissions to the Colombian environment can be as high as 150tonnes/a giving this country the shameful first position as the world's largest mercury polluter per capita from artisanal gold mining. One necessary government intervention is to cut the supply of mercury to the entables. In 2009, eleven companies in Colombia legally imported 130tonnes of metallic mercury, much of it flowing to artisanal gold mines. Entables must be removed from urban centers and technical assistance is badly needed to improve their technology and reduce emissions. PMID:22000915

  15. Induced spawning of the endangered Neotropical species Steindachneridion parahybae (Siluriformes: Pimelodidae

    Directory of Open Access Journals (Sweden)

    Danilo Caneppele

    2009-01-01

    Full Text Available The "surubim do Paraíba" (Steindachneridion parahybae is a freshwater catfish endemic to the Paraíba do Sul River basin, Brazil. This species has been seriously threatened by environmental disturbances in the last several decades. Wild Steindachneridion parahybae males and females were collected in 2003 and taken to the hatchery of a power plant of the Companhia Energética de São Paulo (CESP. Steindachneridion parahybae broodstocks were artificially induced to reproduce in December 2003 using a combination of carp pituitary extract (CPE and human chorionic gonadotropin (hCG. Oocytes and milt were stripped; the fertilized eggs were transferred to 60-liter conical incubators and hatched larvae distributed in nine horizontal trays. Exogenous feed was started just after yolk sac absorption. A high rate of cannibalism and photophobia were observed during the larval period, resulting in a 26% survival rate from larvae to fingerlings.O "surubim do Paraíba" (Steindachneridion parahybae é um bagre de água doce, endêmico da bacia do rio Paraíba do Sul, Brasil. Esta espécie foi seriamente ameaçada por distúrbios ambientais nas últimas décadas. Machos e fêmeas selvagens de Steindachneridion parahybae foram coletados em 2003 e transferidos para a piscicultura da CESP (Companhia Energética de São Paulo. Reprodutores de S. parahybae foram induzidos à reprodução artificial em dezembro de 2003 usando uma combinação de extrato hipofisário de carpa (CPE e gonadotropina coriônica humana (hCG. Após a extrusão dos óvulos e do sêmen, os ovos fertilizados foram transferidos para incubadoras cônicas de 60 litros e, em seguida, as larvas eclodidas distribuídas em nove incubadoras horizontais. Após a absorção do saco vitelino, a alimentação exógena foi iniciada. Uma alta taxa de canibalismo e fotofobia foram observados durante o período larval, resultando em uma taxa de sobrevivência de 26% de larvas para os alevinos

  16. Tissue-specific mercury concentrations in two catfish species from the Brazilian coast

    Directory of Open Access Journals (Sweden)

    Juliana de Souza Azevedo

    2012-06-01

    Full Text Available Some regions of Brazil have particularly high levels of mercury (Hg emissions due to industrial activities, and their fish species may therefore suffer high levels of contamination through bioaccumulation. In this paper we assess Hg contamination in the muscle, liver, gills and blood of two different species of catfish collected from the Cananéia and Santos-São Vicente estuaries, São Paulo State, Brazil. Fish from the most polluted site (Santos-São Vicente showed higher median Hg concentrations in both species (Cathorops spixii - liver: 1530 µg Kg-1, muscle: 327 µg Kg-1 and gill: 101 µg Kg-1; Genidens genidens - liver: 2617 µg Kg-1, muscle: 393 µg Kg-1 and gill: 118 µg Kg-1. Multivariate analysis revealed the importance and influence of key biological variables (size, condition, etc. in determining the overall level of Hg and its distribution within different tissues.Algumas regiões do Brasil apresentam, altos níveis de emissões de mercúrio (Hg devido às atividades industriais, e suas espécies de peixes podem, portanto, estar expostos a elevados níveis de contaminação por meio da bioacumulação. Neste trabalho avaliamos a contaminação por Hg no músculo, fígado, brânquias e sangue de duas espécies de bagres coletados nos estuários de Cananéia e Santos-São Vicente, São Paulo, Brasil. Peixes amostrados no local mais poluído (Santos-São Vicente mostraram maiores concentrações de Hg em ambas as espécies (Cathorops spixii - fígado: 1530 µg Kg-1, músculo: 327 µg Kg-1 e brânquias: 101 µg Kg-1; Genidens genidens - fígado: 2617 µg Kg-1, músculo: 393 µg Kg-1 e brânquias: 118 µg Kg-1. Análises multivariadas revelaram a importância e influência das principais variáveis biológicas (tamanho, condição, etc. no teor geral de Hg e sua distribuição nos diferentes tecidos.

  17. Accumulation and distribution of metals in the tissues of two catfish species from Cananéia and Santos-São Vicente estuaries

    Directory of Open Access Journals (Sweden)

    Juliana de Souza Azevedo

    2012-12-01

    Full Text Available Pb, Cd, Zn, and Cu concentrations and their distribution in liver, gill, and muscle tissues of the catfish Cathorops spixii and Genidens genidens were investigated in order to provide information concerning the bioaccumulation processes in these species. Fish were collected in one estuary subject to slight human influence (Cananéia and in two regions within the Santos-São Vicente estuary, São Paulo, Brazil, subject to distinct anthropogenic influences: 1 industrial and 2 domestic. In general, the highest concentrations of Cu, Zn, Cd, and Pb were found in the liver tissue. Muscle showed the lowest values of metal accumulation for all the elements investigated. Regarding the distribution and the metal pollution index (MPI, the levels of the metals analyzed decreased in the following order: liver>gill>muscle. MPI results suggest that gill and liver are important organs to exemplify the bioaccumulation process and are also better able to reflect both recent and chronic exposure to metals.Concentrações de Pb, Cd, Zn e Cu e sua distribuição no fígado, brânquias e músculo dos bagres Cathorops spixii e Genidens genidens foram determinadas visando fornecer informações sobre os processos de bioacumulação desses metais nas espécies. Os peixes foram coletados no estuário de Cananéia e em duas regiões do estuário de Santos-São Vicente, ambos em São Paulo, Brasil. Esses estuários apresentam distintas influências antropogênicas, sendo o primeiro deles submetido a impacto industrial e o segundo a impacto doméstico. Em geral, as maiores concentrações de Cu, Zn, Cd e Pb foram obtidas no tecido hepático. No músculo foram encontrados os menores valores de acumulação para todos os elementos investigados. Quanto à distribuição dos metais e ao seu índice de poluição (Índice de Poluição por Metais-IPM, os níveis diminuíram na seguinte ordem: fígado>brânquias>músculo. Resultados do IPM sugerem que as brânquias e o fígado s

  18. Environmental characterization of the reproductive season of migratory fish of the Sinú river (Córdoba, Colombia

    Directory of Open Access Journals (Sweden)

    Eduardo Kerguelén-Durango

    2015-09-01

    Full Text Available Objective. To characterize some abiotic factors during the reproductive season of migratory fish (bocachico Prochilodus magdalenae, dorada Brycon sinuensis, bagre blanco Sorubim cuspicaudus and barbul Pimelodus blochii in the Sinú River. Materials and methods. From April to October, 2008, in Carrizola (Tierralta, 36.31 km from the Urrá hydroelectric plant factors such as flow=Qriver, daily flow difference =ΔQriver, velocity=Vriver, temperature=Triver, electrical conductivity=CE, total dissolved solids=STD, turbidity=Turb, cloudiness=Nub, rainfall=Pluv and solar brightness=Bs were measured daily three times/day (07:00 h, 12:00 h, 17:00 h. Also, on the same schedule, ichthyoplankton was collected as an indicator of reproductive activity, assessed by reproductive frequency (Fr=number of days with presence of ichthyoplankton/number of days in the period evaluated X 100 and larval density (Dl=larval/m3. Results. The daily values of Qriver ranged between 278.7 and 838.5 m3/s, ΔQriver between 0.0 and 100.7 m3/s, Vriver between 1.40 and 1.53 m/s, Pluv between 0.0 and 88.2 mm, Triver between 27.0 and 28.7°C, STD between 73.0 and 302.3 mg/L, Turb between 9.7 and 679.7 NTU, CE between 81.0 and 361.7 mS/cm, Bs between 0.0 and 11.2 hours, Nub between 2.0 and 7.3 octaves. The Fr was 30.4%, with April (40.0% and May (74.2% as the higher activity reproductive months, while the Dl in the season was 4.9 larvae/m3, with the larvae group other species (2.9 larvae/m3 and bocachico (1.8 larvae/m3 as the most abundant. Conclusions. Most reproductive activity was recorded early in the season (April and May and parameters such as Qriver, Triver, Vriver, Pluv, STD and Nub may be considered final factors associated with migratory fish reproduction.

  19. Nuclear abnormalities in erythrocytes and morphometric indexes in the catfish Cathorops spixii (Ariidae from different sites on the southeastern Brazilian coast

    Directory of Open Access Journals (Sweden)

    Juliana de Souza Azevedo

    2012-09-01

    Full Text Available Nuclear abnormalities in erythrocytes (NAE were taken as biomarkers in the catfish Cathorops spixii (Ariidae sampled in an estuary little affected by human activity (Cananéia and in three regions (Santos Channel: SC, Santos Bay: SB and São Vicente Channel: SVC of the Santos-São Vicente estuary impacted by various anthropogenic activities. Increases in NAE were observed in fish from SC and SVC sampled in the summer period as compared with specimens from the Cananéia estuary. These results suggest the presence of genotoxic compounds in these regions. However, the absence of significant differences in micronuclei frequency reflects slight mutagenic effects in these individuals. It is possible that the lower NAE frequency in specimens from SB might be associated with the greater remobilization and dilution of chemicals in this region. The low frequency of NAE in C. spixii from the Cananéia estuary is in accordance with the slight anthropogenic influence in this system, and may be suggestive of the absence of genotoxic and mutagenic effects in these organisms.Alterações nucleares eritrocitárias (ANE foram consideradas como biomarcadores nos bagres Cathorops spixii (Ariidae amostrados em um estuário com baixa influência humana (Cananéia e em três regiões (Canal de Santos: CS, Baía de Santos: BS e Canal de São Vicente: CSV no estuário de Santos-São Vicente, impactado por diversas atividades antropogênicas. Aumentos nas ANE foram observados nos peixes amostrados no CS e CSV durante o período de verão, quando comparados com os espécimes do estuário de Cananéia. Estes resultados sugerem a presença de compostos genotóxicos nessas regiões. Entretanto, ausência de diferenças significativas na freqüência de micronúcleos refletem baixos efeitos mutagênicos nesses indivíduos. As menores freqüências de ANE nos espécimes amostrados na BS podem estar associado à maior remobilização e diluição dos compostos químicos na regi

  20. Arius kesslerl & Sciadeops troschelii (Pisces: Ariidae growth in floating net cages in estuarine waters of Buenventura Bay-Colombia Crecimiento de Arius kekkleri y Sciadeops troschelli (Pises: Ariidae en jaulas flotantes en zonas estuarinas de la bahía de Buenaventura

    Directory of Open Access Journals (Sweden)

    Arroyo Rafael

    1999-11-01

    Full Text Available

    Two species of estuary catfish the Arius kessleri (CoCoCo and the Sciadeops troschelii (Nato were held in floating net cages at varying densities in estuarine waters of Buenventura Bay-Colombia. After 120 days for the Cococo had weights of 84.1 g Y64 g with densities of 5 and 30 specimen/rn'. The growth average was 0.58-0.39 g/day; the net yield obtained vary from 0.35 to 1.16 Kg/m', the food conversion ratio vary from 3.3 to 5.0 and de survival rate vary from 86% to 100%. With the Nato we obtained weights of 164 and 184 g, beginning with weights of 41 and 108 g their growth average vary from 0.50 to 0.82 g/day. The net yield obtained vary from 0.58 to 0.75 Kg/m' and the survival rate vary from 83% to 100%. From these results we conclude that the two species of catfish studied are strong species but they do not offer good possibilities for fish farming in estuarine waters.

    Dos especies de Bagres estuarinos Arius kessleri (CoCoCo y Sciadeops troschelii (Nato fueron criados en jaulas flotantes a densidades variables en zonas estuarinas de la bahía de Buenaventura. Después de 120 días, para el Cococo se obtuvieron pesos de 84.1 y 64 g a densidades de 5-30 individuos/rrr' con tasas de crecimiento de 0.58 a 0.39 g/día; las producciones netas obtenidas fluctúan entre 0.35-1.16 Kg/m', la supervivencia fluctúa entre 86-100% y las tasas de conversión de alimento f1uctuaron entre 3.3 y 5.0. El Nato alcanza pesos de 164 y 184 g a partir de pesos iniciales de 41 y 108 g; sus tasas de crecimiento f1uctuaron entre 0.50 y 0.82 g/día; las producciones netas obtenidas f1uctuaron entre 0.58 y 0.75 Kg/m', y sus supervivencias fluctuaron entre 83 y 100%. Se concluye que a pesar de su gran rusticidad y supervivencia, estas dos especies ofrecen poco potencial para ser criadas en jaulas en zonas estuarinas.

  1. Flujos de energía en el sistema de surgencia tropical de la península de la Guajira , Caribe colombiano

    Directory of Open Access Journals (Sweden)

    García Camilo Bernardo

    2004-12-01

    Full Text Available La Guajira es un sistema de surgencia explotado en el Caribe colombiano. Con el propósito de integrar la información disponible sobre el sistema se construyó un modelo trófico de 27 grupos funcionales usando el programa ECOPATH 5.0 Beta. Se obtuvo una base cuantitativa a través de la construcción del modelo, para compararlo con otros sistemas de surgencia. La Guajira presenta una biomasa total de 68 t/km2/año, la producción primaria neta del sistema es de 1248,51 t/km2/año y las transferencias totales del sistema son de 3.275 t/km2/año, lo que
    indica un ecosistema con una surgencia moderada comparada con otros sitios. Las mayores transferencias de energía se dan del nivel trófico I-II (68,93%, aunque existe una importante proporción de flujos al detritus (32%. Las flotas pesqueras afectan principalmente los recursos
    de las fracciones del nivel trófico III, la flota artesanal esta ejerciendo mayor presión sobre el pámpano, bonito y jurel, la flota parguera sobre pargos y meros y la flota industrial sobre las corvinas. Los resultados en los atributos de madurez del sistema sugieren que La Guajira es un
    ecosistema inmaduro debido a que la relación P/R excede a uno y está en desarrollo debido a la baja ascendencia (33,7% y alta capacidad de desarrollo (66,3% como ocurre con otras surgencias donde se presentan valores de ascendencia entre 20% y 35%. Aunque los datos básicos de entrada en el modelo fueron buenos, debido a las investigaciones que se han elaborado entre 1995 y 2000, existen algunos grupos donde no se encuentra aun información disponible. Especialmente en los valores de biomasa del fitoplancton, invertebrados, bagres, peces depredadores
    pelágicos, así como estimaciones de producción en invertebrados, peces  depredadores pelágicos y peces pequeños pelágicos. No existe una cuantificación de las poblaciones de mamíferos y aves en el área de estudio, los cuales constituyen depredadores

  2. Sciades herzbergii oxidative stress biomarkers: an in situ study of an estuarine ecosystem (São Marcos' Bay, Maranhão, Brazil

    Directory of Open Access Journals (Sweden)

    Raimunda Nonata Fortes Carvalho-Neta

    2010-01-01

    Full Text Available In order to study the effects of environmental contamination on wild fish, sites were sampled in São Marcos' Bay. The first is located near the ALUMAR/ALCOA port, a potentially contaminated area. The second, located near the Coqueiro beach, was used as a reference area. The activity of antioxidant defence catalase (CAT and glutathione S-transferase (GST in S. herzbergii was compared with the biometric data and gonadosomatic index (GSI. The result showed that GSI decreased significantly in females (pO objetivo desse trabalho foi estudar os efeitos da contaminação ambiental em peixes amostrados em dois locais da Baía de São Marcos. O primeiro ponto está localizado próximo ao porto da ALUMAR/ALCOA, considerado como uma área potencialmente contaminada. O segundo ponto, situado na praia do Coqueiro, foi usado como uma área de referência. Dados da atividade da enzima de defesa antioxidante catalase (CAT e da glutationa S-transferase (GST em S. herzbergii foram comparados com os dados biométricos e o índice gonadossomático (GSI. Resultados mostraram que o GSI diminuiu significativamente em fêmeas (p <0.05 no local contaminado. A atividade da CAT foi mais alta nos peixes do local contaminado. Uma diferença significativa foi observada na atividade de GST de S. herzbergii no local contaminado e no local de referência (p <0.05. GSI possibilitou uma nova abordagem quanto à natureza da resposta de destoxificação nessa espécie de bagre porque este índice não apresentou correlação com as enzimas no local potencialmente contaminado, mas apresentou no local de referência. Assim, sugere-se que a boa correlação da GST/CAT e GSI poderia estar relacionada à reprodução dos animais no local de referência, mas não no local potencialmente contaminado. Se esse for o caso, pode-se concluir que GST/CAT e GSI podem ser utilizados como bons biomarcadores para avaliar contaminação aquática.

  3. Characterization of an IgG monoclonal antibody targeted to both tissue cyst and sporocyst walls of Toxoplasma gondii.

    Science.gov (United States)

    Gondim, Luís F P; Wolf, Alexander; Vrhovec, Majda G; Pantchev, Nikola; Bauer, Christian; Langenmayer, Martin C; Bohne, Wolfgang; Teifke, Jens P; Dubey, Jitender P; Conraths, Franz J; Schares, Gereon

    2016-04-01

    Toxoplasma gondii infects animals habiting terrestrial and aquatic environments. Its oocysts and tissue cysts are important for the horizontal transmission of this parasite. The oocyst and tissue cyst walls are crucial for the ability of the parasite to persist in the environment or in animal tissues, respectively. However, the composition of these walls is not well understood. We report the generation of monoclonal antibodies directed against wall components using mice immunized with oocyst antigens of T. gondii. One monoclonal antibody (mAb) G1/19 reacted solely with T. gondii sporozoites. The respective antigen had a relative molecular weight (Mr) of 30 kDa. MAb G1/19 failed to react with sporozoites of any other coccidian parasite species tested (Hammondia hammondi, Hammondia heydorni, Cystoisospora felis, Eimeria bovis, Sarcocystis sp.). Another mAb, designated K8/15-15, recognized antigens in sporocyst walls of the parasite and in the walls of in vivo or in vitro produced tissue cysts, as demonstrated by immunofluorescence and immunoblot assays. Antigens of 80 to a high molecular weight protein of about 350 kDa Mr were recognized by this antibody using antigen extracts from sporocysts, and from in vitro or in vivo generated tissue cysts of the parasite. Tissue cyst and sporocyst walls of H. hammondi and H. heydorni, and tissue cysts of Neospora caninum were also recognized by mAb K8/15-15. Sporocyst walls of C. felis also reacted to this mAb. The cyst walls of Sarcocystis sp. and Besnoitia besnoiti were not recognized by mAb K8/15-15. Reactivity by a single mAb against T. gondii antigens in tissue cysts and sporocysts had not been reported previously. MAb K8/15-15 may be a practical tool for the identification of both cysts and sporocysts of the parasite, and may also be potentially employed in proteomic studies on the identification of new components of the cyst and sporocyst walls of T. gondii. PMID:26836446

  4. Prophylactic treatment of flea-infested cats with an imidacloprid/flumethrin collar to forestall infection with Dipylidium caninum

    Directory of Open Access Journals (Sweden)

    Fourie Josephus J

    2012-07-01

    Full Text Available Abstract Background The objective of the study was to determine the sustained effectiveness of 10% imidacloprid (w/w and 4.5% flumethrin (w/w incorporated in a slow-release matrix collar in preventing Dipylidium caninum infection in cats following repeated laboratory-infestations with fleas infected with metacestodes. Methods Efficacy against infection with D. caninum was evaluated by infesting 16 cats with the flea Ctenocephalides felis felis infected with metacestodes of the tapeworm. Medicated collars were fitted to 8 of the cats and infestation of each cat with 200 fleas from a suitably infected batch commenced 7 days later and continued at weekly intervals until Day 28. Efficacy against fleas was evaluated 24 h after each infestation. Infection of the cats with D. caninum was verified by daily examination of the cats’ faeces and immediate surroundings for proglottids from Day 21 to Day 60. Calculation of the prophylactic effectiveness of the collars in preventing infection of the cats with D. caninum was based on the difference in the geometric mean number of scoleces recovered from the gastrointestinal tracts of collared compared to untreated cats at necropsy on Day 61. Results Efficacy of the collars against infestation of the cats with fleas was 99.9% on Day 7 and 100% at each subsequent weekly assessment. Infection of the fleas with metacestodes was ≥40% in 7 to 13 day old fleas, but progressively decreased thereafter. At necropsy all the control cats were infected with D. caninum and harboured between 19 and 346 scoleces with a geometric mean of 58.3. A single treated cat was infected and harboured 2 scoleces. Effective prevention of infection with D. caninum, based on a comparison of the geometric mean numbers of scoleces recovered from control and treated cats, was 99.7%. Conclusion The insecticidal components of the medicated collars are capable of rapidly eliminating newly-acquired infestations of fleas that are infected

  5. Uso da técnica de Southern Blot/Hibridização associada à reação em cadeia da polimerase para aumentar a sensibilidade no diagnóstico das infecções por hemoplasmas em gatos domésticos: Use of Southern Blot/Hybridization technique associated to polymerase chain reaction to improve the sensitivity in the diagnosis of hemoplasma infections in domestic cats

    Directory of Open Access Journals (Sweden)

    Daniel B. Macieira

    2009-12-01

    Full Text Available O objetivo deste trabalho foi verificar se a técnica de Southern Blot/Hibridização (SB em associação à reação de polimerização em cadeia (PCR aumenta a sensibilidade na detecção de DNA de hemoplasmas em gatos domésticos (Felis catus. O sangue total foi coletado em tubos contendo o anticoagulante ácido etilenodiamino tetra-acético, o DNA extraído a partir de 149 animais e a PCR realizada com o uso de sequências iniciadoras espécie-específicas, para amplificar subunidade 16S do RNA ribossomal de Mycoplasma haemofelis e 'Candidatus M. haemominutum' dessas amostras. Para a hibridização, foram utilizadas sondas específicas quimicamente marcadas, e os resultados visualizados por meio da adição de substrato quimiluminescente seguida de autoradiografia. Dezoito (12,1% das 149 amostras testadas apresentaram resultado PCR-positivo para o DNA de hemoplasmas. A técnica de SB mostrou que 24/149 (16,1% amostras apresentaram resultado positivo para hemoplasmas, confirmando os 18 resultados PCR-positivos, além de revelar seis outros adicionais (p The aim of this study was to determine whether Southern Blot/Hybridization (SB associated to Polymerase Chain Reaction (PCR improves the sensitivity in the detection of hemoplasma DNA in domestic cats (Felis catus. Whole blood was collected in tubes containing the anticoagulant ethylenediamine tetra-acetic acid and DNA extracted from 149 animals. PCR was performed using species specific primers to amplify the 16S ribosomal RNA subunit of Mycoplasma haemofelis and 'Candidatus M. haemominutum' from these samples. Hybridization was performed using a 16S rDNA probes chemically labeled and the results were visualized using a chemiluminescent substrate addition followed by autoradiography. Eighteen (12.1% of the 149 tested samples had a positive PCR result for hemoplasma species DNA. SB/hybridization technique showed that 24/149 (16.1% samples were positive for hemoplasmas, confirming the 18 PCR

  6. Cortisol influence on testicular testosterone secretion in domestic cat: An in vitro study Ação do cortisol sobre a secreção de testosterona em testículos de gato doméstico: um estudo in vitro

    Directory of Open Access Journals (Sweden)

    Gelson Genaro

    2010-10-01

    Full Text Available The aim of the present experiment was to investigate the effect of corticosteroids (exogen on in vitro testosterone secretion after stress by transportation (40 minutes. Feline testes (Felis silvestris catus were incubated in the following media: TCM 199; TCM 199 + hCG 10_7M; TCM 199 + hydrocortisone 10_7M, or TCM 199 + hCG + hydrocortisone. The animals (n=21 were allocated into three groups: (S that arrived at 3 h prior to surgery, (A that remained in the laboratory for 36 h before being submitted to surgical procedure, and (C that were also allowed to remain for 36 hours in the laboratory before the surgical procedure, but whose testes had been incubated with hydrocortisone prior to incubation in the referred media. The results showed that group S secreted higher levels of testosterone, regardless of the culture media. It is noteworthy that the suppressing action of hydrocortisone sodium succinate led to a reduction in the testosterone concentration, despite the presence of hCG.O objetivo deste trabalho foi investigar o efeito da hidrocortisona sobre a secreção de testosterona após cultivo in vitro dos testículos, em distintas situações de estresse (transporte de gatos domésticos (Felis silvestris catus. Testículos foram incubados nos seguintes meios de cultura: TCM 199; TCM 199 + hCG 10_7M; TCM 199 + hydrocortisona 10_7M e TCM 199 + hCG + hidrocortisona. Os animais (n=21 foram alocados em 3 sub-grupos: (S animal admitido 3 horas antes da orquiectomia, (A animais orquiectomizados após 36 horas de permanência no biotério e (C animais que permaneceram por 36 horas no biotério antes da cirurgia e que tiveram seus testículos pré-incubados em hidrocortisona. Os resultados demonstraram que o grupo S secretou maiores valores de testosterona em todas as condições estudadas. É válido mencionar que a supressão promovida pela hidrocortisona também promoveu redução na concentração de testosterona no meio TCM 199, a despeito da

  7. Parasitos de aves e mamíferos silvestres em cativeiro no estado de Pernambuco

    Directory of Open Access Journals (Sweden)

    Pauline Marie de Souza Santos

    2015-09-01

    Full Text Available Resumo: Os animais silvestres são hospedeiros de uma grande variedade de parasitos que podem interferir em sua conservação ex situ. O objetivo deste estudo foi identificar os parasitos gastrointestinais (PGI e ectoparasitos dos animais do Centro de Triagem de Animais Silvestres (CETAS do Instituto Brasileiro de Meio Ambiente e Recursos Naturais Renováveis (IBAMA de Recife, Pernambuco, além de determinar os aspectos do manejo em cativeiro que possam estar relacionados com os parasitos identificados. Foram coletados ectoparasitos e amostras fecais de 223 aves e mamíferos, as quais foram processadas pelos métodos: microscopia direta, flutuação e sedimentação. Helmintos e/ou protozoários foram detectados em 91 (40,8% amostras fecais, sendo 64 (70,3% de aves e 27 (29,7% de mamíferos. Ovos de Capillaria sp., Ascaridida, Spirurida e oocistos de Eimeria sp. foram detectados nas amostras fecais das aves, enquanto ovos de Trichuris trichiura, Strongyloides sp., Toxocara canis, Ancylostoma sp., Strongylida e oocistos de Coccídios foram encontrados nas amostras fecais de mamíferos. Os ectoparasitos identificados em aves foram Colpocephalum turbinatum, Kurodaia (Kurodaia fulvofasciata, Halipeurus sp., Naubates sp., Saemundssonia sp., Austromenopon sp., Paragoniocotes sp., Brueelia sp., Myrsidea sp. and Pseudolynchia sp., enquanto em mamíferos os ectoparasitos identificados foram Rhipicephalus sanguineus, Amblyomma varium, A. calcaratum, A. nodosum, Ornithodoros talaje e Ctenocephalides felis felis. A. calcaratum e O. talaje são registrados pela primeira vez em Pernambuco e T. tetradactyla é apresentado como novo hospedeiro de O. talaje. Nenhum dos animais estudados apresentou sinais clínicos em decorrência da infecção/infestação parasitária. Parasitos com potencial zoonótico como T. trichiura, Strongyloides sp., T. canis e Ancylostoma sp. foram identificados em primatas não humanos e carnívoros. Precárias condições estruturais

  8. Predation on dormice in Italy

    Directory of Open Access Journals (Sweden)

    Dino Scaravelli

    1995-05-01

    Full Text Available Abstract The authors analyse available data on the impact of predators on Dormouse populations in Italy. Dormice are found in the diet of 2 snakes (Vipera berus and V. aspis, 2 diurnal birds of prey (Buteo buteo and Aquila chrysaetos, 6 owls (Tyto alba, Strix aluco, Asio otus, Athene noctua, Bubo bubo and Glaucidium passerinum and 9 mammals (Rattus rattus, Ursus arctos, Canis lupus, Vulpes vulpes, Martes martes, M. foina, Meles meles, Felis silvestris and Sus scrofa in a variable percentage of the prey taken. Only Dryomys nitedula was never encountered as a prey item. The most common prey is Muscardinus avellanarius. There are significative regional differences in predation between bioclimatic areas of the Italian peninsula. The contribution of studies on predation to knowledge of Myoxid distribution is discussed. Riassunto Predazione di Mioxidi in Italia - Sono analizzati i dati pubblicati sull'impatto dei predatori sulle popolazioni di Myoxidae in Italia. Myoxidae sono stati riscontrati nelle diete di 2 serpenti (Vipera berus e V. aspis, 2 rapaci diurni (Buteo buteo e Aquila chrysaetos, 6 notturni (Tyto alba, Strix aluco, Asio otus, Athene noctua, Bubo bubo e Glaucidium passerinum e 9 mammiferi (Rattus rattus, Ursus arctos, Canis lupus, Vulpes vulpes, Martes martes, M foina, Meles meles, Felis silvestris e Sus scrofa in percentuale variabile nella comunità di prede. Solo Dryomys nitedula non è mai stato incontrato come preda. La specie piu comunemente predata risulta Muscardinus avellanarius. Sono discusse le

  9. Central Tropical Pacific SST and Salinity Variability over the Little Ice Age

    Science.gov (United States)

    Sayani, H. R.; Cobb, K. M.; Khare, A.; Stone, C.; Grothe, P. R.; Chen, T.; Cheng, H.; Lu, Y.; Edwards, R. L.

    2015-12-01

    Anthropogenic trends are difficult to separate from natural variability in the tropical Pacific, where instrumental data coverage is sparse. Of particular interest are variations of climate in the pre-industrial era, but instrumental data from this time period is virtually nonexistent. Corals allow for the investigation of pre-industrial climate variability, but most living coral colonies rarely span more than a century. Fossil corals provide a valuable archive of climate variability over the past millennia [Cobb et al., 2013] and are best suited to the reconstruction of ENSO. For the reconstruction of mean climate, systematic offsets between proxy records from contemporaneous corals translates to large error bars on the resulting reconstructions [e.g. Felis et al., 2003; Pfeiffer et al., 2009]. By building composite paleoclimate records using multiple corals from the Line Islands (2°N - 6°N, 157°W - 162°W), we quantify mean climate state and climate variability in the central tropical Pacific (CTP) during the Little Ice Age (LIA). We compare paired d18O and Sr/Ca records from Line Island fossil corals to a large collection of modern coral d18O and Sr/Ca records from the same islands to estimate SST and salinity changes from the LIA to the late 20th century. Taken together, Sr/Ca records from three Palmyra Atoll fossil corals spanning 1630-1703CE suggest CTP temperatures may have been 1.7±0.9˚C cooler during much of the 17th century. Reconstructed seawater d18O values are indicative of drier conditions at Palmyra, consistent with a southward shift of the ITCZ during the LIA documented in sediments from the Line Islands [Sachs et al., 2009]. We compare the results from seven LIA-dated fossil corals from nearby Christmas Island (Kiritimati; 2˚N, 157˚W) to the results obtained from Palmyra, enabling us to resolve potential shifts in the meridional gradients of SST and hydrology in this region during the LIA. References:Cobb, K. M., et al. (2013) Science. doi

  10. The late Miocene Phractocephalus catfish (Siluriformes: Pimelodidae from Urumaco, Venezuela: additional specimens and reinterpretation as a distinct species

    Directory of Open Access Journals (Sweden)

    John G. Lundberg

    2003-12-01

    . However, the genus does not occur west or north of the Andes or Venezuelan coastal ranges. Recognizing the Urumaco Phractocephalus as a distinct species does not alter the obvious conclusion that this catfish marks a large river connection between the Caribbean coastal region and the Orinoco system during at least part of the Neogene. Other Urumaco fossils show this same biogeographic relationship.É descrita uma nova espécie fóssil de bagre pimelodídeo proveniente da Formação Urumaco do Mioceno superior no estado Falcón, Venezuela. O exemplar fóssil foi originalmente atribuído a espécie recente Phractocephalus hemioliopterus. Porém, com base em exemplares fósseis adicionais provenientes da Formação Urumaco, essa espécie extinta é descrita como uma nova espécie. As características diagnósticas da nova espécie †Phractocephalus nassi são as seguintes: 1 a metade posterior do frontal e a metade anterior do supraocciptal apresentam uma ornamentação caracterizada por altos relevos e sulcos alongados, assim como reticulações e algumas depressões subcirculares; 2 o mesetmóide é muito largo e está ornamentado; 3 a margem do etmóide lateral é convexa, não apresenta o entalhe orbital e não se projeta anteriormente sobre o côndilo palatino; 4 a fontanela cranial anterior está fechada e forma uma pequena depressão; 5 a margem do processo supraoccipital é redonda lateral e posteriormente, e cobre completamente o complexo de Weber quando visto dorsalmente; 6 o opérculo está ornamentado com reticulações e depressões; 7 o cleitro encontra-se densamente ornamentado ao longo da margem ventral da área de articulação do espinho peitoral; 8 o espinho peitoral encontra-se ornamentado com estrias e sulcos. †Phractocephalus nassi é comparada com a espécie recente P. hemioliopterus e com outra especie fóssil da Formação Solimões do Mioceno superior do Acre no Brasil, a qual ainda não foi descrita. Apresentam-se novas características diagn

  11. La malaria en Colombia, Antioquia y las zonas de Urabá y Bajo Cauca: panorama para interpretar la falla terapéutica antimalárica. Parte 1

    Directory of Open Access Journals (Sweden)

    Jaime Cardona Fonseca

    2003-03-01

    Full Text Available Antecedentes y Problema: en 1998-2002 se investigó en Antioquia (Turbo, Zaragoza y El Bagre, la eficacia terapéutica de medicamentos y combinaciones antimaláricos. La interpretación de la respuesta terapéutica (adecuada, fallas precoz y tardía requiere información adicional para una mejor comprensión. Objetivo: definir un marco de referencia para interpretar los resultados de las evaluaciones de respuesta terapéutica antimalárica, constituido por información sobre el comportamiento de los programas antimaláricos en Colombia y por información demográfica, epidemiológica, climatológica y socioeconómica sobre el departamento de Antioquia, las regiones de Urabá y Bajo Cauca y los municipios de Turbo y El Bagre. Metodología: se usó información oficial secundaria y en menor cantidad, información primaria. Con los datos recogidos se construyeron cuadros y gráficos, y se hicieron cálculos sobre otras variables. Resultados: se describe la malaria (paludismo en Colombia en 1960-2002. En 2002, de los 43,707 millones de habitantes, 22,403 millones (51,17% están expuestos (41,88% con bajo riesgo. El P. vivax es la especie predominante (66% de los casos, excepto en la región del Pacífico, donde el P. falciparum causa el 75% de los casos. Hay brotes de malaria cada 2 a 7 años; la más intensa epidemia en la historia conocida ocurrió en 1998. La mortalidad ha pasado de 25 por cien mil en 1983 a 3 por cien mil en 2000. El índice parasitario anual (IPA ha estado alrededor de 8 por mil expuestos después de 1990, valor que es el cuádruple del existente en 1960-1970. La ineficacia del programa ha sido evidente casi desde su inicio en 1958 y la tendencia de la enfermedad siempre ha sido creciente. El fracaso de los programas gubernamentales antimalaria no tiene origen en fenómenos principalmente biológicos (resistencias del plasmodio a los medicamentos y del anofeles a los insecticidas, ni tampoco en las “condiciones de orden p

  12. Principles underlying sensory map topography in primary visual cortex.

    Science.gov (United States)

    Kremkow, Jens; Jin, Jianzhong; Wang, Yushi; Alonso, Jose M

    2016-05-01

    The primary visual cortex contains a detailed map of the visual scene, which is represented according to multiple stimulus dimensions including spatial location, ocular dominance and stimulus orientation. The maps for spatial location and ocular dominance arise from the spatial arrangement of thalamic afferent axons in the cortex. However, the origins of the other maps remain unclear. Here we show that the cortical maps for orientation, direction and retinal disparity in the cat (Felis catus) are all strongly related to the organization of the map for spatial location of light (ON) and dark (OFF) stimuli, an organization that we show is OFF-dominated, OFF-centric and runs orthogonal to ocular dominance columns. Because this ON-OFF organization originates from the clustering of ON and OFF thalamic afferents in the visual cortex, we conclude that all main features of visual cortical topography, including orientation, direction and retinal disparity, follow a common organizing principle that arranges thalamic axons with similar retinotopy and ON-OFF polarity in neighbouring cortical regions. PMID:27120164

  13. Epidemiological observations on spongiform encephalopathies in captive wild animals in the British Isles.

    Science.gov (United States)

    Kirkwood, J K; Cunningham, A A

    1994-09-24

    Since 1986, scrapie-like spongiform encephalopathy has been diagnosed in 19 captive wild animals of eight species at or from eight zoological collections in the British Isles. The affected animals have comprised members of the family Bovidae: one nyala (Tragelaphus angasi), four eland (Taurotragus oryx), and six greater kudu (Tragelaphus strepsiceros), one gemsbok (Oryx gazella), one Arabian oryx (Oryx leucoryx), and one scimitar-horned oryx (Oryx dammah), and members of the family Felidae: four cheetah (Acinonyx jubatus) and one puma (Felis concolor). In addition, three cases of a spongiform encephalopathy of unknown aetiology have been reported in ostriches (Struthio camellus) from two zoos in north west Germany. Three features suggest that some of these cases may have been caused by the agent of bovine spongiform encephalopathy (BSE). First, they have been temporally and geographically coincident with the BSE epidemic. Secondly, in all the ungulates for which details are available, it is possible that either the affected animal itself, or the herd into which it was born or moved, had been exposed to proprietary feeds containing ruminant-derived protein or other potentially contaminated material, and all the carnivores had been fed parts of cattle carcases judged unfit for human consumption. Thirdly, the pathological results of inoculating mice with a homogenate of fixed brain tissue from the nyala and from one greater kudu were similar to the results of inoculating mice with BSE brain tissue. PMID:7817514

  14. Evolutionary dynamics of endogenous feline leukemia virus proliferation among species of the domestic cat lineage

    International Nuclear Information System (INIS)

    Endogenous feline leukemia viruses (enFeLVs) occur in the germ lines of the domestic cat and related wild species (genus Felis). We sequenced the long terminal repeats and part of the env region of enFeLVs in domestic cats and five wild species. A total of 305 enFeLV sequences were generated across 17 individuals, demonstrating considerable diversity within two major clades. Distinct proliferations of enFeLVs occurred before and after the black-footed cat diverged from the other species. Diversity of enFeLVs was limited for the sand cat and jungle cat suggesting that proliferation of enFeLVs occurred within these species after they diverged. Relationships among enFeLVs were congruent with host species relationships except for the jungle cat, which carried only enFeLVs from a lineage that recently invaded the germline (enFeLV-AGTT). Comparison of wildcat and domestic cat enFeLVs indicated that a distinctive germ line invasion of enFeLVs has not occurred since the cat was domesticated.

  15. Cats of the Pharaohs: Genetic Comparison of Egyptian Cat Mummies to their Feline Contemporaries.

    Science.gov (United States)

    Kurushima, Jennifer D; Ikram, Salima; Knudsen, Joan; Bleiberg, Edward; Grahn, Robert A; Lyons, Leslie A

    2012-10-01

    The ancient Egyptians mummified an abundance of cats during the Late Period (664 - 332 BC). The overlapping morphology and sizes of developing wildcats and domestic cats confounds the identity of mummified cat species. Genetic analyses should support mummy identification and was conducted on two long bones and a mandible of three cats that were mummified by the ancient Egyptians. The mummy DNA was extracted in a dedicated ancient DNA laboratory at the University of California - Davis, then directly sequencing between 246 and 402 bp of the mtDNA control region from each bone. When compared to a dataset of wildcats (Felis silvestris silvestris, F. s. tristrami, and F. chaus) as well as a previously published worldwide dataset of modern domestic cat samples, including Egypt, the DNA evidence suggests the three mummies represent common contemporary domestic cat mitotypes prevalent in modern Egypt and the Middle East. Divergence estimates date the origin of the mummies' mitotypes to between two and 7.5 thousand years prior to their mummification, likely prior to or during Egyptian Predyanstic and Early Dynastic Periods. These data are the first genetic evidence supporting that the ancient Egyptians used domesticated cats, F. s. catus, for votive mummies, and likely implies cats were domesticated prior to extensive mummification of cats. PMID:22923880

  16. Distribution and Activity of Small Mammals on Pastoral Farmland and Forest in New Zealand

    Directory of Open Access Journals (Sweden)

    Carolyn Mary King

    2007-12-01

    Full Text Available We monitored the distribution and activity of small mammals on central North Island farmland continuously for 11 weeks in late summer and autumn 2005, using an automated monitoring device, the Scentinel®. Between 11 February and 29 April 2005 (1718 trap-nights, 1559 visits by small mammals, we documented extensive spatial and temporal variation in distribution and activity of small mammals. Hedgehogs (Erinaceus europaeus and rats (Rattus rattus were strictly nocturnal; ferrets (Mustela furo were mostly nocturnal, and feral cats (Felis catus were indifferent. The disappearance of ferrets during a standard control programme was well represented. Records of rats suddenly increased in early April, coinciding both with the removal of ferrets and with the maize harvest, which reduced cover in the fields. We repeated the trial with six Scentinels set in mixed podocarp/hardwood forest for 5 weeks in mid winter. Most (82% visits recorded between 26 May and 20 June 2005 (198 trap-nights, 690 visits by small mammals were by rats, all strictly nocturnal, but 9 visits by stoats (Mustela erminea were all diurnal.

  17. Reconciling actual and perceived rates of predation by domestic cats

    Science.gov (United States)

    McDonald, Jennifer L; Maclean, Mairead; Evans, Matthew R; Hodgson, Dave J

    2015-01-01

    The predation of wildlife by domestic cats (Felis catus) is a complex problem: Cats are popular companion animals in modern society but are also acknowledged predators of birds, herpetofauna, invertebrates, and small mammals. A comprehensive understanding of this conservation issue demands an understanding of both the ecological consequence of owning a domestic cat and the attitudes of cat owners. Here, we determine whether cat owners are aware of the predatory behavior of their cats, using data collected from 86 cats in two UK villages. We examine whether the amount of prey their cat returns influences the attitudes of 45 cat owners toward the broader issue of domestic cat predation. We also contribute to the wider understanding of physiological, spatial, and behavioral drivers of prey returns among cats. We find an association between actual prey returns and owner predictions at the coarse scale of predatory/nonpredatory behavior, but no correlation between the observed and predicted prey-return rates among predatory cats. Cat owners generally disagreed with the statement that cats are harmful to wildlife, and disfavored all mitigation options apart from neutering. These attitudes were uncorrelated with the predatory behavior of their cats. Cat owners failed to perceive the magnitude of their cats’ impacts on wildlife and were not influenced by ecological information. Management options for the mitigation of cat predation appear unlikely to work if they focus on “predation awareness” campaigns or restrictions of cat freedom. PMID:26306163

  18. First findings and prevalence of adult heartworms (Dirofilaria immitis) in wild carnivores from Serbia.

    Science.gov (United States)

    Penezić, Aleksandra; Selaković, Sanja; Pavlović, Ivan; Ćirović, Duško

    2014-09-01

    Heartworm (Dirofilaria immitis) is a parasitic roundworm that causes a zoonotic disease known as dirofilariosis. Little is known about the role of wild carnivores serving as reservoirs in nature. Therefore, we examined 738 hearts and lungs of free ranging wild carnivores from Serbia to determine the presence of adult heartworms. During the period 2009-2013, the prevalence in golden jackals (Canis aureus) was 7.32%, in red foxes (Vulpes vulpes) 1.55%, in wolves (Canis lupus) 1.43%, and in wild cats (Felis silvestris) 7.69%. No adult heartworm specimens were found in beech martens (Martes foina), stone martens (Martes martes), European polecats (Mustela putorius), badgers (Meles meles) or otter (Lutra lutra). The highest recorded prevalence was in 2013 (7.30%) and the lowest in 2012 (1.6%). In jackals, the prevalence was higher in males (10%) than in females (4.06%), while in foxes the prevalence was 1.75% in males and 1.26% in females. The most infected host was a wolf in which 37 adult specimens were found. Because of the potentially significant role in the life cycle of D. immitis, populations of wild carnivores in Europe should be further examined and tested for heartworm infections. PMID:24951168

  19. Toxoplasma gondii antibody prevalence and two new genotypes of the parasite in endangered Hawaiian Geese (nene: Branta sandvicensis)

    Science.gov (United States)

    Work, Thierry M.; Verma, Shiv K.; Su, Chunlei; Medeiros, John; Kaiakapu, Thomas; Kwok, Oliver C.; Dubey, Jitender P.

    2016-01-01

    Toxoplasma gondii is a protozoan parasite transmitted by domestic cats (Felis catus) that has historically caused mortality in native Hawaiian birds. To estimate how widespread exposure to the parasite is in nene (Hawaiian Geese, Branta sandvicensis), we did a serologic survey for T. gondii antibody and genetically characterized parasite DNA from the tissues of dead birds that had confirmed infections by immunohistochemistry. Of 94 geese sampled, prevalence on the island of Kauai, Maui, and Molokai was 21% (n=42), 23% (n=31), and 48% (n=21), respectively. Two new T. gondii genotypes were identified by PCR-restriction fragment length polymorphism from four geese, and these appeared segregated geographically. Exposure to T. gondii in wild nene is widespread and, while the parasite is not a major cause of death, it could have sublethal or behavioral effects. How to translate such information to implement effective ways to manage feral cats in Hawaii poses challenges.

  20. Diets of introduced predators using stable isotopes and stomach contents

    Science.gov (United States)

    Meckstroth, A.M.; Miles, A.K.; Chandra, S.

    2007-01-01

    In a study of predation on ground-nesting birds at South San Francisco Bay (South Bay), California, USA, we analyzed stomach contents and stable isotopes of carbon and nitrogen to identify commonly consumed prey. We obtained the stomach contents from 206 nonnative red foxes (Vulpes vulpes regalis) collected in the South Bay area and Monterey County during 1995-2001 and from 68 feral cats (Felis silvestris) from the South Bay area during 2001-2002. We determined prey identity, biomass, and frequency, described seasonal diet trends, and derived an Index of Relative Importance. Avian species were the most frequent prey we found in the stomachs of red foxes from South Bay (61%), whereas small rodents were most frequent for red foxes from Monterey County (62%). Small rodents were the most frequent prey we found in feral cats (63%). Carbon and nitrogen isotopic signatures for foxes supported stomach content findings. However, isotope results indicated that cats received a majority of their energy from a source other than rodents and outside the natural system, which differed from the stomach content analysis. We demonstrated the utility of both stable isotope and stomach content analyses to establish a more complete understanding of predators' diets. This information aids natural resource managers in planning and evaluating future predator-removal programs and increases our understanding of the impacts of nonnative foxes and cats on native species.

  1. Feline immunodeficiency virus in South America.

    Science.gov (United States)

    Teixeira, Bruno M; Hagiwara, Mitika K; Cruz, Juliano C M; Hosie, Margaret J

    2012-03-01

    The rapid emergence of AIDS in humans during the period between 1980 and 2000 has led to extensive efforts to understand more fully similar etiologic agents of chronic and progressive acquired immunodeficiency disease in several mammalian species. Lentiviruses that have gene sequence homology with human immunodeficiency virus (HIV) have been found in different species (including sheep, goats, horses, cattle, cats, and several Old World monkey species). Lentiviruses, comprising a genus of the Retroviridae family, cause persistent infection that can lead to varying degrees of morbidity and mortality depending on the virus and the host species involved. Feline immunodeficiency virus (FIV) causes an immune system disease in domestic cats (Felis catus) involving depletion of the CD4+ population of T lymphocytes, increased susceptibility to opportunistic infections, and sometimes death. Viruses related to domestic cat FIV occur also in a variety of nondomestic felids. This is a brief overview of the current state of knowledge of this large and ancient group of viruses (FIVs) in South America. PMID:22590677

  2. The carnivore remains from the Sima de los Huesos Middle Pleistocene site (Sierra de Atapuerca, Spain).

    Science.gov (United States)

    García, N; Arsuaga, J L; Torres, T

    1997-01-01

    Remains of carnivores from the Sima de los Huesos site representing at least 158 adult individuals of a primitive (i.e., not very speleoid) form of Ursus deningeri Von Reichenau 1906, have been recovered through the 1995 field season. These new finds extend our knowledge of this group in the Sierra de Atapuerca Middle Pleistocene. Material previously classified as Cuoninae indet, is now assigned to Canis lupus and a third metatarsal assigned in 1987 to Panthera of gombaszoegensis, is in our opinion only attributable to Panthera sp. The family Mustelidae is added to the faunal list and includes Martes sp. and a smaller species. The presence of Panthera leo cf. fossilis, Lynx pardina spelaea and Felis silvestris, is confirmed. The presence of a not very speloid Ursus deningeri, together with the rest of the carnivore assemblage, points to a not very late Middle Pleistocene age, i.e., oxygen isotope stage 7 or older. Relative frequencies of skeletal elements for the bear and fox samples are without major biases. The age structure of the bear sample, based on dental wear stages, does not follow the typical hibernation mortality profile and resembles a catastrophic profile. The site was not a natal or refuge den. The hypothesis that the site was a natural trap is the most plausible. If the Sima de los Huesos functioned as a natural trap (without an egress out), the human accumulation cannot be attributed to carnivore: activities and must be explained differently. PMID:9300340

  3. Detection of a Hepatozoon and spotted fever group Rickettsia species in the common marsupial tick (Ixodes tasmani) collected from wild Tasmanian devils (Sarcophilus harrisii), Tasmania.

    Science.gov (United States)

    Vilcins, Inger-Marie E; Old, Julie M; Deane, Elizabeth

    2009-05-26

    Tasmanian devils are the largest extant marsupial carnivores, confined to the Australian island state of Tasmania. The iconic marsupial has dramatically declined in number since the discovery of devil facial tumor disease in 1996 and efforts are being made to uncover vital information to assist in the long-term survival of the species. Ticks are the main vectors of arthropod-borne disease in animals, raising the question of whether Tasmanian devils may be host to arthropods capable of harboring infectious agents. Partially engorged ticks were collected from 35 wild Tasmanian devils and tested for the presence of a range of tick-borne genera. A spotted fever group Rickettsia was detected in 45.5% of samples of the tick Ixodes tasmani (n=44), from all trapping locations, sharing close sequence identity to members of the Rickettsia massiliae group. A Hepatozoon species was also identified in 34.1% of the same sample set, sharing sequence similarities to Hepatozoon felis, a known pathogen of felids. Dual detection was identified in 13.6% of tick samples, where prevalence of the two genera overlapped. The existence of two previously undetected species of genera known for containing pathogens identifies additional potential risks to the health of the devil population. PMID:19303711

  4. Enteric protozoa of cats and their zoonotic potential-a field study from Austria.

    Science.gov (United States)

    Hinney, Barbara; Ederer, Christina; Stengl, Carina; Wilding, Katrin; Štrkolcová, Gabriela; Harl, Josef; Flechl, Eva; Fuehrer, Hans-Peter; Joachim, Anja

    2015-05-01

    Domestic cats can be infected with a variety of enteric protozoa. Genotyping of protozoan species, especially Giardia as the most common, can improve assessment of their relevance as zoonotic agents. For an overview on the occurrence of feline enteric protozoa, 298 faecal samples of cats from private households, catteries and animal shelters in Austria were collected. All samples were examined by flotation and using a rapid test for Giardia (FASTest). For the detection of Tritrichomonas blagburni, freshly voided faeces (n = 40) were processed using a commercial culturing system (InPouch TF-Feline). Genotyping was done at the β-giardin gene loci (each sample) and triosephosphate isomerase gene loci (positive samples) for Giardia and at the 18S rRNA gene (positive samples) for Cryptosporidium. Thirty-seven samples (12.4%) were positive for Giardia by flotation and/or using a rapid test. Cryptosporidium was present in 1.7%, Cystoisospora in 4.0%, Sarcocystis in 0.3% and T. blagburni in 2.5% of the samples. Genotyping revealed Giardia cati, the potentially zoonotic Giardia duodenalis and Cryptosporidium felis. Most of the infected cats had no diarrhoea. Cats from shelters were significantly more often infected than owned cats (p = 0.01). When comparing Giardia detection methods, the rapid test had a higher sensitivity than flotation. Polymerase chain reaction (PCR) results were mostly independent from the other two tests. PMID:25762189

  5. A deletion in FOXN1 is associated with a syndrome characterized by congenital hypotrichosis and short life expectancy in Birman cats.

    Directory of Open Access Journals (Sweden)

    Marie Abitbol

    Full Text Available An autosomal recessive syndrome characterized by congenital hypotrichosis and short life expectancy has been described in the Birman cat breed (Felis silvestris catus. We hypothesized that a FOXN1 (forkhead box N1 loss-of-function allele, associated with the nude phenotype in humans, mice and rats, may account for the syndrome observed in Birman cats. To the best of our knowledge, spontaneous mutations in FOXN1 have never been described in non-human, non-rodent mammalian species. We identified a recessive c.1030_1033delCTGT deletion in FOXN1 in Birman cats. This 4-bp deletion was associated with the syndrome when present in two copies. Percentage of healthy carriers in our French panel of genotyped Birman cats was estimated to be 3.2%. The deletion led to a frameshift and a premature stop codon at position 547 in the protein. In silico, the truncated FOXN1 protein was predicted to lack the activation domain and critical parts of the forkhead DNA binding domain, both involved in the interaction between FOXN1 and its targets, a mandatory step to promote normal hair and thymic epithelial development. Our results enlarge the panel of recessive FOXN1 loss-of-function alleles described in mammals. A DNA test is available; it will help owners avoid matings at risk and should prevent the dissemination of this morbid mutation in domestic felines.

  6. Descriptive epidemiology of insects infesting domestic sheep (ovis aries) of district toba tek singh, punjab, pakistan

    International Nuclear Information System (INIS)

    During a cross-sectional prospective epidemiological survey, a total of 2412 sheep were screened for the prevalence of insects. Out of which, 333 (13.80%) were harbored for insects including lice (36.57%), fleas (3.23%) and flies (1.62%). Among the identified species of lice, Haematopinus spp. (44.14%) was predominant followed in order by Damalinia ovis (26.42%) and Linognathus spp. (17.71%). The flea Ctenocepahlides (Ct). felis was more common (4.50%) than Ct. canis (3.30%). Stomoxys calcitrans (3.90%) was the only prevalent specie of fly in the study area. Infestation rate was higher in young sheep (72.68%) as compared to adults (27.32%) and level of infestation was significantly higher in females (75.37%) than males (24.62%). Amongst various breeds of sheep, Cholistani (19.81%) had the highest prevalence followed by Kajli (13.49%), Thalli (12.94%) and Lohi (11.80%). Prevalence of flies (37%) and lice (47%) was highest in December and January, respectively; whereas,that of fleas (39%) reached a peak in April. Among various associated determinants, stall feeding, closed housing, tethered animals and non-cemented floor were found positively associated (P<0.05) with insect infestation. The results showed that insect abundance and the variety of genera were wide in this part of Pakistan. This also causes concern over the emergence of insect-borne diseases in domestic animals. (author)

  7. Serosurvey of Smooth Brucella, Leptospira spp. and Toxoplasma gondii in Free-Ranging Jaguars (Panthera onca) and Domestic Animals from Brazil.

    Science.gov (United States)

    Furtado, Mariana Malzoni; Gennari, Solange Maria; Ikuta, Cassia Yumi; Jácomo, Anah Tereza de Almeida; de Morais, Zenaide Maria; Pena, Hilda Fátima de Jesus; Porfírio, Grasiela Edith de Oliveira; Silveira, Leandro; Sollmann, Rahel; de Souza, Gisele Oliveira; Tôrres, Natália Mundim; Ferreira Neto, José Soares

    2015-01-01

    This study investigated the exposure of jaguar populations and domestic animals to smooth Brucella, Leptospira spp. and Toxoplasma gondii in the Cerrado, Pantanal and Amazon biomes of Brazil. Between February 2000 and January 2010, serum samples from 31 jaguars (Panthera onca), 1,245 cattle (Bos taurus), 168 domestic dogs (Canis lupus familiaris) and 29 domestic cats (Felis catus) were collected and analysed by rose bengal test for smooth Brucella, microscopic agglutination test for Leptospira spp. and modified agglutination test for T. gondii. Cattle populations from all sites (9.88%) were exposed to smooth Brucella, but only one jaguar from Cerrado was exposed to this agent. Jaguars captured in the Cerrado (60.0%) and in the Pantanal (45.5%) were seropositive for different serovars of Leptospira spp., cattle (72.18%) and domestic dogs (13.1%) from the three sites and one domestic cat from Pantanal were also seropositive for the agent. The most prevalent serotype of Leptospira spp. identified in jaguars from the Cerrado (Grippotyphosa) and the Pantanal (Pomona) biomes were distinct from those found in the domestic animals sampled. Jaguars (100%), domestic dogs (38.28%) and domestic cats (82.76%) from the three areas were exposed to T. gondii. Our results show that brucellosis and leptospirosis could have been transmitted to jaguars by domestic animals; and jaguars probably play an important role in the maintenance of T. gondii in nature. PMID:26605787

  8. Serosurvey of Smooth Brucella, Leptospira spp. and Toxoplasma gondii in Free-Ranging Jaguars (Panthera onca and Domestic Animals from Brazil.

    Directory of Open Access Journals (Sweden)

    Mariana Malzoni Furtado

    Full Text Available This study investigated the exposure of jaguar populations and domestic animals to smooth Brucella, Leptospira spp. and Toxoplasma gondii in the Cerrado, Pantanal and Amazon biomes of Brazil. Between February 2000 and January 2010, serum samples from 31 jaguars (Panthera onca, 1,245 cattle (Bos taurus, 168 domestic dogs (Canis lupus familiaris and 29 domestic cats (Felis catus were collected and analysed by rose bengal test for smooth Brucella, microscopic agglutination test for Leptospira spp. and modified agglutination test for T. gondii. Cattle populations from all sites (9.88% were exposed to smooth Brucella, but only one jaguar from Cerrado was exposed to this agent. Jaguars captured in the Cerrado (60.0% and in the Pantanal (45.5% were seropositive for different serovars of Leptospira spp., cattle (72.18% and domestic dogs (13.1% from the three sites and one domestic cat from Pantanal were also seropositive for the agent. The most prevalent serotype of Leptospira spp. identified in jaguars from the Cerrado (Grippotyphosa and the Pantanal (Pomona biomes were distinct from those found in the domestic animals sampled. Jaguars (100%, domestic dogs (38.28% and domestic cats (82.76% from the three areas were exposed to T. gondii. Our results show that brucellosis and leptospirosis could have been transmitted to jaguars by domestic animals; and jaguars probably play an important role in the maintenance of T. gondii in nature.

  9. Enteric protozoan parasites in stray cats in Kuwait with special references to toxoplasmosis and risk factors affecting its occurrence.

    Science.gov (United States)

    Abdou, Nadra-Elwgoud M I; Al-Batel, Maha K; El-Azazy, Osama M E; Sami, Attia M; Majeed, Qais A H

    2013-08-01

    In Kuwait, stray cats were surveyed for enteric protozoan infection using fecal examination and their sera were tested for Toxoplasma gondii IgG using indirect hemagglutination test (IHAT) as well as for feline immunodeficiency virus (FIV) antibodies and feline leukaemia virus (FeLV) antibodies using ELISA. Out of 240 fecal samples examined 22 (9.2%) were found to be infected with oocysts of four species of coccidian protozoa. Isopspora felis was the most predominant enteric protozoan parasite (7.1%), followed by T. gondii (2.1%), I. rivolta (1.6), Sarcocystis was only found in one case (0.4%). Juvenile cats ( 6 months old) had higher infection rate with oocyst of enteric protozoa than older cats (p-value 0.001). Sero-survey of 240 stray cats revealed that 19.6% were positive to T. gondii IgG. Toxoplasma sero-positivity was observed in higher number of adults compared to young cats suggests that with age the risk of exposure to T. gondii increases. While concurrent retroviral infections were not found to be associated with increased risk for developing T. gondii antibodies. PMID:24260809

  10. An investigation into the seroprevalence of Toxoplasma gondii, Bartonella spp., feline immunodeficiency virus (FIV), and feline leukaemia virus (FeLV) in cats in Addis Ababa, Ethiopia.

    Science.gov (United States)

    Tiao, N; Darrington, C; Molla, B; Saville, W J A; Tilahun, G; Kwok, O C H; Gebreyes, W A; Lappin, M R; Jones, J L; Dubey, J P

    2013-05-01

    Toxoplasma gondii and Bartonella spp. are zoonotic pathogens of cats. Feline immunodeficiency virus (FIV), and feline leukaemia virus (FeLV) are immunosuppressive viruses of cats that can affect T. gondii oocyst shedding. In this study, the prevalence of antibodies to T. gondii, Bartonella spp., FIV, as well as FeLV antigens were determined in sera from feral cats (Felis catus) from Addis Ababa, Ethiopia. Using the modified agglutination test, IgG antibodies to T. gondii were found in 41 (85.4%) of the 48 cats with titres of 1:25 in one, 1:50 in one, 1:200 in six, 1:400 in six, 1:800 in six, 1:1600 in eight, and 1:3200 in 13 cats. Toxoplasma gondii IgM antibodies were found in 11/46 cats tested by ELISA, suggesting recent infection. Antibodies to Bartonella spp. were found in five (11%) of 46 cats tested. Antibodies to FIV or FeLV antigen were not detected in any of the 41 cats tested. The results indicate a high prevalence of T. gondii and a low prevalence of Bartonella spp. infection in cats in Ethiopia. PMID:22857007

  11. Serosurvey for selected viral infections in free-ranging jaguars (Panthera onca) and domestic carnivores in Brazilian Cerrado, Pantanal, and Amazon.

    Science.gov (United States)

    Furtado, Mariana Malzoni; de Ramos Filho, José Domingues; Scheffer, Karin Corrêa; Coelho, Claudio José; Cruz, Paula Sônia; Ikuta, Cassia Yumi; Jácomo, Anah Tereza de Almeida; Porfírio, Grasiela Edith de Oliveira; Silveira, Leandro; Sollmann, Rahel; Tôrres, Natália Mundim; Ferreira Neto, José Soares

    2013-07-01

    We investigated the exposure of jaguar (Panthera onca) populations and domestic carnivores to selected viral infections in the Cerrado, Amazon, and Pantanal biomes of Brazil. Between February 2000 and January 2010, we collected serum samples from 31 jaguars, 174 dogs (Canis lupus familiaris), and 35 domestic cats (Felis catus). Serologic analyses for antibodies to rabies virus, canine distemper virus (CDV), feline immunodeficiency virus (FIV), and for feline leukemia virus (FeLV) antigen were conducted. The jaguars from Cerrado and Pantantal were exposed to rabies virus, while the jaguars from the Pantanal and the dogs from all three areas were exposed to CDV. Two cats from the Amazonian site were antigen-positive for FeLV, but no jaguars had FeLV antigen or FIV antibody. Canine distemper and rabies viruses should be carefully monitored and considered potential threats to these jaguar populations. Currently FIV and FeLV do not appear to represent a health threat for jaguar populations in this area. Domestic dogs and cats in these areas should be vaccinated, and the movement of domestic animals around protected areas should be restricted. PMID:23778599

  12. Feline immunodeficiency virus and feline leukemia virus infection in free-ranging guignas (Leopardus guigna) and sympatric domestic cats in human perturbed landscapes on Chiloé Island, Chile.

    Science.gov (United States)

    Mora, Mónica; Napolitano, Constanza; Ortega, René; Poulin, Elie; Pizarro-Lucero, José

    2015-01-01

    Feline immunodeficiency virus (FIV) and feline leukemia virus (FeLV) are two of the most common viruses affecting domestic cats (Felis catus). During the last two decades, reports show that both viruses also infect or affect other species of the family Felidae. Human landscape perturbation is one of the main causes of emerging diseases in wild animals, facilitating contact and transmission of pathogens between domestic and wild animals. We investigated FIV and FeLV infection in free-ranging guignas (Leopardus guigna) and sympatric domestic cats in human perturbed landscapes on Chiloé Island, Chile. Samples from 78 domestic cats and 15 guignas were collected from 2008 to 2010 and analyzed by PCR amplification and sequencing. Two guignas and two domestic cats were positive for FIV; three guignas and 26 domestic cats were positive for FeLV. The high percentage of nucleotide identity of FIV and FeLV sequences from both species suggests possible interspecies transmission of viruses, facilitated by increased contact probability through human invasion into natural habitats, fragmentation of guigna habitat, and poultry attacks by guignas. This study enhances our knowledge on the transmission of pathogens from domestic to wild animals in the global scenario of human landscape perturbation and emerging diseases. PMID:25380363

  13. Variability in assays used for detection of lentiviral infection in bobcats (Lynx rufus), pumas (Puma concolor), and ocelots (Leopardus pardalis)

    Science.gov (United States)

    Franklin, S.P.; Troyer, J.L.; TerWee, J.A.; Lyren, L.M.; Kays, R.W.; Riley, S.P.D.; Boyce, W.M.; Crooks, K.R.; VandeWoude, S.

    2007-01-01

    Although lentiviruses similar to feline immunodeficiency virus (FIV) are known to infect numerous felid species, the relative utility of assays used for detecting lentiviral infection has not been compared for many of these hosts. We tested bobcats (Lynx rufus), pumas (Felis concolor), and ocelots (Leopardus pardalis) for exposure to lentivirus using five different assays: puma lentivirus (PLV), African lion lentivirus (LLV), and domestic cat FIV-based immunoblots, a commercially available enzyme-linked immunosorbent assay (ELISA) kit, and nested polymerase chain reaction (PCR). Puma lentivirus immunoblots identified more seropositive individuals than the other antibody-detection assays. The commercial ELISA provided a fair ability to recognize seropositive samples when compared with PLV immunoblot for screening bobcats and ocelots, but not pumas. Polymerase chain reaction identified fewer positive samples than PLV immunoblot for all three species. Immunoblot results were equivalent whether the sample tested was serum, plasma, or whole blood. The results from this study and previous investigations suggest that the PLV immunoblot has the greatest ability to detect reactive samples when screening wild felids of North America and is unlikely to produce false positive results. However, the commercial ELISA kit may provide ap adequate alternative for screening of some species and is more easily adapted to field conditions. ?? Wildlife Disease Association 2007.

  14. The Population Origins and Expansion of Feral Cats in Australia.

    Science.gov (United States)

    Spencer, Peter B S; Yurchenko, Andrey A; David, Victor A; Scott, Rachael; Koepfli, Klaus-Peter; Driscoll, Carlos; O'Brien, Stephen J; Menotti-Raymond, Marilyn

    2016-03-01

    The historical literature suggests that in Australia, the domestic cat (Felis catus) had a European origin [~200 years before present (ybp)], but it is unclear if cats arrived from across the Asian land bridge contemporaneously with the dingo (4000 ybp), or perhaps immigrated ~40000 ybp in association with Aboriginal settlement from Asia. The origin of cats in Australia is important because the continent has a complex and ancient faunal assemblage that is dominated by endemic rodents and marsupials and lacks the large placental carnivores found on other large continents. Cats are now ubiquitous across the entire Australian continent and have been implicit in the range contraction or extinction of its small to medium sized (<3.5kg) mammals. We analyzed the population structure of 830 cats using 15 short tandem repeat (STR) genomic markers. Their origin appears to come exclusively from European founders. Feral cats in continental Australia exhibit high genetic diversity in comparison with the low diversity found in populations of feral cats living on islands. The genetic structure is consistent with a rapid westerly expansion from eastern Australia and a limited expansion in coastal Western Australia. Australian cats show modest if any population structure and a close genetic alignment with European feral cats as compared to cats from Asia, the Christmas and Cocos (Keeling) Islands (Indian Ocean), and European wildcats (F. silvestris silvestris). PMID:26647063

  15. Genomically intact endogenous feline leukemia viruses of recent origin.

    Science.gov (United States)

    Roca, Alfred L; Pecon-Slattery, Jill; O'Brien, Stephen J

    2004-04-01

    We isolated and sequenced two complete endogenous feline leukemia viruses (enFeLVs), designated enFeLV-AGTT and enFeLV-GGAG. In enFeLV-AGTT, the open reading frames are reminiscent of a functioning FeLV genome, and the 5' and 3' long terminal repeat sequences are identical. Neither endogenous provirus is genetically fixed in cats but polymorphic, with 8.9 and 15.2% prevalence for enFeLV-AGTT and enFeLV-GGAG, respectively, among a survey of domestic cats. Neither provirus was found in the genomes of related species of the Felis genus, previously shown to harbor enFeLVs. The absence of mutational divergence, polymorphic incidence in cats, and absence in related species suggest that these enFeLVs may have entered the germ line more recently than previously believed, perhaps coincident with domestication, and reopens the question of whether some enFeLVs might be replication competent. PMID:15047851

  16. Molecular detection of bacteria in the families Rickettsiaceae and Anaplasmataceae in northern crested caracaras (Caracara cheriway).

    Science.gov (United States)

    Erwin, John A; Fitak, Robert R; Dwyer, James F; Morrison, Joan L; Culver, Melanie

    2016-04-01

    Bacterial pathogens of the families Anaplasmataceae and Rickettsiaceae are often spread to humans or other animals from bites from infected arthropod hosts. Recently, an increasing number of studies have implicated migratory birds in the circulation of these pathogens through the spread of arthropod vectors. However, few studies have examined the potential for resident bird populations to serve as reservoirs for these zoonoses. In this study, we used nested PCRs of the GroESL and 17kDa genes to screen for Anaplasmataceae and Rickettsiaceae, respectively, in a resident population of the northern crested caracara (Caracara cheriway) from Florida (n=55). Additionally, a small number (n=6) of captive individuals from Texas were included. We identified one individual (1.64%) positive for Rickettsia felis and one (1.64%) positive for Ehrlichia chaffeensis; both these individuals were from Florida. Presence of these pathogens demonstrates that these birds are potential hosts; however, the low prevalence of infections suggests that these populations likely do not function as an ecological reservoir. PMID:26837860

  17. Distribución y Hospederos de pulgas (Siphonaptera en la Provincia de Ayabaca, Piura - 1999

    Directory of Open Access Journals (Sweden)

    Edwar J Pozo

    2005-10-01

    Full Text Available Estudio descriptivo transversal realizado en la provincia de Ayabaca (zona endémica de peste bubónica, departamento de Piura, Perú; con el objetivo de ampliar los conocimientos sobre las especies de pulgas presentes. Fueron colectados 10 152 especimenes de pulgas en 46 localidades pertenecientes a seis distritos de la provincia de Ayabaca (Suyo, Sapillica, Montero, Paimas, Lagunas y Ayabaca, entre los meses de enero a julio de 1999. El muestreo se realizó seleccionando para cada vivienda un mínimo de cinco ropas de cama y cinco cuyes (Cavia porcellus además de la totalidad de los roedores capturados en las viviendas y en el área silvestre. Ocho especies de pulgas fueron identificadas (Pulex irritans, Tiamastus cavicola, Polygenis litargus, Xenopsylla cheopis, Ctenocephalides felis, Craneopsylla minerva, Leptopsylla segnis y Cediopsylla spillmanni de éstas, P. irritans se reportó en todos los distritos muestreados, seguida de X. cheopis y P. litargus, encontradas en cinco de los seis distritos.

  18. Reconciling actual and perceived rates of predation by domestic cats.

    Science.gov (United States)

    McDonald, Jennifer L; Maclean, Mairead; Evans, Matthew R; Hodgson, Dave J

    2015-07-01

    The predation of wildlife by domestic cats (Felis catus) is a complex problem: Cats are popular companion animals in modern society but are also acknowledged predators of birds, herpetofauna, invertebrates, and small mammals. A comprehensive understanding of this conservation issue demands an understanding of both the ecological consequence of owning a domestic cat and the attitudes of cat owners. Here, we determine whether cat owners are aware of the predatory behavior of their cats, using data collected from 86 cats in two UK villages. We examine whether the amount of prey their cat returns influences the attitudes of 45 cat owners toward the broader issue of domestic cat predation. We also contribute to the wider understanding of physiological, spatial, and behavioral drivers of prey returns among cats. We find an association between actual prey returns and owner predictions at the coarse scale of predatory/nonpredatory behavior, but no correlation between the observed and predicted prey-return rates among predatory cats. Cat owners generally disagreed with the statement that cats are harmful to wildlife, and disfavored all mitigation options apart from neutering. These attitudes were uncorrelated with the predatory behavior of their cats. Cat owners failed to perceive the magnitude of their cats' impacts on wildlife and were not influenced by ecological information. Management options for the mitigation of cat predation appear unlikely to work if they focus on "predation awareness" campaigns or restrictions of cat freedom. PMID:26306163

  19. Species and geographical distribution of carnivores and small mammals in Sanjiangyuan region%三江源地区食肉动物和小型兽类的种类与分布

    Institute of Scientific and Technical Information of China (English)

    汪元忠; 李超; 吴克梅; 魏有文; 郭文涛

    2009-01-01

    Objective To know the species and distributions of carnivores and small mammals in Sanjiangyuan area.Methods The investigation was done by the night trap. Results There were many carnivores and small mammals in San jiang yuan, belonging to 4 orders, 11 Familys, 27 Genera and 51 species. Conclusion Marrnota himalayana, Microtus oeconornus, Mus musculus, Cricetulus longicaudatus, Ochotona curzoniae, Felis catus, Canis farailiaris, Vulpes vulpes, Vulpes corsac, Canis upus,Mustela eversmanni distributed widely in Sanjiangyuan Area. Marmota himalayana was the main host of nature plague foci in the Qinghai-Tibet plateau.%目的 了解三江源地区食肉动物和小型兽类的种类与分布.方法 整理收藏动物标本,查阅资料,采用鼠夹法调查.结果 在三江源地区有食肉动物和小型兽类4目ll科27属51种.结论 三江源地区喜马拉雅旱獭、根田鼠、小家鼠、长尾仓鼠、高原鼠兔、猫、犬、赤狐、沙狐、狼、艾鼬等广泛分布,其中喜马拉雅旱獭是青藏高原喜马拉雅旱獭鼠疫自然疫源地的主要宿主.

  20. Rickettsioses in Europe.

    Science.gov (United States)

    Portillo, Aránzazu; Santibáñez, Sonia; García-Álvarez, Lara; Palomar, Ana M; Oteo, José A

    2015-01-01

    Bacteria of the genera Rickettsia and Orientia (family rickettsiaceae, order rickettsiales) cause rickettsioses worldwide, and are transmitted by lice, fleas, ticks and mites. In Europe, only Rickettsia spp. cause rickettsioses. With improvement of hygiene, the risk of louse-borne rickettsiosis (epidemic typhus) is low in Europe. Nevertheless, recrudescent form of Rickettsia prowazekii infection persists. There could be an epidemic typhus outbreak if a body lice epidemic occurs under unfavorable sanitary conditions. In Europe, endemic typhus or Rickettsia typhi infection, transmitted by rats and fleas, causes febrile illness. At the beginning of this century, flea-borne spotted fever cases caused by Rickettsia felis were diagnosed. Flea-borne rickettsiosis should be suspected after flea bites if fever, with or without rash, is developed. Tick-borne rickettsioses are the main source of rickettsia infections in Europe. Apart from Rickettsia conorii, the Mediterranean Spotted Fever (MSF) agent, other Rickettsia spp. cause MSF-like: Rickettsia helvetica, Rickettsia monacensis, Rickettsia massiliae or Rickettsia aeschlimannii. In the 1990s, two 'new' rickettsioses were diagnosed: Lymphangitis Associated Rickettsiosis (LAR) caused by Rickettsia sibirica mongolitimonae, and Tick-Borne Lymphadenopathy/Dermacentor-Borne-Necrosis-Erythema-Lymphadenopathy/Scalp Eschar Neck Lymphadenopathy (TIBOLA/DEBONEL/SENLAT), caused by Rickettsia slovaca, Candidatus Rickettsia rioja and Rickettsia raoultii. Lastly, European reports about mite-borne rickettsiosis are scarce. PMID:26384814