Potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae) is a key pest of potato (Solanum tuberosum L., Solanales: Solanaceae) and a vector of "Candidatus Liberibacter solanacearum," the pathogen associated with zebra chip disease. In addition to its presence on cultivated crops, the p...
Directory of Open Access Journals (Sweden)
Fengnian Wu
Full Text Available Potato psyllid (Bactericera cockerelli is an important pest of potato, tomato and pepper. Not only could a toxin secreted by nymphs results in serious phytotoxemia in some host plants, but also over the past few years B. cockerelli was shown to transmit "Candidatus Liberibacter solanacearum", the putative bacterial pathogen of potato zebra chip (ZC disease, to potato and tomato. ZC has caused devastating losses to potato production in the western U.S., Mexico, and elsewhere. New knowledge of the genetic diversity of the B. cockerelli is needed to develop improved strategies to manage pest populations. Mitochondrial genome (mitogenome sequencing provides important knowledge about insect evolution and diversity in and among populations. This report provides the first complete B. cockerelli mitogenome sequence as determined by next generation sequencing technology (Illumina MiSeq. The circular B. cockerelli mitogenome had a size of 15,220 bp with 13 protein-coding gene (PCGs, 2 ribosomal RNA genes (rRNAs, 22 transfer RNA genes (tRNAs, and a non-coding region of 975 bp. The overall gene order of the B. cockerelli mitogenome is identical to three other published Psylloidea mitogenomes: one species from the Triozidae, Paratrioza sinica; and two species from the Psyllidae, Cacopsylla coccinea and Pachypsylla venusta. This suggests all of these species share a common ancestral mitogenome. However, sequence analyses revealed differences between and among the insect families, in particular a unique region that can be folded into three stem-loop secondary structures present only within the B. cockerelli mitogenome. A phylogenetic tree based on the 13 PCGs matched an existing taxonomy scheme that was based on morphological characteristics. The available complete mitogenome sequence makes it accessible to all genes for future population diversity evaluation of B. cockerelli.
Vargas-Madríz, Haidel; Bautista-Martínez, Néstor; Vera-Graziano, Jorge; Sánchez-García, Prometeo; García-Gutiérrez, Cipriano; Sánchez-Soto, Saúl; de Jesús García-Avila, Clemente
2014-01-01
Abstract It is known that some nutrients can have both negative and positive effects on some populations of insects. To test this, the Logrank test and the Interval Overlap Test were evaluated for two crop cycles (February–May and May–August) of the 7705 tomato hybrid, and the effect on the psyllid, Bactericera cockerelli (Sulc.) (Hemiptera: Triozidae), was examined under greenhouse conditions. Tomato plants were in polythene bags and irrigated with the following solutions: T1—Steiner solution, T2—Steiner solution with nitrogen reduced to 25%, T3—Steiner solution with potassium reduced to 25%, and T4—Steiner solution with calcium reduced to 25%. In the Logrank test, a significant difference was found when comparing the survival parameters of B. cockerelli generated from the treatment cohorts: T1–T2; T1–T3; T1–T4; T2–T3; and T3–T4, while no significant differences were found in the T2–T4 comparison in the February–May cycle. In the May–August cycle, significant differences were found when comparing the survival parameters generated from the treatment cohorts: T1–T2; T1–T3; and T1–T4, while no significant differences were found in the T2–T3; T2–T4; and T3–T4 comparisons of survival parameters of B. cockerelli fed with the 7705 tomato hybrid. Also, the Interval Overlap Test was done on the treatment cohorts (T1, T2, T3, and T4) in the February–May and May–August cycles. T1 and T2 compare similarly in both cycles when feeding on the treatments up to 36 d. Similarly, in T1 and T3, the behavior of the insect is similar when feeding on the treatments up to 40 and 73 d, respectively. Comparisons T2–T3 and T2–T4 are similar when feeding on both treatments up to 42, 38 and 37, 63 d, respectively. Finally, the T3–T4 comparison was similar when feeding in both treatments up to 20 and 46 d, respectively. RESUMEN. Se sabe que algunos nutrientes pueden tener efectos tanto negativos como positivos en algunas poblaciones de
Psyllids (Hemiptera: Pyslloidea) harbor bacterial symbionts in specialized organs called bacteriomes. Bacteriomes may be subject to manipulation to control psyllid pests including Bactericera cockerelli (Sulc) (Hemiptera: Triozidae) and Cacopsylla pyricola (Forster) (Hemiptera: Psyllidae) if the bi...
Wuriyanghan, Hada; Falk, Bryce W.
2013-01-01
The potato/tomato psyllid, Bactericera cockerelli (B. cockerelli), is an important plant pest and the vector of the phloem-limited bacterium Candidatus Liberibacter psyllaurous (solanacearum), which is associated with the zebra chip disease of potatoes. Previously, we reported induction of RNA interference effects in B. cockerelli via in vitro-prepared dsRNA/siRNAs after intrathoracic injection, and after feeding of artificial diets containing these effector RNAs. In order to deliver RNAi effectors via plant hosts and to rapidly identify effective target sequences in plant-feeding B. cockerelli, here we developed a plant virus vector-based in planta system for evaluating candidate sequences. We show that recombinant Tobacco mosaic virus (TMV) containing B. cockerelli sequences can efficiently infect and generate small interfering RNAs in tomato (Solanum lycopersicum), tomatillo (Physalis philadelphica) and tobacco (Nicotiana tabacum) plants, and more importantly delivery of interfering sequences via TMV induces RNAi effects, as measured by actin and V-ATPase mRNA reductions, in B. cockerelli feeding on these plants. RNAi effects were primarily detected in the B. cockerelli guts. In contrast to our results with TMV, recombinant Potato virus X (PVX) and Tobacco rattle virus (TRV) did not give robust infections in all plants and did not induce detectable RNAi effects in B. cockerelli. The greatest RNA interference effects were observed when B. cockerelli nymphs were allowed to feed on leaf discs collected from inoculated or lower expanded leaves from corresponding TMV-infected plants. Tomatillo plants infected with recombinant TMV containing B. cockerelli actin or V-ATPase sequences also showed phenotypic effects resulting in decreased B. cockerelli progeny production as compared to plants infected by recombinant TMV containing GFP. These results showed that RNAi effects can be achieved in plants against the phloem feeder, B. cockerelli, and the TMV-plant system will
Long term, sustainable management of zebra chip disease of potato, caused by “Candidatus Liberibacter solanacearum” (Lso) and vectored by potato psyllids (Bactericera cockerelli Sulc), will require development of new cultivars resistant or tolerant to infection and/or capable of reducing spread. The...
Luna-Cruz, Alfonso; Rodríguez-Leyva, Esteban; Lomeli-Flores, J Refugio; Ortega-Arenas, Laura D; Bautista-Martínez, Néstor; Pineda, Samuel
2015-10-01
Bactericera cockerelli (Sulc) (Hemiptera: Triozidae) is one of the most economically important pests of potato, tomato, and peppers in Central America, Mexico, the United States, and New Zealand. Its control is based on the use of insecticides; however, recently, the potential of the eulophid parasitoid Tamarixia triozae (Burks) (Hymenoptera: Eulophidae) for population regulation has been studied. Because T. triozae is likely to be exposed to insecticides on crops, the objective of this study was to explore the compatibility of eight insecticides with this parasitoid. The toxicity and residual activity (persistence) of spirotetramat, spiromesifen, beta-cyfluthrin, pymetrozine, azadirachtin, imidacloprid, abamectin, and spinosad against T. triozae adults were assessed using a method based on the residual contact activity of each insecticide on tomato leaf discs collected from treated plants growing under greenhouse conditions. All eight insecticides were toxic to T. triozae. Following the classification of the International Organization of Biological Control, the most toxic were abamectin and spinosad, which could be placed in toxicity categories 3 and 4, respectively. The least toxic were azadirachtin, pymetrozine, spirotetramat, spiromesifen, imidacloprid, and beta-cyfluthrin, which could be placed in toxicity category 2. In terms of persistence, by day 5, 6, 9, 11, 13, 24, and 41 after application, spirotetramat, azadirachtin, spiromesifen, pymetrozine, imidacloprid, beta-cyfluthrin, abamectin, and spinosad could be considered harmless, that is, placed in toxicity category 1 (<25% mortality of adults). The toxicity and residual activity of some of these insecticides allow them to be considered within integrated pest management programs that include T. triozae. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Torres, Glenda L.; Cooper, W. Rodney; Horton, David R.; Swisher, Kylie D.; Garczynski, Stephen F.; Munyaneza, Joseph E.; Barcenas, Nina M.
2015-01-01
“Candidatus Liberibacter solanacearum” (Proteobacteria) is an important pathogen of solanaceous crops (Solanales: Solanaceae) in North America and New Zealand, and is the putative causal agent of zebra chip disease of potato. This phloem-limited pathogen is transmitted to potato and other solanaceous plants by the potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae). While some plants in the Convolvulaceae (Solanales) are also known hosts for B. cockerelli, previous efforts to detect Liberibacter in Convolvulaceae have been unsuccessful. Moreover, studies to determine whether Liberibacter can be acquired from these plants by B. cockerelli are lacking. The goal of this study was to determine whether horizontal transmission of Liberibacter occurs among potato psyllids on two species of Convolvulaceae, sweet potato (Ipomoea batatas) and field bindweed (Convolvulus arvensis), which grows abundantly in potato growing regions of the United States. Results indicated that uninfected psyllids acquired Liberibacter from both I. batatas and C. arvensis if infected psyllids were present on plants concurrently with the uninfected psyllids. Uninfected psyllids did not acquire Liberibacter from plants if the infected psyllids were removed from the plants before the uninfected psyllids were allowed access. In contrast with previous reports, PCR did detect the presence of Liberibacter DNA in some plants. However, visible amplicons were faint and did not correspond with acquisition of the pathogen by uninfected psyllids. None of the plants exhibited disease symptoms. Results indicate that horizontal transmission of Liberibacter among potato psyllids can occur on Convolvulaceae, and that the association between Liberibacter and Convolvulaceae merits additional attention. PMID:26555359
Cooper, W. Rodney; Garczynski, Stephen F.; Horton, David R.
2015-01-01
Carsonella ruddii (Gamma Proteobacterium) is an obligate bacterial endosymbiont of psyllids that produces essential amino acids that are lacking in the insect’s diet. Accurate estimations of Carsonella populations are important to studies of Carsonella-psyllid interactions and to developing ways to target Carsonella for control of psyllid pests including pear psylla, Cacopsylla pyricola (Förster) (Hemiptera: Psyllidae) and potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae). We used two methods, namely fluorescence in situ hybridization and quantitative polymerase chain reaction (qPCR), to estimate relative abundance of Carsonella in bacteriocytes and whole bodies of psyllids, respectively. Using these two methods, we compared Carsonella populations between female and male insects. Estimations using fluorescence in situ hybridization indicated that Carsonella was more abundant in bacteriocytes of female C. pyricola than in those of males, but Carsonella abundance in bacteriocytes did not differ between sexes of B. cockerelli. Analyses by qPCR using whole-body specimens indicated Carsonella was more abundant in females than in males of both psyllids. Neither fluorescence in situ hybridization nor qPCR indicated that Carsonella populations differed in abundance among adults of different ages (0–3 wk after adult eclosion). Using fluorescence in situ hybridization, Carsonella was observed in ovarioles of newly emerged females and formed an aggregation in the posterior end of mature oocytes. Results of our study indicate that female psyllids harbor greater populations of Carsonella than do males and that sex should be controlled for in studies which require estimations of Carsonella populations. PMID:26056318
Wenninger, Erik J; Carroll, Amy; Dahan, Jennifer; Karasev, Alexander V; Thornton, Michael; Miller, Jeff; Nolte, Philip; Olsen, Nora; Price, William
2017-12-08
Zebra chip disease (ZC) is an emerging disease of potato in which tubers are produced with striped necrotic patterns that make them unmarketable. ZC is associated with the bacterium "Candidatus Liberibacter solanacearum" (Lso), which is transmitted by the potato psyllid, Bactericera cockerelli (Šulc; Hemiptera: Triozidae). First found in Idaho during 2011, ZC now contributes to increased production costs each season via additional insecticide sprays. To clarify the extent and severity of the threat of ZC in Idaho, we sampled potato psyllids in commercial potato fields across the state over four growing seasons (2012-2015). All life stages of psyllids were sampled using a combination of methods (yellow sticky traps, vacuum samples, and leaf samples), and adult psyllids were tested for the presence of Lso by Polymerase Chain Reaction (PCR). Abundance of potato psyllids initially increased gradually over each growing season, then exhibited a sharp late-season rise and a sharp decline as most fields were being harvested. Abundance of psyllids was higher at warmer, lower elevation sites, but infestation onset did not differ between growing regions. Fewer psyllids were collected in vacuum samples than in sticky trap samples. Nymphs and eggs were found only late season and during years with high abundance of adults. Overall incidence of Lso was similar among all years but one. The results presented here clarify our understanding of the seasonal phenology of potato psyllids and Lso in Idaho potato fields and will aid in developing integrated management strategies against this important pest of potato. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Tariq Mustafa
Full Text Available The potato psyllid, Bactericera cockerelli (Šulc (Hemiptera: Triozidae, is a vector of the phloem-limited bacterium 'Candidatus Liberibacter solanacearum' (Lso, the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern. All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato ("inoculation access period", or IAP to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in
Mustafa, Tariq; Horton, David R.; Cooper, W. Rodney; Swisher, Kylie D.; Zack, Richard S.; Pappu, Hanu R.; Munyaneza, Joseph E.
2015-01-01
The potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae), is a vector of the phloem-limited bacterium ‘Candidatus Liberibacter solanacearum’ (Lso), the putative causal agent of zebra chip disease of potato. Little is known about how potato psyllid transmits Lso to potato. We used electrical penetration graph (EPG) technology to compare stylet probing behaviors and efficiency of Lso transmission of three haplotypes of potato psyllid (Central, Western, Northwestern). All haplotypes exhibited the full suite of stylet behaviors identified in previous studies with this psyllid, including intercellular penetration and secretion of the stylet pathway, xylem ingestion, and phloem activities, the latter comprising salivation and ingestion. The three haplotypes exhibited similar frequency and duration of probing behaviors, with the exception of salivation into phloem, which was of higher duration by psyllids of the Western haplotype. We manipulated how long psyllids were allowed access to potato (“inoculation access period”, or IAP) to examine the relationship between phloem activities and Lso transmission. Between 25 and 30% of psyllids reached and salivated into phloem at an IAP of 1 hr, increasing to almost 80% of psyllids as IAP was increased to 24 h. Probability of Lso-transmission was lower across all IAP levels than probability of phloem salivation, indicating that a percentage of infected psyllids which salivated into the phloem failed to transmit Lso. Logistic regression showed that probability of transmission increased as a function of time spent salivating into the phloem; transmission occurred as quickly as 5 min following onset of salivation. A small percentage of infected psyllids showed extremely long salivation events but nonetheless failed to transmit Lso, for unknown reasons. Information from these studies increases our understanding of Lso transmission by potato psyllid, and demonstrates the value of EPG technology in exploring
Tobacco plants with symptoms resembling those associated with the psyllid Bactericera cockerelli and the bacterium “Candidatus Liberibacter solanacearum” (Lso) were observed in April of 2012 in heavily B. cockerelli-infested commercial fields in the Department of El-Paraíso, Honduras; all cultivars ...
Bistline-East, Allison; Pandey, Raju; Kececi, Mehmet; Hoddle, Mark S
2015-06-01
Host range tests for Diaphorencyrtus aligarhensis (Shafee, Alam, & Agarwal) (Hymenoptera: Encyrtidae), an endoparasitoid of Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), sourced from Punjab Pakistan, were conducted in quarantine at the University of California, Riverside, CA. Seven nontarget psyllid species representing four psyllid families were exposed to mated D. aligarhensis females in four different treatment types: 1) short sequential no-choice treatments, 2) prolonged sequential no-choice treatments, 3) prolonged no-choice static treatments, and 4) choice treatments. Selection of nontarget psyllid species was based on phylogenetic proximity to D. citri, likelihood of being encountered by D. aligarhensis in the prospective release areas in California, and psyllid species in biological control of invasive weeds. D. aligarhensis exhibited high host affinity to D. citri, and only parasitized one nontarget species, the pestiferous potato psyllid, Bactericera cockerelli (Sulc), at low levels (citri. Results presented here suggest D. aligarhensis poses minimal risk to nontarget psyllid species in California. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Tonja W. Fisher
2014-11-01
Full Text Available The potato psyllid (PoP Bactericera cockerelli (Sulc and Asian citrus psyllid (ACP Diaphorina citri Kuwayama are the insect vectors of the fastidious plant pathogen, Candidatus Liberibacter solanacearum (CLso and Ca. L. asiaticus (CLas, respectively. CLso causes Zebra chip disease of potato and vein-greening in solanaceous species, whereas, CLas causes citrus greening disease. The reliance on insecticides for vector management to reduce pathogen transmission has increased interest in alternative approaches, including RNA interference to abate expression of genes essential for psyllid-mediated Ca. Liberibacter transmission. To identify genes with significantly altered expression at different life stages and conditions of CLso/CLas infection, cDNA libraries were constructed for CLso-infected and -uninfected PoP adults and nymphal instars. Illumina sequencing produced 199,081,451 reads that were assembled into 82,224 unique transcripts. PoP and the analogous transcripts from ACP adult and nymphs reported elsewhere were annotated, organized into functional gene groups using the Gene Ontology classification system, and analyzed for differential in silico expression. Expression profiles revealed vector life stage differences and differential gene expression associated with Liberibacter infection of the psyllid host, including invasion, immune system modulation, nutrition, and development.
Hoddle, Mark S; Pandey, Raju
2014-02-01
ABSTRACT Tests evaluating the host range of Tamarixia radiata (Waterson) (Hymenoptera: Eulophidae), a parasitoid of the pestiferous Asian citrus psyllid, Diaphorina citri Kuwayama (Hemiptera: Liviidae), sourced from the Punjab of Pakistan, were conducted in quarantine at the University of California, Riverside, CA. Seven nontarget psyllid species (five native and two self-introduced species) representing five families were exposed to T radiata under the following three different exposure scenarios: 1) sequential no-choice tests, 2) static no-choice tests, and 3) choice tests. Nontarget species were selected for testing based on the following criteria: 1) taxonomic relatedness to the target, D. citri; 2) native psyllids inhabiting native host plants related to citrus that could release volatiles attractive to T. radiata; 3) native psyllids with a high probability of occurrence in native vegetation surrounding commercial citrus groves that could be encountered by T. radiata emigrating from D. citri-infested citrus orchards; 4) a common native pest psyllid species; and 5) a beneficial psyllid attacking a noxious weed. The results of host range testing were unambiguous; T radiata exhibited a narrow host range and high host specificity, with just one species of nontarget psyllid, the abundant native pest Bactericera cockerelli Sulc, being parasitized at low levels (citri poses negligible environmental risk.
Zebra chip (ZC) is a disease of potatoes, which is associated with the bacteria ‘Candidatus Liberibacter solanacearum’ (Lso). Lso is transmitted by the potato psyllid, Bactericera cockerelli (Šulc) (Hemiptera: Triozidae). ZC reduces yield and quality, as it results in discoloration of the vascular ...
Zebra chip development during storage: cause for concern?
Zebra chip disease is associated with infections by ‘Candidatus Liberibacter solanacearum’ (Lso), a bacterium spread by the potato psyllid Bactericera cockerelli. A major concern of the potato industry is the likelihood that Lso could cause asymptomatic infections prior to placement of tubers in col...
The potato psyllid, Bactericera cockerelli, is as an economically important insect pest of potatoes in the western U.S., Mexico, Central America and New Zealand. This insect has historically been linked to psyllid yellows disease, but more recently has been shown to be the vector of a bacterium that...
Use of biorational for the vegetable pest control in the north of Sinaloa
Directory of Open Access Journals (Sweden)
María Berenice González Maldonado
2012-09-01
Full Text Available In Sinaloa the vegetable and cucurbits production are important agricultural activities, so each year a high volume of chemicalinsecticides are applied to pest control that attack these crops. This paper present the main pests insects in the region, as wellas an analysis about effects of biorational insecticides on these pests. Was found that for control of Bemisia argentifolii Bellows & Perring (Hemiptera: Aleyrodidae is used Neem oil 0.2%., for kill nymphs of Bactericera cockerelli Sulc. (Homoptera: Psyllidae soursop Annona muricata L. (Annonales: Annonaceae at doses of 2500-5000 mg/L., for Liriomyza trifolii Burgess (Diptera: Agromyzidae neem seeds 2%., to Myzus persicae Sulzer (Hemiptera: Aphididae rapeseed oil at doses 920 g/L (2% v/v., to Frankliniella occidentalis Pergande (Thysanoptera: Thripidae spinosad (Conserve® 48-60 mg/L., and for Phthorimaea operculella Zeller (Lepidoptera: Gelechiidae granular viruses (105 OBs/mL combined with neem (DalNeem TM emulsifiable oil and NeemAzal TM -T/S at doses of 8 mg/L, everyone. The use of these products and the dose depends on the type of pest and crop. In general these products cause insect mortality greater than 95%, besides having low toxicity on natural enemies, so that these can be used individually or in combination in integrated pest control schemes against vegetable pests, and also for disease vectors insects in the northern of Sinaloa.
Stylet biogenesis in Bactericera cockerelli (Hemiptera: Triozidae).
Cicero, Joseph M
2017-07-01
The discovery of 'Ca. Liberibacter solanacearum', causal agent of certain solanaceous and apiaceous crop diseases, inside the functional (intrastadial) and pharate stylet anatomy of the potato psyllid prompted elucidation of the mechanism of stylet replacement as a novel exit portal in the transmission pathway. In Hemiptera, presumptive (formative) stylets, secreted during consecutive pharate instars, replace functional stylets lost with the exuviae. In potato psyllids, each functional stylet has a hollow core filled with a cytology that extends out of the core to form a hemispherical aggregate of cells, the 'end-cap', somewhat resembling a golf ball on a tee. A tightly folded mass of extremely thin cells, the 'matrix', occurs inside the end-cap. Micrograph interpretations indicate that during the pharate stage, the end-cap apolyses from the core and 'deconstructs' to release and expand the matrix into a long, coiled tube, the 'atrium'. Cells that were in contact with the inner walls of the functional stylet core maintain their position at the apex of the tube, and secrete a new stylet, apex first, the growing length of which descends into the tube until completed. They then despool from the coils into their functional position as the exuviae is shed. Copyright © 2016 Elsevier Ltd. All rights reserved.
Nansen, Christian; Vaughn, Kathy; Xue, Yingen; Rush, Charlie; Workneh, Fekede; Goolsby, John; Troxclair, Noel; Anciso, Juan; Gregory, Ashley; Holman, Daniel; Hammond, Abby; Mirkov, Erik; Tantravahi, Pratyusha; Martini, Xavier
2011-08-01
Approximately US $1.3 billion is spent each year on insecticide applications in major row crops. Despite this significant economic importance, there are currently no widely established decision-support tools available to assess suitability of spray application conditions or of the predicted quality or performance of a given commercial insecticide applications. We conducted a field study, involving 14 commercial spray applications with either fixed wing airplane (N=8) or ground rig (N=6), and we used environmental variables as regression fits to obtained spray deposition (coverage in percentage). We showed that (1) ground rig applications provided higher spray deposition than aerial applications, (2) spray deposition was lowest in the bottom portion of the canopy, (3) increase in plant height reduced spray deposition, (4) wind speed increased spray deposition, and (5) higher ambient temperatures and dew point increased spray deposition. Potato psyllid, Bactericera cockerelli (Sulc) (Hemiptera: Triozidae), mortality increased asymptotically to approximately 60% in response to abamectin spray depositions exceeding around 20%, whereas mortality of psyllid adults reached an asymptotic response approximately 40% when lambda-cyhalothrin/thiamethoxam spray deposition exceeded 30%. A spray deposition support tool was developed (http://pilcc.tamu.edu/) that may be used to make decisions regarding (1) when is the best time of day to conduct spray applications and (2) selecting which insecticide to spray based on expected spray deposition. The main conclusion from this analysis is that optimization of insecticide spray deposition should be considered a fundamental pillar of successful integrated pest management programs to increase efficiency of sprays (and therefore reduce production costs) and to reduce risk of resistance development in target pest populations.
Directory of Open Access Journals (Sweden)
Hada Wuriyanghan
Full Text Available The potato/tomato psyllid, Bactericerca cockerelli (B. cockerelli, and the Asian citrus psyllid, Diaphorina citri (D. citri, are very important plant pests, but they are also vectors of phloem-limited bacteria that are associated with two devastating plant diseases. B. cockerelli is the vector of Candidatus Liberibacter psyllaurous (solanacearum, which is associated with zebra chip disease of potatoes, and D. citri is the vector of Ca. Liberibacter asiaticus, which is associated with the Huanglongbing (citrus greening disease that currently threatens the entire Florida citrus industry. Here we used EST sequence information from D. citri to identify potential targets for RNA interference in B. cockerelli. We targeted ubiquitously expressed and gut-abundant mRNAs via injection and oral acquisition of double-stranded RNAs and siRNAs and were able to induce mortality in recipient psyllids. We also showed knockdown of target mRNAs, and that oral acquisition resulted primarily in mRNA knockdown in the psyllid gut. Concurrent with gene knockdown was the accumulation of target specific ∼ 21 nucleotide siRNAs for an abundant mRNA for BC-Actin. These results showed that RNAi can be a powerful tool for gene function studies in psyllids, and give support for continued efforts for investigating RNAi approaches as possible tools for psyllid and plant disease control.
Zeilinger, Adam R; Rapacciuolo, Giovanni; Turek, Daniel; Oboyski, Peter T; Almeida, Rodrigo P P; Roderick, George K
2017-09-01
The emergence rate of new plant diseases is increasing due to novel introductions, climate change, and changes in vector populations, posing risks to agricultural sustainability. Assessing and managing future disease risks depends on understanding the causes of contemporary and historical emergence events. Since the mid-1990s, potato growers in the western United States, Mexico, and Central America have experienced severe yield loss from Zebra Chip disease and have responded by increasing insecticide use to suppress populations of the insect vector, the potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae). Despite the severe nature of Zebra Chip outbreaks, the causes of emergence remain unknown. We tested the hypotheses that (1) B. cockerelli occupancy has increased over the last century in California and (2) such increases are related to climate change, specifically warmer winters. We compiled a data set of 87,000 museum specimen occurrence records across the order Hemiptera collected between 1900 and 2014. We then analyzed changes in B. cockerelli distribution using a hierarchical occupancy model using changes in background species lists to correct for collecting effort. We found evidence that B. cockerelli occupancy has increased over the last century. However, these changes appear to be unrelated to climate changes, at least at the scale of our analysis. To the extent that species occupancy is related to abundance, our analysis provides the first quantitative support for the hypothesis that B. cockerelli population abundance has increased, but further work is needed to link B. cockerelli population dynamics to Zebra Chip epidemics. Finally, we demonstrate how this historical macro-ecological approach provides a general framework for comparative risk assessment of future pest and insect vector outbreaks. © 2017 by the Ecological Society of America.
Directory of Open Access Journals (Sweden)
Lotfalizadeh Hossein
2016-08-01
Full Text Available Bactericera tremblayi (Wagner, 1961 (Hemiptera: Triozidae is reported on Brassica oleracea var. capitata (Brassicaceae in northwestern Iran. Tamarixia monesus (Walker (Hymenoptera: Chalcidoidea, Eulophidae was reared for the first time on B. tremblayi, and compared with Tamarixia tremblayi, another parasitoid of B. tremblayi. This is a new record of T. monesus from the Middle East.
Energy Technology Data Exchange (ETDEWEB)
Teresani, G.R.; Hernández, E.; Bertolini, E.; Siverio, F.; Moreno, A.; Fereres, A.; Cambra, M.
2017-07-01
The bacterium ‘Candidatus Liberibacter solanacearum’ is a recent plant pathogen of several crops in Solanaceae and Apiaceae and is associated with economically important diseases. The bacterium is a carrot seed borne pathogen that can also be transmitted from potato mother tubers and by psyllid vectors. The psyllid Bactericera trigonica Hodkinson was described carrying CaLso associated with vegetative disorders in carrot and celery crops in Spain and its competence to transmit this phloem-limited bacterium among vegetables is currently being investigated. Here electrical penetration graphs showed that B. trigonica fed in the phloem of carrot and celery and probed the phloem in potato, but not in tomato plants. The bacterium was efficiently transmitted to carrot and celery plants when either single B. trigonica or groups of ten fed on these species. An inoculation access period of 24 hours was sufficient for a single B. trigonica to transmit the bacterium to carrot (67.8%), celery (21.1%) and eventually to potato and tomato (6.0%). Higher transmission rates were obtained with 10 individuals on celery (100%), carrot (80%), potato (10%) and tomato (10%). Bactericera trigonica laid eggs, and the hatched nymphs develop into adult on carrot and celery, but not on potato and tomato. CaLso was detected in 20% of the eggs laid by females carrying the bacterium. The results confirmed that B. trigonica is a vector of the bacterium to carrot and celery, and it is discussed the potential role of this psyllid in the transmission of the pathogen to potato and tomato plants.
International Nuclear Information System (INIS)
Teresani, G.R.; Hernández, E.; Bertolini, E.; Siverio, F.; Moreno, A.; Fereres, A.; Cambra, M.
2017-01-01
The bacterium ‘Candidatus Liberibacter solanacearum’ is a recent plant pathogen of several crops in Solanaceae and Apiaceae and is associated with economically important diseases. The bacterium is a carrot seed borne pathogen that can also be transmitted from potato mother tubers and by psyllid vectors. The psyllid Bactericera trigonica Hodkinson was described carrying CaLso associated with vegetative disorders in carrot and celery crops in Spain and its competence to transmit this phloem-limited bacterium among vegetables is currently being investigated. Here electrical penetration graphs showed that B. trigonica fed in the phloem of carrot and celery and probed the phloem in potato, but not in tomato plants. The bacterium was efficiently transmitted to carrot and celery plants when either single B. trigonica or groups of ten fed on these species. An inoculation access period of 24 hours was sufficient for a single B. trigonica to transmit the bacterium to carrot (67.8%), celery (21.1%) and eventually to potato and tomato (6.0%). Higher transmission rates were obtained with 10 individuals on celery (100%), carrot (80%), potato (10%) and tomato (10%). Bactericera trigonica laid eggs, and the hatched nymphs develop into adult on carrot and celery, but not on potato and tomato. CaLso was detected in 20% of the eggs laid by females carrying the bacterium. The results confirmed that B. trigonica is a vector of the bacterium to carrot and celery, and it is discussed the potential role of this psyllid in the transmission of the pathogen to potato and tomato plants.
Directory of Open Access Journals (Sweden)
Jinhui Wang
Full Text Available Haplotypes A and B of 'Candidatus Liberibacter solanacearum' (CLso are associated with diseases of solanaceous plants, especially Zebra chip disease of potato, and haplotypes C, D and E are associated with symptoms on apiaceous plants. To date, one complete genome of haplotype B and two high quality draft genomes of haplotype A have been obtained for these unculturable bacteria using metagenomics from the psyllid vector Bactericera cockerelli. Here, we present the first genomic sequences obtained for the carrot-associated CLso. These two genomic sequences of haplotype C, FIN114 (1.24 Mbp and FIN111 (1.20 Mbp, were obtained from carrot psyllids (Trioza apicalis harboring CLso. Genomic comparisons between the haplotypes A, B and C revealed that the genome organization differs between these haplotypes, due to large inversions and other recombinations. Comparison of protein-coding genes indicated that the core genome of CLso consists of 885 ortholog groups, with the pan-genome consisting of 1327 ortholog groups. Twenty-seven ortholog groups are unique to CLso haplotype C, whilst 11 ortholog groups shared by the haplotypes A and B, are not found in the haplotype C. Some of these ortholog groups that are not part of the core genome may encode functions related to interactions with the different host plant and psyllid species.
Slopeland utilizable limitation classification using landslide inventory
Tsai, Shu Fen; Lin, Chao Yuan
2016-04-01
In 1976, "Slopeland Conservation and Utilization Act" was promulgated as well as the criteria for slopeland utilization limitation classification (SULC) i.e., average slope, effective soil depth, degree of soil erosion, and parent rock became standardized. Due to the development areas on slope land steadily increased and the extreme rainfall events occurred frequently, the areas affected by landslides also increased year by year. According to the act, the land which damaged by disaster must be categorized to the conservation land and required rehabilitation. Nevertheless, the large-scale disaster on slope land and the limitation of SWCB officers are the constraint of field investigation. Therefore, how to establish the ongoing inspective procedure of post-disaster SULC using remote sensing was essential. A-Li-Shan, Ai-Liao, and Tai-Ma-Li Watershed were selected to be case studies in this project. The spatial data from big data i.e., Digital Elevation Model (DEM), soil map, and satellite images integrated with Geographic Information Systems (GIS) were applied to post-disaster SULC. The collapse and deposition area which delineated by vegetation recovery rate was established landslide inventory of cadastral unit combined with watershed unit. The results were verified with field survey and the accuracy was 97%. The landslide inventory could be an effective reference for sediment disaster investigation and a practical evidence for judgement to expropriation. Finally, the results showed that the ongoing inspective procedure of post-disaster SULC was practicable. From the four criteria, the average slope was the major factor. It was found that the non-uniform slopes, especially derived from cadastral units, often produce significant slope difference and lead to errors of average slope evaluation. Therefore, the Grid-based DEM slope derivation has been recommended as the standard method to calculate the average slope. Others criteria were previously required to classify
Directory of Open Access Journals (Sweden)
Thomas Seth Davis
Full Text Available Although bacterial endosymbioses are common among phloeophagous herbivores, little is known regarding the effects of symbionts on herbivore host selection and population dynamics. We tested the hypothesis that plant selection and reproductive performance by a phloem-feeding herbivore (potato psyllid, Bactericera cockerelli is mediated by infection of plants with a bacterial endosymbiont. We controlled for the effects of herbivory and endosymbiont infection by exposing potato plants (Solanum tuberosum to psyllids infected with "Candidatus Liberibacter solanacearum" or to uninfected psyllids. We used these treatments as a basis to experimentally test plant volatile emissions, herbivore settling and oviposition preferences, and herbivore population growth. Three important findings emerged: (1 plant volatile profiles differed with respect to both herbivory and herbivory plus endosymbiont infection when compared to undamaged control plants; (2 herbivores initially settled on plants exposed to endosymbiont-infected psyllids but later defected and oviposited primarily on plants exposed only to uninfected psyllids; and (3 plant infection status had little effect on herbivore reproduction, though plant flowering was associated with a 39% reduction in herbivore density on average. Our experiments support the hypothesis that plant infection with endosymbionts alters plant volatile profiles, and infected plants initially recruited herbivores but later repelled them. Also, our findings suggest that the endosymbiont may not place negative selection pressure on its host herbivore in this system, but plant flowering phenology appears correlated with psyllid population performance.
Directory of Open Access Journals (Sweden)
Veria Y Alvarado
Full Text Available Zebra complex (ZC disease on potatoes is associated with Candidatus Liberibacter solanacearum (CLs, an α-proteobacterium that resides in the plant phloem and is transmitted by the potato psyllid Bactericera cockerelli (Šulc. The name ZC originates from the brown striping in fried chips of infected tubers, but the whole plants also exhibit a variety of morphological features and symptoms for which the physiological or molecular basis are not understood. We determined that compared to healthy plants, stems of ZC-plants accumulate starch and more than three-fold total protein, including gene expression regulatory factors (e.g. cyclophilin and tuber storage proteins (e.g., patatins, indicating that ZC-affected stems are reprogrammed to exhibit tuber-like physiological properties. Furthermore, the total phenolic content in ZC potato stems was elevated two-fold, and amounts of polyphenol oxidase enzyme were also high, both serving to explain the ZC-hallmark rapid brown discoloration of air-exposed damaged tissue. Newly developed quantitative and/or conventional PCR demonstrated that the percentage of psyllids in laboratory colonies containing detectable levels of CLs and its titer could fluctuate over time with effects on colony prolificacy, but presumed reproduction-associated primary endosymbiont levels remained stable. Potato plants exposed in the laboratory to psyllid populations with relatively low-CLs content survived while exposure of plants to high-CLs psyllids rapidly culminated in a lethal collapse. In conclusion, we identified plant physiological biomarkers associated with the presence of ZC and/or CLs in the vegetative potato plant tissue and determined that the titer of CLs in the psyllid population directly affects the rate of disease development in plants.
Castillo Carrillo, C I; Fu, Z; Jensen, A S; Snyder, W E
2016-08-01
Bittersweet nightshade (Solanum dulcamara L.) is a key noncrop host of the potato psyllid (Bactericera cockerelli Šulc), proposed to be a source of the psyllids that colonize potato (Solanum tuberosum L.) fields in the northwestern United States. Here, we describe the broader community of arthropod potato pests, and also predatory arthropods, found in bittersweet nightshade patches. Over 2 yr, we sampled arthropods in patches of this weed spanning the potato-growing region of eastern Washington State. The potato psyllid was the most abundant potato pest that we found, with reproduction of these herbivores recorded throughout much of the growing season where this was measured. Aphid, beetle, and thrips pests of potato also were collected on bittersweet nightshade. In addition to these herbivores, we found a diverse community of >40 predatory arthropod taxa. Spiders, primarily in the Families Dictynidae and Philodromidae, made up 70% of all generalist predator individuals collected. Other generalist predators included multiple species of predatory mites, bugs, and beetles. The coccinellid beetle Stethorus punctillum (Weise) was observed eating psyllid eggs, while the parasitoid wasp Tamarixia triozae (Burks) was observed parasitizing potato psyllid nymphs. Overall, our survey verified the role of bittersweet nightshade as a potato psyllid host, while suggesting that other potato pests also use these plants. At the same time, we found that bittersweet nightshade patches were associated with species-rich communities of natural enemies. Additional work is needed to directly demonstrate movement of pests, and perhaps also predators, from bittersweet nightshade to potato fields. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Alvarado, Veria Y.; Odokonyero, Denis; Duncan, Olivia; Mirkov, T. Erik; Scholthof, Herman B.
2012-01-01
Zebra complex (ZC) disease on potatoes is associated with Candidatus Liberibacter solanacearum (CLs), an α-proteobacterium that resides in the plant phloem and is transmitted by the potato psyllid Bactericera cockerelli (Šulc). The name ZC originates from the brown striping in fried chips of infected tubers, but the whole plants also exhibit a variety of morphological features and symptoms for which the physiological or molecular basis are not understood. We determined that compared to healthy plants, stems of ZC-plants accumulate starch and more than three-fold total protein, including gene expression regulatory factors (e.g. cyclophilin) and tuber storage proteins (e.g., patatins), indicating that ZC-affected stems are reprogrammed to exhibit tuber-like physiological properties. Furthermore, the total phenolic content in ZC potato stems was elevated two-fold, and amounts of polyphenol oxidase enzyme were also high, both serving to explain the ZC-hallmark rapid brown discoloration of air-exposed damaged tissue. Newly developed quantitative and/or conventional PCR demonstrated that the percentage of psyllids in laboratory colonies containing detectable levels of CLs and its titer could fluctuate over time with effects on colony prolificacy, but presumed reproduction-associated primary endosymbiont levels remained stable. Potato plants exposed in the laboratory to psyllid populations with relatively low-CLs content survived while exposure of plants to high-CLs psyllids rapidly culminated in a lethal collapse. In conclusion, we identified plant physiological biomarkers associated with the presence of ZC and/or CLs in the vegetative potato plant tissue and determined that the titer of CLs in the psyllid population directly affects the rate of disease development in plants. PMID:22615987
Energy Technology Data Exchange (ETDEWEB)
Teresani, G.; Hernández, E.; Bertolini, E.; Siverio, F.; Marroquín, C.; Molina, J.; Hermoso de Mendoza, A.; Cambra, M.
2015-07-01
‘Candidatus Liberibacter solanacearum’ has recently been reported to be associated with vegetative disorders and economic losses in carrot and celery crops in Spain. The bacterium is a carrot seedborne pathogen and it is transmitted by psyllid vector species. From 2011 to 2014 seasonal and occasional surveys in carrot, celery and potato plots were performed. The sticky plant method was used to monitor the arthropods that visited the plants. The collected arthropods were classified into Aphididae and Cicadellidae, and the superfamily Psylloidea was identified to the species level. The superfamily Psylloidea represented 35.45% of the total arthropods captured on celery in Villena and 99.1% on carrot in Tenerife (Canary Islands). The maximum flight of psyllid species was in summer, both in mainland Spain and the Canary Islands, reaching a peak of 570 specimens in August in Villena and 6,063 in July in Tenerife. The main identified psyllid species were as follows: Bactericera trigonica Hodkinson, B. tremblayi Wagner and B. nigricornis Förster. B. trigonica represented more than 99% of the psyllids captured in the Canary Islands and 75% and 38% in 2011 and 2012 in Villena, respectively. In addition, Trioza urticae Linnaeus, Bactericera sp., Ctenarytaina sp., Cacopsylla sp., Trioza sp. and Psylla sp. were captured. ‘Ca. L. solanacearum’ targets were detected by squash real-time PCR in 19.5% of the psyllids belonging to the different Bactericera species. This paper reports at least three new psyllid species that carry the bacterium and can be considered as potential vectors. (Author)
Dicty_cDB: Contig-U15060-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 000227 |pid:none) Bacillus cereus Q1, complete ge... 114 3e-23 B83991( B83991 ) glycolate oxidase subunit BH2730 [imported...ana interm... 56 2e-15 5 ( AF211126 ) Carsonella ruddii natural-host Bactericera cocker....psnkfvpqrlfqq*fvf tiqrkln*vllgnqvkvl*vnsqvqwlksifitfvplisrmfvslslvskvqrrl*isie lqfsissprmlplv*vlllvklgpkkdmi... la... 1074 0.0 1 ( AB000109 ) Dictyostelium discoideum mitochondrial DNA, compl... 1074 0.0 1 ( BJ412759 ) Dictyosteli...7, 3' ... 731 0.0 1 ( DQ336395 ) Dictyostelium citrinum mitochondrion, complete ge... 456 0.0 3 ( BJ387435 ) Dictyosteli
Ghanim, Murad; Achor, Diann; Ghosh, Saptarshi; Kontsedalov, Svetlana; Lebedev, Galina; Levy, Amit
2017-12-05
Citrus greening disease known also as Huanglongbing (HLB) caused by the phloem-limited bacterium 'Candidatus Liberibacter asiaticus' (CLas) has resulted in tremendous losses and the death of millions of trees worldwide. CLas is transmitted by the Asian citrus psyllid Diaphorina citri. The closely-related bacteria 'Candidatus Liberibacter solanacearum' (CLso), associated with vegetative disorders in carrots, is transmitted by the carrot psyllid Bactericera trigonica. A promising approach to prevent the transmission of these pathogens is to interfere with the vector-pathogen interactions, but our understanding of these processes is limited. It was recently reported that CLas induced changes in the nuclear architecture, and activated programmed cell death, in D. citri midgut cells. Here, we used electron and fluorescent microscopy and show that CLas induces the formation of endoplasmic reticulum (ER)-associated bodies. The bacterium recruits those ER structures into Liberibacter containing vacuoles (LCVs), in which bacterial cells seem to propagate. ER- associated LCV formation was unique to CLas, as we could not detect these bodies in B. trigonica infected with CLso. ER recruitment is hypothesized to generate a safe replicative body to escape cellular immune responses in the insect gut. Understanding the molecular interactions that undelay these responses will open new opportunities for controlling CLas.
Directory of Open Access Journals (Sweden)
María Cristina Granara De Willink
2007-07-01
Full Text Available Se presenta un estudio sistemático y cladístico de las especies de Phenacoccus Cockerell neotropicales. Se describen e ilustran 18 especies nuevas: Phenacoccus argentinus Granara de Willink, Ph. berberis Granara de Willink, Ph. chubutensis Granara de Willink, Ph. ornatus Granara de Willink, Ph. persimilis Granara de Willink (Argentina; Ph. erythrinus Granara de Willink (Brasil y Argentina; Ph. peruvianus Granara de Willink (Argentina y Perú; Ph. sisymbriifolium Granara de Willink (Argentina y Uruguay; Ph. chilindrinae Granara de Willink, Ph. cornicirculus Granara de Willink, Ph. ruellia Granara de Willink, Ph. setosus Granara de Willink, Ph. sonoraensis Granara de Willink (México; Ph. hirsutus Granara de Willink (Puerto Rico; Ph. multicerarii Granara de Willink (Venezuela; Ph. sisalanus Granara de Willink (Haití y República Dominicana; Ph. toconaoensis Granara de Willink (Chile, y Ph. uruguayensis Granara de Willink (Uruguay. Todas las especies de Phenacoccus conocidas anteriormente para la región (24 en total son diagnosticadas. También se citan, ilustran y describen Phenacoccus artemisiae Ehrhorn y Ph. graminicola Leonardi, encontradas por primera vez en la Argentina. Se incluyen claves de géneros de Phenacoccinae neotropicales y de las especies de Phenacoccus neotropicales y también una lista de plantas hospederas de los Phenacoccus, que contiene 48 Familias Botánicas y 124 especies. Finalmente se realizó un análisis cladístico de los Phenacoccinae neotropicales, que incluye además de Phenacoccus los siguientes géneros: Brasiliputo Williams & Granara de Willink, Brevennia Goux, Chileputo Williams & Granara de Willink, Heliococcus Sulc, Heterococcus Ferris, Mammicoccus Balachowsky, Peliococcus Borchsenius, Pellizzaricoccus Kozár. Una matriz de 60 taxones (que incluye 10 géneros y 111 caracteres morfológicos, fue analizada mediante el criterio de parsimonia con el género Puto Signoret como taxón raíz. Los resultados