WorldWideScience

Sample records for b2 feal alloys

  1. The changes in the electronic structure of B2 FeAl alloy with a Fe antisite and absorbed hydrogen

    International Nuclear Information System (INIS)

    Gonzalez, E.A.; Jasen, P.V.; Luna, R.; Bechthold, P.; Juan, A.; Brizuela, G.

    2009-01-01

    The electronic structure and bonding in a B2 FeAl alloy with and without hydrogen interaction with a Fe antisite were computed using a density functional theoretical method. The hydrogen absorption turns out to be a favorable process. The hydrogen was found close to an octahedral site where one of its Al capped is replaced by a Fe antisite. The Fe-H distance is of 1.45 A same as the Al-H distance. The density of states (DOS) curves show several peaks below the d metal band which is made up mostly of hydrogen based states (>50% H 1s ) while the metal contribution in this region includes mainly s and p orbitals. An electron transfer of nearby 0.21e - comes from the metal to the H. The overlap population values reveal metal-metal bond breaking, the intermetallic bond being the most affected. The H bond mainly with the Al atom and the reported Fe-H overlap population is much lower than that corresponding to FePd alloys and BCC Fe. The changes in the overlap population show the Fe-Al bond is weakened nearly 41.5% after H absorption, while the Fe-Fe bond is only weakened 34.5%. H also develops a stronger bond with the Al atoms. The main bond is developed with Al being twice stronger than Fe-H.

  2. Strength anomaly in B2 FeAl single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Yoshimi, K.; Hanada, S.; Yoo, M.H. [Oak Ridge National Lab., TN (United States); Matsumoto, N. [Tohoku Univ. (Japan). Graduate School

    1994-12-31

    Strength and deformation microstructure of B2 Fe-39 and 48%Al single crystals (composition given in atomic percent), which were fully annealed to remove frozen-in vacancies, have been investigated at temperatures between room temperature and 1073K. The hardness of as-homogenized Fe-48Al is higher than that of as-homogenized Fe-39Al while after additional annealing at 698K the hardness of Fe-48Al becomes lower than that of Fe-39Al. Fe-39Al single crystals slowly cooled after homogenizing at a high temperature were deformed in compression as a function of temperature and crystal orientation. A peak of yield strength appears around 0.5T{sub m} (T{sub m} = melting temperature). The orientation dependence of the critical resolved shear stress does not obey Schmid`s law even at room temperature and is quite different from that of b.c.c. metals and B2 intermetallics at low temperatures. At the peak temperature slip transition from <111>-type to <001>-type is found to occur macroscopically and microscopically, while it is observed in TEM that some of the [111] dislocations decompose into [101] and [010] on the (1096I) plane below the peak temperature. The physical sources for the positive temperature dependence of yield stress of B2 FeAl are discussed based on the obtained results.

  3. Environmental embrittlement of intermetallic compounds in Fe-Al alloys

    Institute of Scientific and Technical Information of China (English)

    张建民; 张瑞林; S.H.YU; 余瑞璜

    1996-01-01

    First,it is proposed that hydrogen atoms occupy the interstitial sites in Fe3Al and FeAl.Then the environmental embrittlement of intermetallic compounds in Fe-Al alloys is studied in the light of calculated valence electron structures and bond energy of Fe3Al and FeAl containing hydrogen atoms.From the analyses it is found that the states of metal atoms will change,in which more lattice electrons will become covalent electrons to bond with hydrogen atoms when the atomic hydrogen diffuses into the intermetallic compounds in Fe-Al alloys,which will result in the decrease of local metallicity in Fe3Al and FeAl.Meanwhile,it is found that the crystal will easily cleave since solute hydrogen bonds with metal atoms and severely anisotropic bonds form.As a conclusion,these factors result in the environmental embrittlement of Fe3Al and FeAl.

  4. Large tunnel magnetoresistance at room temperature with a Co2FeAl full-Heusler alloy electrode

    International Nuclear Information System (INIS)

    Okamura, S.; Miyazaki, A.; Sugimoto, S.; Tezuka, N.; Inomata, K.

    2005-01-01

    Magnetic tunnel junctions (MTJs) with a Co 2 FeAl Heusler alloy electrode are fabricated by the deposition of the film using an ultrahigh vacuum sputtering system followed by photolithography and Ar ion etching. A tunnel magnetoresistance (TMR) of 47% at room temperature (RT) are obtained in a stack of Co 2 FeAl/Al-O x /Co 75 Fe 25 magnetic tunnel junction (MTJ) fabricated on a thermally oxidized Si substrate despite the A2 type atomic site disorder for Co 2 FeAl. There is no increase of TMR in MTJs with the B2 type Co 2 FeAl, which is prepared by the deposition on a heated substrate. X-ray photoelectron spectroscopy (XPS) depth profiles in Co 2 FeAl single layer films reveal that Al atoms in Co 2 FeAl are oxidized preferentially at the surfaces. On the other hand, at the interfaces in Co 2 FeAl/Al-O x /Co 75 Fe 25 MTJs, the ferromagnetic layers are hardly oxidized during plasma oxidation for a formation of Al oxide barriers

  5. Development of weldable, corrosion-resistant iron-aluminide (FeAl) alloys

    Energy Technology Data Exchange (ETDEWEB)

    Maziasz, P.J.; Goodwin, G.M.; Wang, X.L.; Alexander, D.J. [Oak Ridge National Lab., TN (United States)

    1997-04-01

    A boron-microalloyed FeAl alloy (Fe-36Al-0.2Mo-0.05Zr-0.13C, at.%, with 100-400 appm B) with improved weldability and mechanical properties was developed in FY 1994. A new scale-up and industry technology development phase for this work began in FY 1995, pursuing two parallel paths. One path was developing monolithic FeAl component and application technology, and the other was developing coating/cladding technology for alloy steels, stainless steels and other Fe-Cr-Ni alloys. In FY 1995, it was found that cast FeAl alloys had good strength at 700-750{degrees}C, and some (2.5%) ductility in air at room-temperature. Hot-extruded FeAl with refined grain size was found to have ductility and to also have good impact-toughness at room-temperature. Further, it was discovered that powder-metallurgy (P/M) FeAl, consolidated by direct hot-extrusion at 950-1000{degrees}C to have an ultra fine-grained microstructure, had the highest ductility, strength and impact-toughness ever seen in such intermetallic alloys.

  6. Ab-initio electronic and magnetic properties of Fe-Al alloys

    Directory of Open Access Journals (Sweden)

    Apiñaniz, E.

    2000-06-01

    Full Text Available This work presents ab-initio self-consistent calculations performed with the TB-LMTO code to study the different phases of the Fe-Al phase diagram, corresponding to the ordered structures B2, DO3 and B32 and for Fe50Al50 and Fe3Al compositions. Both, unpolarized and spin-polarized calculations have been performed to deduce the energetic difference between the paramagnetic and ferromagnetic state of the corresponding structure. Calculations for the disordered structures have also been performed for the previously mentioned compositions. These results show that by disordering the alloy magnetism is enhanced and that the equilibrium lattice parameter increases.

    En este trabajo se presentan cálculos autoconsistentes ab-initio realizados con el método TB-LMTO (Tight Binding Linear Muffin Tin Orbital con el fin de estudiar las diferentes estructuras que se presentan en el diagrama de fases de las aleaciones Fe-Al. Se han estudiado las estructuras ordenadas B2, DO3 y B32 para las siguientes concentraciones: Fe50Al50 y Fe3Al. Asimismo, se han realizado cálculos teniendo y sin tener en cuenta la polarización de spin con el fin de poder deducir la diferencia energética entre los estados ferromágneticos y paramágneticos de la misma estructura. Por otra parte se han realizado estos mismos cálculos para estructuras desordenadas y las mismas concentraciones. Los resultados muestran que mediante el desorden aumenta el magnetismo de estas aleaciones y crece el parámetro de red.

  7. Optimization of the boron content in FeAl (40 at. % Al) alloys

    International Nuclear Information System (INIS)

    Webb, G.; Juliet, P.; Lefort, A.

    1993-01-01

    FeAl intermetallic alloys are of interest for several high temperature applications due to excellent oxidation resistance, low density, and relatively low cost. Attempts to further increase the ductility of iron-rich FeAl have met with, at best, marginal success. Of the ductilization techniques employed, B doping appears to be a promising method for obtaining enhanced ductility and high strength in iron rich FeAl. Boron additions enhance the ductility of these alloys by increasing the grain boundary cohesive strength which reduces the tendency for intergranular fracture. The goal of the present work was to determine the optimum B concentration for increasing ambient temperature ductility. To accomplish this, a series of three iron rich FeAl alloys of similar Fe stoichiometries were doped with different levels of B (0,12, and 80 wppm). Secondary ion mass spectrometry (SIMS) was conducted on these alloys for evaluation of the B partitioning after consolidation by extrusion. Ambient temperature tensile testing and SEM fractography were then used to evaluate the effect of such additions on ambient temperature ductility in air. The results of these experiments indicate that optimum ductility is obtained from a homogeneous distribution of boron in which boride precipitation is limited

  8. Alloy Design Data Generated for B2-Ordered Compounds

    Science.gov (United States)

    Noebe, Ronald D.; Bozzolo, Guillermo; Abel, Phillip B.

    2003-01-01

    Developing alloys based on ordered compounds is significantly more complicated than developing designs based on disordered materials. In ordered compounds, the major constituent elements reside on particular sublattices. Therefore, the addition of a ternary element to a binary-ordered compound is complicated by the manner in which the ternary addition is made (at the expense of which binary component). When ternary additions are substituted for the wrong constituent, the physical and mechanical properties usually degrade. In some cases the resulting degradation in properties can be quite severe. For example, adding alloying additions to NiAl in the wrong combination (i.e., alloying additions that prefer the Al sublattice but are added at the expense of Ni) will severely embrittle the alloy to the point that it can literally fall apart during processing on cooling from the molten state. Consequently, alloying additions that strongly prefer one sublattice over another should always be added at the expense of that component during alloy development. Elements that have a very weak preference for a sublattice can usually be safely added at the expense of either element and will accommodate any deviation from stoichiometry by filling in for the deficient component. Unfortunately, this type of information is not known beforehand for most ordered systems. Therefore, a computational survey study, using a recently developed quantum approximate method, was undertaken at the NASA Glenn Research Center to determine the preferred site occupancy of ternary alloying additions to 12 different B2-ordered compounds including NiAl, FeAl, CoAl, CoFe, CoHf, CoTi, FeTi, RuAl, RuSi, RuHf, RuTi, and RuZr. Some of these compounds are potential high temperature structural alloys; others are used in thin-film magnetic and other electronic applications. The results are summarized. The italicized elements represent the previous sum total alloying information known and verify the computational

  9. Effect of aluminum content on the passivation behavior of Fe-Al alloys in sulfuric acid solution

    DEFF Research Database (Denmark)

    Chiang, Wen-Chi; Luu, W.C.; Wu, J.K.

    2006-01-01

    -Al alloys, which the Al content of alloy exceeds 19 at %, have wide passivation regions with low passivation current. However, when the Al content of Fe-Al alloys exceeds this range, the increment of Al content has slight influence on passivation behavior compared with ternary Cr addition....

  10. Moessbauer study of Fe-Al disordered alloys near the critical concentration

    International Nuclear Information System (INIS)

    Bohorquez, A.; Tabares, J.A.; Perez Alcazar, G.A.; Gancedo, J.R.

    1994-01-01

    Disordered bcc Fe 1-q Al q alloys in the composition range 0.5≤q≤0.6 were studied by Moessbauer effect measurements. The Moessbauer spectra at 300 K of all the samples consist of two paramagnetic sites, one is a singlet and the other a doublet with quadrupole splitting. The results can be interpreted by considering that the sites of this disordered system are arranged near the configurations of the Fe and Al sites of the Fe-Al ordered system. (orig.)

  11. Corrosion resistance of Fe-Al alloy-coated steel under bending stress in high temperature lead-bismuth eutectic

    International Nuclear Information System (INIS)

    Yamaki, Eriko; Takahashi, Minoru

    2009-01-01

    Formation of thin Fe-Al alloy layers on the surface of cladding and structural materials is effective to protect a base material from corrosion in high temperature LBE. However, it is concerned that these protective layers may be damaged under various stress conditions. This study on Fe-Al alloy coatings deposited by unbalanced magnetron sputtering (UBMS) is focused to evaluate corrosion resistance and integrity of the Fe-Al coating layers with thickness of 0.5 mm under bending stress in high temperature LBE. High chromium steel specimens (HCM12A, Recloy10) with Fe-Al alloy coating were exposed to LBE pool with low oxygen concentration (up to 5.2x10 -8 wt%) at 550 and 650degC under 45kg-loading for 240 and 500 h. No LBE corrosion was observed in the base metal and coating layer after the tests at 550degC for 550 h. The coating layers could be barrier for corrosion resistance from LBE at 550degC, although the coating scales are cracked by the load. At 650degC, because the base metal was contoccured directly with LBE through cracks across the coating layer. Penetration of LBE to base metal and dissolution of beset metal into LBE occurred. Fe-Al coating layer was not corroded by LBE. (author)

  12. Application of feal intermetallic phase matrix based alloys in the turbine components of a turbocharger

    Directory of Open Access Journals (Sweden)

    J. Cebulski

    2015-01-01

    Full Text Available This paper presents a possible application of the state-of-the-art alloys based on the FeAl intermetallic phases as materials for the manufacture of heat-proof turbine components in an automobile turbocharger. The research was aimed at determining the resistance to corrosion of Fe40Al5CrTiB alloy in a gaseous environment containing 9 % O2 + 0,2 % HCl + 0,08 % SO2 + N2. First the kinetics of corrosion processes for the considered alloy were determined at the temperatures of 900 °C, 1 000 °C and 1 100 °C, which was followed by validation under operating conditions. To do so, the tests were carried out over a distance of 20 000 km. The last stage involved examination of the surfaces after the test drive. The obtained results are the basis for further research in this field.

  13. Development of a high specific stiffness mechanically milled FeAl intermetallic alloy

    Energy Technology Data Exchange (ETDEWEB)

    Baccino, R; San Filippo, D; Martel, P; Moret, F

    1996-12-31

    Powder metallurgy techniques such as gas atomization and mechanical milling have been used to develop a FeAl alloy with enhanced ductility and strength at both low and high temperature. The improvement method combines ductility increase by grain boundary strengthening, grain size reduction and oxide dispersion strengthening. The material has been characterized and tested in the form of extruded bars. Microstructure, order and texture of as-extruded and heat treated samples have been studied by TEM, X-ray diffraction and Moessbauer spectroscopy. Physical and mechanical properties of the material are compared to some conventional engineering alloys in order to discuss the conceivable applications in aeronautical and automotive industries. (authors). 22 refs., 4 figs., 2 tabs.

  14. Nanophase intermetallic FeAl obtained by sintering after mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    D' Angelo, L., E-mail: luisa.dangelo@gmail.co [Departamento de Mecanica, UNEXPO, Luis Caballero Mejias, Charallave (Venezuela, Bolivarian Republic of); D' Onofrio, L. [Facultad de Ciencias, Dpto. Fisica, Universidad Central de Venezuela, Caracas (Venezuela, Bolivarian Republic of); Gonzalez, G., E-mail: gemagonz@ivic.v [Laboratorio de Materiales, Centro Tecnologico, Instituto Venezolano de Investigaciones Cientificas, Apdo. 21827, Caracas 1020A (Venezuela, Bolivarian Republic of)

    2009-08-26

    The preparation of bulk nanophase materials from nanocrystalline powders has been carried out by the application of sintering at high pressure. Fe-50 at.%Al system has been prepared by mechanical alloying for different milling periods from 1 to 50 h, using vials and balls of stainless steel and a ball-to-powder weight ratio (BPR) of 8:1 in a SPEX 8000 mill. Sintering of the 5 and 50 h milled powders was performed under high uniaxial pressure at 700 deg. C. The characterization of powders from each interval of milling was performed by X-ray diffraction, Moessbauer spectroscopy, scanning and transmission electron microscopy. After 5 h of milling formation of a nanocrystalline alpha-Fe(Al) solid solution that remains stable up to 50 h occurs. The grain size decreases to 7 nm after 50 h of milling. The sintering of the milled powders resulted in a nanophase-ordered FeAl alloys with a grain size of 16 nm. Grain growth during sintering was very small due to the effect of the high pressure applied.

  15. Processing and structure of in situ Fe-Al alloys produced by gas tungsten arc welding

    Energy Technology Data Exchange (ETDEWEB)

    Banovic, S.W.; DuPont, J.N.; Marder, A.R. [Lehigh Univ., Bethlehem, PA (United States). Energy Research Center

    1997-02-14

    Iron aluminide weld overlays are being investigated for corrosion and erosion protection of boiler tubes in low NOx burners. The primary objective of the research is to identify overlay compositions which can be deposited in a crack-free condition and provide corrosion protection in moderately reducing environments. In the current phase of work, Fe-Al alloy weld overlays were produced by depositing commercially pure aluminum wire on to low carbon steel substrates using Gas Tungsten Arc Welding. A systematic variation of the wire feed speed and current, two major factors affecting dilution, resulted in a variation in aluminum contents of the welds ranging from 3--42 wt% aluminum. The aluminum content was observed to increase with wire feed speed and a decrease in the current. The aluminum content was also found to affect the cracking susceptibility of the overlays. At 10wt% aluminum, few to no cracks were observed in the deposits. Above this value, cracking was prevalent throughout the weld. In addition, two types of microstructures were found correlating to different concentrations of aluminum. A homogeneous matrix with second phase particles consisting of coarse columnar grains was found for low aluminum concentrations. With higher aluminum contents, a two-phase constituent was observed to surround primary dendrites growing from the substrate. The transition of the microstructures occurred between 24 and 32 wt% Al.

  16. Annealing and thickness effects on magnetic properties of Co2FeAl alloy films

    Science.gov (United States)

    Wang, Ke; Xu, Zhan; Ling, Fujin; Wang, Yahong; Dong, Shuo

    2018-03-01

    Co2FeAl (CFA) films in a wide thickness range between 2 and 100 nm are sputtered at room temperature. Perpendicular magnetic anisotropy (PMA) is achieved in the annealed structure of Pd/CFA/MgO with CFA thickness ranging between 2.3 and 4.9 nm. PMA as high as 2 × 106 erg/cm3 is demonstrated in the structures annealed in the temperature range between 300 and 350 °C. Positive contributions to the PMA made by the interfaces of Pd/CFA and CFA/MgO are identified. For the as-deposited structure of MgO/CFA/Ta with thick CFA alloy up to 5 nm or above a high effective saturation magnetization of 983.9 ± 30.1 emu/cc is derived from the fitting and an in-plane uniaxial magnetic anisotropy of 104 erg/cm3 in magnitude is revealed by angular dependent magnetic measurements. In addition to the increase in saturation magnetization, a fourfold cubic magnetic anisotropy is found to develop with annealing, in line with the improvement of the crystalline structure confirmed by X-ray diffraction measurements. Out results provide some useful information for the design of the CFA-based magnetoelectronic devices.

  17. Plastic anomaly of the B2 ordered Fe-40Al alloy

    International Nuclear Information System (INIS)

    Calonne, O.

    2002-05-01

    The plastic behaviour of Fe-40Al (B2-ordered) alloys was studied. This material has the particularly of exhibiting a yield stress that increases in a given temperature range ('yield stress anomaly'). This anomaly is usually associated with a zero strain rate sensitivity in the very same temperature range. These two peculiarities can be explained as a whole by a thermally activated exhaustion of the mobile dislocations. In this work, the macroscopic mechanical behaviour of the FeAl alloys was first characterised. Then, slip geometry was studied in a large temperature range using oriented single crystals. Finally, the elementary deformation processes were studied through an analysis of dislocation structures in deformed materials using TEM post-mortem and in-situ techniques. Our results show that the yield stress anomaly stems from superdislocations exhaustion through the formation of antiphase boundary tubes, due to vacancy absorption. The number of antiphase boundary tubes produced during dislocation motion depends on vacancy concentration, that in turn increases with temperature. This is believed to be the main reason for thermally activated exhaustion. In addition, the anomaly peak and the related stress fall-off at higher temperatures can be ascribed to superdislocation decomposition, which provides the material with ordinary dislocations that cannot generate antiphase boundary tubes. Superdislocations exhaustion seems to be the catalyzing factor for decomposition. We have proposed a basis for an exhaustion/multiplication model. Considering a classical Frank-Read type multiplication mechanism, we express the yield stress as a function of temperature and we show that this results in an anomaly. Moreover, supposing that boron modifies vacancy migration energy, we suggest that the influence of boron on the stress anomaly stems from an increase of vacancy capture radius by mobile superdislocations. (authors)

  18. The Surface and Bulk Magnetic Properties of Fe-Al Alloys

    Czech Academy of Sciences Publication Activity Database

    Hendrych, A.; Žitovsky, O.; Jirásková, Yvonna; Matko, I.

    2014-01-01

    Roč. 126, č. 1 (2014), s. 58-59 ISSN 0587-4246. [CSMAG Czech and Slovak Conference on Magnetism /15./. Košice, 17.06.2013-21.06.2013] R&D Projects: GA MŠk 7AMB12SK009 Institutional support: RVO:68081723 Keywords : Fe-Al * MOKE * Surface properties * MFM Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.530, year: 2014

  19. Anomalous Hall effect in ion-beam sputtered Co2FeAl full Heusler alloy thin films

    Science.gov (United States)

    Husain, Sajid; Kumar, Ankit; Akansel, Serkan; Svedlindh, Peter; Chaudhary, Sujeet

    2017-11-01

    Investigations of temperature dependent anomalous Hall effect and longitudinal resistivity in Co2FeAl (CFA) thin films grown on Si(1 0 0) at different substrate temperature Ts are reported. The scaling of the anomalous Hall conductivity (AHC) and the associated phenomenological mechanisms (intrinsic and extrinsic) are analyzed vis-à-vis influence of Ts. The intrinsic contribution to AHC is found to be dominating over the extrinsic one. The appearance of a resistivity minimum at low temperature necessitates the inclusion of quantum corrections on account of weak localization and electron-electron scattering effects whose strength reduces with increase in Ts. The study establishes that the optimization of Ts plays an important role in the improvement of atomic ordering which indicates the higher strength of spin-orbit coupling and leads to the dominant intrinsic contribution to AHC in these CFA full Heusler alloy thin films.

  20. Plastic anomaly of the B2 ordered Fe-40Al alloy; Anomalie plastique de l'alliage Fe-40Al ordonne B2

    Energy Technology Data Exchange (ETDEWEB)

    Calonne, O

    2002-05-01

    The plastic behaviour of Fe-40Al (B2-ordered) alloys was studied. This material has the particularly of exhibiting a yield stress that increases in a given temperature range ('yield stress anomaly'). This anomaly is usually associated with a zero strain rate sensitivity in the very same temperature range. These two peculiarities can be explained as a whole by a thermally activated exhaustion of the mobile dislocations. In this work, the macroscopic mechanical behaviour of the FeAl alloys was first characterised. Then, slip geometry was studied in a large temperature range using oriented single crystals. Finally, the elementary deformation processes were studied through an analysis of dislocation structures in deformed materials using TEM post-mortem and in-situ techniques. Our results show that the yield stress anomaly stems from superdislocations exhaustion through the formation of antiphase boundary tubes, due to vacancy absorption. The number of antiphase boundary tubes produced during dislocation motion depends on vacancy concentration, that in turn increases with temperature. This is believed to be the main reason for thermally activated exhaustion. In addition, the anomaly peak and the related stress fall-off at higher temperatures can be ascribed to superdislocation decomposition, which provides the material with ordinary dislocations that cannot generate antiphase boundary tubes. Superdislocations exhaustion seems to be the catalyzing factor for decomposition. We have proposed a basis for an exhaustion/multiplication model. Considering a classical Frank-Read type multiplication mechanism, we express the yield stress as a function of temperature and we show that this results in an anomaly. Moreover, supposing that boron modifies vacancy migration energy, we suggest that the influence of boron on the stress anomaly stems from an increase of vacancy capture radius by mobile superdislocations. (authors)

  1. Synthesis of Fe-Al nanoparticles by hydrogen plasma-metal reaction

    CERN Document Server

    Liu Tong; Li Xing Guo

    2003-01-01

    Fe-Al nanoparticles of eight kinds have been prepared by hydrogen plasma-metal reaction. The morphology, crystal structure, and chemical composition of the nanoparticles obtained were investigated by transmission electron microscopy (TEM), x-ray diffractometry (XRD), and induction-coupled plasma spectroscopy. The particle size was determined by TEM and Brunaumer-Emmet-Teller gas adsorption. It was found that all the nanoparticles have spherical shapes, with average particle size in the range of 29-46 nm. The oxide layer in nanoparticles containing Al after passivation is not observable by XRD and TEM. The Al contents in Fe-Al ultrafine particles are about 1.2-1.5 times those in the master alloys. The evaporation speeds of Al and Fe in Fe-Al alloys are mutually accelerated at a certain composition. The crystal structures of the Fe-Al nanoparticles vary with the composition of the master alloys. Pure Fe sub 3 Al (D0 sub 3) and FeAl (B2) structures are successfully produced with 15 and 25 at.% Al in bulks, respe...

  2. Point defects in B.C.C. Fe-Al, Fe-Co, and Fe-Co-V ordered alloys

    International Nuclear Information System (INIS)

    Riviere, J.P.; Dinhut, J.F.

    1982-01-01

    Radiation damage produced at 20 K by 2.5 MeV electrons is studied in three B 2 type Fe-40 at % Al, Fe-Co, Fe-Co-V ordered alloys. The resistivity damage in Fe-40 at % Al ordered single crystals is found less effective in the directions. The results suggest that replacement collision chains are difficult to propagate along the direction. Frenkel pair creation superimposed with disordering can account for the resistivity damage in the initially ordered Fe-Co alloy. Informations concerning replacement collision sequences in direction are derived. During the recovery of all the alloys, three main stages are observed and an ordering enhancement occurs. (author)

  3. B2-ordered iron-aluminium alloys strengthening. Influence of additions (Ni and B) and microstructure

    International Nuclear Information System (INIS)

    Colas, David

    2004-01-01

    We study the effects of additions (Ni and B) and microstructure on the mechanical behaviour of 40 at. % Al iron-aluminium alloys. From a macroscopic point of view, we show that nickel reinforces FeAl alloys over the whole temperature range, but that it simultaneously leads to emphasize the room temperature brittleness of these alloys through a cleavage stress decrease. We confirm powder metallurgy grain refining interest to enhance yield stress as well as fracture resistance. We show that nickel-induced yield stress effect is additive to 'Hall-Petch' one. Also, we point out that the strengthening phenomena (nickel or grain size) cause the yield stress anomaly, which these alloys usually present, to be hidden. Through a dislocation structures analysis of deformed materials we precise that low temperature nickel-induced solid solution hardening (SSH) cannot be explained on the basis of classical SSH theories but more probably through nickel influence upon the Peierls stress. Moreover, we show that the APB tubes dragging model may be compatible with our microscopic and macroscopic results about the anomaly. Eventually, we put into relation a dynamic super-dislocations multiplication process observation (in situ transmission microscopy) with the nickel-containing alloys tendency to cleavage. (author) [fr

  4. Study of electronic structure and magnetic properties of epitaxial Co{sub 2}FeAl Heusler Alloy Thin Films

    Energy Technology Data Exchange (ETDEWEB)

    Soni, S. [Department of Pure & Applied Physics, University of Kota, Kota 324007 (India); Dalela, S., E-mail: sdphysics@rediffmail.com [Department of Pure & Applied Physics, University of Kota, Kota 324007 (India); Sharma, S.S. [Department of Physics, Govt. Women Engineering College, Ajmer (India); Liu, E.K.; Wang, W.H.; Wu, G.H. [State Key Laboratory for Magnetism, Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Kumar, M. [Department of Physics, Malviya National Institute of Technology, Jaipur-302017 (India); Garg, K.B. [Department of Physics, University of Rajasthan, Jaipur-302004 (India)

    2016-07-25

    This work reports the magnetic and electronic characterization of plane magnetized buried Heusler Co{sub 2}FeAl nano thin films of different thickness by X-ray absorption spectroscopy (XAS) and X-ray magnetic circular dichroism (XMCD) measurements. . The spectra on both Fe- and Co L{sub 2,3} edges show a pronounced magnetic dichroic signal in remanence, corresponding to a ferromagnetically-aligned moments on Fe and Co atoms conditioning the peculiar characteristics of the Co{sub 2}FeAl Heusler compound (a half-metallic ferromagnet). The detailed knowledge of the related magnetic and electronic properties of these samples over a wide range of thickness of films are indispensable for achieving a higher tunnel magnetoresistance ratio, and thus for spintronics device applications. - Highlights: • Electronic structure and Magnetic Properties of Epitaxial Co{sub 2}FeAl Heusler Films. • X-ray absorption spectroscopy (XAS) and X-ray magnetic circular dichroism (XMCD). • Fe- and Co L{sub 2,3} edges show a pronounced magnetic dichroic signal in remanence. • Calculated Orbital, Spin and total magnetic moments of Fe and Co for 30 nm Co{sub 2}FeAl thin film. • The total magnetic moment of Fe at L{sub 2,3} edges increases with the thickness of the Co2FeAl films.

  5. Influence of Molybdenum on the Alloying and Physical Properties of Fe-Al

    Czech Academy of Sciences Publication Activity Database

    Jirásková, Yvonna; Buršík, Jiří; Hapla, Miroslav; Turek, Ilja

    2015-01-01

    Roč. 28, č. 3 (2015), s. 905-910 ISSN 1557-1939 R&D Projects: GA ČR(CZ) GAP108/11/1350; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Nanostructured materials * Mechanical alloying * Magnetic proprties * Grain core * Defects Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.100, year: 2015

  6. Estimation of ductility of Fe-Al alloys by means of small punch test

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Ferdinand; Milička, Karel

    Roč.18, č.7 (2010), s. 1357-1359 ISSN 0966-9795. [Discussion Meeting on the Development of Innovative Iron Aluminium Alloys /5./. Praha, 21.09.2009-24.09.2009] R&D Projects: GA ČR GA106/08/1238 Institutional research plan: CEZ:AV0Z20410507 Keywords : iron aluminides * brittleness * small punch test Subject RIV: JG - Metallurgy Impact factor: 2.327, year: 2010

  7. Studies of atomic diffusion in binary alloys by X-ray photon correlation spectroscopy with particular attention to B2 phases

    International Nuclear Information System (INIS)

    Stana, M.B.

    2015-01-01

    The way single atoms change places in a condensed system determines many of its properties. Insight into the mechanisms controlling such processes, therefore, yields a better understanding of matter which in turn allows for improving fabrication and tailoring of material properties. Intermetallic alloys have many attractive features for industrial applications, such as high specific strength, good corrosion and oxidation resistance and low raw material cost. Their application is, however, still strongly limited by properties such as high brittleness at low temperatures. Methods capable of studying diffusion on an atomistic level have been restricted to high temperatures close to the melting point of intermetallics until now. The new method of atomic- scale X-ray Photon Correlation Spectroscopy provides a means of studying these materials at technically relevant working temperatures. This thesis demonstrates the application of this new technique to binary intermetallic alloys. In the first part the theoretical concepts underlying atomic-scale X-ray Photon Correlation Spectroscopy such as correlation, rate equations, scattering and reciprocal space will be tho- roughly discussed. As computer simulation techniques play an important role in data evaluation, a chapter is dedicated to this topic. The experimental preconditions are then treated. The last chapters are devoted to the presentation of experimental results. It is shown that a new diffusion mechanism is required to explain atomic hops at relatively low temperature in a B2 Fe-Al alloy with a few percent of excess Fe, while in a B2 Ag-Mg alloy with excess Ag commonly known mechanisms can explain the observed diffusion behavior. (author) [de

  8. Why is the slip direction different in different B2 alloys?

    Czech Academy of Sciences Publication Activity Database

    Lin, Y.-S.; Cak, M.; Paidar, Václav; Vitek, V.

    2012-01-01

    Roč. 60, č. 3 (2012), s. 881-888 ISSN 1359-6454 R&D Projects: GA AV ČR IAA100100920 Institutional research plan: CEZ:AV0Z10100520 Keywords : B2 ordered alloys * slip direction * dislocations * gamma-surface * elastic anisotropy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.941, year: 2012

  9. Microstructure and magnetism of Co2FeAl Heusler alloy prepared by arc and induction melting compared with planar flow casting

    Science.gov (United States)

    Titov, A.; Jiraskova, Y.; Zivotsky, O.; Bursik, J.; Janickovic, D.

    2018-04-01

    This paper is devoted to investigations of the structural and magnetic properties of the Co2FeAl Heusler alloy produced by three technologies. The alloys prepared by arc and induction melting have resulted in coarse-grained samples in contrast to the fine-grained ribbon-type sample prepared by planar flow casting. Scanning electron microscopy completed by energy dispersive X-ray spectroscopy, X-ray diffraction, Mössbauer spectroscopy, and magnetic methods sensitive to both bulk and surface were applied. The chemical composition was slightly different from the nominal only for the ribbon sample. From the viewpoint of magnetic properties, the bulk coercivity and remnant magnetization have followed the structure influenced by the technology used. Saturation magnetization was practically the same for samples prepared by arc and induction melting, whereas the magnetization of ribbon is slightly lower due to a higher Al content at the expense of iron and cobalt. The surface magnetic properties were markedly influenced by anisotropy, grain size, and surface roughness of the samples. The surface roughness and brittleness of the ribbon-type sample did not make domain structure observation possible. The other two samples could be well polished and their highly smooth surface has enabled domain structure visualization by both magneto-optical Kerr microscopy and magnetic force microscopy.

  10. B2 intermetallic compounds of Zr. New class of the shape memory alloys

    International Nuclear Information System (INIS)

    Koval, Yu.N.; Delaey, L.; Jang, W.Y.

    1995-01-01

    It is known that the B2 equiatomic intermetallic compounds of Zr (ZrCo-based) undergo a martensitic transformation (MT) with wide temperature hysteresis. It was found that the MT is accompanied by the perfect shape memory effect (SME) for ZrCu and ZrRh. In this report we represent the results of structural analysis, electrical resistivity, calorimetric and SME measurements for ZrCu- and ZrCo-based compounds. Interrelation between structural, thermodynamical parameters of MT and SME in this alloys will be described. The shape memory aspects of this potential alloys for the application at high temperatures will be discussed. (orig.)

  11. Site preference and elastic properties of ternary alloying additions in B2 YAg alloys by first-principles calculations

    Energy Technology Data Exchange (ETDEWEB)

    Wu Yurong, E-mail: winwyr@126.com [College of Electromechanical Engineering, Hunan University of Science and Technology, Xiantang 411201 (China); Hu Wangyu [Department of Applied Physics, Hunan University, Changsha 410082 (China); Xu Longshan [Department of Materials Science and Engineering, Xiamen University of Technology, Xiamen 361024 (China)

    2012-09-15

    First-principles calculations were preformed to study the site preference behavior and elastic properties of 3d (Ti-Cu) transition-metal elements in B2 ductility YAg alloy. In YAg, Ti is found to occupy the Y sublattice whereas V, Cr, Co, Fe, Ni and Cu tend to substitute for Ag sublattice. Due to the addition of 3d transition metals, the lattice parameters of YAg is decreased in the order: Valloy, and Fe is the most effective element to improve the ductility of YAg, while Ti, Ni and V alloying elements can reduce the ductility of YAg alloy, especially, V transforms ductile into brittle for YAg alloy. In addition, both V and Ni alloying elements can increase the hardness of YAg alloy, and Y{sub 8}Ag{sub 7}V is harder than Y{sub 8}Ag{sub 7}Ni.

  12. The formation of AlB2 in an Al-B master alloy

    International Nuclear Information System (INIS)

    Wang Xiaoming

    2005-01-01

    The formation of borides in an Al-3 wt.%B master alloy, produced via chemical reactions of KBF 4 and aluminium has been investigated. The chemical reactions produce boron, which dissolves into molten aluminium and subsequently forms aluminium borides. Backscattered electron imaging (BEI) of the Al-3 wt.%B master alloy under a scanning electron microscope (SEM) revealed the presence of two types of phases that contain different levels of boron. Combined with X-ray diffraction (XRD) results, the two types of phases are identified as AlB 2 on AlB 12 . This gives a direct evidence for a peritectic reaction of AlB 12 and aluminium, which produces AlB 2 . The thermodynamic properties of the reactions that may be involved are examined, and the presence of AlB 12 phase in the master alloy explained. The observed microstructure is explained according to the peritectic reaction in an Al-B phase diagram. The stability of AlB 2 and AlB 12 at lower temperature than 975 deg. C is clarified

  13. Phase transformations in the B2 phase of Co-rich Co-Al binary alloys

    International Nuclear Information System (INIS)

    Niitsu, K.; Omori, T.; Nagasako, M.; Oikawa, K.; Kainuma, R.; Ishida, K.

    2011-01-01

    Research highlights: → Bainitic transformation and a martensite-like structure from B2-CoAl were observed depending on quenching rate. → The phase separation into the metastable A2 + B2 structure was found in the as-quenched B2-CoAl. → The two-phase structure of A2 and B2 was found to show some coercive force after aging under a magnetic field. - Abstract: Phase transformations in the β (B2) phase of Co-21 and -23 at.% Al alloys were examined using transmission electron microscopy, energy dispersive X-ray spectroscopy and differential scanning calorimetry. The microstructures obtained from as-quenched specimens were found to be strongly affected by the quenching condition. While relatively thick sheet-specimens with a lower quenching rate showed bainitic plate precipitates with a fcc structure, a martensite-like structure was observed by optical microscopy in relatively thin specimens with a higher quenching rate. Regardless of the quenching condition, a spinodal-like microstructure composed of A2 and B2 phases was also detected and the A2 phase changed to a metastable hcp phase during further aging.

  14. Manipulating magnetic anisotropy of the ultrathin Co{sub 2}FeAl full-Heusler alloy film via growth orientation of the Pt buffer layer

    Energy Technology Data Exchange (ETDEWEB)

    Wen, F.S., E-mail: wenfsh03@126.com [State Key Lab of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Xiang, J.Y.; Hao, C.X.; Zhang, F.; Lv, Y.F. [State Key Lab of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China); Wang, W.H. [Institute of Physics, Chinese Academy of Science, Beijing 100080 (China); Hu, W.T.; Liu, Z.Y. [State Key Lab of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China)

    2013-12-15

    The ultrathin films of Co{sub 2}FeAl (CFA) full-Heusler alloy were prepared between two Pt layers on MgO single crystals by magnetron sputtering. By controlling the substrate temperature, different growth orientations of the Pt underlayers were realized, and their effects were investigated on the magnetic anisotropy of the ultrathin CFA film. It was revealed that different Pt orientations lead to distinctly different magnetic anisotropy for the sandwiched ultrathin CFA films. The Pt (111) orientation favors the perpendicular anisotropy, while the appearance of partial Pt (001) orientation leads to the quick decrease of perpendicular anisotropy and the complete Pt (001) orientation gives rise to the in-plane anisotropy. With the Pt (111) orientation, the temperature and thickness-induced spin reorientation transitions were investigated in the sandwiched ultrathin CFA films. - Highlights: • Different Pt orientations lead to different magnetic anisotropy for sandwiched ultrathin CFA films. • The Pt (111) orientation favors the perpendicular anisotropy for CFA layer. • Temperature and thickness-induced spin reorientation transitions were investigated in sandwiched ultrathin CFA films. • 0.8 nm CFA film is good candidate as electrode in magnetic tunnel junctions.

  15. Manipulating magnetic anisotropy of the ultrathin Co2FeAl full-Heusler alloy film via growth orientation of the Pt buffer layer

    International Nuclear Information System (INIS)

    Wen, F.S.; Xiang, J.Y.; Hao, C.X.; Zhang, F.; Lv, Y.F.; Wang, W.H.; Hu, W.T.; Liu, Z.Y.

    2013-01-01

    The ultrathin films of Co 2 FeAl (CFA) full-Heusler alloy were prepared between two Pt layers on MgO single crystals by magnetron sputtering. By controlling the substrate temperature, different growth orientations of the Pt underlayers were realized, and their effects were investigated on the magnetic anisotropy of the ultrathin CFA film. It was revealed that different Pt orientations lead to distinctly different magnetic anisotropy for the sandwiched ultrathin CFA films. The Pt (111) orientation favors the perpendicular anisotropy, while the appearance of partial Pt (001) orientation leads to the quick decrease of perpendicular anisotropy and the complete Pt (001) orientation gives rise to the in-plane anisotropy. With the Pt (111) orientation, the temperature and thickness-induced spin reorientation transitions were investigated in the sandwiched ultrathin CFA films. - Highlights: • Different Pt orientations lead to different magnetic anisotropy for sandwiched ultrathin CFA films. • The Pt (111) orientation favors the perpendicular anisotropy for CFA layer. • Temperature and thickness-induced spin reorientation transitions were investigated in sandwiched ultrathin CFA films. • 0.8 nm CFA film is good candidate as electrode in magnetic tunnel junctions

  16. Atomistic simulation of the point defects in B2-type MoTa alloy

    International Nuclear Information System (INIS)

    Zhang Jianmin; Wang Fang; Xu Kewei; Ji, Vincent

    2009-01-01

    The formation and migration mechanisms of three different point defects (mono-vacancy, anti-site defect and interstitial atom) in B 2 -type MoTa alloy have been investigated by combining molecular dynamics (MD) simulation with modified analytic embedded-atom method (MAEAM). From minimization of the formation energy, we find that the anti-site defects Mo Ta and Ta Mo are easier to form than Mo and Ta mono-vacancies, while Mo and Ta interstitial atoms are difficult to form in the alloy. In six migration mechanisms of Mo and Ta mono-vacancies, one nearest-neighbor jump (1NNJ) is the most favorable due to its lowest activation and migration energies, but it will cause a disorder in the alloy. One next-nearest-neighbor jump (1NNNJ) and one third-nearest-neighbor jump (1TNNJ) can maintain the ordered property of the alloy but require higher activation and migration energies, so the 1NNNJ and 1TNNJ should be replaced by straight [1 0 0] six nearest-neighbor cyclic jumps (S[1 0 0]6NNCJ) or bent [1 0 0] six nearest-neighbor cyclic jumps (B[1 0 0]6NNCJ) and [1 1 0] six nearest-neighbor cyclic jumps ([1 1 0]6NNCJ), respectively. Although the migrations of Mo and Ta interstitial atoms need much lower energy than Mo and Ta mono-vacancies, they are not main migration mechanisms due to difficult to form in the alloy.

  17. High-temperature deformation of B2 NiAl-base alloys

    International Nuclear Information System (INIS)

    Lee, I.G.; Ghosh, A.K.

    1994-01-01

    The high-temperature deformation behavior of three rapidly solidified and processed NiAl-base alloys--NiAl, NiAl containing 2 pct TiB 2 , and NiAl containing 4 pct HfC--have been studied and their microstructural and textural changes during deformation characterized. Compressions tests were conducted at 1,300 and 1,447 K at strain rates ranging from 10 -6 to 10 -2 s -1 . HfC-containing material showed dispersion strengthening as well as some degree of grain refinement over NiAl, while TiB 2 dispersoid-containing material showed grain refinement as well as secondary recrystallization and did not improve high-temperature strength. Hot-pack rolling was also performed to develop thin sheet materials (1.27-mm thick) and from these alloys. Without dispersoids, NiAl rolled easily at 1,223 K and showed low flow stress and good ductility during the hot-rolling operation. Rolling of dispersoid-containing alloys was difficult due to strain localization and edge-cracking effects, resulting partly from the high flow stress at the higher strain rate during the rolling operation. Sheet rolling initially produced a {111} texture, which eventually broke into multiple-texture components with severe deformation

  18. Superconducting properties of MgB2 particle impregnated with Mg-based alloys

    International Nuclear Information System (INIS)

    Shimizu, Yusuke; Matsuda, Kenji; Mizutani, Manabu; Nishimura, Katsuhiko; Kawabata, Tokimasa; Ikeno, Susumu; Hishinuma, Yoshimitsu; Aoyama, Shigeki

    2011-01-01

    The three-dimensional penetration method combined with semi-solid casting (SS-3DPC) was utilized to prepare magnesium diboride (MgB 2 ) powder composite materials with various host materials of Mg, Mg-3%Al, Mg-3%Al-1%Zn, Mg-9%Al, and Mg-9%Al-1%Zn. X-ray diffraction measurements indicated predominant peak patterns of MgB 2 and a host alloy, implying that the host material tightly bonded MgB 2 grains without melting the MgB 2 powder. This was confirmed by SEM images. Measured electrical resistivity and magnetization versus temperature showed clear signals of superconducting transition temperature of 27-38 K for all the samples cut out from the billets. Magnetic hysteresis loop observed at 5 K enabled us to estimate a critical current density (J c ) based on the extended Bean model. Additions of aluminum and zinc elements to magnesium host-matrix were found to enhance J c and increase residual resistivity (ρ 0 ) suggesting that aluminum and zinc have an effect on pinning magnetic flux flow for J c enhancement, and scattering conduction electrons for increase of ρ 0 . (author)

  19. Atomic site occupancies and magnetic properties of Ni-doped FeAl intermetallic compounds

    CERN Document Server

    Ko, K Y; Yoon, S

    1999-01-01

    Neutron and X-ray powder diffraction revealed FeAl sub 1 sub - sub x Ni sub x alloys to have the B2(CsCl) structure with a virtually constant lattice parameter of 2.91 A and with the Ni atoms preferring the Fe sites. The annealed specimens showed paramagnetism for x 0.25 whereas the rapidly solidified specimens showed superparamagnetism for x = 0.25. The magnetization increased as the Ni concentration (x) increased. The rapidly solidified specimens, in general, showed stronger magnetic properties than the annealed ones. The magnetic properties were explained in terms of the local environmental model for magnetic atoms.

  20. B2 Grain Growth Behavior of a Ti-22Al-25Nb Alloy Fabricated by Hot Pressing Sintering

    Science.gov (United States)

    Jia, Jianbo; Liu, Wenchao; Xu, Yan; Chen, Chen; Yang, Yue; Luo, Junting; Zhang, Kaifeng

    2018-05-01

    Grain growth behavior of a powder metallurgy (P/M) Ti-22Al-25Nb alloy was investigated by applying a series of isothermal treatment tests over a wide range of temperatures and holding times. An isothermal treatment scheme was conducted in the B2 phase region (1070-1110 °C) and α 2 + B2 phase region (1010-1050 °C) at holding times of 10, 30 min, 1, 2, and 3 h, respectively. The effects of temperature and holding time on the microstructure evolution and microhardness of the P/M Ti-22Al-25Nb alloy at elevated temperatures were evaluated using optical microscope, scanning electron microscope, x-ray diffraction, and Vickers hardness test techniques. The results revealed that the alloy's treated microstructure was closely linked to temperature and holding time, respectively. The change law of B2 grain growth with holding time and temperature can be well interpreted by the Beck equation and Hillert equation, respectively. The B2 grain growth exponent n and activation energy Q were acquired based on experimental data in the α 2 + B2 and B2 phase regions. In addition, the grain growth contour map for the P/M Ti-22Al-25Nb alloy was constructed to depict variations in B2 grain size based on holding time and temperature.

  1. Synthesis of Mo5SiB2 based nanocomposites by mechanical alloying and subsequent heat treatment

    International Nuclear Information System (INIS)

    Abbasi, A.R.; Shamanian, M.

    2011-01-01

    Research highlights: → α-Mo-Mo 5 SiB 2 nanocomposite was produced after 20 h milling of Mo-Si-B powders. → Heat treatment of 5 h MAed powders led to the formation of boride phases. → Heat treatment of 10 h MAed powders led to the formation of Mo 5 SiB 2 phase. → By increasing heat treatment time, quantity of Mo 5 SiB 2 phase increased. → 5 h heat treatment of 20 h MAed powders led to the formation of Mo 5 SiB 2 -based composite. - Abstract: In this study, systematic investigations were conducted on the synthesis of Mo 5 SiB 2 -based alloy by mechanical alloying and subsequent heat treatment. In this regard, Mo-12.5 mol% Si-25 mol% B powder mixture was milled for different times. Then, the mechanically alloyed powders were heat treated at 1373 K for 1 h. The phase transitions and microstructural evolutions of powder particles during mechanical alloying and heat treatment were studied by X-ray diffractometry and scanning electron microscopy. The results showed that the phase evolutions during mechanical alloying and subsequent heat treatment are strongly dependent on milling time. After 10 h of milling, a Mo solid solution was formed, but, no intermetallic phases were detected at this stage. However, an α-Mo-Mo 5 SiB 2 nanocomposite was formed after 20 h of milling. After heat treatment of 5 h mechanically alloyed powders, small amounts of MoB and Mo 2 B were detected and α-Mo-MoB-Mo 2 B composite was produced. On the other hand, heat treatment of 10 h and 20 h mechanically alloyed powders led to the formation of an α-Mo-Mo 5 SiB 2 -MoSi 2 -Mo 3 Si composite. At this point, there is a critical milling time (10 h) for the formation of Mo 5 SiB 2 phase after heat treatment wherein below that time, boride phase and after that time, Mo 5 SiB 2 phase are formed. In the case of 20 h mechanically alloyed powders, by increasing heat treatment time, not only the quantity of α-Mo was reduced and the quantity of Mo 5 SiB 2 was increased, but also new boride

  2. Preparation and characterization of highly L21-ordered full-Heusler alloy Co2FeAl0.5Si0.5 thin films for spintronics device applications

    International Nuclear Information System (INIS)

    Wang Wenhong; Sukegawa, Hiroaki; Shan Rong; Furubayashi, Takao; Inomata, Koichiro

    2008-01-01

    We report the investigation of structure and magnetic properties of full-Heusler alloy Co 2 FeAl 0.5 Si 0.5 (CFAS) thin films grown on MgO-buffered MgO (001) substrates through magnetron sputtering. It was found that single-crystal CFAS thin films with high degree of L2 1 ordering and sufficiently flat surface could be obtained after postdeposition annealing. All the films show a distinct uniaxial magnetic anisotropy with the easy axis of magnetization along the in-plane [110] direction. These results indicate that the use of the MgO buffer for CFAS is a promising approach for achieving a higher tunnel magnetoresistance ratio, and thus for spintronics device applications

  3. Modified embedded-atom method interatomic potential for the Fe-Al system

    International Nuclear Information System (INIS)

    Lee, Eunkoo; Lee, Byeong-Joo

    2010-01-01

    An interatomic potential for the Fe-Al binary system has been developed based on the modified embedded-atom method (MEAM) potential formalism. The potential can describe various fundamental physical properties of Fe-Al binary alloys-structural, elastic and thermodynamic properties, defect formation behavior and interactions between defects-in reasonable agreement with experimental data or higher-level calculations. The applicability of the potential to atomistic investigations of various defect formation behaviors and their effects on the mechanical properties of high aluminum steels as well as Fe-Al binary alloys is demonstrated.

  4. The free growth criterion for grain initiation in TiB 2 inoculated γ-titanium aluminide based alloys

    Science.gov (United States)

    Gosslar, D.; Günther, R.

    2014-02-01

    γ-titanium aluminide (γ-TiAl) based alloys enable for the design of light-weight and high-temperature resistant engine components. This work centers on a numerical study of the condition for grain initiation during solidification of TiB2 inoculated γ-TiAl based alloys. Grain initiation is treated according to the so-called free growth criterion. This means that the free growth barrier for grain initiation is determined by the maximum interfacial mean curvature between a nucleus and the melt. The strategy presented in this paper relies on iteratively increasing the volume of a nucleus, which partially wets a hexagonal TiB2 crystal, minimizing the interfacial energy and calculating the corresponding interfacial curvature. The hereby obtained maximum curvature yields a scaling relation between the size of TiB2 crystals and the free growth barrier. Comparison to a prototypical TiB2 crystal in an as cast γ-TiAl based alloy allowed then to predict the free growth barrier prevailing under experimental conditions. The validity of the free growth criterion is discussed by an interfacial energy criterion.

  5. Theoretical study of superconductivity in MgB 2 and its alloys

    Indian Academy of Sciences (India)

    total density of states (DOS) and; the partial DOS around the Fermi energy, F, clearly show the importance of B -electrons for superconductivity. For BeB2 and NaB2, our results indicate qualitative similarities but significant quantitative differences in their electronic structure due to differences in the number of valence ...

  6. Impact of the B2 ordering behavior on the mechanical properties of a FeCoMo alloy

    Energy Technology Data Exchange (ETDEWEB)

    Turk, C., E-mail: chris.turk@unileoben.ac.at [Montanuniversität Leoben, Department of Physical Metallurgy and Materials Testing, Franz-Josef Straße 18, 8700 Leoben (Austria); Leitner, H.; Kellezi, G. [Böhler Edelstahl GmbH & Co KG, Mariazellerstraße 25, 8605 Kapfenberg (Austria); Clemens, H. [Montanuniversität Leoben, Department of Physical Metallurgy and Materials Testing, Franz-Josef Straße 18, 8700 Leoben (Austria); Gan, W.M.; Staron, P. [German Engineering Materials Science Centre, Helmholtz-Zentrum Geesthacht, D-21502 Geesthacht (Germany); Primig, S. [Montanuniversität Leoben, Department of Physical Metallurgy and Materials Testing, Franz-Josef Straße 18, 8700 Leoben (Austria)

    2016-04-26

    A Fe - 25 at% Co - 9 at% Mo alloy can be hardened by nm-sized (Fe, Co){sub 7}Mo{sub 6} µ-phase precipitates which is accomplished by solution annealing in the austenite region followed by rapid quenching to room temperature and subsequent aging below the austenite transition temperature. In overaged condition the Mo-content in the remaining matrix drops towards zero and, therefore, the matrix consist of 71 at% Fe and 29 at% Co. The binary Fe-Co system shows a disorder-order, A2↔B2 transition at a critical ordering temperature between 25 at% and 72 at% Co. It is expected that the remaining matrix of an overaged Fe - 25 at% Co - 9 at% Mo alloy also exhibits such an ordering reaction. It will be demonstrated that the formation of a B2 ordered FeCo phase can be delayed or completely prevented by rapid quenching from temperatures above the critical ordering temperature. This has a strong impact on the mechanical properties of this alloy which have been studied by means of tensile, impact toughness and hardness testing. The evidence for a disorder-order transition in this alloy has been given by neutron diffraction as well as high resolution transmission electron microscopy.

  7. Effects of B2 precipitate size on transformation-induced plasticity of Cu–Zr–Al glassy alloys

    Energy Technology Data Exchange (ETDEWEB)

    Kuo, C.N. [Department of Materials and Optoelectronic Science, Center for Nanoscience and Nanotechnology, National Sun Yat-Sen University, Kaohsiung 804, Taiwan, ROC (China); Huang, J.C., E-mail: jacobc@mail.nsysu.edu.tw [Department of Materials and Optoelectronic Science, Center for Nanoscience and Nanotechnology, National Sun Yat-Sen University, Kaohsiung 804, Taiwan, ROC (China); Li, J.B.; Jang, J.S.C. [Institute of Materials Science and Engineering, Department of Mechanical Engineering, National Central University, Chung-Li, Taiwan, ROC (China); Lin, C.H. [Department of Mechanical and Electromechanical Engineering, National Sun Yat-Sen University, Kaohsiung 804, Taiwan, ROC (China); Nieh, T.G. [Department of Materials and Optoelectronic Science, Center for Nanoscience and Nanotechnology, National Sun Yat-Sen University, Kaohsiung 804, Taiwan, ROC (China); Department of Materials Science and Engineering, The University of Tennessee, Knoxville, TN 37996 (United States)

    2014-03-25

    Highlights: • This paper addresses the effects of the CuZr B2 size and distribution on plasticity. • There is a critical size to induce the martensitic/twinning transformation. • An analytic model based on melt flow dynamics is settled. -- Abstract: To demonstrate the effect of processing on the microstructure and subsequent mechanical property of bulk metallic glasses, we prepared two alloys, Cu{sub 47.5}Zr{sub 47.5}Al{sub 5} and Cu{sub 47.5}Zr{sub 48}Al{sub 4}Co{sub 0.5}, using two different designs of suction mold – one with a sharp inlet and one with a blunt inlet. The two alloys have been demonstrated previously to be ductile via phase transformation of the B2 phase and twin formation during plastic deformation. Microstructures of the as-cast as well plastically deformed samples, in particular, the size and distribution of the B2 phase, were examined using X-ray diffraction, scanning and transmission electron microscopy. Compressive tests were conducted on samples cast by different molds and their properties were found to closely correlate with the B2 morphology. Fluid dynamics during suction casting was also analyzed. Effects of Vena contracta, flow velocity, and Reynolds number were discussed and compared favorably with experimental observations.

  8. A comparative study of ausforming of shape memory alloys with A2 and B2 structures

    International Nuclear Information System (INIS)

    Hornbogen, E.

    1999-01-01

    Ausforming implies plastic deformation of austenite (β) at temperatures T AF M d , at which no stress- or strain-induced transformation can occur. It introduces a variety of extrinsic lattice defects, which in turn modify the course of transformation, the structure of martensite, and increase the conventional strength of the alloys. The temperature range of ausforming has to be subdivided into three subranges, depending on whether the β-phase is (1), disordered; (2), ordered; or (3) capable of precipitation of a second phase or massive transformation. For the Cu-base alloys the ranges 1 and 3, and for Ni-Ti 2 and 3 may apply. This causes a different hot-deformation behavior of the two types of alloys: the formation of dislocation groupings (2-d, 3-d-nets, and Moires) in the brass-type alloys which undergo ordering during cooling from T AF. In addition a particular twinning mechanism and the formation of a rolling texture are found in ordered Ni-Ti. In Ni-Ti-alloys premartensitic R-phase formation can be caused by ausforming. Ausforming leads to lower temperatures but not to suppression of martensitic transformation cycles. Conventional strength is increased in both types of alloys. (orig.)

  9. Formation of Al{sub 2}O{sub 3}/FeAl coatings on a 9Cr-1Mo steel, and corrosion evaluation in flowing Pb-17Li loop

    Energy Technology Data Exchange (ETDEWEB)

    Majumdar, Sanjib, E-mail: sanjib@barc.gov.in [High Temperature Materials Development Section, Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Paul, Bhaskar [High Temperature Materials Development Section, Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Chakraborty, Poulami [Materials Science Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Kishor, Jugal; Kain, Vivekanand [High Temperature Materials Development Section, Materials Processing & Corrosion Engineering Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Dey, Gautam Kumar [Materials Science Division, Bhabha Atomic Research Centre, Trombay, Mumbai (India); Materials Group, Bhabha Atomic Research Centre, Trombay, Mumbai (India)

    2017-04-01

    Iron aluminide coating layers were formed on a ferritic martensitic grade 9Cr-1Mo (P 91) steel using pack aluminizing process. The formation of different aluminide compositions such as orthorhombic-Fe{sub 2}Al{sub 5}, B2-FeAl and A2-Fe(Al) on the pack chemistry and heat treatment conditions have been established. About 4–6 μm thick Al{sub 2}O{sub 3} scale was formed on the FeAl phase by controlled heat treatment. The corrosion tests were conducted using both the FeAl and Al{sub 2}O{sub 3}/FeAl coated specimens in an electro-magnetic pump driven Pb-17Li Loop at 500 °C for 5000 h maintaining a flow velocity of 1.5 m/s. The detailed characterization studies using scanning electron microscopy, back-scattered electron imaging and energy dispersive spectrometry revealed no deterioration of the coating layers after the corrosion tests. Self-healing oxides were formed at the cracks generated in the aluminide layers during thermal cycling and protected the base alloy (steel) from any kind of elemental dissolution or microstructural degradation. - Highlights: •Al{sub 2}O{sub 3}/FeAl coating produced on P91 steel by pack aluminizing and heat treatment. •Corrosion tests of coated steel conducted in flowing Pb-17Li loop at 500 °C for 5000 h. •Coating was protective against molten metal corrosion during prolonged exposure. •Self-healing protective oxides formed in the cracks generated in aluminide layers.

  10. Stress/strain characteristics of Cu alloy sheath in situ processed MgB2 superconducting wires

    International Nuclear Information System (INIS)

    Katagiri, Kazumune; Kasaba, Koichi; Shoji, Yoshitaka

    2005-01-01

    The mechanical properties of copper and copper alloy (Cu-Zr, Cu-Be and Cu-Cr) sheath in situ PIT-processed MgB 2 superconducting wires were studied at room temperature (RT) and 4.2 K. The effects of stress-strain on the critical current (I c ) of the wires have also been studied at 4.2 K and in magnetic fields up to 5 T. It has been clarified that alloying the Cu sheath significantly increases the yield and flow stresses of the wires at both RT and 4.2 K. The 0.5% flow stresses of the Cu alloy sheath wire were 147-237 MPa, whereas that of Cu was 55 MPa. At RT, serration corresponding to multiple cracking was observed around a strain of 0.4% and the stress-strain curves saturated beyond that point. The strain dependence of I c prior to the critical strain (ε irr ) was different depending on the magnetic field; being almost constant at 2 T and increasing with strain at 5 T. The I c decreased beyond ε irr , which is much larger for Cu alloy sheath wires as compared to Cu sheath wire. This is due to the difference in the residual compressive strain in the MgB 2 core during cooling from the heat-treatment temperature to 4.2 K, which is determined through relaxation by yielding in the sheath materials. The transverse compression tests revealed that the I c of the Cu alloy sheath wire did not degrade up to 314 MPa, which is also higher than that of Cu sheath wire. (author)

  11. Effect of an interface Mg insertion layer on the reliability of a magnetic tunnel junction based on a Co{sub 2}FeAl full-Heusler alloy

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Jungmin; Kil, Gyuhyun; Lee, Gaehun; Choi, Chulmin; Song, Yunheub [Hanyang University, Seoul (Korea, Republic of); Sukegawa, Hiroaki; Mitani, Seiji [National Institute for Materials Science, Ibaraki (Japan)

    2014-04-15

    The reliability of a magnetic tunnel junction (MTJ) based on a Co{sub 2}FeAl (CFA) full-Heusler alloy with a MgO tunnel barrier was evaluated. In particular, the effect of a Mg insertion layer under the MgO was investigated in view of resistance drift by using various voltage stress tests. We compared the resistance change during constant voltage stress (CVS) and confirmed a trap/detrap phenomenon during the interval stress test for samples with and without a Mg insertion layer. The MTJ with a Mg insertion layer showed a relatively small resistance change for the CVS test and a reduced trap/detrap phenomenon for the interval stress test compared to the sample without a Mg insertion layer. This is understood to be caused by the improved crystallinity at the bottom of the CFA/MgO interface due to the Mg insertion layer, which provides a smaller number of trap site during the stress test. As a result, the interface condition of the MgO layer is very important for the reliability of a MTJ using a full-Heusler alloy, and the the insert of a Mg layer at the MgO interface is expected to be an effective method for enhancing the reliability of a MTJ.

  12. Laser surface alloying (LSA) of aluminium (AA 1200) with TiB2 for hardness improvement

    CSIR Research Space (South Africa)

    Popoola, AP

    2010-10-01

    Full Text Available The present work deals with the development of Aluminium metal matrix composite (MMC) using TiB2 reinforcement. The aim is to improve the microhardness property of the substrate. The surface of the aluminium was sand blasted to improve its laser...

  13. NMR relaxation rates and Knight shifts in the alloy Mg1-xAlxB2

    International Nuclear Information System (INIS)

    Serventi, S; Allodi, G; Bucci, C; Renzi, R De; Guidi, G; Pavarini, E; Manfrinetti, P; Palenzona, A

    2003-01-01

    We measured the 27 Al and 11 B NMR spin lattice relaxation rates and the isotropic Knight shifts in powder samples of Mg 1-x Al x B 2 , as a function of the Al concentration, x. The temperature independence of the Knight shifts and the linear temperature dependence of the relaxation are verified throughout the compositions explored. The variation with x of the measured quantities is discussed in terms of the projected densities of states at the Fermi energy, finding good qualitative as well as quantitative agreement with recent band structure calculations

  14. Crystallization behavior and the thermal properties of Zr63Al7.5Cu17.5Ni10B2 bulk amorphous alloy

    International Nuclear Information System (INIS)

    Jang, J.S.C.; Chang, L.J.; Jiang, Y.T.; Wong, P.W.

    2003-01-01

    The ribbons of amorphous Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys with 0.1 mm thickness were prepared by melt spinning method. The thermal properties and micro structural development during the annealing of amorphous alloy have been investigated by a combination of differential thermal analysis, differential scanning calorimetry, high-temperature optical microscope, X-ray diffractometry and TEM. The glass transition temperature for the Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloys are measured about 645 K (372 C). This alloy also obtains a large temperature interval ΔT x about 63 K. Meanwhile, the calculated T rg for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy presents the value of 0.57. The activation energy of crystallization for the alloy Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 was about 370± 10 kJ/mole as determined by the Kissinger and Avrami plot, respectively. These values are about 20% higher than the activation energy of crystallization for the Zr 65 Al 7.5 Cu 17.5 Ni 10 alloy (314 kJ/mol.). This implies that the boron additions exhibit the effect of improving the thermal stability for the Zr-based alloy. The average value of the Avrami exponent n were calculated to be 1.75±0.15 for Zr 63 Al 7.5 Cu 17.5 Ni 10 B 2 alloy. This indicates that this alloy presents a crystallization process with decreasing nucleation rate. (orig.)

  15. The effect of TiB2 reinforcement on the mechanical properties of an Al-Cu-Li alloy-based metal-matrix composite

    Science.gov (United States)

    Langan, T. J.; Pickens, J. R.

    1991-01-01

    Weldalite 049, an Al-base Cu-Li-Mg-Ag-Zr alloy, achieves 700 MPa tensile strengths in the near-peak-aged temper in virtue of the nucleation of a T(1)-type platelike strengthening precipitate. Attention is presently given to the possibility that the alloy's modulus could be further increased through the addition of high-modulus TiB2 particles, using the 'XD' process, due to TiB2's good wettability with liquid Al. An 8-percent modulus increase is obtained with 4 vol pct TiB2.

  16. Solid-state reactions during mechanical milling of Fe-Al under nitrogen atmosphere

    Czech Academy of Sciences Publication Activity Database

    Jirásková, Yvonna; Buršík, Jiří; Čížek, J.; Jančík, D.

    2013-01-01

    Roč. 568, AUG (2013), s. 106-111 ISSN 0925-8388 R&D Projects: GA ČR(CZ) GAP108/11/1350 Institutional support: RVO:68081723 Keywords : milling * mechanical alloying * Mössbauer phase analysis * Fe-Al alloy * microstructure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.726, year: 2013

  17. Effect of hydrogen on formation of Fe-Al nanoparticles by mechanical milling

    Czech Academy of Sciences Publication Activity Database

    Lukáč, F.; Čížek, J.; Jirásková, Yvonna; Procházka, I.; Vlček, M.; Švec, P.; Janičkovič, D.

    2014-01-01

    Roč. 29, Dec. (2014), s. 23-28 ISSN 1661-9897 R&D Projects: GA ČR(CZ) GAP108/11/1350; GA MŠk 7AMB12SK009 Institutional support: RVO:68081723 Keywords : Fe-Al alloy * defects * mechanical alloying * hydrogen Subject RIV: BM - Solid Matter Physics ; Magnetism

  18. Microstructure and corrosion resistance of TC2 Ti alloy by laser cladding with Ti/TiC/TiB_2 powders

    International Nuclear Information System (INIS)

    Diao, Yunhua; Zhang, Kemin

    2015-01-01

    Highlights: • A TiC/TiB_2 composite coating was produced onto a TC2 Ti alloy by laser cladding with Ti/TiC/TiB_2 powders. • A maximum hardness of 1100 HV was achieved in the laser clad TiC/TiB_2 composite layer. • Corrosion resistance of the TC2 alloy in NaCl (3.5 wt%) aqueous solution can be improved after laser cladding. - Abstract: In the present work, a TiC/TiB_2 composite coating was produced onto a TC2 Ti alloy by laser cladding with Ti/TiC/TiB_2 powders. The surface microstructure, phase components and compositions were characterized with methods of optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffractometry (XRD), and energy dispersive spectrometry (EDS). The cladding layer is consisted of Ti, TiC and TiB_2. And the surface microhardness was measured. After laser cladding, a maximum hardness of 1100 HV is achieved in the laser cladding surface layer, which is more three times higher than that of the TC2 substrate (∼300 HV). Due to the formation of TiC and TiB_2 intermetallic compounds in the alloyed region and grain refinement, the microhardness of coating is higher than TC2 Ti alloy. In this paper, the corrosion property of matrix material and treated samples were both measured in NaCl (3.5 wt%) aqueous solution. From the result we can see that the laser cladding specimens’ corrosion property is clearly becoming better than that of the substrate.

  19. Tribological Behavior of Aluminum Alloy AlSi10Mg-TiB2 Composites Produced by Direct Metal Laser Sintering (DMLS)

    Science.gov (United States)

    Lorusso, Massimo; Aversa, Alberta; Manfredi, Diego; Calignano, Flaviana; Ambrosio, Elisa Paola; Ugues, Daniele; Pavese, Matteo

    2016-08-01

    Direct metal laser sintering (DMLS) is an additive manufacturing technique for the production of parts with complex geometry and it is especially appropriate for structural applications in aircraft and automotive industries. Aluminum-based metal matrix composites (MMCs) are promising materials for these applications because they are lightweight, ductile, and have a good strength-to-weight ratio This paper presents an investigation of microstructure, hardness, and tribological properties of AlSi10Mg alloy and AlSi10Mg alloy/TiB2 composites prepared by DMLS. MMCs were realized with two different compositions: 10% wt. of microsize TiB2, 1% wt. of nanosize TiB2. Wear tests were performed using a pin-on-disk apparatus on the prepared samples. Performances of AlSi10Mg samples manufactured by DMLS were also compared with the results obtained on AlSi10Mg alloy samples made by casting. It was found that the composites displayed a lower coefficient of friction (COF), but in the case of microsize TiB2 reinforcement the wear rate was higher than with nanosize reinforcements and aluminum alloy without reinforcement. AlSi10Mg obtained by DMLS showed a higher COF than AlSi10Mg obtained by casting, but the wear rate was higher in the latter case.

  20. PHASE CONSTITUENTS AND MICROSTRUCTURE OF Ti3Al/Fe3Al + TiN/TiB2 COMPOSITE COATING ON TITANIUM ALLOY

    OpenAIRE

    JIANING LI; CHUANZHONG CHEN; CUIFANG ZHANG

    2011-01-01

    Laser cladding of the Fe3Al + B4C/TiN + Al2O3 pre-placed powders on the Ti-6Al-4V alloy can form the Ti3Al/Fe3Al + TiN/TiB2 composite coating, which improved the wear resistance of the Ti-6Al-4V alloy surface. In this study, the Ti3Al/Fe3Al + TiN/TiB2 composite coating has been researched by means of X-ray diffraction and scanning electron microscope. It was found that during the laser cladding process, Al2O3 can react with TiB2, leading to the formations of Ti3Al and B. This principle can be...

  1. Preparation and Characterization of TiB2-(Supra-Nano-Dual-Phase High-Entropy Alloy Cermet by Spark Plasma Sintering

    Directory of Open Access Journals (Sweden)

    Shulei Zhang

    2018-01-01

    Full Text Available This paper introduces the preparation method and characterization results of TiB2 ceramics with CoCrFeNiAl high-entropy alloy (HEA as a sintering aid by Spark Plasma Sintering (SPS. Good wettability between HEA and TiB2 was proved by the sessile drop method, indicating promising prospects for this composite. The sintering results showed that the addition of HEA could dramatically promote the sinterability of TiB2. TiB2-5 wt. % HEA dense ceramics prepared at the optimal temperature of 1650 °C showed fine morphology without formation of brittle phases. The liquid phase in the ceramics was highly consistent with the so-called “supra-nano-dual-phase materials (SNDPM”, with near-ideal strength. This study represents the first time that a ceramic-SNDPM composite has been fabricated since the invention of such structures.

  2. Synthesis and characterization of in situ TiC–TiB2 composite coatings by reactive plasma spraying on a magnesium alloy

    International Nuclear Information System (INIS)

    Zou Binglin; Tao Shunyan; Huang Wenzhi; Khan, Zuhair S.; Fan Xizhi; Gu Lijian; Wang Ying; Xu Jiaying; Cai Xiaolong; Ma Hongmei; Cao Xueqiang

    2013-01-01

    Highlights: ► TiC–TiB 2 composites coatings were produced on Mg alloy by reactive plasma spraying. ► Phase composition, microstructure and wear resistance of the coatings were studied. ► The resultant product in the coatings was composed of TiC and TiB 2 . ► The produced coatings displayed porous and dense microstructures. ► The synthesized coatings exhibited good wear resistance for Mg alloy substrate. - Abstract: TiC–TiB 2 composite coatings were successfully synthesized using the technique of reactive plasma spraying (RPS) on a magnesium alloy. Phase composition, microstructure and wear resistance of the coatings were characterized by using X-ray diffraction, scanning electron microscopy and pin-on-disk wear test, respectively. The results showed that the resultant product in the RPS coatings was composed of TiC and TiB 2 . Depending on the ignition of self-propagating high-temperature synthesis reaction in the agglomerate particles, the RPS coatings displayed porous and dense microstructures. The porosity of the RPS coatings, to some extent, decreased when the feed powders were plasma sprayed with Ni powders. The RPS coatings provided good wear resistance for the substrate under various loads. For high loads (e.g., ≥15 N), the wear resistance could be significantly improved by the proper addition of Ni into the RPS coatings.

  3. Characterization of Low-Symmetry Structures from Phase Equilibrium of Fe-Al System—Microstructures and Mechanical Properties

    Directory of Open Access Journals (Sweden)

    Piotr Matysik

    2015-03-01

    Full Text Available Fe-Al intermetallic alloys with aluminum content over 60 at% are in the area of the phase equilibrium diagram that is considerably less investigated in comparison to the high-symmetry Fe3Al and FeAl phases. Ambiguous crystallographic information and incoherent data referring to the phase equilibrium diagrams placed in a high-aluminum range have caused confusions and misinformation. Nowadays unequivocal material properties description of FeAl2, Fe2Al5 and FeAl3 intermetallic alloys is still incomplete. In this paper, the influence of aluminum content and processing parameters on phase composition is presented. The occurrence of low-symmetry FeAl2, Fe2Al5 and FeAl3 structures determined by chemical composition and phase transformations was defined by scanning electron microscopy (SEM and energy-dispersive X-ray spectroscopy (EDS examinations. These results served to verify diffraction investigations (XRD and to explain the mechanical properties of cast materials such as: hardness, Young’s modulus and fracture toughness evaluated using the nano-indentation technique.

  4. Phase Constituents and Microstructure of Ti3Al/Fe3Al + TiN/TiB2 Composite Coating on Titanium Alloy

    Science.gov (United States)

    Li, Jianing; Chen, Chuanzhong; Zhang, Cuifang

    Laser cladding of the Fe3Al + B4C/TiN + Al2O3 pre-placed powders on the Ti-6Al-4V alloy can form the Ti3Al/Fe3Al + TiN/TiB2 composite coating, which improved the wear resistance of the Ti-6Al-4V alloy surface. In this study, the Ti3Al/Fe3Al + TiN/TiB2 composite coating has been researched by means of X-ray diffraction and scanning electron microscope. It was found that during the laser cladding process, Al2O3 can react with TiB2, leading to the formations of Ti3Al and B. This principle can be used to improve the Fe3Al + B4C/TiN laser-cladded coating on the Ti-6Al-4V alloy. Furthermore, during the cladding process, C consumed the oxygen in Fe3Al + B4C /TiN + Al2O3 molten pool, which retarded the productions of the redundant metal oxides.

  5. The effect of TiB2 reinforcement on the mechanical properties of an Al-Cu-Li alloy-based metal-matrix composite

    Science.gov (United States)

    1991-01-01

    The addition of ceramic particles to aluminum based alloys can substantially improve mechanical properties, especially Young's modulus and room and elevated temperature strengths. However, these improvements typically occur at the expense of tensile ductility. The mechanical properties are evaluated to a metal matrix composite (MMC) consisting of an ultrahigh strength aluminum lithium alloy, Weldalite (tm) 049, reinforced with TiB2 particles produced by an in situ precipitation technique called the XD (tm) process. The results are compared to the behavior of a nonreinforced Weldalite 049 variant. It is shown that both 049 and 049-TiB2 show very attractive warm temperature properties e.g., 625 MPa yield strength at 150 C after 100 h at temperature. Weldalite 049 reinforced with a nominal 4 v pct. TiB2 shows an approx. 8 pct. increase in modulus and a good combination of strength (529 MPa UTS) and ductility (6.5 pct.) in the T3 temper. And the high ductility of Weldalite 049 in the naturally aged and underaged tempers makes the alloy a good, high strength matrix for ceramic reinforcement.

  6. Laser coating of aluminum alloy EN AW 6082-T651 with TiB2 and TiC: Microstructure and mechanical properties

    Science.gov (United States)

    Ravnikar, Dunja; Dahotre, Narendra B.; Grum, Janez

    2013-10-01

    This paper deals with laser coating of ceramics by deposition of a precursor powder mixture of TiB2-TiC-Al on an EN AW 6082-T651 aluminum alloy. The resulting coating was studied by means of a microstructural and mechanical analysis. The coating has with TiC and TiB2 particles of various shapes and sizes embedded in an Al matrix, as well as being adherent and free of cracks with an average porosity lower than 2%. Microhardness in the coating is 40% higher than the uncoated alloy, while the microhardness in the laser melt zone and heat-affected zone dropped significantly. The wear test showed a great improvement in terms of the mass lost after the 30 min test. The three-point bending test was used to determine the flexural properties of the coated aluminum alloy. Higher content of TiB2 in ceramic components increases the flexural strength of the coated specimens, delaying the occurrence of the first crack in the coating or the occurrence of delamination. The measurements of residual stresses confirmed the presence of favorable compressive residual stresses in the surface coating. With depth, these stresses become tensile.

  7. A study of TiB2/TiB gradient coating by laser cladding on titanium alloy

    Science.gov (United States)

    Lin, Yinghua; Lei, Yongping; Li, Xueqiao; Zhi, Xiaohui; Fu, Hanguang

    2016-07-01

    TiB2/TiB gradient coating has been fabricated by a laser cladding technique on the surface of a Ti-6Al-4V substrate using TiB2 powder as the cladding material. The microstructure and mechanical properties of the gradient coating were analyzed by SEM, EPMA, XRD, TEM and an instrument to measure hardness. With the increasing distance from the coating surface, the content of TiB2 particles gradually decreased, but the content of TiB short fibers gradually increased. Meanwhile, the micro-hardness and the elastic modulus of the TiB2/TiB coating showed a gradient decreasing trend, but the fracture toughness showed a gradient increasing trend. The fracture toughness of the TiB2/TiB coating between the center and the bottom was improved, primarily due to the debonding of TiB2 particles and the high fracture of TiB short fibers, and the fracture position of TiB short fiber can be moved to an adjacent position. However, the debonding of TiB2 particles was difficult to achieve at the surface of the TiB2/TiB coating.

  8. A statistical analysis on erosion wear behaviour of A356 alloy reinforced with in situ formed TiB2 particles

    International Nuclear Information System (INIS)

    Kumar, S.; Subramanya Sarma, V.; Murty, B.S.

    2008-01-01

    Solid particle erosion wear behaviour of A356 and A356/TiB 2 in situ composites has been studied. A356 alloy reinforced with in situ TiB 2 particles was fabricated by the reaction of halide salts with aluminium melt and the formation of Al 3 Ti brittle phase is completely suppressed. The composites show good grain refinement of α-Al and modification of eutectic Si. These in situ composites show high hardness and better erosion resistance than the base alloy. Though the sizes of in situ formed TiB 2 reinforcement particles are smaller than the erodent SiC particles, TiB 2 particles are able to effectively resist the erodent particles. Design of experiment has been used to run the solid particle erosion experiment. An attempt has also been made to develop a mathematical model by using regression analysis. Analysis of variance (ANOVA) technique is applied to check the validity of the developed model. Student's t-test is utilized to find out the significance of factors. The wear mechanism has been studied by analyzing the surface of the worn specimen using scanning electron microscopy and energy dispersive X-ray microanalysis

  9. Tribological and Wear Performance of Carbide Tools with TiB2 PVD Coating under Varying Machining Conditions of TiAl6V4 Aerospace Alloy

    Directory of Open Access Journals (Sweden)

    Jose Mario Paiva

    2017-11-01

    Full Text Available Tribological phenomena and tool wear mechanisms during machining of hard-to-cut TiAl6V4 aerospace alloy have been investigated in detail. Since cutting tool wear is directly affected by tribological phenomena occurring between the surfaces of the workpiece and the cutting tool, the performance of the cutting tool is strongly associated with the conditions of the machining process. The present work shows the effect of different machining conditions on the tribological and wear performance of TiB2-coated cutting tools compared to uncoated carbide tools. FEM modeling of the temperature profile on the friction surface was performed for wet machining conditions under varying cutting parameters. Comprehensive characterization of the TiB2 coated vs. uncoated cutting tool wear performance was made using optical 3D imaging, SEM/EDX and XPS methods respectively. The results obtained were linked to the FEM modeling. The studies carried out show that during machining of the TiAl6V4 alloy, the efficiency of the TiB2 coating application for carbide cutting tools strongly depends on cutting conditions. The TiB2 coating is very efficient under roughing at low speeds (with strong buildup edge formation. In contrast, it shows similar wear performance to the uncoated tool under finishing operations at higher cutting speeds when cratering wear predominates.

  10. Structural, magnetic and transport properties of Co2FeAl Heusler films with varying thickness

    International Nuclear Information System (INIS)

    Wang, Xiaotian; Li, Yueqing; Du, Yin; Dai, Xuefang; Liu, Guodong; Liu, Enke; Liu, Zhongyuan; Wang, Wenhong; Wu, Guangheng

    2014-01-01

    We report on a systematic study of the structural, magnetic properties and the anomalous Hall effect, in the Heusler alloy Co 2 FeAl (CFA) epitaxial films on MgO (001), as a function of film thickness. It was found that the epitaxial CFA films show a highly ordered B2 structure with an in-plane uniaxial magnetic anisotropy. The electrical transport properties reveal that the lattice and magnon scattering contributions to the longitudinal resistivity. Independent on the thickness of films, the anomalous Hall resistivity of CFA films is found to be dominated by skew scattering only. Moreover, the anomalous Hall resistivity shows weakly temperature dependent behavior, and its absolute value increases as the thickness decreases. We attribute this temperature insensitivity in the anomalous Hall resistivity to the weak temperature dependent of tunneling spin-polarization in the CFA films, while the thickness dependence behavior is likely due to the increasing significance of interface or free surface electronic states. - Highlights: ●Highly ordered CFA films with various thicknesses were prepared on MgO substrates. ●The magnon scattering contributions to the longitudinal resistivity in the CFA films. ●The anomalous Hall resistivity of the CFA films shows weakly temperature dependent. ●The CFA films show weak temperature dependent of tunneling spin-polarization

  11. Epitactical FeAl films on sapphire and their magnetic properties

    International Nuclear Information System (INIS)

    Trautvetter, Moritz

    2011-01-01

    In the presented thesis epitaxial FeAl thin films on sapphire have been prepared by pulse laser deposition (PLD). The thin films deposited at room temperature exhibits ferromagnetism and subsequent annealing is necessary to transform the thin films to paramagnetic B2-phase, where the transition temperature depends on the crystalline orientation of the sapphire substrate. Alternatively, by deposition at higher substrate temperature the B2-phase is obtained directly. However, morphology of the FeAl film is influenced by different growth modes resulting from different substrate temperatures. The paramagnetic FeAl films can then be transformed to ferromagnetic phase by successive ion irradiation. Independent of the ion species used for irradiation, the same universal relation between thin films' coercive fields and irradiation damage is identified. The ion irradiation ferromagnetism can be transformed back to paramagnetism by subsequent annealing. The mutual transition between ferromagnetic and paramagnetic phases has been performed several times and shows full reversibility. The ferromagnetic phase induced by Kr + irradiation exhibits structural relaxation, where the saturate magnetization of FeAl thin film gradually decreases in several days. Later, ion irradiation has been performed selectively on defined areas of the thin film with the help of an unconventional lithography technique. The subsequent thin film is composed of ordered hexagonal array of ferromagnetic nano-cylinders separated by a paramagnetic matrix, suggesting a promising system for magnetic data storage. (orig.)

  12. Enhanced antiferromagnetic coupling in dual-synthetic antiferromagnet with Co2FeAl electrodes

    International Nuclear Information System (INIS)

    Zhang, D.L.; Xu, X.G.; Wu, Y.; Li, X.Q.; Miao, J.; Jiang, Y.

    2012-01-01

    We study dual-synthetic antiferromagnets (DSyAFs) using Co 2 FeAl (CFA) Heusler electrodes with a stack structure of Ta/CFA/Ru/CFA/Ru/CFA/Ta. When the thicknesses of the two Ru layers are 0.45 nm, 0.65 nm or 0.45 nm, 1.00 nm, the CFA-based DSyAF has a strong antiferromagnetic coupling between adjacent CFA layers at room temperature with a saturation magnetic field of ∼11,000 Oe, a saturation magnetization of ∼710 emu/cm 3 and a coercivity of ∼2.0 Oe. Moreover, the DSyAF has a good thermal stability up to 400 °C, at which CFA films show B2-ordered structure. Therefore, the CFA-based DSyAFs are favorable for applications in future spintronic devices. - Graphical abstract: Display Omitted Highlights: ► Co 2 FeAl can be applied in room temperature dual-synthetic antiferromagnets. ► Co 2 FeAl dual-synthetic antiferromagnets have a good thermal stability up to 400 °C. ► The Co 2 FeAl has B2-ordered structure in annealed dual-synthetic antiferromagnets.

  13. Growth and magnetic study of sputtered Fe/Al multilayers

    International Nuclear Information System (INIS)

    Cherif, S.M.; Bouziane, K.; Roussigne, Y.; Al-Busaidy, M.

    2007-01-01

    Brillouin light scattering (BLS) and vibrating sample magnetometry (VSM) were used to study the effect of interfacial intermixing and microstructure on the magnetic properties of DC magnetron sputtered Fe/Al multilayers (MLs) on Si(1 0 0) substrate. Three samples with nominal composition [Al (4 nm)/Fe (3.7 nm)] x18 and deposited under different negative DC bias voltages (V b = -50, -200 and -400 V) have been investigated. The X-ray diffraction results indicate that the FeAl MLs have a poor crystallinity with no evidence of the absence of B2 phase. The grazing X-ray reflectivity results suggest that the interfacial roughness and intermixing were gradually reduced from 0.7 to 0.5 nm (±0.05 nm) by increasing V b from -50 to -400 V. The magnetization measurements demonstrate the presence of in-plane uniaxial anisotropy and magnetically dead interfacial layers. The BLS results reveal spin-wave surface modes whose frequencies also depend on the applied V b . The same trend upon V b was observed for the perpendicular and in-plane anisotropies

  14. Growth and magnetic study of sputtered Fe/Al multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Cherif, S.M. [LPMTM (CNRS-UPR 9001), Universite Paris 13, 99 Av. J.B. Clement, 93430 Villetaneuse (France); Bouziane, K. [LPMTM (CNRS-UPR 9001), Universite Paris 13, 99 Av. J.B. Clement, 93430 Villetaneuse (France) and Department of Physics, College of Science, Sultan Qaboos University, P.O. Box 36, Al-Khodh 123 (Oman)]. E-mail: bouzi@squ.edu.om; Roussigne, Y. [LPMTM (CNRS-UPR 9001), Universite Paris 13, 99 Av. J.B. Clement, 93430 Villetaneuse (France); Al-Busaidy, M. [Department of Physics, College of Science, Sultan Qaboos University, P.O. Box 36, Al-Khodh 123 (Oman)

    2007-03-15

    Brillouin light scattering (BLS) and vibrating sample magnetometry (VSM) were used to study the effect of interfacial intermixing and microstructure on the magnetic properties of DC magnetron sputtered Fe/Al multilayers (MLs) on Si(1 0 0) substrate. Three samples with nominal composition [Al (4 nm)/Fe (3.7 nm)]{sub x18} and deposited under different negative DC bias voltages (V {sub b} = -50, -200 and -400 V) have been investigated. The X-ray diffraction results indicate that the FeAl MLs have a poor crystallinity with no evidence of the absence of B2 phase. The grazing X-ray reflectivity results suggest that the interfacial roughness and intermixing were gradually reduced from 0.7 to 0.5 nm ({+-}0.05 nm) by increasing V {sub b} from -50 to -400 V. The magnetization measurements demonstrate the presence of in-plane uniaxial anisotropy and magnetically dead interfacial layers. The BLS results reveal spin-wave surface modes whose frequencies also depend on the applied V{sub b}. The same trend upon V {sub b} was observed for the perpendicular and in-plane anisotropies.

  15. Microstructure of Multi-Pass Friction-Stir-Processed Al-Zn-Mg-Cu Alloys Reinforced by Nano-Sized TiB2 Particles and the Effect of T6 Heat Treatment

    Directory of Open Access Journals (Sweden)

    Xiaofei Ju

    2017-11-01

    Full Text Available In this work, a fine-grained structure with a uniform distribution of TiB2 particles and precipitates was achieved in TiB2 particle-reinforced (PR Al-Zn-Mg-Cu alloys by friction stir processing (FSP. The effects of multi-pass FSP on the microstructure, and TiB2 particle distribution, as well as the microstructural evolution in the following T6 treatment, were investigated by X-ray diffraction, scanning electron microscopy and associated electron backscattered diffraction. The results showed that the distribution of TiB2 particles and alloy precipitates was further improved with an increase in the FSP passes. Moreover, compared with alloy segregation in the as-cast PR alloys during T6 treatment, a complete solution of the precipitates was achieved in the FSP-treated PR alloys. The fine-grained structure of the FSP-treated PR alloys was thermally stable without any abnormal growth at the high temperature of T6 treatment due to the pinning effect of dispersed TiB2 particles. The strength and ductility of the PR alloys were simultaneously improved by the combination of FSP and T6 treatment.

  16. Corrosion Behavior of Detonation Gun Sprayed Fe-Al Type Intermetallic Coating

    Science.gov (United States)

    Senderowski, Cezary; Chodala, Michal; Bojar, Zbigniew

    2015-01-01

    The detonation gun sprayed Fe-Al type coatings as an alternative for austenitic valve steel, were investigated using two different methods of testing corrosion resistance. High temperature, 10-hour isothermal oxidation experiments at 550, 750, 950 and 1100 °C show differences in the oxidation behavior of Fe-Al type coatings under air atmosphere. The oxide layer ensures satisfying oxidation resistance, even at 950 and 1100 °C. Hematite, α-Al2O3 and metastable alumina phases were noticed on the coatings top surface, which preserves its initial thickness providing protection to the underlying substrate. In general, only negligible changes of the phase composition of the coatings were noticed with simultaneous strengthening controlled in the micro-hardness measurements, even after 10-hours of heating at 1100 °C. On the other hand, the electrochemical corrosion tests, which were carried out in 200 ppm Cl− (NaCl) and pH ~4 (H2SO4) solution to simulate the acid-rain environment, reveal higher values of the breakdown potential for D-gun sprayed Fe-Al type coatings than the ones for the bulk Fe-Al type alloy and Cr21Mn9Ni4 austenitic valve steel. This enables these materials to be used in structural and multifunctional applications in aggressive environments, including acidic ones. PMID:28787991

  17. Corrosion characterization of in-situ titanium diboride (TiB2) reinforced aluminium-copper (Al-Cu) alloy by two methods: Salts spray fog and linear polarization resistance (LPR)

    Science.gov (United States)

    Rosmamuhamadani, R.; Talari, M. K.; Yahaya, Sabrina M.; Sulaiman, S.; Ismail, M. I. S.; Hanim, M. A. Azmah

    2018-05-01

    Aluminium-copper (Al-Cu) alloys is the one of most Metal Matrix Composites (MMCs) have important high-strength Al alloys. The aluminium (Al) casting alloys, based on the Al-Cu system are widely used in light-weight constructions and transport applications requiring a combination of high strength and ductility. In this research, Al-Cu master alloy was reinforced with 3 and 6wt.% titanium diboride (TiB2) that obtained from salts route reactions. The salts used were were potassium hexafluorotitanate (K2TiF6) and potassium tetrafluoroborate (KBF4). The salts route reaction process were done at 800 °C. The Al-Cu alloy then has characterized on the mechanical properties and microstructure characterization. Salts spray fog test and Gamry-electrode potentiometer instruments were used to determine the corrosion rate of this alloys. From results obtained, the increasement of 3wt.%TiB2 contents will decrease the value of the corrosion rate. In corrosion test that conducted both of salt spray fog and Gamry-electrode potentiometer, the addition of 3wt.%TiB2 gave the good properties in corrosion characterization compare to Al-Cu-6wt.%TiB2 and Al-Cu cast alloy itself. As a comparison, Al-Cu with 3wt.%TiB2 gave the lowest value of corrosion rate, which means alloy has good properties in corrosion characterization. The results obtained show that in-situ Al-Cu alloy composites containing the different weight of TiB2 phase were synthesized successfully by the salt-metal reaction method.

  18. Mechanism of magnetic recovery in the disorder-order transformation of Fe70Al30 mechanically deformed alloys

    International Nuclear Information System (INIS)

    Rodriguez, D. Martin; Apinaniz, E.; Plazaola, F.; Garitaonandia, J.S.; Jimenez, J.A.; Schmool, D.S.; Cuello, G.J.

    2005-01-01

    The degree of order in Fe-Al intermetallic alloys has an important influence on their magnetic properties. Moreover, the deformation of ordered alloys causes a dramatic increase of magnetization. If deformed alloys are heated, their magnetic properties decrease again. The reordering process was monitored by neutron diffraction, Moessbauer spectroscopy, and calorimetric measurements on the Fe 70 Al 30 crushed alloy. This indicates that the reordering process occurs in two stages. In the first (150-200 deg. C) new small B2 phase domains are nucleated due to vacancy migration. A second reordering stage occurs between 300 and 450 deg. C, where dislocation motion induces B2 domain growth and A2 phase elimination. The main mechanism responsible for this decrease of magnetization during the reordering process is the decrease of the disordered A2 phase content in the alloy

  19. High temperature Moessbauer study of order-disorder transformation in iron-aluminum alloys

    International Nuclear Information System (INIS)

    Oki, Kensuke; Yamamura, Akihiko; Kudo, Kazunao; Eguchi, Tetsuo

    1979-01-01

    Ordering process of iron rich Fe-Al alloys has been investigated at elevated temperatures by mean of Moessbauer spectroscopy. The observed spectra are analyzed to obtain the temperature dependences of the internal field, isomer shift and line width, and the results are discussed in connection with the ordering process. The alloy with 24.7 at% Al exhibits spectra, which are characteristic of the superposition of a single-line spectrum and a six-line one, originating from the ordered paramagnetic B2 or DO 3 state and disordered ferromagnetic α, respectively, and the results confirm the coexistence of α phase with B2 or DO 3 . The isomer shift of the paramagnetic component of the spectra shows discontinuous changes at the temperatures of transformation α reversible B2 and B2 reversible DO 3 . (author)

  20. Development of weldable, corrosion-resistant iron-aluminide alloys

    Energy Technology Data Exchange (ETDEWEB)

    Maziasz, P.J.; Goodwin, G.M.; Wang, X.L. [Oak Ridge National Laboratory, TN (United States)

    1995-05-01

    Corrosion-resistant, weldable FeAl alloys have been developed with improved high-temperature strength industrial applications. Previous processing difficulties with these alloys led to their evaluation as weld-overlay claddings on conventional structural steels to take advantage of their good properties now. Simplified and better processing methods for monolithic FeAl components are also currently being developed so that components for industrial testing can be made. Other avenues for producing FeAl coatings are currently being explored. Neutron scattering experiments residual stress distributions in the FeAl weld-overlay cladding began in FY 1993 and continued this year.

  1. In situ neutron diffraction study of the plastic deformation mechanisms of B2 ordered intermetallic alloys: NiAl, CuZn, and CeAg

    Energy Technology Data Exchange (ETDEWEB)

    Wollmershauser, J.A. [Department of Materials Science and Engineering, University of Virginia, P.O. Box 400745, 116 Engineer' s Way, Charlottesville, VA 22904-04745 (United States); Kabra, S. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Agnew, S.R. [Department of Materials Science and Engineering, University of Virginia, P.O. Box 400745, 116 Engineer' s Way, Charlottesville, VA 22904-04745 (United States)], E-mail: sra4p@virginia.edu

    2009-01-15

    The internal stress developments of B2 compounds NiAl, CuZn, and CeAg are examined using in situ neutron diffraction. CeAg is a representative of a newly discovered class of fully ordered and ductile B2 compounds. Using polycrystal plasticity modeling to interpret the results, it is revealed that the internal stress evolution of CeAg is nearly identical to that of NiAl, indicating that they share a common primary mechanism of plastic deformation, i.e., <1 0 0>{l_brace}0 1 1{r_brace} 'cube' slip. This result reinforces the dilemma previously observed for rare-earth alloys CuY, AgY, and CuDy, since cube slip provides insufficient independent slip systems to accommodate large-scale homogenous polycrystalline deformation. There is no evidence in the diffraction data of either mechanical twinning or stress-induced phase transformation. The activity of bcc-type <1 1 1>{l_brace}11-bar0{r_brace} slip at high stresses is confirmed and a lower bound for the critical resolved shear stress is quantified.

  2. Direct separation of arsenic and antimony oxides by high-temperature filtration with porous FeAl intermetallic.

    Science.gov (United States)

    Zhang, Huibin; Liu, Xinli; Jiang, Yao; Gao, Lin; Yu, Linping; Lin, Nan; He, Yuehui; Liu, C T

    2017-09-15

    A temperature-controlled selective filtration technology for synchronous removal of arsenic and recovery of antimony from the fume produced from reduction smelting process of lead anode slimes was proposed. The chromium (Cr) alloyed FeAl intermetallic with an asymmetric pore structure was developed as the high-temperature filter material after evaluating its corrosive resistance, structural stability and mechanical properties. The results showed that porous FeAl alloyed with 20wt.% Cr had a long term stability in a high-temperature sulfide-bearing environment. The separation of arsenic and antimony trioxides was realized principally based on their disparate saturated vapor pressures at specific temperature ranges and the asymmetric membrane of FeAl filter elements with a mean pore size of 1.8μm. Pilot-scale filtration tests showed that the direct separation of arsenic and antimony can be achieved by a one-step or two-step filtration process. A higher removal percentage of arsenic can reach 92.24% at the expense of 6∼7% loss of antimony in the two-step filtration process at 500∼550°C and 300∼400°C. The FeAl filters had still good permeable and mechanical properties with 1041h of uninterrupted service, which indicates the feasibility of this high-temperature filtration technology. Copyright © 2017. Published by Elsevier B.V.

  3. Structural, magnetic and transport properties of Co{sub 2}FeAl Heusler films with varying thickness

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiaotian [School of Material Sciences and Engineering, Hebei University Technology, Tianjin 300130 (China); Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Li, Yueqing [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); State Key Laboratory of Metastable Material Sciences and Technology, Yanshan University, Qinhuangdao 066004 (China); Du, Yin [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Dai, Xuefang; Liu, Guodong [School of Material Sciences and Engineering, Hebei University Technology, Tianjin 300130 (China); Liu, Enke [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Liu, Zhongyuan [State Key Laboratory of Metastable Material Sciences and Technology, Yanshan University, Qinhuangdao 066004 (China); Wang, Wenhong, E-mail: wenhong.wang@iphy.ac.cn [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Wu, Guangheng [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)

    2014-08-01

    We report on a systematic study of the structural, magnetic properties and the anomalous Hall effect, in the Heusler alloy Co{sub 2}FeAl (CFA) epitaxial films on MgO (001), as a function of film thickness. It was found that the epitaxial CFA films show a highly ordered B2 structure with an in-plane uniaxial magnetic anisotropy. The electrical transport properties reveal that the lattice and magnon scattering contributions to the longitudinal resistivity. Independent on the thickness of films, the anomalous Hall resistivity of CFA films is found to be dominated by skew scattering only. Moreover, the anomalous Hall resistivity shows weakly temperature dependent behavior, and its absolute value increases as the thickness decreases. We attribute this temperature insensitivity in the anomalous Hall resistivity to the weak temperature dependent of tunneling spin-polarization in the CFA films, while the thickness dependence behavior is likely due to the increasing significance of interface or free surface electronic states. - Highlights: ●Highly ordered CFA films with various thicknesses were prepared on MgO substrates. ●The magnon scattering contributions to the longitudinal resistivity in the CFA films. ●The anomalous Hall resistivity of the CFA films shows weakly temperature dependent. ●The CFA films show weak temperature dependent of tunneling spin-polarization.

  4. Mechanical properties and electronic structures of Fe-Al intermetallic

    Energy Technology Data Exchange (ETDEWEB)

    Liu, YaHui; Chong, XiaoYu; Jiang, YeHua, E-mail: jiangyehua@kmust.edu.cn; Zhou, Rong; Feng, Jing, E-mail: jingfeng@kmust.edu.cn

    2017-02-01

    Using the first-principles calculations, the elastic properties, anisotropy properties, electronic structures, Debye temperature and stability of Fe-Al (Fe{sub 3}Al, FeAl, FeAl{sub 2}, Fe{sub 2}Al{sub 5} and FeAl{sub 3}) binary compounds were calculated. The formation enthalpy and cohesive energy of these Fe-Al compounds are negative, and show they are thermodynamically stable structures. Fe{sub 2}Al{sub 5} has the lowest formation enthalpy, which shows the Fe{sub 2}Al{sub 5} is the most stable of Fe-Al binary compounds. These Fe-Al compounds display disparate anisotropy due to the calculated different shape of the 3D curved surface of the Young’s modulus and anisotropic index. Fe{sub 3}Al has the biggest bulk modulus with the value 233.2 GPa. FeAl has the biggest Yong’s modulus and shear modulus with the value 296.2 GPa and 119.8 GPa, respectively. The partial density of states, total density of states and electron density distribution maps of the binary Fe-Al binary compounds are analyzed. The bonding characteristics of these Fe-Al binary compounds are mainly combination by covalent bond and metallic bonds. Meanwhile, also exist anti-bond effect. Moreover, the Debye temperatures and sound velocity of these Fe-Al compounds are explored.

  5. Effects of Al content and annealing on the phases formation, lattice parameters, and magnetization of A lxF e2B2 (x =1.0 ,1.1 ,1.2 ) alloys

    Science.gov (United States)

    Levin, E. M.; Jensen, B. A.; Barua, R.; Lejeune, B.; Howard, A.; McCallum, R. W.; Kramer, M. J.; Lewis, L. H.

    2018-03-01

    AlF e2B2 is a ferromagnet with the Curie temperature around 300 K and has the potential to be an outstanding rare-earth free candidate for magnetocaloric applications. However, samples prepared from the melt contain additional phases which affect the functional response of the AlF e2B2 phase. We report on the effects of Al content in samples with the initial (nominal) composition of A lxF e2B2 , where x =1.0 , 1.1, and 1.2 prepared by arc-melting followed by suction casting and annealing. The as-cast A lxF e2B2 alloys contain AlF e2B2 as well as additional phases, including the primary solidifying FeB and A l13F e4 compounds, which are ferromagnetic and paramagnetic, respectively, at 300 K. The presence of these phases makes it difficult to extract the intrinsic magnetic properties of AlF e2B2 phase. Annealing of A lxF e2B2 alloys at 1040 °C for 3 days allows for reaction of the FeB with A l13F e4 to form the AlF e2B2 phase, significantly reduces the amount of additional phases, and results in nearly pure AlF e2B2 phase as confirmed with XRD, magnetization, scanning electron microscopy, and electronic transport. The values of the magnetization, effective magnetic moment per Fe atom, specific heat capacity, electrical resistivity, and Seebeck coefficient for the AlF e2B2 compound have been established.

  6. Catalytic Methane Decomposition over Fe-Al2O3

    KAUST Repository

    Zhou, Lu; Enakonda, Linga Reddy; Saih, Youssef; Loptain, Sergei; Gary, Daniel; Del-Gallo, Pascal; Basset, Jean-Marie

    2016-01-01

    The presence of a Fe-FeAl2O4 structure over an Fe-Al2O3 catalysts is demonstrated to be vital for the catalytic methane decomposition (CMD) activity. After H2 reduction at 750°C, Fe-Al2O3 prepared by means of a fusion method, containing 86.5wt% Fe

  7. A novel Fe–Cr–Nb matrix composite containing the TiB_2 neutron absorber synthesized by mechanical alloying and final hot isostatic pressing (HIP) in the Ti-tubing

    International Nuclear Information System (INIS)

    Litwa, Przemysław; Perkowski, Krzysztof; Zasada, Dariusz; Kobus, Izabela; Konopka, Gustaw; Czujko, Tomasz; Varin, Robert A.

    2016-01-01

    The Fe–Cr–Ti-Nb elemental powders were mechanically alloyed/ball milled with TiB_2 and a small quantity of Y_2O_3 ceramic to synthesize a novel Fe-based alloy-ceramic powder composite that could be processed by hot isostatic pressing (HIP) for a perceived potential application as a neutron absorber in nuclear reactors. After ball milling for the 30–80 h duration relatively uniform powders with micrometric sizes were produced. With increasing milling time a fraction of TiB_2 particles became covered with the much softer Fe-based alloy which resulted in the formation of a characteristic “core-mantel” structure. For the final HIP-ing process the mechanically alloyed powders were initially uniaxially pressed into rod-shaped compacts and then cold isostatically pressed (CIP-ed). Subsequently, the rod-shaped compacts were placed in the Ti-tubing and subjected to hot isostatic pressing (HIP) at 1150 °C/200 MPa pressure. The HIP-ing process resulted in the formation of the near-Ti and intermediate diffusional layers in the microstructure of HIP-ed samples which formed in accord with the Fe-Ti binary phase diagram. Those layers contain the phases such as α-Ti (HCP), the FeTi intermetallic and their hypo-eutectoid mixtures. In addition, needle-like particles were formed in both layers in accord with the Ti-B binary phase diagram. Nanohardness testing, using a Berkovich type diamond tip, shows that the nanohardness in the intermediate layer areas, corresponding to the composition of the hypo-eutectoid mixture of Ti-FeTi, equals 980.0 (±27.1) HV and correspondingly 1176.9 (±47.6) HV for the FeTi phase. The nanohardness in the sample's center in the areas with the fine mixture of Fe-based alloy and small TiB_2 particles equals 1048.3 (±201.8) HV. The average microhardness of samples HIP-ed from powders milled for 30 and 80 h is 588 HV and 733 HV, respectively. - Highlights: • A Fe–Cr–Nb-based composite with TiB_2 neutron absorbing ceramic was mechanically

  8. Structure and hardness of TiAl-TiB2 composite prepared by hot isostatic pressing of mechanically alloyed powders. Mekanikaru aroingu funmatsu no HIP shoketsu ni yori sakuseishita TiAl/TiB2 fukugo zairyo no soshiki to kodo

    Energy Technology Data Exchange (ETDEWEB)

    Sato, T; Shimakage, K [Muroran Inst. of Technology, Hokkaido (Japan). Faculty of Engineering; Miyakawa, S [Muroran Inst. of Technology, Hokkaido (Japan). Graduate Student

    1992-11-20

    The practical application of Ti-Al system intermetallic compounds is expected as an advanced light heat resistant material. TiAl group out of them, as for the specific strength, has an equivalent maximum working temperature as that of the nickel base alloy, which is utilized as a turbine material for the current aircraft, and moreover it is also said that it is superior in the creep and rupture properties to the latter. In this study, by mechanical alloying (MA) of each mixed powder of Ti-Al and Ti-B, by suing heptane as a grinding aid, each MA powder of the amorphous TiAl containing carbon and extremely fine compound TiB2 were prepared, and subsequently the true density sintering by the hot isostatic pressing (HIP) was performed, and by doing these, the preparation of TiAl/TiB2 system composite material with a high composite ratio of TiO2 was tried. Consequently, by the MA treatment of the mixed powder of Ti and B for more than 50 hours, the compound powder of TiB2 mixed with TiB could be prepared, and its hardness has shown the maximum value Hmv=l200 with a composition of TiAl/25 mol % TiB2. 14 refs., 10 figs., 2 tabs.

  9. Catalytic Methane Decomposition over Fe-Al2O3

    KAUST Repository

    Zhou, Lu

    2016-05-09

    The presence of a Fe-FeAl2O4 structure over an Fe-Al2O3 catalysts is demonstrated to be vital for the catalytic methane decomposition (CMD) activity. After H2 reduction at 750°C, Fe-Al2O3 prepared by means of a fusion method, containing 86.5wt% FeAl2O4 and 13.5wt% Fe0, showed a stable CMD activity at 750°C for as long as 10h. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Plastic deformation of Fe-Al polycrystals strengthened with Zr-containing Laves phases Part II. Mechanical properties

    International Nuclear Information System (INIS)

    Wasilkowska, A.; Bartsch, M.; Stein, F.; Palm, M.; Sauthoff, G.; Messerschmidt, U.

    2004-01-01

    Fe-10 at.% Al-2.5 at.% Zr and Fe-20 at.% Al-2.5 at.% Zr alloys were deformed between room temperature and 700 deg. C. The materials show a flow stress plateau at about 300 MPa up to 600 deg. C for the material with 10 at.% Al and above 600 MPa up to 400 deg. C for the alloy with 20% Al. The high flow stresses compared to Fe-Al reference materials are partly due to the addition of Zr. The strain rate sensitivity of the flow stress was measured by stress relaxation and strain rate cycling tests. It is low up to 400 deg. C and high between 450 and 600 deg. C, i.e. in the range of the flow stress decrease. The microstructures of the undeformed materials are described in Part I of this paper. Micrographs of the deformed specimens taken in a high-voltage electron microscope reveal that the deformation occurs mainly within the soft Fe-Al grains and in the Fe-Al component of the grain boundary eutectic. The deformation data are interpreted in terms of solution hardening from the Al solute, dynamic strain ageing due to the Cottrell effect of the same defects, the athermal stress component of elastic dislocation interactions, the Hall-Petch contribution from the grain size, and the strengthening effect of the grain boundary layers

  11. Influence of volume percentage of NanoTiB2 particles on tribological & mechanical behaviour of 6061-T6 Al alloy nano-surface composite layer prepared via friction stir process

    Directory of Open Access Journals (Sweden)

    V. Kishan

    2017-02-01

    Full Text Available The aim of present study is to analyze the influence of volume percentage (vol.% of nano-sized particles (TiB2: average size is 35 nm on microstructure, mechanical and tribological behavior of 6061-T6 Al alloy surface nano composite prepared via Friction stir process (FSP. The microstructure of the fabricated surface nanocomposites is examined using optical microscopy (OM and scanning electron microscope (SEM for distribution of TiB2 nano reinforcement particles, thickness of nano composite layer formed on the Aluminum alloy substrate and fracture features. The depth of surface nano composite layer is measured as 3683.82 μm along the cross section of stir zone of nano composite perpendicular to FSP. It was observed that increase in volume percentage of TiB2 particles, the microhardness is increased up to 132 Hv and it is greater than as-received Al alloy's microhardness (104 Hv. It is also observed that at 4 volume percentage higher tensile properties exhibited as compared with the 2 and 8 vol. %. It is found that high wear resistance exhibited at 4 volume percentage as-compared with the 2 and 8 vol. %. The observed wear and mechanical properties are interrelated with microstructure, fractography and worn morphology.

  12. Effect of Temperature on the Deformation Behavior of B2 Austenite in a Polycrystalline Ni49.9Ti50.1 (at.Percent) Shape Memory Alloy

    Science.gov (United States)

    Garg, A.; Benafan, O.; Noebe, R. D.; Padula, S. A., II; Clausen, B.; Vogel, S.; Vaidyanathan, R.

    2013-01-01

    Superelasticity in austenitic B2-NiTi is of great technical interest and has been studied in the past by several researchers [1]. However, investigation of temperature dependent deformation in B2-NiTi is equally important since competing mechanisms of stress-induced martensite (SIM), retained martensite, plastic and deformation twinning can lead to unusual mechanical behaviors. Identification of the role of various mechanisms contributing to the overall deformation response of B2-NiTi is imperative to understanding and maturing SMA-enabled technologies. Thus, the objective of this work was to study the deformation of polycrystalline Ni49.9Ti50.1 (at. %) above A(sub f) (105 C) in the B2 state at temperatures between 165-440 C, and generate a B2 deformation map showing active deformation mechanisms in different temperature-stress regimes.

  13. Theoretical analysis of compatibility of several reinforcement materials with NiAl and FeAl matrices

    Science.gov (United States)

    Misra, Ajay K.

    1989-01-01

    Several potential reinforcement materials were assessed for their chemical, coefficient of thermal expansion (CTE), and mechanical compatibility with the intermetallic matrices based on NiAl and FeAl. Among the ceramic reinforcement materials, Al2O3, TiC, and TiB2, appear to be the optimum choices for NiAl and FeAl matrices. However, the problem of CTE mismatch with the matrix needs to be solved for these three reinforcement materials. Beryllium-rich intermetallic compounds can be considered as potential reinforcement materials provided suitable reaction barrier coatings can be developed for these. Based on preliminary thermodynamic calculations, Sc2O3 and TiC appear to be suitable as reaction barrier coatings for the beryllides. Several reaction barrier coatings are also suggested for the currently available SiC fibers.

  14. Effect of aluminium concentration and boron dopant on environmental embrittlement in FeAl aluminides

    International Nuclear Information System (INIS)

    Liu, C.T.; George, E.P.

    1991-01-01

    This paper reports on the room-temperature tensile properties of FeAl aluminides determined as functions of aluminum concentration (35 to 43 at. % Al), test environment, and surface (oil) coating. The two lower aluminum alloys containing 35 and 36.5% Al are prone to severe environmental embrittlement, while the two higher aluminum alloys with 40 and 43% Al are much less sensitive to change in test environment and surface coating. The reason for the different behavior is that the grain boundaries are intrinsically weak in the higher aluminum alloys, and these weak boundaries dominate the low ductility and brittle fracture behavior of the 40 and 43% Al alloys. When boron is added to the 40% Al alloy as a grain-boundary strengthener, the environmental effect becomes prominent. In this case, the tensile ductility of the boron-doped alloy, just like that of the lower aluminum alloys, can be dramatically improved by control of test environment (e.g. dry oxygen vs air). Strong segregation of boron to the grain boundaries, with a segregation factor of 43, was revealed by Auger analyses

  15. Epitactical FeAl films on sapphire and their magnetic properties; Epitaktische FeAl-Filme auf Saphir und ihre magnetischen Eigenschaften

    Energy Technology Data Exchange (ETDEWEB)

    Trautvetter, Moritz

    2011-05-05

    In the presented thesis epitaxial FeAl thin films on sapphire have been prepared by pulse laser deposition (PLD). The thin films deposited at room temperature exhibits ferromagnetism and subsequent annealing is necessary to transform the thin films to paramagnetic B2-phase, where the transition temperature depends on the crystalline orientation of the sapphire substrate. Alternatively, by deposition at higher substrate temperature the B2-phase is obtained directly. However, morphology of the FeAl film is influenced by different growth modes resulting from different substrate temperatures. The paramagnetic FeAl films can then be transformed to ferromagnetic phase by successive ion irradiation. Independent of the ion species used for irradiation, the same universal relation between thin films' coercive fields and irradiation damage is identified. The ion irradiation ferromagnetism can be transformed back to paramagnetism by subsequent annealing. The mutual transition between ferromagnetic and paramagnetic phases has been performed several times and shows full reversibility. The ferromagnetic phase induced by Kr{sup +} irradiation exhibits structural relaxation, where the saturate magnetization of FeAl thin film gradually decreases in several days. Later, ion irradiation has been performed selectively on defined areas of the thin film with the help of an unconventional lithography technique. The subsequent thin film is composed of ordered hexagonal array of ferromagnetic nano-cylinders separated by a paramagnetic matrix, suggesting a promising system for magnetic data storage. (orig.)

  16. Effect of mushy state rolling on age-hardening and tensile behavior of Al-4.5Cu alloy and in situ Al-4.5Cu-5TiB2 composite

    International Nuclear Information System (INIS)

    Siddhalingeshwar, I.G.; Herbert, M.A.; Chakraborty, M.; Mitra, R.

    2011-01-01

    Research highlights: → Mushy state rolling of composites reduces peak-aging times to ∼7.5-10% of that of as-cast alloy. → Uniform Cu atom distribution achieved in matrices by mushy state rolling enhances aging kinetics. → Uniform precipitate distribution obtained by mushy state rolling leads to higher microhardness. → Peak-age tensile strength and strain hardening rates are found to increase on mushy state rolling. - Abstract: The effect of mushy state rolling on aging kinetics of stir-cast Al-4.5Cu alloy and in situ Al-4.5Cu-5TiB 2 composite and their tensile behavior in solution-treated (495 deg. C) or differently aged (170 deg. C) conditions, has been investigated. As-cast or pre-hot rolled alloy and composite samples were subjected to single or multiple mushy state roll passes to 5% thickness reduction at temperatures for 20% liquid content. Peak-aging times of mushy state rolled composite matrices have been found as ∼7.5-10% of that of as-cast alloy. Such enhancement in aging kinetics is attributed to homogeneity in Cu atom distribution as well as increase in matrix dislocation density due to thermal expansion coefficient mismatch between Al and TiB 2 , matrix grain refinement and particle redistribution, achieved by mushy state rolling. Uniform precipitate distribution in mushy state rolled composite matrices leads to greater peak-age microhardness with higher yield and ultimate tensile strengths than those in as-cast alloy and composite.

  17. Electrospark deposition of Al2O3–TiB2/Ni composite-phase surface coatings on Cu–Cr–Zr alloy electrodes

    Directory of Open Access Journals (Sweden)

    Ping Luo

    2015-03-01

    Full Text Available To improve electrode life during the resistance spot welding of galvanized steel plates, an Al2O3–TiB2 composite coating was synthesized on the surfaces of spot-welding electrodes through an electrospark deposition process. The microstructure, elemental composition, phase structure, and mechanical properties of the coating were characterized using scanning electron microscopy, energy-dispersive X-ray spectroscopy, X-ray diffraction analysis, and microhardness testing. It was found that extensive cracking occurred in the monolithic Al2O3–TiB2 coating and at the coating–electrode interface. When the Al2O3–TiB2 coating was deposited on electrodes precoated with Ni, the number of defects decreased significantly. Further, delamination did not occur, and fewer cracks were formed. The average hardness of the multilayered Al2O3–TiB2/Ni coating was approximately 2200 HV and higher than that of the monolithic Al2O3–TiB2 coating (1100 HV.

  18. The influence of chromium on structure and mechanical properties of B2 nickel aluminide alloys. Ph.D. Thesis - Florida Univ., 1991 Final Report

    Science.gov (United States)

    Cotton, James Dean

    1992-01-01

    Major obstacles to the use of NiAl-based alloys and composites are low ductility and toughness. These shortcomings result in part from a lack of sufficient slip systems to accommodate plastic deformation of polycrystalline material (von Mises Criterion). It has been reported that minor additions of chromium to polycrystalline NiAl cause the predominant slip system to shift from the usual. If true, then a major step toward increasing ductility in this compound may be realized. The purpose of the present study was to verify this phenomenon, characterize it with respect to chromium level and Ni to Al ratio, and correlate any change in slip system with microstructure and mechanical properties. Compression and tensile specimens were prepared from alloys containing 0 to 5 percent chromium and 45 to 55 percent aluminum. Following about one percent strain, transmission electron microscopy foils were produced and the slip systems determined using the g x b = 0 invisibility criterion. Contrary to previous results, chromium was found to have no effect on the preferred slip system of any of the alloys studied. Possible reasons for the inconsistency of the current results with previous work are considered. Composition-structure-property relationships are discerned for the alloys, and good correlation are demonstrated in terms of conventional strengthening models for metallic systems.

  19. Fabrication of FeAl Intermetallic Foams by Tartaric Acid-Assisted Self-Propagating High-Temperature Synthesis

    Directory of Open Access Journals (Sweden)

    Krzysztof Karczewski

    2018-04-01

    Full Text Available Iron aluminides are intermetallics with interesting applications in porous form thanks to their mechanical and corrosion resistance properties. However, making porous forms of these materials is not easy due to their high melting points. We formed FeAl foams by elemental iron and aluminum powders sintering with tartaric acid additive. Tartaric acid worked as an in situ gas-releasing agent during the self-propagating high-temperature synthesis of FeAl intermetallic alloy, which was confirmed by X-ray diffraction measurements. The porosity of the formed foams was up to 36 ± 4%. In the core of the sample, the average equivalent circle diameter was found to be 47 ± 20 µm, while on the surface, it was 35 ± 16 µm; thus, the spread of the pore size was smaller than reported previously. To investigate functional applications of the formed FeAl foam, the pressure drop of air during penetration of the foam was examined. It was found that increased porosity of the material increased the flow of the air through the metallic foam.

  20. Heat resistance of Fe-Al intermetallics in the context of selected heat-resistant and hihg-temperature creep resistant steels

    Directory of Open Access Journals (Sweden)

    P. Baranowski

    2009-04-01

    Full Text Available Results are hereby presented of heat-resistance tests of two Fe3Al and FeAl intermetallic phase-based alloys in the context of St41k-typeboiler steel and 50H21G9N4 high-temperature creep resistant steel. It has been ascertained that heat resistance of the 50H21G9N4 steeland of the Fe3Al and FeAl intermetallic phase-based alloys significantly exceeds that of the boiler steel tested in the air atmosphere and the atmosphere of a flue gas with CO, CO2, SiO2 content alike. Improvement of these properties depends of exposure conditions. The largest differences have been observed when the tests were carried out in temperature 1023 K and in the flue gas atmosphere. The differences have been more and more noticeable as the exposition duration extended. A tendency has been also recorded of smaller mass decrements of the Fe3Al and FeAl intermetallic phase-based alloys as compared to the 50H21G9N4 steel.

  1. Influence of the brazing parameters on microstructure and mechanical properties of brazed joints of Hastelloy B2 nickel base alloy; Influencia de los parametros de soldeo fuerte en la microestructura y propiedades mecanicas de la union de la aleacion base niquel Hastelloy B2

    Energy Technology Data Exchange (ETDEWEB)

    Sotelo, J. C.; Gonzalez, M.; Porto, E.

    2014-07-01

    A study of the high vacuum brazing process of solid solution strengthened Hastelloy B2 nickel alloy has been done. A first stage of research has focused on the selection of the most appropriate brazing filler metal to the base material and vacuum furnace brazing process. The influence of welding parameters on joint microstructure constituents, relating the microstructure of the joint to its mechanical properties, has been evaluated. Two gaps of 50 and 200 micrometers, and two dwell times at brazing temperature of 10 and 90 minutes were studied. The braze joint mainly consists of the nickel rich matrix, nickel silicide and ternary compounds. Finally, the results of this study have shown the high bond strength for small gaps and increased dwell times of 90 minutes. (Author)

  2. Fatigue properties of Fe-Al intermetallic coatings prepared by plasma spraying

    Czech Academy of Sciences Publication Activity Database

    Mušálek, Radek; Kovářík, O.; Skiba, Tomáš; Haušild, P.; Karlík, M.; Colmenares-Angulo, J.

    2010-01-01

    Roč. 18, č. 7 (2010), s. 1415-1418 ISSN 0966-9795. [FEAL 2009 - 5th Discussion Meeting on the Development of Innovative Iron Aluminium Alloys. Prague, 21.09.2009-24.09.2009] R&D Projects: GA MŠk ME 901 Institutional research plan: CEZ:AV0Z20430508 Keywords : Iron aluminides * Fatigue resistance and crack growth * plasma spraying * scanning electron microscopy Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.327, year: 2010 http://www.sciencedirect.com/science?_ob=GatewayURL&_method=citationSearch&_uoikey=B6TX8-4YGHK94-2&_origin=SDEMFRHTML&_version=1&md5=557fd571c715e5f2cff573d5255bb184

  3. Effect of Li level, artificial aging, and TiB2 reinforcement on the fracture toughness of Weldalite (tm) 049-type alloys

    Science.gov (United States)

    1991-01-01

    Plane strain fracture toughness (K sub IC) was evaluated for Weldalite (tm) 049 with and without TiB2 reinforcement. For the nonreinforced variant, changes in toughness were measured for various aging conditions and lithium levels. Toughness testing was carried out on fatigue precracked compact tension (CT) specimens at 24 C, as per ASTM standard E-399. Toughness was measured as a function of aging time at 160 C for the two Weldalite 049(1.3) heats. The composition of these heats differed only in that 0.03 wt pct. Ti was added to one as an additional grain refiner. Both heats showed a decrease in toughness with increasing aging time, although toughness values for one were significantly higher than for the other. This greater toughness may be due to a subtle change in the grain size resulting for the presence of Ti or, alternatively, to differences in texture or substructure formed during extrusion.

  4. Synthesis, characterization and magnetic properties of Fe-Al nanopins

    International Nuclear Information System (INIS)

    Zhang, W.S.; Brueck, E.; Li, W.F.; Si, P.Z.; Geng, D.Y.; Zhang, Z.D.

    2005-01-01

    We report the synthesis of Fe-Al nanopins using arc discharge. The morphology and chemical composition of the Fe-Al nanopins were studied by means of X-ray diffraction, X-ray photoelectron spectroscopy (XPS), energy dispersive X-ray spectroscopy (EDX), and high-resolution transmission electron microscopy (HRTEM). The nanopins are composed of a spherical base of about 20-100 nm and a needle-like tip of about several hundred nanometers. EDX and HRTEM studies indicate that the spherical base is mainly composed of α-Fe and FeAl core coated with a thin Al 2 O 3 layer, while the needle-like part contains only Al and O and corresponds to Al 2 O 3 . The formation mechanism of the nanopins is suggestive of a vapor-liquid-solid (VLS) growth process. The as-prepared Fe-Al nanopins show ferromagnetic properties. The temperature dependence of the magnetization at high temperatures indicates the existence of some phase transformations

  5. Correlation induced paramagnetic ground state in FeAl

    Czech Academy of Sciences Publication Activity Database

    Mohn, P.; Persson, C.; Blaha, P.; Schwarz, K.; Novák, Pavel; Eschrig, H.

    2001-01-01

    Roč. 87, č. 19 (2001), s. 196401-1-196401-4 ISSN 0031-9007 Institutional research plan: CEZ:AV0Z1010914 Keywords : FeAl * paramagnetic ground state Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 6.668, year: 2001

  6. Thermo-physical characterization of the Fe_6_7Mo_6Ni_3_._5Cr_3_._5P_1_2C_5_._5B_2_._5 bulk metallic glass forming alloy

    International Nuclear Information System (INIS)

    Bochtler, Benedikt; Gross, Oliver; Gallino, Isabella; Busch, Ralf

    2016-01-01

    The iron-phosphorus based bulk metallic glass forming alloy Fe_6_7Mo_6Ni_3_._5Cr_3_._5P_1_2C_5_._5B_2_._5 is characterized with respect to its thermophysical properties, crystallization and relaxation behavior, as well as its viscosity. The alloy provides a high critical casting thickness of 13 mm, thus allowing for the casting of amorphous parts with a considerable size. Calorimetric measurements reveal the characteristic transformation temperatures, transformation enthalpies, and the specific heat capacity. The analyses show that no stable supercooled liquid region exists upon heating. The specific heat capacity data are used to calculate the enthalpy, entropy, and Gibbs free energy differences between the crystalline and the supercooled liquid state. The crystallization behavior of amorphous samples upon heating is analyzed by differential scanning calorimetry and X-ray diffraction, and a time-temperature-transformation diagram is constructed. Dilatometry is used to determine the thermal expansion behavior. The equilibrium viscosity below the glass transition as well as volume relaxation behavior are measured by three-point beam bending and dilatometry, respectively, to assess the kinetic fragility. With a kinetic fragility parameter of D* = 21.3, the alloy displays a rather strong liquid behavior. Viscosity above the melting point is determined using electromagnetic levitation in microgravity on a reduced gravity aircraft in cooperation with the German Aerospace Center (DLR). These high-temperature viscosity data are compared with the low-temperature three-point beam bending measurements. The alloy displays a strong liquid behavior at low temperatures and a fragile behavior at high temperatures. These results are analogous to the ones observed in several Zr-based bulk metallic glass forming liquids, indicating a strong to fragile liquid-liquid transition in the undercooled liquid, which is obscured by crystallization.

  7. A first-principles study of B2 NiAl alloyed with rare earth elements Pr, Pm, Sm, and Eu

    Institute of Scientific and Technical Information of China (English)

    He Jun-Qi; Wang You; Yan Mu-Fu; Pan Zhao-Yi; Guo Li-Xin

    2013-01-01

    The structural,elastic,and electronic properties of NiAl alloyed with rare earth elements Pr,Pm,Sm,and Eu are investigated by using density functional theory (DFT).The study suggests that Pr,Pm,Sm,and Eu all tend to be substituted for an Al site.Ni8Al7Pm possesses the largest ductility.Only the hardness and ductility of Ni8Al7Eu are enhanced simultaneously.The covalency strength of the Ni-Al bond in Ni8Al7Pm is higher than that in Ni8Al7Eu.The covalency strength of an Al-Al bond and that of a Ni-Ni bond in Ni8Al7Eu are higher than that in Ni8Al7Pm.The Ni-Pm bond and the Ni-Eu bond are covalent,and the covalency strength of the Ni-Pm bond is greater.The Al-Pm bond and the Al-Eu bond show great covalency strength and ionicity,respectively.

  8. Molecular dynamics studies of tweed and ω-phase instabilities in B2Ni62.5Al37.5 alloys

    International Nuclear Information System (INIS)

    Becquart, C.; Clapp, P.C.; Rifkin, J.A.

    1992-01-01

    Diffuser TEM and x-ray data has been reported by several research groups that has been interpreted in terms of both tweed and ω-phase instabilities. This patent describes computer simulations of 1,024 atom arrays that were run at various temperatures using the Voter-Chen Embedded Atom Method interactions. If the extra Ni atoms were placed at random on the Al sub-lattice of the B2 structure, at low temperatures both left-angle 110 right-angle and left-angle 112 right-angle diffuse streaking were observed in reciprocal lattice plots, indicative of tweed and ω-phase instabilities, respectively. The atomic displacements causing the left-angle 110 right-angle diffuse streaking could generally be classified as {110} left-angle 1 - 10 right-angle local shears, in agreement with accepted models of tweed. However, the displacements producing the left-angle 112 right-angle streaking were best described as coordinated atom row motions in left-angle 111 right-angle interplanar collapse. Both types of diffuse streaking deceased with increasing temperature, but the left-angle 110 right-angle type was stronger at all temperatures and persisted to higher temperatures. Furthermore, the atomic displacements producing the streaking were static at low temperatures (persistence times greater than 1000 vibrational periods) but became dynamic at higher temperatures (persistence times of the order of a few vibrational periods). Another interesting result was that by merely rearranging the extra Ni atoms into an ordered superlattice pattern, virtually no diffuse streaking of any type was observed at any temperature, strongly suggesting that compositional disorder (or other kinds of point defects) are essential to induce tweed instabilities

  9. Characterization of Low-Symmetry Structures from Phase Equilibrium of Fe-Al System-Microstructures and Mechanical Properties.

    Science.gov (United States)

    Matysik, Piotr; Jóźwiak, Stanisław; Czujko, Tomasz

    2015-03-04

    Fe-Al intermetallic alloys with aluminum content over 60 at% are in the area of the phase equilibrium diagram that is considerably less investigated in comparison to the high-symmetry Fe₃Al and FeAl phases. Ambiguous crystallographic information and incoherent data referring to the phase equilibrium diagrams placed in a high-aluminum range have caused confusions and misinformation. Nowadays unequivocal material properties description of FeAl₂, Fe₂Al₅ and FeAl₃ intermetallic alloys is still incomplete. In this paper, the influence of aluminum content and processing parameters on phase composition is presented. The occurrence of low-symmetry FeAl₂, Fe₂Al₅ and FeAl₃ structures determined by chemical composition and phase transformations was defined by scanning electron microscopy (SEM) and energy-dispersive X-ray spectroscopy (EDS) examinations. These results served to verify diffraction investigations (XRD) and to explain the mechanical properties of cast materials such as: hardness, Young's modulus and fracture toughness evaluated using the nano-indentation technique.

  10. Perpendicular magnetic anisotropy in Co2FeAl0.5Si0.5/MgO bottom electrodes for magnetic tunnel junctions

    International Nuclear Information System (INIS)

    Li, X.Q.; Wu, Y.; Gao, S.; Xu, X.G.; Miao, J.; Jiang, Y.

    2013-01-01

    Perpendicular magnetic anisotropy (PMA) was achieved in annealed Co 2 FeAl 0.5 Si 0.5 (CFAS)/MgO-based multilayers with good thermal stability up to 400 °C and a large anisotropy energy density K u over 2.0 × 10 5 J/m 3 . The thickness of the full-Heusler CFAS film to maintain PMA is up to 4.8 nm in which the co-existence of disordered A2, ordered B2 and fully ordered L2 1 structures is observed. X-ray photoelectron spectroscopy analysis demonstrates that the origin of the PMA is the hybridization between Co 3d and O 2p orbitals at the CFAS/MgO interface. - Highlights: • We achieved perpendicular magnetic anisotropy (PMA) in Co 2 FeAl 0.5 Si 0.5 (4.8 nm) film; • L2 1 , B2 and A2 phases coexist in perpendicular magnetic anisotropic Co 2 FeAl 0.5 Si 0.5 ; • Magnetic properties have strong dependence on the annealing temperature; • The PMA is induced by the hybridization between Co-3d and O-2p orbitals

  11. Effect of the temperature, strain rate and microstructure on flow and fracture characteristics of Ti-45Al-2Nb-2Mn+0.8vol.% TiB2 XD alloy

    Science.gov (United States)

    Erice, B.; Pérez-Martín, M. J.; Cendón, D. A.; Gálvez, F.

    2012-05-01

    A series of quasi-static and dynamic tensile tests at varying temperatures were carried out to determine the mechanical behaviour of Ti-45Al-2Nb-2Mn+0.8vol.% TiB2 XD as-HIPed alloy. The temperature for the tests ranged from room temperature to 850 ∘C. The effect of the temperature on the ultimate tensile strength, as expected, was almost negligible within the selected temperature range. Nevertheless, the plastic flow suffered some softening because of the temperature. This alloy presents a relatively low ductility; thus, a low tensile strain to failure. The dynamic tests were performed in a Split Hopkinson Tension Bar, showing an increase of the ultimate tensile strength due to the strain rate hardening effect. Johnson-Cook constitutive relation was used to model the plastic flow. A post-testing microstructural of the specimens revealed an inhomogeneous structure, consisting of lamellar α2 + γ structure and γ phase equiaxed grains in the centre, and a fully lamellar structure on the rest. The assessment of the duplex-fully lamellar area ratio showed a clear relationship between the microstructure and the fracture behaviour.

  12. Ferromagnetic bulk glassy alloys

    International Nuclear Information System (INIS)

    Inoue, Akihisa; Makino, Akihiro; Mizushima, Takao

    2000-01-01

    This paper deals with the review on the formation, thermal stability and magnetic properties of the Fe-based bulk glassy alloys in as-cast bulk and melt-spun ribbon forms. A large supercooled liquid region over 50 K before crystallization was obtained in Fe-(Al, Ga)-(P, C, B, Si), Fe-(Cr, Mo, Nb)-(Al, Ga)-(P, C, B) and (Fe, Co, Ni)-Zr-M-B (M=Ti, Hf, V, Nb, Ta, Cr, Mo and W) systems and bulk glassy alloys were produced in a thickness range below 2 mm for the Fe-(Al, Ga)-(P, C, B, Si) system and 6 mm for the Fe-Co-(Zr, Nb, Ta)-(Mo, W)-B system by copper-mold casting. The ring-shaped glassy Fe-(Al, Ga)-(P, C, B, Si) alloys exhibit much better soft magnetic properties as compared with the ring-shaped alloy made from the melt-spun ribbon because of the formation of the unique domain structure. The good combination of high glass-forming ability and good soft magnetic properties indicates the possibility of future development as a new bulk glassy magnetic material

  13. The effect of boron doping on the magnetostriction of Fe-Ga and Fe-Al samples

    Energy Technology Data Exchange (ETDEWEB)

    Doerr, Mathias; Granovsky, Sergey; Loewenhaupt, Michael [TU Dresden, Institut fuer Festkoerperphysik (Germany); Teodoro dos Santos, Claudio; Bormio-Nunes, Cristina [Universidade de Sao Paulo, Escola de Engenharia de Lorena, Lorena (Brazil)

    2011-07-01

    Fe-Ga (Galfenol) based alloys are used in a number of magnetomechanical applications because of the high magnetostriction values of more than 100 ppm at room temperature. The addition of boron inhibits the crystallographic ordering of the alloys and stabilizes the disordered A2 structure that is responsible for the high striction values. Especially, polycrystalline and rapid cooled Fe-Ga-B and Fe-Al-B samples were investigated in our project. Magnetization and longitudinal as well as transversal magnetostriction measurements at temperatures of 5 K, 80 K and 300 K show a similar effect of the amount of B as found on single crystals. Whereas the saturation magnetization is nearly the same and mainly determined by the Fe content, a dependence of the striction values on the amount of B is visible (more than 10% in the Fe-Al system). The results illustrate the influence of the stoichiometry and the preparation conditions on the magnetomechanical properties.

  14. Improving of Corrosion Resistance of Aluminum Alloys by Removing Intermetallic Compound

    International Nuclear Information System (INIS)

    Seri, Osami

    2008-01-01

    It is well known that iron is one of the most common impurity elements sound in aluminum and its alloys. Iron in the aluminum forms an intermetallic compounds such as FeAl 3 . The FeAl 3 particles on the aluminum surface are one of the most detrimental phases to the corrosion process and anodizing procedure for aluminum and its alloys. Trial and error surface treatment will be carried out to find the preferential and effective removal of FeAl 3 particles on the surfaces without dissolution of aluminum matrix around the particles. One of the preferable surface treatments for the aim of getting FeAl 3 free surface was an electrochemical treatment such as cathodic current density of -2 kAm -2 in a 20-30 mass% HNO 3 solution for the period of 300s. The corrosion characteristics of aluminum surface with FeAl 3 free particles are examined in a 0.1 kmol/m 3 NaCl solution. It is found that aluminum with free FeAl 3 particles shows higher corrosion resistance than aluminum with FeAl 3 particles

  15. Erosion resistance of FeAl-TiB2 and FeAl-WC at room and elevated temperatures

    International Nuclear Information System (INIS)

    Alman, D.E.; Tylczak, J.H.; Hawk, J.A.

    2000-01-01

    The resistance of FeAl-40%TiB 2 and FeAl-80%WC cermets to solid particle erosion at 25, 180, 500 and 700 C was evaluated and compared to the behavior of WC-6%Co (Co-90%WC) cemented carbides. Even though the WC-Co contained a higher volume fraction of the hard phase, the erosion rates of the FeAl-cermets were similar in magnitude to the erosion rates of the WC-Co. However, the erosion rates of the FeAl-cermets either were constant (FeAl-TiB 2 ) or decreased (FeAl-WC) with increasing test temperature; whereas, the erosion rates of the WC-Co cemented carbides increased with increasing test temperature. This indicated that once the microstructures of the FeAl-cermets are optimized for wear resistance, these materials might make promising candidates for high-temperature wear applications

  16. Combustion synthesis of AlB2-Al2O3 composite powders with AlB2 nanowire structures

    Science.gov (United States)

    Yang, Pan; Xiao, Guoqing; Ding, Donghai; Ren, Yun; Yang, Shoulei; Lv, Lihua; Hou, Xing

    2018-05-01

    Using of Al and B2O3 powders as starting materials, and Mg-Al alloy as additives, AlB2-Al2O3 composite powders with AlB2 nanowire structures were successfully fabricated via combustion synthesis method in Ar atmosphere at a pressure of 1.5 MPa. The effect of different amount of Mg-Al alloy on the phase compositions and morphology of the combustion products was investigated. The results revealed that AlB2 and Al2O3 increased, whereas Al decreased with the content of Mg-Al alloy increasing. The impurities MgAl2O4 and AlB12 would exist in the sample with adding of 18 wt% Mg-Al alloy. Interestingly, FESEM/TEM/EDS results showed that AlB2 nanowires were observed in the products when the content of Mg-Al alloy is 6 wt% and 12 wt%. The more AlB2 nanowires can be found as the content of Mg-Al alloy increased. And the yield of AlB2 nanowires with the diameter of about 200 nanometers (nm) and the length up to several tens of micrometers (μm) in the combustion product is highest when the content of Mg-Al alloy is 12 wt%. The vapor, such as Mg-Al (g), B2O2 (g), AlO (g) and Al2O (g), produced during the process of combustion synthesis, reacted with each other to yield AlB2 nanowires by vapor-solid (VS) mechanism and the corresponding model was also proposed.

  17. In-situ studies of the TGO growth stresses and the martensitic transformation in the B2 phase in commercial Pt-modified NiAl and NiCoCrAlY bond coat alloys

    Energy Technology Data Exchange (ETDEWEB)

    Hovis, D.; Hu, L.; Reddy, A.; Heuer, A.H. [Dept. of Materials Science and Engineering, Case Western Reserve Univ., Cleveland, OH (United States); Paulikas, A.P.; Veal, B.W. [Materials Science Div., Argonne National Lab., Argonne, IL (United States)

    2007-12-15

    Oxide growth stresses were measured in situ at 1100 C on commercial Pt-modified NiAl and NiCoCrAlY bond coat alloys using synchrotron X-rays. Measurements were taken on samples that had no preoxidation, as well as on samples that had experienced 24 one-hour thermal exposures at 1150 C, a condition known to induce rumpling in the Pt-modified NiAl alloy, but not in the NiCoCrAlY alloy. The NiCoCrAlY alloy showed continuous stress relaxation under all conditions, whereas the Pt-modified NiAl alloys would typically stabilize at a fixed (often non-zero) stress suggesting a higher creep strength in the 'Thermally Grown Oxide' on the latter alloy, though the precise behavior was dependent on initial surface preparation. The formation of martensite in the Pt-modified NiAl alloys was also observed upon cooling and occurred at temperatures below 200 C for all of the samples observed. Based on existing models, this M{sub s} temperature is too low to account for the rumpling observed in these alloys. (orig.)

  18. Influence of TiB2 particles on machinability and machining parameter optimization of TiB2/Al MMCs

    Directory of Open Access Journals (Sweden)

    Ruisong JIANG

    2018-01-01

    Full Text Available In situ formed TiB2 particle reinforced aluminum matrix composites (TiB2/Al MMCs have some extraordinary properties which make them be a promising material for high performance aero-engine blade. Due to the influence of TiB2 particles, the machinability is still a problem which restricts the application of TiB2/Al MMCs. In order to meet the industrial requirements, the influence of TiB2 particles on the machinability of TiB2/Al MMCs was investigated experimentally. Moreover, the optimal machining conditions for this kind of MMCs were investigated in this study. The major conclusions are: (1 the machining force of TiB2/Al MMCs is bigger than that of non-reinforced alloy and mainly controlled by feed rate; (2 the residual stress of TiB2/Al MMCs is compressive while that of non-reinforced alloy is nearly neutral; (3 the surface roughness of TiB2/Al MMCs is smaller than that of non-reinforced alloy under the same cutting speed, but reverse result was observed when the feed rate increased; (4 a multi-objective optimization model for surface roughness and material removal rate (MRR was established, and a set of optimal parameter combinations of the machining was obtained. The results show a great difference from SiC particle reinforced MMCs and provide a useful guide for a better control of machining process of this material.

  19. The role of TiB2 in strengthening TiB2 reinforced aluminium casting composites

    International Nuclear Information System (INIS)

    Chen, Z; Kang, H; Zhao, Y; Zheng, Y; Wang, T

    2016-01-01

    With an aim of developing high quality in situ TiB 2 reinforced aluminium foundry alloy based composites, the conventional direct synthesis method was modified into a two-step route. In step one we optimized the halide salt route to fabricate in situ TiB 2 particulate reinforced aluminium matrix composites and in step two we investigated the effects of the Al-5wt.% TiB 2 composite, as a “master composite”, on strengthening the practical foundry alloys. The in situ formed TiB 2 particles play two roles while strengthening the composites: (1) The grain refinement effect that improves the quality of the alloy matrix; and (2) The interactions between the hard particulates and the matrix add extra increment to the material strength. In different alloy systems, TiB 2 may play distinct roles in these two aspects (figure 1). Further analysis of the strengthening mechanisms shows that particle agglomeration behaviour during solidification is responsible for the latter one. The present work details the role of TiB 2 in strengthening TiB 2 reinforced aluminium casting composites. (paper)

  20. Behaviour of new ODS alloys under single and multiple deformation

    Czech Academy of Sciences Publication Activity Database

    Mašek, B.; Khalaj, O.; Nový, Z.; Kubina, T.; Jirková, H.; Svoboda, Jiří; Stadler, C.

    2016-01-01

    Roč. 50, č. 6 (2016), s. 891-898 ISSN 1580-2949 R&D Projects: GA ČR(CZ) GA14-24252S Institutional support: RVO:68081723 Keywords : ODS alloys * composite * steel * Fe-Al Subject RIV: JI - Composite Materials Impact factor: 0.436, year: 2016

  1. Capping layer-tailored interface magnetic anisotropy in ultrathin Co2FeAl films

    International Nuclear Information System (INIS)

    Belmeguenai, M.; Zighem, F.; Chérif, S. M.; Gabor, M. S.; Petrisor, T.; Tiusan, C.

    2015-01-01

    Co 2 FeAl (CFA) thin films of various thicknesses (2 nm ≤ d ≤ 50 nm) have been grown on (001) MgO single crystal substrates and then capped with Cr, V, and Ta. Their magnetic and structural properties have been studied by x-ray diffraction (XRD), vibrating sample magnetometry, and broadband microstrip ferromagnetic resonance (MS-FMR). The XRD revealed that the films are epitaxial with the cubic [001] CFA axis normal to the substrate plane and that the chemical order varies from the B2 phase to the A2 phase when decreasing the thickness. The deduced lattice parameters showed that the Cr-capped films exhibit a larger tetragonal distortion, as compared with the films capped with V or Ta. The presence of magnetic dead layers has been observed in CFA samples capped with V and Ta but not in the case of the Cr-capped ones. The effective magnetization, deduced from the fit of MS-FMR measurements, increases (decreases) linearly with the CFA inverse thickness (1/d) for the Cr-capped (Ta-capped) films while it is constant for the V-capped ones. This allows quantifying the perpendicular surface anisotropy coefficients of −0.46 erg/cm 2 and 0.74 erg/cm 2 for Cr and Ta-capped films, respectively. Moreover, the fourfold and the uniaxial anisotropy fields, measured in these films, showed different trends with a respect to the CFA inverse thickness. This allows inferring that a non-negligible part of the fourfold magnetocrystalline term is of interfacial origin

  2. Enhanced magnetocaloric properties and critical behavior of (Fe0.72Cr0.28)3Al alloys for near room temperature cooling

    Science.gov (United States)

    Sharma, V.; Maheshwar Repaka, D. V.; Chaudhary, V.; Ramanujan, R. V.

    2017-04-01

    Magnetic cooling is an environmentally friendly, energy efficient, thermal management technology relying on high performance magnetocaloric materials (MCM). Current research has focused on low cost, corrosion resistant, rare earth (RE) free MCMs. We report the structural and magnetocaloric properties of novel, low cost, RE free, iron based (Fe0.72Cr0.28)3Al alloys. The arc melted buttons and melt spun ribbons possessed the L21 crystal structure and B2 crystal structure, respectively. A notable enhancement of 33% in isothermal entropy change (-ΔS m) and 25% increase in relative cooling power (RCP) for the ribbons compared to the buttons can be attributed to higher structural disorder in the Fe-Cr and Fe-Al sub-lattices of the B2 structure. The critical behavior was investigated using modified Arrott plots, the Kouvel-Fisher plot and the critical isotherm technique; the critical exponents were found to correspond to the short-range order 3D Heisenberg model. The field and temperature dependent magnetization curves of (Fe0.72Cr0.28)3Al alloys revealed their soft magnetic nature with negligible hysteresis. Thus, these alloys possess promising performance attributes for near room temperature magnetic cooling applications.

  3. Stress-anneal-induced magnetic anisotropy in highly textured Fe-Ga and Fe-Al magnetostrictive strips for bending-mode vibrational energy harvesters

    Directory of Open Access Journals (Sweden)

    Jung Jin Park

    2016-05-01

    Full Text Available Magnetostrictive Fe-Ga and Fe-Al alloys are promising materials for use in bending-mode vibrational energy harvesters. For this study, 50.8 mm × 5.0 mm × 0.5 mm strips of Fe-Ga and Fe-Al were cut from 0.50-mm thick rolled sheet. An atmospheric anneal was used to develop a Goss texture through an abnormal grain growth process. The anneal lead to large (011 grains that covered over 90% of sample surface area. The resulting highly-textured Fe-Ga and Fe-Al strips exhibited saturation magnetostriction values (λsat =  λ∥ − λ⊥ of ∼280 ppm and ∼130 ppm, respectively. To maximize 90° rotation of magnetic moments during bending of the strips, we employed compressive stress annealing (SA. Samples were heated to 500°C, and a 100-150 MPa compressive stress was applied while at 500°C for 30 minutes and while being cooled. The effectiveness of the SA on magnetic moment rotation was inferred by comparing post-SA magnetostriction with the maximum possible yield of rotated magnetic moments, which is achieved when λ∥ = λsat and λ⊥ = 0. The uniformity of the SA along the sample length and the impact of the SA on sensing/energy harvesting performance were then assessed by comparing pre- and post-SA bending-stress-induced changes in magnetization at five different locations along the samples. The SA process with a 150 MPa compressive load improved Fe-Ga actuation along the sample length from 170 to 225 ppm (from ∼60% to within ∼80% of λsat. The corresponding sensing/energy harvesting performance improved by as much as a factor of eight in the best sample, however the improvement was not at all uniform along the sample length. The SA process with a 100 MPa compressive load improved Fe-Al actuation along the sample length from 60 to 73 ppm (from ∼46% to ∼56% of λsat, indicating only a marginally effective SA and suggesting the need for modification of the SA protocol. In spite of this, the SA was effective at improving the sensing

  4. Stress-anneal-induced magnetic anisotropy in highly textured Fe-Ga and Fe-Al magnetostrictive strips for bending-mode vibrational energy harvesters

    Science.gov (United States)

    Park, Jung Jin; Na, Suok-Min; Raghunath, Ganesh; Flatau, Alison B.

    2016-05-01

    Magnetostrictive Fe-Ga and Fe-Al alloys are promising materials for use in bending-mode vibrational energy harvesters. For this study, 50.8 mm × 5.0 mm × 0.5 mm strips of Fe-Ga and Fe-Al were cut from 0.50-mm thick rolled sheet. An atmospheric anneal was used to develop a Goss texture through an abnormal grain growth process. The anneal lead to large (011) grains that covered over 90% of sample surface area. The resulting highly-textured Fe-Ga and Fe-Al strips exhibited saturation magnetostriction values (λsat = λ∥ - λ⊥) of ˜280 ppm and ˜130 ppm, respectively. To maximize 90° rotation of magnetic moments during bending of the strips, we employed compressive stress annealing (SA). Samples were heated to 500°C, and a 100-150 MPa compressive stress was applied while at 500°C for 30 minutes and while being cooled. The effectiveness of the SA on magnetic moment rotation was inferred by comparing post-SA magnetostriction with the maximum possible yield of rotated magnetic moments, which is achieved when λ∥ = λsat and λ⊥ = 0. The uniformity of the SA along the sample length and the impact of the SA on sensing/energy harvesting performance were then assessed by comparing pre- and post-SA bending-stress-induced changes in magnetization at five different locations along the samples. The SA process with a 150 MPa compressive load improved Fe-Ga actuation along the sample length from 170 to 225 ppm (from ˜60% to within ˜80% of λsat). The corresponding sensing/energy harvesting performance improved by as much as a factor of eight in the best sample, however the improvement was not at all uniform along the sample length. The SA process with a 100 MPa compressive load improved Fe-Al actuation along the sample length from 60 to 73 ppm (from ˜46% to ˜56% of λsat, indicating only a marginally effective SA and suggesting the need for modification of the SA protocol. In spite of this, the SA was effective at improving the sensing/energy harvesting

  5. Lattice dynamic properties of Rh2XAl (X=Fe and Y) alloys

    Science.gov (United States)

    Al, Selgin; Arikan, Nihat; Demir, Süleyman; Iyigör, Ahmet

    2018-02-01

    The electronic band structure, elastic and vibrational spectra of Rh2FeAl and Rh2YAl alloys were computed in detail by employing an ab-initio pseudopotential method and a linear-response technique based on the density-functional theory (DFT) scheme within a generalized gradient approximation (GGA). Computed lattice constants, bulk modulus and elastic constants were compared. Rh2YAl exhibited higher ability to resist volume change than Rh2FeAl. The elastic constants, shear modulus, Young modulus, Poisson's ratio, B/G ratio electronic band structure, total and partial density of states, and total magnetic moment of alloys were also presented. Rh2FeAl showed spin up and spin down states whereas Rh2YAl showed none due to being non-magnetic. The calculated total densities of states for both materials suggest that both alloys are metallic in nature. Full phonon spectra of Rh2FeAl and Rh2YA1 alloys in the L21 phase were collected using the ab-initio linear response method. The obtained phonon frequencies were in the positive region indicating that both alloys are dynamically stable.

  6. Preparation of Fe-Al Intermetallic / TiC-Al2O3 Ceramic Composites from Ilmenite by SHS

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Fe-Al intermetallic/TiC-Al2O3 ceramic composites were successfully prepared by self-propagating high-temperature synthesis (SHS) from natural ilmenite, aluminium and carbon as the raw materials. The effects of carbon sources, preheating time and heat treatment temperature on synthesis process and products were investigated in detail, and the reaction process of the FeTiO3-Al-C system was also discussed.It is shown that the temperature and velocity of the combustion wave are higher when graphite is used as the carbon source, which can reflect the effect of the carbon source structure on the combustion synthesis;Prolonging the preheating time or heat treatment temperature is beneficial to the formation of the ordered intermetallics; The temperature and velocity of the combustion wave arc improved, but the disordered alloys are difficult to eliminate with the preheating time prolonged. The compound powders mainly containing ordered Fe3Al intermetallic can be prepared through heat treatment at 750 ℃.

  7. Exchange bias induced at a Co2FeAl0.5Si0.5/Cr interface

    International Nuclear Information System (INIS)

    Yu, C N T; Vick, A J; Inami, N; Ono, K; Frost, W; Hirohata, A

    2017-01-01

    In order to engineer the strength of an exchange bias in a cubic Heusler alloy layer, crystalline strain has been induced at a ferromagnet/antiferromagnet interface by their lattice mismatch in addition to the conventional interfacial exchange coupling between them. Such interfaces have been formed in (Co 2 FeAl 0.5 Si 0.5 (CFAS)/Cr) 3 structures grown by ultrahigh vacuum molecular beam epitaxy. The magnetic and structural properties have been characterised to investigate the exchange interactions at the CFAS/Cr interfaces. Due to the interfacial lattice mismatch of 1.4%, the maximum offset of 18 Oe in a magnetisation curve has been measured for the case of a CFAS (2 nm)/Cr (0.9 nm) interface at 193 K. The half-metallic property of CFAS has been observed to remain unchanged, which agrees with the theoretical prediction by Culbert et al (2008 J. Appl. Phys . 103 07D707). Such a strain-induced exchange bias may provide insight of the interfacial interactions and may offer a wide flexibility in spintronic device design. (paper)

  8. Ab initio calculation of the bcc Fe-Al phase diagram including magnetic interactions

    International Nuclear Information System (INIS)

    Gonzales-Ormeno, Pablo Guillermo; Petrilli, Helena Maria; Schoen, Claudio Geraldo

    2006-01-01

    The metastable phase diagram of the body-centered cubic-based ordering equilibria in the Fe-Al system has been calculated by the cluster expansion method, through the combination of the full potential-linear augmented plane wave and cluster variation methods. The results are discussed with reference to the effect of including the spin polarizations of Fe in the thermodynamic model

  9. Maps of Fe-Al phases formation kinetics parameters during isothermal sintering

    Energy Technology Data Exchange (ETDEWEB)

    Pochec, Ewelina, E-mail: epochec@wat.edu.pl [Department of Advanced Materials and Technology, Military University of Technology (Poland); Jozwiak, Stanislaw; Karczewski, Krzysztof; Bojar, Zbigniew [Department of Advanced Materials and Technology, Military University of Technology (Poland)

    2012-10-10

    Highlights: Black-Right-Pointing-Pointer The sintering temperature and compaction pressure have a strong influence on the sinters structure. Black-Right-Pointing-Pointer The measurements confirmed the presence of the high-aluminium phases from Fe-Al equilibrium system in tested sinters. Black-Right-Pointing-Pointer The kinetics of Fe-Al phase formation can be described by Johnson-Mehl-Avrami modelling. - Abstract: The influence of technological parameters (compaction pressure and sintering temperature) on Fe-Al phase formation was investigated. The kinetics of phase transformation preceding and during an SHS reaction was studied in isothermal conditions by DSC using the JMA (Johnson-Mehl-Avrami) model. This model allowed us to determine basic kinetic parameters, including the Avrami exponent, which characterises the rate and manner of particular phase nucleation. The activation energy (E{sub a}) of particular phase formation was determined by the Kissinger method. XRD analysis and SEM observations of sintered material showed that not only Fe{sub 2}Al{sub 5} phase and low-aluminium solid solution in iron but also aluminium-rich FeAl{sub 2} and FeAl{sub 3} phases are formed during the sintering of an FeAl50 elementary powder mixture in isothermal conditions with an SHS reaction. The above conclusions were confirmed by iron-based solid solution lattice parameter studies and microhardness measurements.

  10. Diffusion in substitutionally disordered B2 intermetallics

    International Nuclear Information System (INIS)

    Belova, I.V.; Murch, G.E.

    2002-01-01

    In this paper, a comprehensive diffusion kinetics theory is formulated to describe seamlessly tracer and chemical diffusion in antistructurally disordered B2 intermetallics showing positive and negative deviations from stoichiometry. The theory is based around unit processes consisting of six-jump cycles that can be assisted by intrinsic and extrinsic antistructural atoms of either atomic species. The Ising alloy model is used to illustrate the formalism, but the formalism can be adapted to other models. Expressions are developed for the tracer diffusion coefficients, the phenomenological coefficients, the intrinsic diffusion coefficients, the interdiffusion coefficient and the various correlation factor components. Results for the tracer and collective correlation factors and the vacancy wind factor (in interdiffusion) are in excellent agreement with results from Monte Carlo computer simulations based around single vacancy jumps. (author)

  11. A study on the formation of iron aluminide (FeAl) from elemental powders

    Energy Technology Data Exchange (ETDEWEB)

    Sina, H.; Corneliusson, J.; Turba, K.; Iyengar, S.

    2015-07-05

    Highlights: • Fe–40 at.% Al discs with coarse iron powder showed precombustion and combustion peaks. • Loose powder mixtures and discs with fine iron powder showed only combustion peaks. • Slower heating rate and fine aluminum particles promote precombustion. • The major product formed during both the reactions was Fe{sub 2}Al{sub 5}. • Heating the samples to 1000 °C yielded a stable FeAl phase as the final product. - Abstract: The formation of iron aluminide (FeAl) during the heating of Fe–40 at.% Al powder mixture has been studied using a differential scanning calorimeter. The effect of particle size of the reactants, compaction of the powder mixtures as well as the heating rate on combustion behavior has been investigated. On heating compacted discs containing relatively coarser iron powder, DSC data show two consecutive exothermic peaks corresponding to precombustion and combustion reactions. The product formed during both these reactions is Fe{sub 2}Al{sub 5} and there is a volume expansion in the sample. The precombustion reaction could be improved by a slower heating rate as well as a better surface coverage of iron particles using relatively finer aluminum powder. The combustion reaction was observed to be weaker after a strong precombustion stage. Heating the samples to 1000 °C resulted in the formation of a single and stable FeAl phase through the diffusional reaction between Fe{sub 2}Al{sub 5} and residual iron. DSC results for compacted discs containing relatively finer iron powder and for the non-compacted samples showed a single combustion exotherm during heating, with Fe{sub 2}Al{sub 5} as the product and traces of FeAl. X-ray diffraction and EDS data confirmed the formation of FeAl as the final product after heating these samples to 1000 °C.

  12. Thickness dependencies of structural and magnetic properties of cubic and tetragonal Heusler alloy bilayer films

    Science.gov (United States)

    Ranjbar, R.; Suzuki, K. Z.; Sugihara, A.; Ando, Y.; Miyazaki, T.; Mizukami, S.

    2017-07-01

    The thickness dependencies of the structural and magnetic properties for bilayers of cubic Co-based Heusler alloys (CCHAs: Co2FeAl (CFA), Co2FeSi (CFS), Co2MnAl (CMA), and Co2MnSi (CMS)) and D022-MnGa were investigated. Epitaxy of the B2 structure of CCHAs on a MnGa film was achieved; the smallest thickness with the B2 structure was found for 3-nm-thick CMS and CFS. The interfacial exchange coupling (Jex) was antiferromagnetic (AFM) for all of the CCHAs/MnGa bilayers except for unannealed CFA/MnGa samples. A critical thickness (tcrit) at which perpendicular magnetization appears of approximately 4-10 nm for the CMA/MnGa and CMS/MnGa bilayers was observed, whereas this thickness was 1-3 nm for the CFA/MnGa and CFS/MnGa films. The critical thickness for different CCHAs materials is discussed in terms of saturation magnetization (Ms) and the Jex .

  13. B2-B2.5 code benchmarking

    Energy Technology Data Exchange (ETDEWEB)

    Dekeyser, W.; Baelmans, M; Voskoboynikov, S.; Rozhansky, V.; Reiter, D.; Wiesen, S.; Kotov, V.; Boerner, P.

    2011-01-15

    ITER-IO currently (and since about 15 years) employs the SOLPS4.xxx code for its divertor design, currently version SOLPS4.3. SOLPS.xxx is a special variant of the B2-EIRENE code, which was originally developed by an European consortium (FZ Juelich, AEA Culham, ERM Belgium/KU Leuven) in the late eighties and early nineties of the last century under NET contracts. Until today even the very similar edge plasma codes within the SOLPS family, if run on a seemingly identical choice of physical parameters, still sometimes disagree significantly with each other. It is obvious that in computational engineering applications, as they are carried out for the various ITER divertor aspects with SOLPS4.3 for more than a decade now, any transition from one to another code must be fully backward compatible, or, at least, the origin of differences in the results must be identified and fully understood quantitatively. In this report we document efforts undertaken in 2010 to ultimately eliminate the third issue. For the kinetic EIRENE part within SOLPS this backward compatibility (back until 1996) was basically achieved (V. Kotov, 2004-2006) and SOLPS4.3 is now essentially up to date with the current EIRENE master maintained at FZ Juelich. In order to achieve a similar level of reproducibility for the plasma fluid (B2, B2.5) part, we follow a similar strategy, which is quite distinct from the previous SOLPS benchmark attempts: the codes are ''disintegrated'' and pieces of it are run on smallest (i.e. simplest) problems. Only after full quantitative understanding is achieved, the code model is enlarged, integrated, piece by piece again, until, hopefully, a fully backward compatible B2 / B2.5 ITER edge plasma simulation will be achieved. The status of this code dis-integration effort and its findings until now (Nov. 2010) are documented in the present technical note. This work was initiated in a small workshop by the three partner teams of KU Leuven, St. Petersburg

  14. Contextualized B2B Registries

    OpenAIRE

    Radetzki, U; Boniface, M.J.; Surridge, M.

    2007-01-01

    Abstract. Service discovery is a fundamental concept underpinning the move towards dynamic service-oriented business partnerships. The business process for integrating service discovery and underlying registry technologies into busi-ness relationships, procurement and project management functions has not been examined and hence existing Web Service registries lack capabilities required by business today. In this paper we present a novel contextualized B2B registry that supports dynamic regist...

  15. The effect of ZrO2 grinding media on the attrition milling of FeAl with Y2O3

    International Nuclear Information System (INIS)

    Gedevanishvili, S.; Deevi, S.C.

    2004-01-01

    Attrition milling of water and gas atomized FeAl was carried out with Y 2 O 3 , where ZrO 2 was used as a grinding media in place of stainless steel balls to avoid contamination with Cr and C. Consolidation of the milled powders produced complex FeAl phases containing Zr which doubled the hardness and significantly improved the creep resistance as compared to that of unmilled and consolidated FeAl

  16. Structural evolution of Fe-50 at.% Al powders during mechanical alloying and subsequent annealing processes

    International Nuclear Information System (INIS)

    Haghighi, Sh. Ehtemam; Janghorban, K.; Izadi, S.

    2010-01-01

    Iron aluminides, despite having desirable properties like excellent corrosion resistance, present low room-temperature ductility and low strength at high temperatures. Mechanical alloying as a capable process to synthesize nanocrystalline materials is under consideration to modify these drawbacks. In this study, the microstructure of iron aluminide powders synthesized by mechanical alloying and subsequent annealing was investigated. Elemental Fe and Al powders with the same atomic percent were milled in a planetary ball mill for 15 min to 100 h. The powder milled for 80 h was annealed at temperatures of 300, 500 and 700 o C for 1 h. The alloyed powders were disordered Fe(Al) solid solutions which were transformed to FeAl intermetallic after annealing. The effect of the milling time and annealing treatment on structural parameters, such as crystallite size, lattice parameter and lattice strain was evaluated by X-ray diffraction. Typically, these values were 15 nm, 2.92 A and 3.1% for the disordered Fe(Al) solid solution milled for 80 h and were 38.5 nm, 2.896 A and 1.2% for the FeAl intermetallic annealed at 700 o C, respectively.

  17. Microstructural evolution and creep of Fe-Al-Ta alloys

    Energy Technology Data Exchange (ETDEWEB)

    Prokopcakova, Petra; Svec, Martin [Technical University of Liberec (Czech Republic). Dept. of Material Science; Palm, Martin [Max-Planck-Institut fuer Eisenforschung GmbH, Duesseldorf (Germany). Structure and Nano-/Micromechanics of Materials

    2016-05-15

    The microstructural evolution in Fe-Al-Ta alloys containing 23 - 31 at.% Al and 1.5 - 2.2 at.% Ta has been studied in the temperature range 650 - 750 C by annealing for 1, 10, 100 and 1 000 h. The experiments confirm that in this temperature range the precipitation of the stable hexagonal C14 Laves phase is preceded by formation of coherent, metastable L2{sub 1} Heusler phase precipitates within the Fe-Al matrix. However, precipitates of C14 are observed after much shorter annealing times than previously assumed. Creep strength increases substantially with increasing Al content of the alloys because the solid solubility for Ta in the Fe-Al matrix increases with increasing Al content and solid-solution hardening contributes substantially to the observed high creep strength. It may therefore be that the microstructural changes during creep have no noticeable effect on creep strength.

  18. Microstructural evolution and creep of Fe-Al-Ta alloys

    International Nuclear Information System (INIS)

    Prokopcakova, Petra; Svec, Martin; Palm, Martin

    2016-01-01

    The microstructural evolution in Fe-Al-Ta alloys containing 23 - 31 at.% Al and 1.5 - 2.2 at.% Ta has been studied in the temperature range 650 - 750 C by annealing for 1, 10, 100 and 1 000 h. The experiments confirm that in this temperature range the precipitation of the stable hexagonal C14 Laves phase is preceded by formation of coherent, metastable L2 1 Heusler phase precipitates within the Fe-Al matrix. However, precipitates of C14 are observed after much shorter annealing times than previously assumed. Creep strength increases substantially with increasing Al content of the alloys because the solid solubility for Ta in the Fe-Al matrix increases with increasing Al content and solid-solution hardening contributes substantially to the observed high creep strength. It may therefore be that the microstructural changes during creep have no noticeable effect on creep strength.

  19. Nanocrystalline (Fe{sub 60}Al{sub 40}){sub 80}Cu{sub 20} alloy prepared by mechanical alloying

    Energy Technology Data Exchange (ETDEWEB)

    Krifa, M.; Mhadhbi, M. [Laboratoire de Chimie Inorganique, 99/UR/12-22, FSS – Université de Sfax, B.P. 1171, Sfax 3018 (Tunisia); Escoda, L.; Güell, J.M. [Dept. de Fisica, Universitat de Girona, Campus Montilivi, 17071 Girona (Spain); Suñol, J.J., E-mail: joanjosep.sunyol@udg.edu [Dept. de Fisica, Universitat de Girona, Campus Montilivi, 17071 Girona (Spain); Llorca-Isern, N.; Artieda-Guzmán, C. [Dept. CMEM, Universitat de Barcelona, Martí Franques 1, 08028 Barcelona (Spain); Khitouni, M. [Laboratoire de Chimie Inorganique, 99/UR/12-22, FSS – Université de Sfax, B.P. 1171, Sfax 3018 (Tunisia)

    2013-03-25

    Highlights: ► Nanocrystalline Fe(Al, Cu) powdered alloy (10 nm) has been synthesized by MA. ► Decreasing the crystallite size increases coercivity and squareness ratio. ► As low crystallites size stronger hard ferromagnetic material results. -- Abstract: A nanostructured disordered Fe(Al, Cu) solid solution was obtained from prealloyed FeAl and elemental Cu powders using a high-energy ball mill. The transformations occurring in the material during milling were studied with the use of X-ray diffraction. The transformation of the phase depends upon the milling time. With the increase of milling time all Cu atoms became dissolved in the bcc Fe and the final product of the MA process was the nanocrystalline Fe(Al, Cu) solid solution with a mean crystallite size of 10 nm. Scanning electron microscopy (SEM) was employed to examine the morphology of the samples as a function of milling times. Magnetic properties were also investigated and were related to the microstructural changes. The system showed hard magnetic behavior.

  20. Capping layer-tailored interface magnetic anisotropy in ultrathin Co{sub 2}FeAl films

    Energy Technology Data Exchange (ETDEWEB)

    Belmeguenai, M., E-mail: belmeguenai.mohamed@univ-paris13.fr; Zighem, F.; Chérif, S. M. [LSPM (CNRS-UPR 3407), Université Paris 13, Sorbonne Paris Cité, 99 Avenue Jean-Baptiste Clément, 93430 Villetaneuse (France); Gabor, M. S., E-mail: mihai.gabor@phys.utcluj.ro; Petrisor, T. [Center for Superconductivity, Spintronics and Surface Science, Department of Physics and Chemistry, Technical University of Cluj-Napoca, Str. Memorandumului No. 28, RO-400114 Cluj-Napoca (Romania); Tiusan, C. [Center for Superconductivity, Spintronics and Surface Science, Department of Physics and Chemistry, Technical University of Cluj-Napoca, Str. Memorandumului No. 28, RO-400114 Cluj-Napoca (Romania); Institut Jean Lamour, CNRS, Lorraine Université, BP 70239, F-54506 Vandoeuvre (France)

    2015-01-14

    Co{sub 2}FeAl (CFA) thin films of various thicknesses (2 nm ≤ d ≤ 50 nm) have been grown on (001) MgO single crystal substrates and then capped with Cr, V, and Ta. Their magnetic and structural properties have been studied by x-ray diffraction (XRD), vibrating sample magnetometry, and broadband microstrip ferromagnetic resonance (MS-FMR). The XRD revealed that the films are epitaxial with the cubic [001] CFA axis normal to the substrate plane and that the chemical order varies from the B2 phase to the A2 phase when decreasing the thickness. The deduced lattice parameters showed that the Cr-capped films exhibit a larger tetragonal distortion, as compared with the films capped with V or Ta. The presence of magnetic dead layers has been observed in CFA samples capped with V and Ta but not in the case of the Cr-capped ones. The effective magnetization, deduced from the fit of MS-FMR measurements, increases (decreases) linearly with the CFA inverse thickness (1/d) for the Cr-capped (Ta-capped) films while it is constant for the V-capped ones. This allows quantifying the perpendicular surface anisotropy coefficients of −0.46 erg/cm{sup 2} and 0.74 erg/cm{sup 2} for Cr and Ta-capped films, respectively. Moreover, the fourfold and the uniaxial anisotropy fields, measured in these films, showed different trends with a respect to the CFA inverse thickness. This allows inferring that a non-negligible part of the fourfold magnetocrystalline term is of interfacial origin.

  1. Co2FeAl Heusler thin films grown on Si and MgO substrates: Annealing temperature effect

    International Nuclear Information System (INIS)

    Belmeguenai, M.; Tuzcuoglu, H.; Zighem, F.; Chérif, S. M.; Moch, P.; Gabor, M. S.; Petrisor, T.; Tiusan, C.

    2014-01-01

    10 nm and 50 nm Co 2 FeAl (CFA) thin films have been deposited on MgO(001) and Si(001) substrates by magnetron sputtering and annealed at different temperatures. X-rays diffraction revealed polycrystalline or epitaxial growth (according to CFA(001)[110]//MgO(001)[100] epitaxial relation) for CFA films grown on a Si and on a MgO substrate, respectively. For these later, the chemical order varies from the A2 phase to the B2 phase when increasing the annealing temperature (T a ), while only the A2 disorder type has been observed for CFA grown on Si. Microstrip ferromagnetic resonance (MS-FMR) measurements revealed that the in-plane anisotropy results from the superposition of a uniaxial and a fourfold symmetry term for CFA grown on MgO substrates. This fourfold anisotropy, which disappears completely for samples grown on Si, is in accord with the crystal structure of the samples. The fourfold anisotropy field decreases when increasing T a , while the uniaxial anisotropy field is nearly unaffected by T a within the investigated range. The MS-FMR data also allow for concluding that the gyromagnetic factor remains constant and that the exchange stiffness constant increases with T a . Finally, the FMR linewidth decreases when increasing T a , due to the enhancement of the chemical order. We derive a very low intrinsic damping parameter (1.1×10 −3 and 1.3×10 −3 for films of 50 nm thickness annealed at 615 °C grown on MgO and on Si, respectively)

  2. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  3. The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)

    Science.gov (United States)

    Jacobson, Nathan S.; Myers, Dwight L.

    2011-01-01

    The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.

  4. Application of Small Punch Test for Estimation of Fracture Properties of Fe-Al Alloys

    Czech Academy of Sciences Publication Activity Database

    Dobeš, Ferdinand; Milička, Karel

    2010-01-01

    Roč. 63, Sp. Iss. (2010), s. 83-86 ISSN 0018-8069. [Determination of Mechanical Properties of Materials by Small Punch and Other Miniature Testing Techniques/1./. Ostrava, 31.08.2010-02.09.2010] R&D Projects: GA ČR GA106/08/1238 Institutional research plan: CEZ:AV0Z20410507 Keywords : small punch test * ductility * iron aluminides Subject RIV: JG - Metallurgy

  5. Three types of dislocation core structure in B2 alloys

    Czech Academy of Sciences Publication Activity Database

    Paidar, Václav; Čák, M.

    2016-01-01

    Roč. 73, Jun (2016), 21-25 ISSN 0966-9795 Institutional support: RVO:68378271 Keywords : intermetallics * mechanical properties * planar faults * ab-initio calculations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 3.140, year: 2016

  6. 32 CFR 806b.2 - Basic guidelines.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Basic guidelines. 806b.2 Section 806b.2 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE ADMINISTRATION PRIVACY ACT PROGRAM Overview of the Privacy Act Program § 806b.2 Basic guidelines. This part implements the Privacy Act of 1974...

  7. Influence of gas detonation spraying conditions on the quality of Fe-Al intermetallic protective coatings

    Directory of Open Access Journals (Sweden)

    Senderowski C.

    2007-01-01

    Full Text Available The aim of this paper is to present generalized research results and analyses of the quality of coatings produced with self decomposing Fe-Al intermetallic powders deposited on 1045 steel in the gas detonation spraying (GDS. A number of GDS experiments has been carried out with significantly changed operational spraying parameters (the volume of the fuel gas, carrier gas, distance and the frequency of spraying which define the process energy level directly influencing the quality of the coating. On the basis of the initial results the choice of the process parameters has been made to obtain the most advantageous set of geometrical and physical-mechanical properties of the coating material and substrate. The quality of the coatings was considered by taking into account the grain morphology, chemical content, phase inhomogeneity, cohesive porosity, as well as adhesive porosity in the substrate coating joint. The coating roughness was also considered. It was found that all GDS coatings produced are built with lamellar splats which result from the GDS process transformed (changed plasticity and geometry powder particles forming the deposit. The result of the GDS spraying parameters optimization is the lack of signs of melting of the material (even in microareas while the geometry of the deposited grains is considerably changed. This phenomenon has been considered as a proof of high plasticity of the GDS formed Fe-Al intermetallic coatings.

  8. The grain refinement behavior of TiB2 particles prepared with in situ technology

    International Nuclear Information System (INIS)

    Wang Chunlei; Wang Mingxing; Yu Benhai; Chen Dong; Qin Ping; Feng Minghai; Dai Qirun

    2007-01-01

    The grain-refining behavior of TiB 2 particles was investigated by the method of adding Al-4B master alloy into the melt of electrolytic low-titanium aluminum (ELTA). The results indicate that TiB 2 particles will be formed when the Al-4B master alloy is added into the melt of ELTA. These TiB 2 particles are produced by in situ technology, thus their surface properties are preserved and do not alter. At the bottom of the melt, the TiB 2 particles are pushed to the grain boundaries because of the absence of enough titanium atoms, which indicates that TiB 2 particles alone are not potent nuclei of α-Al. Though some TiB 2 particles settle down at the bottom, there are still numbers of fine TiB 2 particles suspended. These TiB 2 particles, together with the titanium atoms left, will form much more heterogeneous nucleation sites during the solidification of the melt, resulting in the grain-refining efficiency of the ELTA with Al-4B addition being improved obviously. To investigate the grain-refining mechanism of aluminum, this method has its advantages in comparison with that of adding synthetic TiB 2 particles into the melt of aluminum

  9. Influence of the surfactant and annealing rate on the morphology, magnetic and structural characteristics of Co{sub 2}FeAl nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Pezeshki-Nejad, Zahra [Institute of Nano Science and Nano Technology, University of Kashan, P.O. Box. 87317–51167, Kashan, Islamic Republic of Iran (Iran, Islamic Republic of); Ramazani, Abdolali [Institute of Nano Science and Nano Technology, University of Kashan, P.O. Box. 87317–51167, Kashan, Islamic Republic of Iran (Iran, Islamic Republic of); Department of Physics, University of Kashan, 87317-51167, Kashan (Iran, Islamic Republic of); Alikhanzadeh-Arani, Sima [Institute of Nano Science and Nano Technology, University of Kashan, P.O. Box. 87317–51167, Kashan, Islamic Republic of Iran (Iran, Islamic Republic of); Almasi-Kashi, Mohammad [Institute of Nano Science and Nano Technology, University of Kashan, P.O. Box. 87317–51167, Kashan, Islamic Republic of Iran (Iran, Islamic Republic of); Department of Physics, University of Kashan, 87317-51167, Kashan (Iran, Islamic Republic of); Salavati-Niasari, Masoud, E-mail: salavati@kashanu.ac.ir [Institute of Nano Science and Nano Technology, University of Kashan, P.O. Box. 87317–51167, Kashan, Islamic Republic of Iran (Iran, Islamic Republic of)

    2016-08-15

    This research focuses on the synthesis and characterization of the attractive magnetic alloys, full-Heusler Co{sub 2}FeAl nanoparticles. A modified co-precipitation method has been developed in a template of chitosan biopolymer. XRD pattern of the product confirmed the high crystalline quality of the L2{sub 1}‒ordered nanoparticles, refined by Rietveld analysis. It was found that using different annealing rates can be surprisingly effective to achieve different morphologies from granular microstructure to fibrous-shaped nanostructure. Based on the obtained results of the high resolution TEM image, the presence of both populations of large single crystal grains and polycrystalline clusters containing several small particles (about 10 nm) can be found in the sample annealed up to 700 °C with 5 °C/min. This particle size distribution led to the co-existence of high and low coercive-field phases in the related FORC diagram. Major hysteresis loops showed that the using of chitosan biopolymer resulted in a smaller magnetic saturation compared to that of the control sample, probably due to presence of the oxide shell around the surface of nanoparticles when exposed to air. - Highlights: • First Order Reversal Curves (FORCs) analysis was used to study precisely. • A simple chemical process of co- precipitation rout was used for synthesizing the nanoparticles. • Well known chitosan biopolymer was used as polymer template for coating the nanoparticles. • Effects of the temperature and heating rate in the annealing process were investigated.

  10. Influence of the surfactant and annealing rate on the morphology, magnetic and structural characteristics of Co2FeAl nanoparticles

    International Nuclear Information System (INIS)

    Pezeshki-Nejad, Zahra; Ramazani, Abdolali; Alikhanzadeh-Arani, Sima; Almasi-Kashi, Mohammad; Salavati-Niasari, Masoud

    2016-01-01

    This research focuses on the synthesis and characterization of the attractive magnetic alloys, full-Heusler Co 2 FeAl nanoparticles. A modified co-precipitation method has been developed in a template of chitosan biopolymer. XRD pattern of the product confirmed the high crystalline quality of the L2 1 ‒ordered nanoparticles, refined by Rietveld analysis. It was found that using different annealing rates can be surprisingly effective to achieve different morphologies from granular microstructure to fibrous-shaped nanostructure. Based on the obtained results of the high resolution TEM image, the presence of both populations of large single crystal grains and polycrystalline clusters containing several small particles (about 10 nm) can be found in the sample annealed up to 700 °C with 5 °C/min. This particle size distribution led to the co-existence of high and low coercive-field phases in the related FORC diagram. Major hysteresis loops showed that the using of chitosan biopolymer resulted in a smaller magnetic saturation compared to that of the control sample, probably due to presence of the oxide shell around the surface of nanoparticles when exposed to air. - Highlights: • First Order Reversal Curves (FORCs) analysis was used to study precisely. • A simple chemical process of co- precipitation rout was used for synthesizing the nanoparticles. • Well known chitosan biopolymer was used as polymer template for coating the nanoparticles. • Effects of the temperature and heating rate in the annealing process were investigated.

  11. Effect of nano-oxide layers on giant magnetoresistance in pseudo-spin-valves using Co2FeAl electrodes

    International Nuclear Information System (INIS)

    Zhang, D.L.; Xu, X.G.; Wu, Y.; Miao, J.; Jiang, Y.

    2011-01-01

    We studied the pseudo-spin-valves (PSVs) with a structure of Ta/Co 2 FeAl/NOL 1 /Co 2 FeAl/Cu/Co 2 FeAl/NOL 2 /Ta, where NOL represents the nano-oxide layer. Compared with the normal Co 2 FeAl (CFA) PSV with a structure of Ta/Co 2 FeAl/Cu/Co 2 FeAl/Ta, which shows only a current-in-plane (CIP) giant magnetoresistance (GMR) of 0.03%, the CFA PSV with NOLs shows a large CIP-GMR of 5.84%. The enhanced GMR by the NOLs inserted in the CFA PSV is due to the large specular reflection caused by [(CoO)(Fe 2 O 3 )(Al 2 O 3 )] in NOL 1 and [(Fe 2 O 3 )(Al 2 O 3 )(Ta 2 O 5 )] in NOL 2 . Another reason is that the roughness of the interface between Ta and CFA is improved by the oxidation procedure. - Research highlights: → Nano-oxide layers are applied in the pseudo-spin-valves with the Heusler alloy. → The CIP-GMR of pseudo-spin-valves is improved from 0.03% to 5.84%. → The GMR ratio is decided by the position of nano-oxide layers.

  12. Tunnel magnetoresistance of an as-deposited Co2FeAl0.5Si0.5-based magnetic tunnel junction on a Ta/Ru buffer layer

    International Nuclear Information System (INIS)

    Hwang, Jae Youn; Lee, Gae Hun; Song, Yun Heub; Yim, Hae In

    2010-01-01

    A magnetic tunnel junction (MTJ) with a Co 2 FeAl 0.5 Si 0.5 (CFAS) heusler film on a conductive Ta/Ru buffer layer was fabricated for the first time. In the as-deposited state, a highly B2-ordered CFAS film was obtained by using the Ta/Ru buffer layer. The Ta (110) buffer layer causes a Ru (002) buffer layer, which leads to the growth of CFAS with a B2 structure and a completely flat CFAS film. After 600 .deg. C annealing, strain relaxation occurred in the Ta/Ru interface, and the surface roughness decreased; however, the B2-ordered CFAS film remained. Also, in the as-deposited state, a exchange-biased CFAS/AlO x /CFAS MTJ deposited on a Ta/Ru buffer layer exhibited a relatively high tunnel magnetoresistance (TMR) of 13% at room temperature, which resulted from the highly B2-ordered CFAS layer and the perfectly flat surface roughness resulting from the use of the Ta/Ru buffer layer.

  13. Growth modes and epitaxy of FeAl thin films on a-cut sapphire prepared by pulsed laser and ion beam assisted deposition

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Xiang; Trautvetter, Moritz; Ziemann, Paul [Institut für Festkörperphysik, Universität Ulm, Albert-Einstein-Allee 11, 89069 Ulm (Germany); Wiedwald, Ulf [Institut für Festkörperphysik, Universität Ulm, Albert-Einstein-Allee 11, 89069 Ulm (Germany); Fakultät für Physik, Universität Duisburg-Essen, Lotharstraße 1, 47057 Duisburg (Germany)

    2014-01-14

    FeAl films around equiatomic composition are grown on a-cut (112{sup ¯}0) sapphire substrates by ion beam assisted deposition (IBAD) and pulsed laser deposition (PLD) at ambient temperature. Subsequent successive annealing is used to establish chemical order and crystallographic orientation of the films with respect to the substrate. We find a strongly [110]-textured growth for both deposition techniques. Pole figures prove the successful preparation of high quality epitaxial films by PLD with a single in-plane orientation. IBAD-grown films, however, exhibit three in-plane orientations, all of them with broad angular distributions. The difference of the two growth modes is attributed to the existence of a metastable intermediate crystalline orientation as concluded from nonassisted sputter depositions at different substrate temperatures. The formation of the chemically ordered crystalline B2 phase is accompanied by the expected transition from ferromagnetic to paramagnetic behavior of the films. In accordance with the different thermally induced structural recovery, we find a step-like magnetic transition to paramagnetic behavior after annealing for 1 h at T{sub A} = 300 °C for IBAD deposition, while PLD-grown films show a gradual decrease of ferromagnetic signals with rising annealing temperatures.

  14. Lattice dynamical and thermodynamical properties of ReB2, RuB2, and OsB2 compounds in the ReB2 structure

    International Nuclear Information System (INIS)

    Deligoz, E.; Colakoglu, K.; Ciftci, Y. O.

    2012-01-01

    Structural and lattice dynamical properties of ReB 2 , RuB 2 , and OsB 2 in the ReB 2 structure are studied in the framework of density functional theory within the generalized gradient approximation. The present results show that these compounds are dynamically stable for the considered structure. The temperature-dependent behaviors of thermodynamical properties such as internal energy, free energy, entropy, and heat capacity are also presented. The obtained results are in good agreement with the available experimental and theoretical data

  15. MgB2 thin films by hybrid physical-chemical vapor deposition

    International Nuclear Information System (INIS)

    Xi, X.X.; Pogrebnyakov, A.V.; Xu, S.Y.; Chen, K.; Cui, Y.; Maertz, E.C.; Zhuang, C.G.; Li, Qi; Lamborn, D.R.; Redwing, J.M.; Liu, Z.K.; Soukiassian, A.; Schlom, D.G.; Weng, X.J.; Dickey, E.C.; Chen, Y.B.; Tian, W.; Pan, X.Q.; Cybart, S.A.; Dynes, R.C.

    2007-01-01

    Hybrid physical-chemical vapor deposition (HPCVD) has been the most effective technique for depositing MgB 2 thin films. It generates high magnesium vapor pressures and provides a clean environment for the growth of high purity MgB 2 films. The epitaxial pure MgB 2 films grown by HPCVD show higher-than-bulk T c due to tensile strain in the films. The HPCVD films are the cleanest MgB 2 materials reported, allowing basic research, such as on magnetoresistance, that reveals the two-band nature of MgB 2 . The carbon-alloyed HPCVD films demonstrate record-high H c2 values promising for high magnetic field applications. The HPCVD films and multilayers have enabled the fabrication of high quality MgB 2 Josephson junctions

  16. Melting and casting of FeAl-based cast alloy

    Energy Technology Data Exchange (ETDEWEB)

    Sikka, V.K. [Oak Ridge National Lab., TN (United States); Wilkening, D. [Columbia Falls Aluminum Co., Columbia Falls, MT (United States); Liebetrau, J.; Mackey, B. [AFFCO, L.L.C., Anaconda, MT (United States)

    1998-11-01

    The FeAl-based intermetallic alloys are of great interest because of their low density, low raw material cost, and excellent resistance to high-temperature oxidation, sulfidation, carburization, and molten salts. The applications based on these unique properties of FeAl require methods to melt and cast these alloys into complex-shaped castings and centrifugal cast tubes. This paper addresses the melting-related issues and the effect of chemistry on the microstructure and hardness of castings. It is concluded that the use of the Exo-Melt{trademark} process for melting and the proper selection of the aluminum melt stock can result in porosity-free castings. The FeAl alloys can be melted and cast from the virgin and revert stock. A large variation in carbon content of the alloys is possible before the precipitation of graphite flakes occurs. Titanium is a very potent addition to refine the grain size of castings. A range of complex sand castings and two different sizes of centrifugal cast tubes of the alloy have already been cast.

  17. Magnetic and structural properties of Co2FeAl thin films grown on Si substrate

    International Nuclear Information System (INIS)

    Belmeguenai, Mohamed; Tuzcuoglu, Hanife; Gabor, Mihai; Petrisor, Traian; Tiusan, Coriolan; Berling, Dominique; Zighem, Fatih; Mourad Chérif, Salim

    2015-01-01

    The correlation between magnetic and structural properties of Co 2 FeAl (CFA) thin films of different thicknesses (10 nmFeAl thin films were grown on a Si(001) substrates and annealed at 600 °C. • The thickness dependence of magnetic and structural properties has been studied. • X-ray measurements revealed an (011) out-of-plane textured growth of the films. • The easy axis coercive field varies linearly with the inverse CFA thickness. • The effective magnetization increases linearly with the inverse film thickness

  18. B11 NMR in the layered diborides OsB2 and RuB2

    Science.gov (United States)

    Suh, B. J.; Zong, X.; Singh, Y.; Niazi, A.; Johnston, D. C.

    2007-10-01

    B11 nuclear magnetic resonance (NMR) measurements have been performed on B11 enriched OsB2 and RuB2 polycrystalline powder samples in an external field of 4.7T and in the temperature range, 4.2KOsB2 and RuB2 , respectively. The experimental results indicate that a p character dominates the conduction electron wave function at the B site with a negligibly small s character in both compounds.

  19. Ni-ZrB2 electrocomposites

    International Nuclear Information System (INIS)

    Pushpavanam, M.; Natarajan, S.R.

    1992-01-01

    New generation materials require high temperature oxidation resistance besides many other tribological properties. Ni-ZrB 2 composites and their properties are dealt with in this paper. (author). 7 refs., 3 figs., 4 tabs

  20. A Model of B2B Exchanges

    OpenAIRE

    Gabor Fath; Miklos Sarvary

    2001-01-01

    B2B exchanges are revolutionizing the way businesses will buy and sell a variety of intermediary products and services. It is estimated that most of the roughly $7 trillion worth of business transactions are likely to go through these new institutions within the next decade. This paper tries to understand the economics governing the transactions within B2B exchanges and analyze their likely evolution over time. In doing so, we start by providing the rigorous definitions to a number of critica...

  1. Hotelzon's B2B content marketing plan

    OpenAIRE

    Nguyen, Trang

    2015-01-01

    This thesis follows a research-based structure. The objective of this research was to help the case company Hotelzon develop a practical business-to-business (B2B) content marketing plan to engage new customers. The research topic came up when the case company named Hotelzon started expanding its business to many other countries. Therefore, attracting new prospects has become a critical issue to B2B corporates in this online world and constantly changing business environment. The first pa...

  2. Comparison of monoclonal antibodies and rabbit antisera in B2 microglobulin (B2m) radioimmunoassay

    International Nuclear Information System (INIS)

    Vincent, C.

    1981-01-01

    Human B2m is a globular protein devoid of carbohydrates and is composed of 100 aminoacids with an intrachain disulfide bridge in position 25-81. Its aminoacid sequence and three dimensional structure shows a partial homology with the constant domains of immunoglobulins. B2m has been detected at the surface of nearly all cell types with the exception of erythrocytes and trophoblastic cells and also in all biological fluids. On the cell surface B2m is found non-covalently associated with HLA molecules, and in serum and urine only a small part of the B2m is associated with HLA heavy chain, the remaining is found as free B2m. The aim of this paper is firstly to try to demonstrate the presence of two types of epitopes one of them specific of free B2m and secondly to compare monoclonal antibodies with rabbit antisera for B2m radioimmunoassay. (Auth.)

  3. Microstructure and mechanical properties investigation of in situ TiB2 and ZrB2 reinforced Al-4Cu composites

    Science.gov (United States)

    Lutfi Anis, Ahmad; Ramli, Rosmamuhammadani; Darham, Widyani; Zakaria, Azlan; Talari, Mahesh Kumar

    2016-02-01

    Conventional Al-Cu alloys exhibit coarse grain structure leading to inferior mechanical properties in as-cast condition. Expensive thermo-mechanical treatments are needed to improve microstructure and corresponding mechanical properties. In situ Al-based composites were developed to improve mechanical properties by dispersion strengthening and grain refinement obtained by the presence of particulates in the melt during solidification. In this work Al-4Cu - 3TiB2 and Al-4Cu-3ZrB2 in situ composites were prepared by liquid casting method. XRD, electron microscopy and mechanical tests were performed on suitably sectioned and metallographically prepared surfaces to investigate the phase distribution, hardness and tensile properties. It was found that the reinforcement particles were segregated along the grain boundaries of Al dendrites. Tensile fracture morphology for both Al-4Cu - 3TiB2 and Al-4Cu-3ZrB2 were analyzed and compared to determine the fracture propagation mechanism in the composites. Al-4Cu-3ZrB2 in situ composites displayed higher strength and hardness compared to Al-4Cu-3TiB2 which could be ascribed to the stronger interfacial bonding between the Al dendrites and ZrB2 particulates as evidenced from fractographs.

  4. Neutron polarizing Fe-Al supermirror on a Si crystal substrate and its applications for thermal and cold neutrons

    International Nuclear Information System (INIS)

    Syromyatnikov, V.G.; Shchebetov, A.F.; Soroko, Z.N.

    1994-01-01

    Experimental data are presented for an Fe-Al neutron polarizing supermirror on a Si crystal substrate with an antireflecting Cd layer. The polarizing efficiency of this supermirror is P≥qslant0.8 for the range of glancing angles θ/λ=0.25-1.7 /nm and P≥qslant0.95 for θ/λ=0.34-1.7 /nm. Some applications of this supermirror for thermal and cold neutrons are considered. ((orig.))

  5. Study of behaviour during a quench treatment of ferrite delta of binary and pseudo-binary alloys

    International Nuclear Information System (INIS)

    Champin, B.

    1970-01-01

    Focusing of Fe-Cr and Fe-Mo alloys (and extending results to different binary alloys like Fe-W, Fe-Al and Fe-Si, and even to some ternary systems such as Fe-Cr-Ni and Fe-Mo-Ni), and after having recalled some previous results and presented experimental materials and processes, this research thesis describes the behaviour of the considered alloys, reports a detailed study of Fe-Mo alloys (influence of carbon content), a bibliographical study of the gamma-to-delta transformation, the study of hybrid alloys (behaviour, partial transformations, diffusion), the study of other types of alloys (hyper-quench of delta ferrite of Fe-Mo alloys, adsorption and diffusion). It discusses the case of two-phase structures, and the mechanism and kinetics of the delta-to-gamma transformation

  6. Co{sub 2}FeAl Heusler thin films grown on Si and MgO substrates: Annealing temperature effect

    Energy Technology Data Exchange (ETDEWEB)

    Belmeguenai, M., E-mail: belmeguenai.mohamed@univ-paris13.fr; Tuzcuoglu, H.; Zighem, F.; Chérif, S. M.; Moch, P. [LSPM (CNRS-UPR 3407), 99 avenue Jean-Baptiste Clément, Université Paris 13, 93430 Villetaneuse (France); Gabor, M. S., E-mail: mihai.gabor@phys.utcluj.ro; Petrisor, T. [Center for Superconductivity, Spintronics and Surface Science, Technical University of Cluj-Napoca, Str. Memorandumului No. 28 RO-400114 Cluj-Napoca (Romania); Tiusan, C. [Center for Superconductivity, Spintronics and Surface Science, Technical University of Cluj-Napoca, Str. Memorandumului No. 28 RO-400114 Cluj-Napoca (Romania); Institut Jean Lamour, CNRS, Université de Nancy, BP 70239, F–54506 Vandoeuvre (France)

    2014-01-28

    10 nm and 50 nm Co{sub 2}FeAl (CFA) thin films have been deposited on MgO(001) and Si(001) substrates by magnetron sputtering and annealed at different temperatures. X-rays diffraction revealed polycrystalline or epitaxial growth (according to CFA(001)[110]//MgO(001)[100] epitaxial relation) for CFA films grown on a Si and on a MgO substrate, respectively. For these later, the chemical order varies from the A2 phase to the B2 phase when increasing the annealing temperature (T{sub a}), while only the A2 disorder type has been observed for CFA grown on Si. Microstrip ferromagnetic resonance (MS-FMR) measurements revealed that the in-plane anisotropy results from the superposition of a uniaxial and a fourfold symmetry term for CFA grown on MgO substrates. This fourfold anisotropy, which disappears completely for samples grown on Si, is in accord with the crystal structure of the samples. The fourfold anisotropy field decreases when increasing T{sub a}, while the uniaxial anisotropy field is nearly unaffected by T{sub a} within the investigated range. The MS-FMR data also allow for concluding that the gyromagnetic factor remains constant and that the exchange stiffness constant increases with T{sub a}. Finally, the FMR linewidth decreases when increasing T{sub a}, due to the enhancement of the chemical order. We derive a very low intrinsic damping parameter (1.1×10{sup −3} and 1.3×10{sup −3} for films of 50 nm thickness annealed at 615 °C grown on MgO and on Si, respectively)

  7. Electronic structure of MgB2

    Indian Academy of Sciences (India)

    Abstract. Results of ab initio electronic structure calculations on the compound MgB2 using the. FPLAPW method employing GGA for the exchange-correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, c/a ratio and the bulk modulus, all of which are in excellent ...

  8. Electronic structure of MgB 2

    Indian Academy of Sciences (India)

    Results of ab initio electronic structure calculations on the compound MgB2 using the FPLAPW method employing GGA for the exchange-correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, / ratio and the bulk modulus, all of which are in excellent agreement with ...

  9. Solidification Mechanism of the D-Gun Sprayed Fe-Al Particles

    Directory of Open Access Journals (Sweden)

    Wołczyński W.

    2017-12-01

    Full Text Available The detonation gas spraying method is used to study solidification of the Fe-40Al particles after the D-gun spraying and settled on the water surface. The solidification is divided into two stages. First, the particle solid shell forms during the particle contact with the surrounding air / gas. Usually, the remaining liquid particle core is dispersed into many droplets of different diameter. A single Fe-Al particle is described as a body subjected to a rotation and finally to a centrifugal force leading to segregation of iron and aluminum. The mentioned liquid droplets are treated as some spheres rotated freely / chaotically inside the solid shell of the particle and also are subjected to the centrifugal force. The centrifugal force, and first of all, the impact of the particles onto the water surface promote a tendency for making punctures in the particles shell. The droplets try to desert / abandon the mother-particles through these punctures. Some experimental evidences for this phenomenon are delivered. It is concluded that the intensity of the mentioned phenomenon depends on a given droplet momentum. The droplets solidify rapidly during their settlement onto the water surface at the second stage of the process under consideration. A model for the solidification mechanism is delivered.

  10. Effectiveness of Arsenic Co-Precipitation with Fe-Al Hydroxides for Treatment of Contaminated Water

    Directory of Open Access Journals (Sweden)

    Jaime Wilson Vargas de Mello

    2018-03-01

    Full Text Available ABSTRACT Wastewater treatment is a challenging problem faced by the mining industry, especially when mine effluents include acid mine drainage with elevated arsenic levels. Iron (hydroxides are known to be effective in removal of As from wastewater, and although the resulting compounds are relatively unstable, the presence of structural Al enhances their stability, particularly under reducing conditions. The purpose of this study was to assess the effectiveness of Al-Fe (hydroxide co-precipitates for the removal of As from wastewater and to assess the chemical stability of the products. Different Al-Fe (hydroxides were synthesized at room temperature from ferrous and aluminum salts using three different Fe:Al molar ratios (1:0.0, 1:0.3, and 1:0.7 and aged for 90 days (sulfate experiments or 120 days (chloride experiments in the presence of arsenic. At the end of the aging periods, the precipitated sludges were dried and characterized in order to evaluate their stability and therefore potential As mobility. All treatments were effective in reducing As levels in the water to below 10 µg L-1, but the presence of Al impaired the effectiveness of the treatment. Aluminum decreased the chemical stability of the precipitated sludge and hence its ability to retain As under natural environmental conditions.

  11. Mechanical properties enhancement and microstructure study of Al-Si-TiB2 in situ composites

    Science.gov (United States)

    Sahoo, S. K.; Majhi, J.; Pattnaik, A. B.; Sahoo, J. K.; Das, Swagat

    2018-03-01

    Al–Si alloy-based composite is one of the most promising MMC materials owing to its outstanding mechanical properties, wear and corrosion resistance, low cost and ability to be synthesized via conventional casting routes. Challenges in achieving clean interface between reinforced particles and matrix alloy have been overcome by means of in-situ techniques of fabrication. Present investigation is concerned with synthesizing Al-Si-TiB2 in-situ composites through stir casting route using K2TiF6 and KBF4 halide salts for exothermic salt metal reaction. X-Ray diffraction analysis revealed the existence of TiB2 in the prepared samples. Effect of TiB2in-situ particles in the Al-Si base alloy has been investigated from the results obtained from optical microscopy as well as SEM study and wear analysis with a pin on disc wear testing apparatus. Improved hardness and wear properties were observed with addition of TiB2.

  12. A study of microstructure and wear behaviour of TiB2/Al metal matrix composites

    Directory of Open Access Journals (Sweden)

    A. Sreenivasan

    Full Text Available The present paper deals with the study of microstructure and wear characteristics of TiB2 reinforced aluminium metal matrix composites (MMCs. Matrix alloys with 5, 10 and 15% of TiB2 were made using stir casting technique. Effect of sliding velocity on the wear behaviour and tribo-chemistry of the worn surfaces of both matrix and composites sliding against a EN24 steel disc has been investigated under dry conditions. A pin-on-disc wear testing machine was used to find the wear rate, in which EN24 steel disc was used as the counter face, loads of 10-60N in steps of 10N and speeds of 100, 200, 300, 400 and 500 rpm were employed. The results showed that the wear rate was increased with an increase in load and sliding speed for both the materials. However, a lower wear rate was obtained for MMCs when compared to the matrix alloys. The wear transition from slight to severe was presented at the critical applied loads. The transition loads for the MMCs were much higher than that of the matrix alloy. The transition loads were increased with increase in TiB2 and the same was decreased with the increase of sliding speeds. The SEM and EDS analyses were undertaken to demonstrate the effect of TiB2 particles on the wear mechanism for each conditions.

  13. Thermodynamic properties of vitamin B2

    International Nuclear Information System (INIS)

    Knyazev, A.V.; Letyanina, I.A.; Plesovskikh, A.S.; Smirnova, N.N.; Knyazeva, S.S.

    2014-01-01

    Graphical abstract: - Highlights: • Temperature dependence of heat capacity of vitamin B 2 has been measured by precision adiabatic vacuum calorimetry. • The thermodynamic functions of the vitamin B 2 have been determined for the range from T → 0 to 322 K. • The energy of combustion of the riboflavin has been measured at 298.15 K. • The enthalpy of combustion Δ c H° and the thermodynamic parameters Δ f H°, Δ f S°, Δ f G° have been calculated. - Abstract: In the present work temperature dependence of heat capacity of vitamin B 2 (riboflavin) has been measured for the first time in the range from 6 to 322 K by precision adiabatic vacuum calorimetry. Based on the experimental data, the thermodynamic functions of the vitamin B 2 , namely, the heat capacity, enthalpy H°(T) − H°(0), entropy S°(T) − S°(0) and Gibbs function G°(T) − H°(0) have been determined for the range from T → 0 to 322 K. The value of the fractal dimension D in the function of multifractal generalization of Debye's theory of the heat capacity of solids was estimated and the character of heterodynamics of structure was detected. In a calorimeter with a static bomb and an isothermal shield, the energy of combustion of the riboflavin has been measured at 298.15 K. The enthalpy of combustion Δ c H° and the thermodynamic parameters Δ f H°, Δ f S°, Δ f G° and of reaction of formation of the riboflavin from simple substances at T = 298.15 K and p = 0.1 MPa have been calculated

  14. Effects of TiB2 Particle and Short Fiber Sizes on the Microstructure and Properties of TiB2-Reinforced Composite Coatings

    Science.gov (United States)

    Lin, Yinghua; Yao, Jianhua; Wang, Liang; Zhang, Qunli; Li, Xueqiao; Lei, Yongping; Fu, Hanguang

    2018-03-01

    In this study, particle and short fiber-reinforced titanium matrix composite coatings are prepared via laser in situ technique using (0.5 and 50 μm) TiB2 and Ti powder as cladding materials. The microstructure and properties of the composite coatings are studied, and the changing mechanism of the microstructure is discussed. The results reveal that particle agglomeration is prone to appear with using fine TiB2 particles. Decomposition of the particles preferentially occurs with using coarse TiB2 particles. The cracks and pores on the surface of the coating are formed at a lower laser energy density. With the increase in the laser energy density, cracking on the surface of the coating diminishes, but the coating exhibits depression behavior. The depression extent of the coating using fine TiB2 particle as the reinforcement is much less than that of the coating using coarse TiB2 particle. Moreover, the size of the aggregate and the tendency of cracking can be reduced with the increase in Ti addition. Meanwhile, short TiB fiber bundles are formed by the diffusion mechanism of rod aggregate, and randomly oriented TiB short fibers are formed mainly by the dissolution-precipitation mechanism of fine TiB2 particles. Moreover, the growth of short TiB fibers can be in an alternating manner between B27 and Bf structures. The micro-hardness and wear resistance of the coatings are evidently higher than that of the titanium alloy substrate. The wear resistance of the large size TiB2 coating is higher than that of the small size TiB2 coating under the condition of low load.

  15. Effect of TiB2 Pretreatment on Pt/TiB2 Catalyst Performance

    International Nuclear Information System (INIS)

    Huang, Zhen; Lin, Rui; Fan, Renjie; Fan, Qinbai; Ma, Jianxin

    2014-01-01

    Highlights: • We pretreated Titanium diboride by different acids and alkali. • We synthesis the Pt/as-pretreated TiB 2 catalysts by a colloid route. • We investigated the effects of TiB 2 Pretreatment on Pt/TiB 2 Catalyst Performance. • The BET surface area and defects on the surface have a close relationship with the deposition of Pt nanoparticles. - Abstract: Carbon support corrosion of traditional Pt/C catalyst is one of the major contributors causing poor durability of proton exchange membrane fuel cells (PEMFC). Titanium diboride (TiB 2 ) has high electrical conductivity and considerable chemical stability, which making it as a good candidate for catalyst support in PEMFC. In this work, TiB 2 was pretreated by different acid and alkali. The as-obtained samples were characterized by Ex-situ microscopy (ESM) and X-ray diffraction (XRD). The pore size distribution (PSD) was analyzed by using DFT method. The PSD shows distinct volume in mesopore regions (less than 50 nm). The TiB2 pretreated by H 2 O 2 shows the biggest BET surface area of 57 m 2 g −1 and its PSD focus on mesoporous (1.5-8 nm) region, which resulted to high dispersion and better loading of Pt particles. The Hydrogen oxidization reaction (HOR) and oxygen reduction reaction (ORR) activity was characterized by Rotating Disk Electrode (RDE). The Pt/TiB 2 prepared by H 2 O 2 -pretreated TiB 2 using the colloidal method showed better half-cell electrochemical performance. Facile synthetic for the development of Pt/TiB 2 catalysts was developed

  16. Structural transformation in mechanosynthesized bcc Fe-Al-Si(Ge) solid solutions during heating

    International Nuclear Information System (INIS)

    Kubalova, L.M.; Sviridov, I.A.; Vasilyeva, O.Ya.; Fadeeva, V.I.

    2007-01-01

    X-ray diffractometry and Moessbauer spectroscopy study of Fe 50 Al 25 Si 25 and Fe 50 Al 25 Ge 25 alloys obtained by mechanical alloying (MA) of elementary powders was carried out. Phase transformation during heating of synthesized products was studied using differential scanning calorimetry (DSC). After 2.5 h of MA monophase alloys containing bcc Fe(Al, Ge) solid solutions Fe(Al, Si) are formed. Fe(Al, Si) is partially ordered B2 type and Fe(Al, Ge) is completely disordered. DSC curves of synthesized alloys displayed the presence of exothermal peaks caused by phase transformation. The metastable Fe(Al, Si) solid solution transformed into FeAl 1-x Si x (B2) and FeSi 1-x Al x (B20) equilibrium phases. The Fe(Al, Ge) solid solution transformed into equilibrium phases through intermediate stage of Fe 6 Ge 3 Al 2 metastable phase formation. The Fe 6 Ge 3 Al 2 phase dissociated into three equilibrium phases: FeAl 1-x Ge x (B2), χ-Fe 6 Ge 5 and η-Fe 13 (Ge, Al) 8 (B8 2 ). The structure of Fe 6 Ge 3 Al 2 was calculated by Rietveld method, the distribution of Al and Ge in the elementary cell and its parameters were calculated. Moessbauer study showed that Fe(Al, Si) and Fe(Al, Ge) solid solutions are paramagnetic. In the equilibrium state the alloy containing Si is also paramagnetic while the alloy with Ge showed ferromagnetic properties

  17. Properties of boride-added powder metallurgy magnesium alloys

    Science.gov (United States)

    Tanaka, Atsushi; Yoshimura, Syota; Fujima, Takuya; Takagi, Ken-ichi

    2009-06-01

    Magnesium alloys with metallic borides, magnesium diboride (MgB2) or aluminum diboride (AlB2), were investigated regarding their mechanical properties, transverse rupture strength (TRS) and micro Vickers hardness (HV). The alloys were made from pure Mg, Al and B powders by mechanical alloying and hot pressing to have boride content of between 2.0 and 20 vol%. The alloy with AlB2 exhibited an obvious improvement of HV around a boride content of 6 vol% though the other alloy, with MgB2, did not. TRS showed moderate maxima around the same boride content region for the both alloys. X-ray diffraction measurements indicated an intermetallic compound, Mg17Al12, formed in the alloy with AlB2, which was consistent with its higher hardness.

  18. Properties of boride-added powder metallurgy magnesium alloys

    International Nuclear Information System (INIS)

    Tanaka, Atsushi; Yoshimura, Syota; Fujima, Takuya; Takagi, Ken-ichi

    2009-01-01

    Magnesium alloys with metallic borides, magnesium diboride (MgB 2 ) or aluminum diboride (AlB 2 ), were investigated regarding their mechanical properties, transverse rupture strength (TRS) and micro Vickers hardness (HV). The alloys were made from pure Mg, Al and B powders by mechanical alloying and hot pressing to have boride content of between 2.0 and 20 vol%. The alloy with AlB 2 exhibited an obvious improvement of HV around a boride content of 6 vol% though the other alloy, with MgB 2 , did not. TRS showed moderate maxima around the same boride content region for the both alloys. X-ray diffraction measurements indicated an intermetallic compound, Mg 17 Al 12 , formed in the alloy with AlB 2 , which was consistent with its higher hardness.

  19. Evaluations of MgB2 Coatings on 2'' Copper Discs for Superconducting Radio Frequency Applications

    Science.gov (United States)

    Withanage, Wenura; Tan, Teng; Lee, Namhoon; Banjade, Huta; Eremeev, Grigory; Welander, Paul; Valente-Feliciano, Anne-Marie; Kustom, Robert; Wolak, Matthäus; Nassiri, Alireza; Xi, Xiaoxing

    We propose that coating the inner walls of copper RF cavities with superconducting MgB2 (Tc = 39 K) can result in a viable alternative to the already established niobium-based SRF technology. This approach improves the thermal conductivity, allows for operation at higher temperatures, and reduces the need for large helium refrigeration, thereby resulting in lower operational costs. For our studies, we grew MgB2 films via hybrid physical chemical vapor deposition (HPCVD) on 2'' Cu substrates. Since Mg and Cu readily form an alloy at higher temperatures, the HPCVD setup was modified in order to achieve lower deposition temperatures, minimize alloy formation, and provide high quality MgB2 films. This method yielded MgB2 coatings on 2'' Cu discs with transition temperatures around 38 K. The samples were characterized with regards to their RF attributes and showed similar performance in comparison to Nb reference samples. The presented results show that MgB2 coated copper can be a suitable alternative for use in SRF cavities.

  20. Use of Fe/Al drinking water treatment residuals as amendments for enhancing the retention capacity of glyphosate in agricultural soils.

    Science.gov (United States)

    Zhao, Yuanyuan; Wendling, Laura A; Wang, Changhui; Pei, Yuansheng

    2015-08-01

    Fe/Al drinking water treatment residuals (WTRs), ubiquitous and non-hazardous by-products of drinking water purification, are cost-effective adsorbents for glyphosate. Given that repeated glyphosate applications could significantly decrease glyphosate retention by soils and that the adsorbed glyphosate is potentially mobile, high sorption capacity and stability of glyphosate in agricultural soils are needed to prevent pollution of water by glyphosate. Therefore, we investigated the feasibility of reusing Fe/Al WTR as a soil amendment to enhance the retention capacity of glyphosate in two agricultural soils. The results of batch experiments showed that the Fe/Al WTR amendment significantly enhanced the glyphosate sorption capacity of both soils (pretention capacity in soils. Copyright © 2015. Published by Elsevier B.V.

  1. Half-metallic magnetism in Ti3Co5-xFexB2

    Directory of Open Access Journals (Sweden)

    Rohit Pathak

    2017-05-01

    Full Text Available Bulk alloys and thin films of Fe-substituted Ti3Co5B2 have been investigated by first-principle density-functional calculations. The series, which is of interest in the context of alnico magnetism and spin electronics, has been experimentally realized in nanostructures but not in the bulk. Our bulk calculations predict paramagnetism for Ti3Co5B2, Ti3Co4FeB2 and Ti3CoFe4B2, whereas Ti3Fe5B2 is predicted to be ferromagnetic. The thin films are all ferromagnetic, indicating that moment formation may be facilitated at nanostructural grain boundaries. One member of the thin-film series, namely Ti3CoFe4B2, is half-metallic and exhibits perpendicular easy-axis magnetic anisotropy. The half-metallicity reflects the hybridization of the Ti, Fe and Co 3d orbitals, which causes a band gap in minority spin channel, and the limited equilibrium solubility of Fe in bulk Ti3Co5B2 may be linked to the emerging half-metallicity due to Fe substitution.

  2. Joining thick section aluminum to steel with suppressed FeAl intermetallic formation via friction stir dovetailing

    Energy Technology Data Exchange (ETDEWEB)

    Reza-E-Rabby, Md.; Ross, Kenneth; Overman, Nicole R.; Olszta, Matthew J.; McDonnell, Martin; Whalen, Scott A.

    2018-04-01

    A new solid-phase technique called friction stir dovetailing (FSD) has been developed for joining thick section aluminum to steel. In FSD, mechanical interlocks are formed at the aluminum-steel interface and are reinforced by metallurgical bonds where intermetallic growth has been uniquely suppressed. Lap shear testing shows superior strength and extension at failure compared to popular friction stir approaches where metallurgical bonding is the only joining mechanism. High resolution microscopy revealed the presence of a 40-70 nm interlayer having a composition of 76.4 at% Al, 18.4 at% Fe, and 5.2 at% Si, suggestive of limited FeAl3 intermetallic formation.

  3. Lattice Thermal Conductivity from Atomistic Simulations: ZrB2 and HfB2

    Science.gov (United States)

    Lawson, John W.; Daw, Murray S.; Bauschlicher, Charles W.

    2012-01-01

    Ultra high temperature ceramics (UHTC) including ZrB2 and HfB2 have a number of properties that make them attractive for applications in extreme environments. One such property is their high thermal conductivity. Computational modeling of these materials will facilitate understanding of fundamental mechanisms, elucidate structure-property relationships, and ultimately accelerate the materials design cycle. Progress in computational modeling of UHTCs however has been limited in part due to the absence of suitable interatomic potentials. Recently, we developed Tersoff style parameterizations of such potentials for both ZrB2 and HfB2 appropriate for atomistic simulations. As an application, Green-Kubo molecular dynamics simulations were performed to evaluate the lattice thermal conductivity for single crystals of ZrB2 and HfB2. The atomic mass difference in these binary compounds leads to oscillations in the time correlation function of the heat current, in contrast to the more typical monotonic decay seen in monoatomic materials such as Silicon, for example. Results at room temperature and at elevated temperatures will be reported.

  4. B2B oriented on-line applications generator

    OpenAIRE

    Vintilă Bogdan-Cătălin

    2008-01-01

    B2B applications are presented. Quality characteristics of B2B applications are defined. B2B application structure is defined. The application for contracts is developed. The advantages are identified.

  5. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  6. Stability of the Al/TiB2 interface and doping effects of Mg/Si

    Science.gov (United States)

    Deng, Chao; Xu, Ben; Wu, Ping; Li, Qiulin

    2017-12-01

    The Al/TiB2 interface is of significant importance in controlling the mechanical properties of Al-B4C composites and tuning the heterogeneous nucleation of Al/Si alloys in industry. Its stability and bonding conditions are critical for both purposes. In this paper, the interfacial energies were investigated by first-principles calculations, and the results support the reported grain refinement mechanisms in Al/Si alloys. Moreover, to improve the mechanical properties of the interface, Mg and Si were doped at the interface, and our simulations show that the two interfaces will both weaken after doping Mg/Si, thus the formation of TiB2 is inhibited. As a result, the processability of the Al-B4C composites may be improved. Our results provide a theoretical basis and guidance for practical applications.

  7. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  8. Flux pinning behaviors of Ti and C co-doped MgB2 superconductors

    International Nuclear Information System (INIS)

    Yang, Y.; Zhao, D.; Shen, T.M.; Li, G.; Zhang, Y.; Feng, Y.; Cheng, C.H.; Zhang, Y.P.; Zhao, Y.

    2008-01-01

    Flux pinning behavior of carbon and titanium concurrently doped MgB 2 alloys has been studied by ac susceptibility and dc magnetization measurements. It is found that critical current density and irreversibility field of MgB 2 have been significantly improved by doping C and Ti concurrently, sharply contrasted to the situation of C-only-doped or Ti-only-doped MgB 2 samples. AC susceptibility measurement reveals that the dependence of the pinning potential on the dc applied field of Mg 0.95 Ti 0.05 B 1.95 C 0.05 has been determined to be U(B dc )∝B dc -1 compared to that of MgB 2 U(B dc )∝B dc -1.5 . As to the U(J) behavior, a relationship of U(J) ∝ J -0.17 is found fitting well for Mg 0.95 Ti 0.05 B 1.95 C 0.05 with respect to U(J) ∝ J -0.21 for MgB 2 . All the results reveal a strong enhancement of the high field pinning potential in C and Ti co-doped MgB 2

  9. Co2FeAl based magnetic tunnel junctions with BaO and MgO/BaO barriers

    Directory of Open Access Journals (Sweden)

    J. Rogge

    2015-07-01

    Full Text Available We succeed to integrate BaO as a tunneling barrier into Co2FeAl based magnetic tunnel junctions (MTJs. By means of Auger electron spectroscopy it could be proven that the applied annealing temperatures during BaO deposition and afterwards do not cause any diffusion of Ba neither into the lower Heusler compound lead nor into the upper Fe counter electrode. Nevertheless, a negative tunnel magnetoresistance (TMR ratio of -10% is found for Co2FeAl (24 nm / BaO (5 nm / Fe (7 nm MTJs, which can be attributed to the preparation procedure and can be explained by the formation of Co- and Fe-oxides at the interfaces between the Heusler and the crystalline BaO barrier by comparing with theory. Although an amorphous structure of the BaO barrier seems to be confirmed by high-resolution transmission electron microscopy (TEM, it cannot entirely be ruled out that this is an artifact of TEM sample preparation due to the sensitivity of BaO to moisture. By replacing the BaO tunneling barrier with an MgO/BaO double layer barrier, the electric stability could effectively be increased by a factor of five. The resulting TMR effect is found to be about +20% at room temperature, although a fully antiparallel state has not been realized.

  10. Nanoscale Titanium Dioxide (nTiO2) Transport in Water-Saturated Natural Sediments: Influence of Soil Organic Matter and Fe/Al Oxyhydroxides

    Science.gov (United States)

    Fisher-Power, L.; Cheng, T.

    2017-12-01

    Transport of engineered nanoparticles (ENP) in subsurface environments has important implications to water quality and soil contamination. Although extensive research has been conducted to understand the effects of water chemistry on ENP transport, less attention has been paid to influences from the transport medium/matrix. The objective of this research is to investigate the effects of natural organic matter (NOM) and Fe/Al oxyhydroxides in a natural sediment on ENP transport. A sediment was collected and separated into four portions, one of which was unmodified, and the others treated to remove specific components (organic matter, Fe/Al oxyhydroxides, or both organic matter and Fe/Al oxyhydroxides). Transport of nanoscale titanium dioxide (nTiO2) in columns packed with quartz sand and each of the four types of the sediment under water-saturated conditions was studied. Our results showed that nTiO2 transport was strongly influenced by pH and sediment composition. When influent pH = 5, nTiO2 transport in all the sediments was low, as positively-charged nTiO2 was attracted to negatively charged NOM, quartz, and other minerals. nTiO2 transport was slightly enhanced in columns packed with untreated sediment or Fe/Al oxyhydroxides removed sediment due to dissolved organic matter generated by the partial dissolution of NOM, which adsorbed onto nTiO2 surface and reversed its zeta potential to negative. When influent pH = 9, nTiO2 transport was generally high since negatively-charged nTiO2 was repelled by negatively charged transport medium. However, in columns packed with the organic matter removed sediment or the Fe/Al oxyhydroxides removed sediment, nTiO2 transport was low. This was attributable to pH buffering by the sediment, which decreased pore water pH in the column, resulting in zeta potential change and electrostatic attraction between Fe/Al oxyhydroxides and nTiO2. This research demonstrates that electrostatic forces between nTiO2 and mineral/organic components

  11. Tritium permeation characterization of Al{sub 2}O{sub 3}/FeAl coatings as tritium permeation barriers on 321 type stainless steel containers

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Feilong; Xiang, Xin; Lu, Guangda; Zhang, Guikai, E-mail: zhangguikai@caep.cn; Tang, Tao; Shi, Yan; Wang, Xiaolin

    2016-09-15

    Accurate tritium transport properties of prospective tritium permeation barriers (TPBs) are essential to tritium systems in fusion reactors. By passing a temperature and rate-controlled sweeping gas over specimen surfaces to carry the permeated tritium to an ion chamber, the gas-driven permeation of tritium has been performed on 321 type stainless steel containers with Al{sub 2}O{sub 3}/FeAl barriers, to determine the T-permeation resistant performance and mechanism of the barrier. The tritium permeability of the Al{sub 2}O{sub 3}/FeAl coated container was reduced by 3 orders of magnitude at 500–700 °C by contrast with that of the bare one, which meets the requirement of the tritium permeation reduction factor (PRF) of TPBs for tritium operating components in the CN-HCCB TBM. The Al{sub 2}O{sub 3}/FeAl barrier resists the tritium permeation by the diffusion in the bulk substrate at a limited number of defect sites with an effective area and thickness, suggesting that the TPB quality is a very important factor for efficient T-permeation resistance. - Highlights: • T-permeation has been measured on bare and coated type 321 SS containers. • Al{sub 2}O{sub 3}/FeAl coating give a reduction of T-permeability of 3 orders of magnitude. • Mechanism of Al{sub 2}O{sub 3}/FeAl barrier resisting T-permeation has obtained. • Quality of TPB is a very important factor for efficient T-permeating reduction.

  12. Transmission electron microscopy characterization of laser-clad iron-based alloy on Al-Si alloy

    International Nuclear Information System (INIS)

    Mei, Z.; Wang, W.Y.; Wang, A.H.

    2006-01-01

    Microstructure characterization is important for controlling the quality of laser cladding. In the present work, a detailed microstructure characterization by transmission electron microscopy was carried out on the iron-based alloy laser-clad on Al-Si alloy and an unambiguous identification of phases in the coating was accomplished. It was found that there is austenite, Cr 7 C 3 and Cr 23 C 6 in the clad region; α-Al, NiAl 3 , Fe 2 Al 5 and FeAl 2 in the interface region; and α-Al and silicon in the heat-affected region. A brief discussion was given for their existence based on both kinetic and thermodynamic principles

  13. Effect of Rare Earth Element on Microstructure and Properties of in situ Synthesized TiB2/Al Composites

    Directory of Open Access Journals (Sweden)

    QU Min

    2018-03-01

    Full Text Available The effect of rare earth element Ce, Sc and Er on TiB2 particles and matrix alloy micros-tructure of TiB2/Al composites was studied with in situ synthesis method. It shows that the addition of rare earth element improves the microstructure and properties of TiB2/Al composites notably. The particles of TiB2 are relatively homogenously distributed as adding 0.3% (mass fraction rare earth element Sc and Er, moreover, it is Er that refines the microstructure of matrix alloy most significantly, then is Sc. Similarly, it is demonstrated that the addition of Sc and Er results in better tensile strength, which is enhanced by 32% and 31%, respectively; the addition of Er also leads to the best ductility by 85% with optimal tensile property. Meanwhile, fracture morphology analysis reveals that the fracture of the composites is microporous gathered ductile fracture when adding Sc and Er. Finally, it is verified that the mechanism of rare earth element on composites lies in two aspects:one is that the addition of rare earth element improves the wettability of the composites and suppresses the agglomeration of TiB2 particles; the other is that the addition of rare earth element refines the microstructure of matrix alloy and then improves the tensile strength of the composites.

  14. Influence of in situ formed ZrB2 particles on microstructure and mechanical properties of AA6061 metal matrix composites

    International Nuclear Information System (INIS)

    Dinaharan, I.; Murugan, N.; Parameswaran, Siva

    2011-01-01

    Highlights: → In situ fabrication of aluminium metal matrix composite reinforced ZrB 2 particles. → Colour metallography of composites. → Improvement of matrix properties by ZrB 2 particles. → Sliding wear behaviour of in situ composites. - Abstract: Particulate reinforced metal matrix composites (PMMCs) have gained considerable amount of research emphasis and attention in the present era. Research is being carried out across the globe to produce new combination of PMMCs. PMMCs are prepared by adding a variety of ceramic particles with monolithic alloys using several techniques. An attempt has been made to produce aluminium metal matrix composites reinforced with zirconium boride (ZrB 2 ) particles by the in situ reaction of K 2 ZrF 6 and KBF 4 salts with molten aluminium. The influence of in situ formed ZrB 2 particles on the microstructure and mechanical properties of AA6061 alloy was studied in this work. The in situ formed ZrB 2 particles significantly refined the microstructure and enhanced the mechanical properties of AA6061 alloy. The weight percentage of ZrB 2 was varied from 0 to 10 in steps of 2.5. Improvement of hardness, ultimate tensile strength and wear resistance of AA6061 alloy was observed with the increase in ZrB 2 content.

  15. Electronic Commerce in Tourism in China: B2B or B2C?

    Science.gov (United States)

    Li, Hongxiu; Suomi, Reima

    E-commerce has significantly changed the distribution channels of travel products in the world including China. Online channels are growing important in travel service distribution. In China tourism industry has been developed rapidly with the economic development, more and more international travel service providers are trying to expand their Chinese market through the Internet. This paper sheds lights on the e-commerce development models in China for international travel service providers. It explores the current e-tourism in China from the three different participants in the value chain in tourism industry - consumer, travel agent and travel service provider. The paper also identifies the barriers in B2C arena in international outbound travel market, and discusses the possible approaches for international travel service providers to develop their e-commerce in the huge Chinese market. The results in this study reveal that international travel service providers should focus on B2B model to expand their electronic market in China. B2C development in tourism largely depends on the change of Chinese customers' behavior and the change of international tourism regulations. The findings of the study are expected to assist international travel service providers to understand current e-tourism in China and to support their planning for future e-commerce development in China.

  16. Study on the dual-synthetic antiferromagnetic property using the Co2FeAl Heulser electrodes

    International Nuclear Information System (INIS)

    Zhang, D L; Xu, X G; Wu, Y; Li, X Q; Miao, J; Jiang, Y

    2011-01-01

    In this paper, we present the experimental results of dual-synthetic antiferromagnets (DSyAFs) with Co 2 FeAl (CFA) Heusler electrodes. It is shown that when the thicknesses of Ru layers are (0.45, 0.65) and (0.45, 1.00) (in nm), the CFA-based DSyAFs have a strong synthetic antiferromagnetic coupling among three CFA layers at room temperature, with a large saturation magnetic field Hs of ∼11000 Oe, a low saturation magnetization Ms of ∼708 emu/cm 3 and a switching field Hsw of ∼2.0 Oe, respectively. It is exciting that the CFA-based DSyAFs have an excellent thermal stability up to 400 0 C. Therefore, the CFA-based DSyAFs are favourable for applications in future spintronic devices.

  17. Argon Ion Irradiation Effect on the Magnetic Properties of Fe-Al2O3 Nano Granular Film

    Directory of Open Access Journals (Sweden)

    Setyo Purwanto

    2014-10-01

    Full Text Available We studied the effect of Argon (Ar ion irradiation on Fe-Al2O3 nanogranular thin film. X-ray diffraction (XRD patterns show that the ion dose might promote the growth of the Fe2O3 phase from an amorphous phase to a crystalline phase. The magnetic and magnetoresistance properties were investigated using a vibrating sample magnetometer (VSM and a four point probe (FPP. The results suggest that percolation concentration occurred at the 0.55 Fe volume fraction and with a maximum magnetoresistance (MR ratio of 3%. The present MR ratio was lower than that of previous results, which might be related to the existence of the α-Fe2O3 phase promoted by Ar ion irradiation. CEMS spectra show ion irradiation induces changes from superparamagnetic characteristics to ferromagnetic ones, which indicates the spherical growth of Fe particles in the Al2O3 matrix.

  18. Magnetic and structural properties of Co{sub 2}FeAl thin films grown on Si substrate

    Energy Technology Data Exchange (ETDEWEB)

    Belmeguenai, Mohamed, E-mail: belmeguenai.mohamed@univ-paris13.fr [LSPM (CNRS-UPR 3407) 99 Avenue Jean-Baptiste Clément Université Paris 13, 93430 Villetaneuse (France); Tuzcuoglu, Hanife [LSPM (CNRS-UPR 3407) 99 Avenue Jean-Baptiste Clément Université Paris 13, 93430 Villetaneuse (France); Gabor, Mihai; Petrisor, Traian [Center for Superconductivity, Spintronics and Surface Science, Technical University of Cluj-Napoca, Street Memorandumului No. 28, RO-400114 Cluj-Napoca (Romania); Tiusan, Coriolan [Center for Superconductivity, Spintronics and Surface Science, Technical University of Cluj-Napoca, Street Memorandumului No. 28, RO-400114 Cluj-Napoca (Romania); Institut Jean Lamour, CNRS, Université de Nancy, BP 70239, F-54506 Vandoeuvre (France); Berling, Dominique [IS2M (CNRS-LRC 7228), 15 rue Jean Starcky, Université de Haute-Alsace, BP 2488, 68057 Mulhouse-Cedex (France); Zighem, Fatih; Mourad Chérif, Salim [LSPM (CNRS-UPR 3407) 99 Avenue Jean-Baptiste Clément Université Paris 13, 93430 Villetaneuse (France)

    2015-01-01

    The correlation between magnetic and structural properties of Co{sub 2}FeAl (CFA) thin films of different thicknesses (10 nmFeAl thin films were grown on a Si(001) substrates and annealed at 600 °C. • The thickness dependence of magnetic and structural properties has been studied. • X-ray measurements revealed an (011) out-of-plane textured growth of the films. • The easy axis coercive field varies linearly with the inverse CFA thickness. • The effective magnetization increases linearly with the inverse film thickness.

  19. Laser cladding of aluminium using TiB2

    CSIR Research Space (South Africa)

    Kumar, S

    2010-03-01

    Full Text Available to that of steel (5) and Tita- nium (6; 7). Previous work con- sists of an effort to make deep laser injection of TiB2 on Al or the creation of in-situ of TiB2 using other reactant particles. In-situ creation of TiB2 suffers from other side effects...

  20. Theoretical study of the ionization of B2H5

    International Nuclear Information System (INIS)

    Curtiss, L.A.; Pople, J.A.

    1989-01-01

    Ab initio molecular orbital calculations at the G1 level of theory have been carried out on neutral B 2 H 5 radical, doubly bridged B 2 H + 5 cation, and the first triplet excited state of B 2 H + 5 . Singly bridged B 2 H 5 is 4.0 kcal/mol (without zero-point energies) more stable than doubly bridged B 2 H 5 . Based on this work and previous theoretical work on triply bridged B 2 H + 5 , ionization potentials (vertical and adiabatic) are determined for B 2 H 5 . The adiabatic ionization potentials of the two B 2 H 5 structures are 6.94 eV (singly bridged) and 7.53 eV (doubly bridged). A very large difference is found between the vertical and adiabatic ionization potentials (3.37 eV) of the singly bridged B 2 H 5 structure. The first triplet state of B 2 H + 5 is found to be 4.55 eV higher in energy than the lowest energy B 2 H + 5 cation (triply bridged). The results of this theoretical study support the interpretation of Ruscic, Schwarz, and Berkowitz of their recent photoionization measurements on B 2 H 5

  1. Component Based System Framework for Dynamic B2B Interaction

    NARCIS (Netherlands)

    Hu jinmin, Jinmin; Grefen, P.W.P.J.

    Business-to-Business (B2B) collaboration is becoming a pivotal way to bring today's enterprises to success in the dynamically changing e-business environment. Though many business-to-business protocols are developed to support B2B interaction, none are generally accepted. A B2B system should support

  2. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  3. B-2 Extremely High Frequency SATCOM and Computer Increment 1 (B-2 EHF Inc 1)

    Science.gov (United States)

    2015-12-01

    Confidence Level Confidence Level of cost estimate for current APB: 55% This APB reflects cost and funding data based on the B-2 EHF Increment I SCP...This cost estimate was quantified at the Mean (~55%) confidence level . Total Quantity Quantity SAR Baseline Production Estimate Current APB...Production Estimate Econ Qty Sch Eng Est Oth Spt Total 33.624 -0.350 1.381 0.375 0.000 -6.075 0.000 -0.620 -5.289 28.335 Current SAR Baseline to Current

  4. Corrosion resistance properties of enamels with high B2O3-P2O5 content to molten aluminum

    International Nuclear Information System (INIS)

    Zhou, M.; Li, K.; Shu, D.; Sun, B.D.; Wang, J.

    2003-01-01

    Anticorrosive properties of borophosphate and boron-free enamels to molten aluminum were investigated using SEM and electron probe. Carbonates of alkali metal and alkaline earth metal were added in an appropriate weight ratio to achieve desired melting temperature of the enamels. SEM examination on the solidified interface between the enamels and aluminum alloy show that the enamels can spread slightly on aluminum alloy. For anticorrosive sample of borophosphate enamel, phosphorus was not detected by electron probe at the side of aluminum alloy near the interface, but silicon was detected in the silica-free enamels side. For the sample of boron-free enamels, however, phosphorus was found at the side of aluminum alloy near the interface. It was revealed that the enamels with high B 2 O 3 -P 2 O 5 content have high corrosion resistance to molten aluminum

  5. Corrosion characteristics of an aluminium alloy in the H3PO4 - CO2 mixture

    International Nuclear Information System (INIS)

    Aljinovic, Lj.; Smith, M.; Gotovac, V.

    1998-01-01

    The Al 6063 alloy examined in this work contains silicon and magnesium capable of forming Mg 2 Si and iron, which can form an intermetallic second phase (FeAl 3 ). In order to examine the influence of temperature on the corrosion behaviour of the Al 6063 alloy, examinations were carried out in aerated H 3 PO 4 and in H 3 PO 4 saturated with CO 2 at temperatures of 20, 30, 40, and 50 C. The following electrochemical methods were applied: determination of dependence of E OCP on time, recording of anodic and cathodic polarization curves, and cyclic voltammetry. It has been observed that corrosion parameters obtained are strongly temperature dependent. They also depend on CO 2 dissolved in H 3 PO 4 . CO 2 retards cathodic and anodic reactions at all temperatures, which can be attributed to formation of a kind of mechanical passivity as alloy components react with CO 2 . (orig.)

  6. Novel Composite Powders with Uniform TiB2 Nano-Particle Distribution for 3D Printing

    Directory of Open Access Journals (Sweden)

    Mengxing Chen

    2017-03-01

    Full Text Available It is reported that the ductility and strength of a metal matrix composite could be concurrently improved if the reinforcing particles were of the size of nanometers and distributed uniformly. In this paper, we revealed that gas atomization solidification could effectively disperse TiB2 nanoparticles in the Al alloy matrix due to its fast cooling rate and the coherent orientation relationship between TiB2 particles and α-Al. Besides, nano-TiB2 led to refined equiaxed grain structures. Furthermore, the composite powders with uniformly embedded nano-TiB2 showed improved laser absorptivity. The novel composite powders are well suited for selective laser melting.

  7. Progress in electrical and mechanical properties of rectangular MgB2 wires

    International Nuclear Information System (INIS)

    Kovac, P; Melisek, T; Kopera, L; Husek, I; Polak, M; Kulich, M

    2009-01-01

    Critical current densities and mechanical resistance of MgB 2 wires made by the rectangular wire-in-tube technique (RWIT) have been studied. Wires prepared from different precursor powders and variable sheath materials are compared. The best electrical performance (10 4 A cm -2 at 11.3 T) was measured for the wire with mechanically alloyed powder doped by SiC. While the critical current densities, J c , at 4.2 K are considerably influenced by the powder used, the differences at 20 K are much smaller. Flattened wires show different levels of critical current anisotropy influenced by the precursor powder used. Stress-strain characteristics and critical current degradation are strongly affected by the applied metallic materials and also by the filament's strength. The highest irreversible strain ε irr = 0.55% was measured for Ti/Cu/Monel sheathed wire with filaments from mechanically alloyed powder.

  8. Slow coarsening of B2-ordered domains at low temperatures: A kinetic Monte Carlo study

    International Nuclear Information System (INIS)

    Le Floc'h, D.; Bellon, P.; Athenes, M.

    2000-01-01

    The kinetics of the ordering and coarsening of B2-ordered domains is studied using atomistic kinetic Monte Carlo simulations. Special emphasis is put on the effect of annealing temperature, alloy composition, and atom dynamics on the coarsening behavior. When atomic diffusion proceeds by vacancy jumps to nearest-neighbor sites, a transient slow coarsening regime is observed at temperatures below half the order-disorder transition temperature T c . It results in apparent coarsening exponents that decrease with decreasing the annealing temperature. Values as low as 0.14 are measured at 0.25T c . Slow transients take place in both stoichiometric and nonstoichiometric alloys. These regimes are correlated with the transient creation of excess antisites during domain disappearance. Since antiphase boundary mobility decreases with increasing antisite concentration, this transient excess results in the slow coarsening observed in simulations. (c) 2000 The American Physical Society

  9. Role of powder preparation route on microstructure and mechanical properties of Al-TiB2 composites fabricated by accumulative roll bonding (ARB)

    International Nuclear Information System (INIS)

    Askarpour, M.; Sadeghian, Z.; Reihanian, M.

    2016-01-01

    Accumulative roll bonding (ARB) was conducted up to seven cycles to fabricate Al-TiB 2 particulate metal matrix composites. The reinforcing particles were prepared and used in three different processing conditions: as-received TiB 2 , mixed TiB 2 -Al and in-situ synthesized TiB 2 -Al. The mixed TiB 2 -Al powder was produced by milling of TiB 2 with Al powder and in-situ synthesized TiB 2 -Al powder was prepared by mechanical alloying (MA) through inducing TiB 2 particles in the Al with various composition of 10, 20 and 30 wt% Al. Transmission electron microscope (TEM) and scanning electron microscope (SEM) were used to evaluate the microstructure of the produced composites. The composite obtained from the in-situ TiB 2 -Al powder showed the most uniform distribution of particles and exhibited the highest tensile strength of about 177 MPa in comparison with the composites reinforced with the as-received TiB 2 (156 MPa) and mixed TiB 2 -Al powder (160 MPa). After seven ARB cycles, an ultra-fine grained structure with the average size of about 300 nm was obtained in the composite reinforced with in-situ TiB 2 -Al powder. The appearance of dimples in tensile fracture surfaces revealed a ductile-type fracture in the produced composites.

  10. Investigation of B2 and related phases in the Ti-Al-Nb ternary systems

    International Nuclear Information System (INIS)

    Bendersky, L.A.; Boettinger, W.J.

    1989-01-01

    Alloy compositions around Ti 2 AlNb were studied to establish phase equilibria and transformations during cooling from 1100 degrees C and 1400 degrees C. In addition to general results obtained on a wide range of compositions, which include evidence for a broad B2 phase field, transformation of BCC Ti 4 Al 3 Nb to a phase with an omega-type structure is reported. Detailed analysis indicates that this phase has the B8 2 structure after annealing at 700 degrees C

  11. Structural and magnetic study of mechanically deformed Fe rich FeAlSi ternary alloys

    International Nuclear Information System (INIS)

    Legarra, E.; Apiñaniz, E.; Plazaola, F.

    2012-01-01

    Highlights: ► Addition of Si to binary Fe–Al alloys makes the disordering more difficult. ► Si addition opposes the large volume increase found in FeAl alloys with deformation. ► Disordering induces a redistribution of non-ferrous atoms around Fe atoms in Fe 75 Al 25−x Si x and Fe 70 Al 30−x Si x . ► Addition of Si to binary Fe 75 Al 25 and Fe 70 Al 30 alloys opposes the magnetic behavior induced by Al in the magnetism of Fe. ► Si inhibits the para-ferro transition found in Fe 60 Al 40 alloy with disordering. - Abstract: In this work we study systematically the influence of different Al/Si ratios on the magnetic and structural properties of mechanically disordered powder Fe 75 Al 25−x Si x , Fe 70 Al 30−x Si x and Fe 60 Al 40−x Si x alloys by means of Mössbauer spectroscopy, X-ray diffraction and magnetic measurements. In order to obtain different stages of disorder the alloys were deformed by different methods: crushing induction melted alloys and ball milling annealed (ordered) alloys using different number of balls and speed. X-ray and Mössbauer data show that mechanical deformation induces the disordered A2 structure in these alloys. The results indicate that addition of Si to binary Fe–Al alloys makes the disordering more difficult. In addition, X-ray diffraction patterns show that the normalized lattice parameter variation of the disordered alloys of each composition decreases monotonically with Si content, indicating clearly that Si addition opposes the large volume increase found in FeAl alloys with deformation. The study of the hyperfine fields indicates that there is a redistribution of non-ferrous atoms around Fe atoms with the disordering; indeed, there is an inversion of the behavior of the hyperfine field of the Fe atoms. On the other hand, the magnetic measurements indicate that addition of Si to binary Fe 75 Al 25 and Fe 70 Al 30 alloys opposes the magnetic behavior induced by Al in the magnetism of Fe.

  12. PRECIPITATION BEHAVIOR OF Co PHASES IN B2-ORDERED(Ni,Co)Al COMPOUND

    Institute of Scientific and Technical Information of China (English)

    W.H. Tian; A.L. Fan; M. Nemoto

    2002-01-01

    The precipitation behavior of Co phases in B2-ordered (Ni, Co)Al has been investigatedin terms of transmission electron microscopy. Fine precipitation off cc-Co occurs in(Ni, Co)Al by aging at temperature over 973K. The orientation relationship betweenthe fcc-Co precipitates and the B2-(Ni, Co)Al matrix follows the Kurdjumow-Sachs(K-S) orientation relation. But when the aging temperature is under 873K the Coprecipitates have a hcp crystal structure. The orientation relationship between thehcp-Co precipitates and the B2-(Ni, Co)Al matrix follows the Burgers orientation re-lation. (Ni, Co)Al is hardened appreciably by the fine precipitation of both the fcc-Coand hcp-Co phases. The temperature dependence of the yield strength of precipitate-containing B2-ordered (Ni, Co)Al was investigated by compression tests over the rangeof 298-1273K. The fine precipitation of Co phases enhances greatly the low and in-termediate temperature yield strength. When the deformation temperature was over873K, the strength of precipitate-containing (Ni, Co)Al is comparable to ternary dual-phase (Ni, Co)Al+Ni3Al alloy.

  13. Fabrication of highly spin-polarized Co2FeAl0.5Si0.5 thin-films

    Directory of Open Access Journals (Sweden)

    M. Vahidi

    2014-04-01

    Full Text Available Ferromagnetic Heusler Co2FeAl0.5Si0.5 epitaxial thin-films have been fabricated in the L21 structure with saturation magnetizations over 1200 emu/cm3. Andreev reflection measurements show that the spin polarization is as high as 80% in samples sputtered on unheated MgO (100 substrates and annealed at high temperatures. However, the spin polarization is considerably smaller in samples deposited on heated substrates.

  14. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  15. Photoabsorption coefficient of alloys at Al with transition metals V, Fe, Ni and with Cu and Pr from 30 eV to 150 eV photon energy

    International Nuclear Information System (INIS)

    Hagemann, H.J.; Gudat, W.; Kunz, C.

    1975-10-01

    The absorption coeffecient of VAl 3 , FeAl, NiAl, NiAl 3 , CuAl 2 , PrAl 2 and of disordered V-Al (16 at. % Al, 28 %, 41%) and Fe-Al (11%) alloys has been measured in the region of the Msub(2,3)-absorption of the transition metals and the L-absorption of Al. The strong changes of the Al spectrum in the region of the 100 eV maximum upon alloying are explained as another evidence of the EXAFS (extended X-ray absorption fine structure) nature of these structures. The broad, prominent absorption peaks from the 3p excitations in V and Fe and from the 4d excitations in Pr are influenced only little on alloying and thus appear to be of atomic origin. The fine structure at the onset of the Pr 4d-transitions is identical in the metal and the alloy but differs from that of Pr oxide. The only Msub(2,3)-edge which is detectably shifted is that if Ni (up to 2.1 eV), whereas the onset of the Al Lsub(2,3)-edge is shifted in all the alloys (up to 1.1 eV). The shifts are interpreted in accordance with X-ray fluorescence and nuclear resonance measurements as changes of the density of states in the valence band of the alloys. (orig.) [de

  16. Moessbauer Study of the Ball Milling Disordering Process of FeAl Intermetallic Compounds

    International Nuclear Information System (INIS)

    Oleszak, Dariusz; Bruna, Pere; Crespo, Daniel; Pradell, Trinitat

    2005-01-01

    Structural changes during ball milling of ordered Fe50Al50 intermetallic compounds were studied. X-Ray diffraction allowed the computation of a Long Range Order parameter (LRO) which dropped to zero after a short milling time. The initial B2 ordered structure gradually transforms into a disordered BCC structure, with a final crystallite size of about 25 nm. Moessbauer spectroscopy was used for obtaining a Chemical Short Range Order parameter (CSRO). Using a semiempirical n-body noncentral potential a model of the partially disordered B2 structure was built allowing computing the distribution of Quadrupole Splitting during the disordering process. Comparison between experimental and simulated Moessbauer spectra shows a maximum of disorder in the system for 5h milling, related to the highest value of the lattice spacing and the broader quadrupole hyperfine distribution. However, after milling for times longer than 5h, there is a change on the behavior of the experimental data that cannot be explained by the simple disordering process

  17. NMR relaxation rates and Knight shifts in MgB2 and AlB2: theory versus experiments

    International Nuclear Information System (INIS)

    Pavarini, E; Baek, S H; Suh, B J; Borsa, F; Bud'ko, S L; Canfield, P C

    2003-01-01

    We have performed 11 B NMR measurements in 11 B enriched MgB 2 powder sample in the normal phase. The Knight shift was accurately determined by using the magic angle spinning technique. Results for 11 B and 27 Al Knight shifts (K) and relaxation rates (1/T 1 ) are also reported for AlB 2 . The data show a dramatic decrease of both K and 1/T 1 for 11 B in AlB 2 with respect to MgB 2 . We compare experimental results with ab initio calculated NMR relaxation rates and Knight shifts. The experimental values for 1/T 1 and K are in most cases in good agreement with the theoretical results. We show that the decrease of K and 1/T 1 for 11 B is consistent with a drastic drop of the density of states at the boron site in AlB 2 with respect to MgB 2

  18. B2B or Not to Be: Does B2B E-Commerce Increase Labour Productivity?

    OpenAIRE

    Bertschek, Irene; Fryges, Helmut; Kaiser, Ulrich

    2004-01-01

    We implement an endogeneous switching-regression model for labour productivity and firms' decision to use business-to-business (B2B) e-commerce. Our approach allows B2B usage to affect any parameter of the labour productivity equation and to properly take account of strategic complementarities between the input factors and B2B usage. Empirical evidence from 1,394 German firms shows that firms using B2B e-commerce have a significantly higher output elasticity with respect to ICT-investment and...

  19. A diffraction based study of the deformation mechanisms in anomalously ductile B2 intermetallics

    Science.gov (United States)

    Mulay, Rupalee Prashant

    For many decades, the brittle nature of most intermetallic compounds (e.g. NiAl) has been the limiting factor in their practical application. Many B2 (CsCl prototypical structure) intermetallics are known to exhibit slip on the {110} slip mode, which provides only 3 independent slip systems and, hence, is unable to satisfy the von Mises (a.k.a. Taylor) criterion for polycrystalline ductility. As a result, inherent polycrystalline ductility is unexpected. Recent discovery of a number of ductile B2 intermetallics has raised questions about possible violation of the von Mises criterion by these alloys. These ductile intermetallic compounds are MR (metal (M) combined with a rare earth metal or group IV refractory metal (R)) alloys and are stoichiometric, ordered compounds. Single crystal slip trace analyses have only identified the presence of {011} or {010} slip systems. More than 100 other B2 MR compounds are known to exist and many of them have already been shown to be ductile (e.g., CuY, AgY, CuDy, CoZr, CoTi, etc.). Furthermore, these alloys exhibit a large Bauschinger effect. The present work uses several diffraction based techniques including electron back scattered diffraction (EBSD), X-ray diffraction (XRD) and in-situ neutron diffraction; in conjunction with scanning electron microscopy (SEM), transmission electron microscopy (TEM), mechanical testing, and crystal plasticity modeling, to elucidate the reason for ductility in select B2 alloys, explore the spread of this ductility over the B2 family, and understand the Bauschinger effect in these alloys. Several possible explanations (e.g., slip of dislocations, strong texture, phase transformations and twinning) for the anomalous ductility were explored. An X-ray diffraction based analysis ruled out texture, phase purity and departure from order as explanations for the anomalous ductility in MR alloys. In-situ neutron diffraction and post deformation SEM, EBSD, and TEM were unable to detect any evidence for

  20. ORM-based semantics of B2B transactions.

    NARCIS (Netherlands)

    Balsters, H.; van Blommestein, F.; Meersman, R; Herrero, P; Dillon, T

    2009-01-01

    After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely

  1. 17 CFR 270.8b-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... such document is filed with such exchange. (j) Share. The term “share” means a share of stock in a... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definitions. 270.8b-2 Section 270.8b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND...

  2. Hexagonal OsB2: Sintering, microstructure and mechanical properties

    International Nuclear Information System (INIS)

    Xie, Zhilin; Lugovy, Mykola; Orlovskaya, Nina; Graule, Thomas; Kuebler, Jakob; Mueller, Martin; Gao, Huili; Radovic, Miladin; Cullen, David A.

    2015-01-01

    Highlights: • ReB 2 -type hexagonal OsB 2 powder has been densified by spark plasma sintering. • The sintered OsB 2 contains ∼80 wt.% hexagonal and ∼20 wt.% orthorhombic phases. • The average grain size of the sintered OsB 2 sample was 0.56 ± 0.26 μm. • H = 31 ± 9 GPa and E = 574 ± 112 GPa measured by nanoindentation. - Abstract: The metastable high pressure ReB 2 -type hexagonal OsB 2 bulk ceramics was produced by spark plasma sintering. The phase composition, microstructure, and mechanical behavior of the sintered OsB 2 were studied by X-ray diffraction, optical microscopy, TEM, SEM, EDS, and nanoindentation. The produced ceramics was rather porous and contained a mixture of hexagonal (∼80 wt.%) and orthorhombic (∼20 wt.%) phases as identified by X-ray diffraction and EBSD analysis. Two boron-rich phases, which do not contain Os, were also identified by TEM and SEM/EDS analysis. Nanoindentation measurements yielded a hardness of 31 ± 9 GPa and Young’s modulus of 574 ± 112 GPa, indicating that the material is rather hard and very stiff; however, it is very prone to crack formation and propagation, which is indicative of a very brittle nature of this material. Improvements in the sintering regime are required in order to produce dense, homogeneous and single phase hexagonal OsB 2 bulk ceramics

  3. Multiband model for tunneling in MgB2 junctions

    NARCIS (Netherlands)

    Brinkman, Alexander; Golubov, Alexandre Avraamovitch; Rogalla, Horst; Dolgov, O.V.; Kortus, J.; Kong, Y.; Jepsen, O.; Andersen, O.K.

    2002-01-01

    A theoretical model for quasiparticle and Josephson tunneling in multiband superconductors is developed and applied to MgB2-based junctions. The gap functions in different bands in MgB2 are obtained from an extended Eliashberg formalism, using the results of band structure calculations. The

  4. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  5. Spin pumping in ion-beam sputtered C o2FeAl /Mo bilayers: Interfacial Gilbert damping

    Science.gov (United States)

    Husain, Sajid; Kumar, Ankit; Barwal, Vineet; Behera, Nilamani; Akansel, Serkan; Svedlindh, Peter; Chaudhary, Sujeet

    2018-02-01

    The spin-pumping mechanism and associated interfacial Gilbert damping are demonstrated in ion-beam sputtered C o2FeAl (CFA)/Mo bilayer thin films employing ferromagnetic resonance spectroscopy. The dependence of the net spin-current transportation on Mo layer thickness, 0 to 10 nm, and the enhancement of the net effective Gilbert damping are reported. The experimental data have been analyzed using spin-pumping theory in terms of spin current pumped through the ferromagnet/nonmagnetic metal interface to deduce the real spin-mixing conductance and the spin-diffusion length, which are estimated to be 1.56 (±0.30 ) ×1019m-2 and 2.61 (±0.15 )nm , respectively. The damping constant is found to be 8.8 (±0.2 ) ×10-3 in the Mo(3.5 nm)-capped CFA(8 nm) sample corresponding to an ˜69 % enhancement of the original Gilbert damping 5.2 (±0.6 ) ×10-3 in the Al-capped CFA thin film. This is further confirmed by inserting the Cu dusting layer which reduces the spin transport across the CFA/Mo interface. The Mo layer thickness-dependent net spin-current density is found to lie in the range of 1 -4 MA m-2 , which also provides additional quantitative evidence of spin pumping in this bilayer thin-film system.

  6. Temperature-dependent Gilbert damping of Co2FeAl thin films with different degree of atomic order

    Science.gov (United States)

    Kumar, Ankit; Pan, Fan; Husain, Sajid; Akansel, Serkan; Brucas, Rimantas; Bergqvist, Lars; Chaudhary, Sujeet; Svedlindh, Peter

    2017-12-01

    Half-metallicity and low magnetic damping are perpetually sought for spintronics materials, and full Heusler compounds in this respect provide outstanding properties. However, it is challenging to obtain the well-ordered half-metallic phase in as-deposited full Heusler compound thin films, and theory has struggled to establish a fundamental understanding of the temperature-dependent Gilbert damping in these systems. Here we present a study of the temperature-dependent Gilbert damping of differently ordered as-deposited Co2FeAl full Heusler compound thin films. The sum of inter- and intraband electron scattering in conjunction with the finite electron lifetime in Bloch states governs the Gilbert damping for the well-ordered phase, in contrast to the damping of partially ordered and disordered phases which is governed by interband electronic scattering alone. These results, especially the ultralow room-temperature intrinsic damping observed for the well-ordered phase, provide fundamental insights into the physical origin of the Gilbert damping in full Heusler compound thin films.

  7. Development of U6Fe-Al dispersions for the use of LEU in research and test reactors

    International Nuclear Information System (INIS)

    Nazare, S.

    1983-01-01

    For some time now, efforts are being made to develop fuel dispersions that would permit the use of low (approx. 20% 235-U) enriched uranium (LEU) instead of the currently used highly (approx. 93% 235-U) enriched uranium (HEU) in research and test reactors. Since penalties in the performance of the reactor have to be avoided, the 235-U content in the dispersion has at least to be retained at current levels. On account of their high U-densities, the major development effort has been focussed on the uranium silicides (U 3 Si, U 3 Si(Al), and U 3 Si 2 -based dispersions). With silicides as dispersants, it is possible to fabricate fuel element plates with U-densities in the dispersion of about 6.0 gU/cm 3 . In comparison to the silicides, the U 6 Fe-phase offers several advantages namely: higher U-density (approx. 17.0 gU/cm 3 ); relative ease of formation compared to U 3 Si; possible advantages with regard to reprocessing of the spent fuel due to the absence of silicon. The studies outlined here were performed with a view to investigating the preparation, reaction behavior and dimensional stability after heat treatment of U 6 Fe-Al dispersions

  8. Development of U6Fe-Al dispersions for the use of LEU in research and test reactors

    International Nuclear Information System (INIS)

    Nazare, S.

    1983-01-01

    For some time now, efforts are being made to develop fuel dispersions that would permit the use of low (∼ 20% 235-U) enriched uranium (LEU) instead of the currently used highly (∼ 93% 235-U) enriched uranium (HEU) in research and test reactors. Since penalties in the performance of the reactor have to be avoided, the 235-U content in the dispersion has at least to be retained at current levels. On account of their high U-densities, the major development effort has been focussed on the uranium silicides [U 3 Si, U 3 Si(Al), and U 3 Si 2 - based dispersions. With silicides as dispersants, it is possible to fabricate fuel element plates with U-densities in the dispersion of about 6.0 g U/cm 3 . In comparison to the silicides, the U 6 Fe-phase offers several advantages namely: - higher U-density (∼ 17.0 g U/cm 3 ); - relative ease of formation compared to U 3 Si; - possible advantages with regard to reprocessing of the spent fuel due to the absence of silicon. The studies outlined here were therefore performed with a view to investigating the preparation, reaction behaviour and dimensional stability after heat treatment of U 6 Fe-Al dispersions

  9. Alloy materials

    Energy Technology Data Exchange (ETDEWEB)

    Hans Thieme, Cornelis Leo (Westborough, MA); Thompson, Elliott D. (Coventry, RI); Fritzemeier, Leslie G. (Acton, MA); Cameron, Robert D. (Franklin, MA); Siegal, Edward J. (Malden, MA)

    2002-01-01

    An alloy that contains at least two metals and can be used as a substrate for a superconductor is disclosed. The alloy can contain an oxide former. The alloy can have a biaxial or cube texture. The substrate can be used in a multilayer superconductor, which can further include one or more buffer layers disposed between the substrate and the superconductor material. The alloys can be made a by process that involves first rolling the alloy then annealing the alloy. A relatively large volume percentage of the alloy can be formed of grains having a biaxial or cube texture.

  10. Magnetic and Moessbauer studies on GdCo3B2 and DyCo3B2

    International Nuclear Information System (INIS)

    Malik, S.K.; Umarji, A.M.; Shenoy, G.K.

    1984-10-01

    Magnetization and Moessbauer studies have been carried out on GdCo 3 B 2 and DyCo 3 B 2 . These compounds are magnetically ordered with Curie temperatures of 56 0 and 21 0 K respectively. The Co atoms are either nonmagnetic or carry a small moment in these compounds. The saturation moment of DyCo 3 B 2 at 5 0 K is smaller than the Dy 3+ free-ion value. From 161 Dy Moessbauer studies, the measured hyperfine magnetic field at the Dy site is also observed to be smaller than the free-ion value. 155 Gd Moessbauer measurements in GdCo 3 B 2 reveal the presence of large crystalline electric fields at the rare earth site. This causes the moment and the hyperfine field at the Dy site in DyCo 3 B 2 to be reduced from its free-ion value

  11. Defect structure of ultrafine MgB2 nanoparticles

    International Nuclear Information System (INIS)

    Bateni, Ali; Somer, Mehmet; Repp, Sergej; Erdem, Emre; Thomann, Ralf; Acar, Selçuk

    2014-01-01

    Defect structure of MgB 2 bulk and ultrafine particles, synthesized by solid state reaction route, have been investigated mainly by the aid of X-band electron paramagnetic resonance spectrometer. Two different amorphous Boron (B) precursors were used for the synthesis of MgB 2 , namely, boron 95 (purity 95%–97%, <1.5 μm) and nanoboron (purity >98.5%, <250 nm), which revealed bulk and nanosized MgB 2 , respectively. Scanning and transmission electron microscopy analysis demonstrate uniform and ultrafine morphology for nanosized MgB 2 in comparison with bulk MgB 2 . Powder X-ray diffraction data show that the concentration of the by-product MgO is significantly reduced when nanoboron is employed as precursor. It is observed that a significant average particle size reduction for MgB 2 can be achieved only by using B particles of micron or nano size. The origin and the role of defect centers were also investigated and the results proved that at nanoscale MgB 2 material contains Mg vacancies. Such vacancies influence the connectivity and the conductivity properties which are crucial for the superconductivity applications

  12. Effect of Li level, artificial aging, and TiB2 reinforcement on the modulus of Weldalite (tm) 049

    Science.gov (United States)

    1991-01-01

    The dynamic Young's Modulus (E) was determined for (1) alloys 049(1.3)(heat 072), (2) 049(1.9), and (3) 049(1.3) TiB2 in the T3 temper and after aging at 160 C were made on a single 0.953 cm (0.375 in) cube to reduce scatter from microstructural inhomogeneities. Both shear and transverse wave velocities were measured for the L, LT, and ST directions by a pulse echo technique. These velocities were then used to calculate modulus. The change is shown in E with aging time at 160 C (320 F) for the three alloys. It is clear from the plots that aging has a minor, but measurable, influence on the E of alloys 049(1.3) and 049(1.9): E decreases by -2.5 pct. for 2 and 3 during the initial stages of artificial aging. This decrease in E generally follows the strength reversion. On further aging beyond the reversion well, E increases and then decreases again as the alloy overage. The slightly higher modulus in the T8 than in the T3 temper is consistent with the presence of the high modulus T sub 1 phase in the T8 temper. A similar change in E was observed on aging for the TiB2 reinforced variant that also follows the aging curve.

  13. Digitaalisen markkinoinnin suunnitelma b2b-yritykselle

    OpenAIRE

    Harhakoski, Oskari

    2011-01-01

    Työ käsittelee digitaalisen markkinoinnin suunnitelman tekemistä b2b-yritykselle. Tavoitteena oli kilpailuedun hankkiminen sosiaalisen median tehokkaalla hyödyntämisellä mark-kinoinnissa. Konkreettisemmin yritys halusi lisää näkyvyyttä ja myyntiä. Suunnitelman laatimisessa hyödynnettiin POST-menetelmää. Erityistä huomiota kiinnitettiin b2b-markkinoinnin eroihin b2c-markkinointiin verrattuna. Myös yrityksen toimiminen Suomen markkinoilla huomioitiin. Lisäksi analysoitiin kilpailijoita asia...

  14. Pulse laser irradiation into superconducting MgB2 detector

    International Nuclear Information System (INIS)

    Fujiwara, Daisuke; Miki, Shigehito; Satoh, Kazuo; Yotsuya, Tsutomu; Shimakage, Hisashi; Wang, Zhen; Okayasu, Satoru; Katagiri, Masaki; Machida, Masahiko; Kato, Masaru; Ishida, Takekazu

    2005-01-01

    We performed 20-ps pulse laser irradiation experiments on a MgB 2 neutron detector to know a thermal-relaxation process for designing a MgB 2 neutron detector. The membrane-type structured MgB 2 device was fabricated to minimize the heat capacity of sensing part of a detector as well as to enhance its sensitivity. We successfully observed a thermal-relaxation signal resulting from pulse laser irradiation by developing a detection circuit. The response time was faster than 1 μs, meaning that the detector would be capable of counting neutrons at a rate of more than 10 6 events per second

  15. Magnetic anisotropy of YNi2B2C single crystals

    International Nuclear Information System (INIS)

    Baran, M.; Gladczuk, L.; Gorecka, J.; Szymczak, H.; Szymczak, R.; Drzazga, Z.; Winiarska, H.

    1994-01-01

    Reversible and irreversible magnetization processes in YNi 2 B 2 C single crystal have been measured and analysed in terms of existing theories. Performed measurements suggest that anisotropy of the effective mass in YNi 2 B 2 C superconductor is rather small and similar to that observed in conventional superconductors. Effect of hydrostatic pressure on T c is shown to be typical of low-temperature superconductors. It is suggested that the layered structure of YNi 2 B 2 C has some effect on the irreversible magnetization processes observed in this superconductor. ((orig.))

  16. 26 CFR 1.403(b)-2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.403(b)-2 Definitions. (a) Application... 1450(b) of the Small Business Job Protection Act of 1996 (110 Stat. 1755, 1814) for special rules...

  17. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery...... on the ways in which design sense making artefacts may drive also B2B sales agents’ work....

  18. B2B Models for DoD Acquisition

    National Research Council Canada - National Science Library

    Kamel, Magdi N

    2008-01-01

    A central vision of B2B e-commerce is that of an electronic marketplace that would bring suppliers together with major buyers of goods and services for the purpose of conducting "frictionless commerce...

  19. Explosive device of conduit using Ti Ni alloy

    Directory of Open Access Journals (Sweden)

    A. Yu. Kolobov

    2014-01-01

    Full Text Available Presently, materials have been developed which are capable at changing temperate to return significant inelastic deformations, exhibit rubber-like elasticity, convert heat into mechanical work, etc. The aggregate of these effects is usually called the shape memory effect.At present a great number of compounds and alloys with a shape memory effect has been known.These are alloys based on titanium nickelide (TiNi, copper-based alloys (Cu-Al, Cu-Sn, Cu-Al-Ni, Cu-Zn-Si, etc., gold and silver (Ag-Cd, Au-Ag-Cd, Au-Cd-Cu, Au-Zn-Cu, etc., manganese (Mn-Cr, Fe-Cu, Mn-Cu-Ni, Mn-Cu-Zr, Mn-Ni, etc., iron (Fe-Mn, Fe-Ni, Fe-Al, etc., and other compounds.The alloys based on titanium nickelide (nitinol are the most widely used.Alloys with shape memory effect find various applications in engineering and medicine, namely connecting devices, actuators, transformable design, multipurpose medical implants, etc.There is a task of breaking fuel conduit during separating the spacecraft from the rocket in space technology.The paper examines the procedure for design calculation of the separating device of conduit with the use of Ti-Ni alloy. This device can be used instead of the pyro-knives.The device contains two semi-rings from Ti-Ni alloy. In the place of break on the conduit an annular radius groove is made.At a temperature of martensite passage the semi-rings undergo deformation and in the strained state are set in the device. With heating to the temperature of the austenitic passage of bushing macro-deformation the energy stored by the nitinol bushing is great enough to break the conduit on the neck.The procedures of design calculation and response time of device are given.

  20. Novel high pressure hexagonal OsB2 by mechanochemistry

    International Nuclear Information System (INIS)

    Xie, Zhilin; Graule, Moritz; Orlovskaya, Nina; Andrew Payzant, E.; Cullen, David A.; Blair, Richard G.

    2014-01-01

    Hexagonal OsB 2 , a theoretically predicted high-pressure phase, has been synthesized for the first time by a mechanochemical method, i.e., high energy ball milling. X-ray diffraction indicated that formation of hexagonal OsB 2 begins after 2.5 h of milling, and the reaction reaches equilibrium after 18 h of milling. Rietveld refinement of the powder data indicated that hexagonal OsB 2 crystallizes in the P63/mmc space group (No. 194) with lattice parameters of a=2.916 Å and c=7.376 Å. Transmission electron microscopy confirmed the appearance of the hexagonal OsB 2 phase after high energy ball milling. in situ X-ray diffraction experiments showed that the phase is stable from −225 °C to 1050 °C. The hexagonal OsB 2 powder was annealed at 1050 °C for 6 days in vacuo to improve crystallinity and remove strain induced during the mechanochemical synthesis. The structure partially converted to the orthorhombic phase (20 wt%) after fast current assisted sintering of hexagonal OsB 2 at 1500 °C for 5 min. Mechanochemical approaches to the synthesis of hard boride materials allow new phases to be produced that cannot be prepared using conventional methods. - Graphical abstract: High resolution transmission electron micrograph of hexagonal OsB 2 nanocrystallite with corresponding fast Fourier transform and simulated diffraction pattern. - Highlights: • Hexagonal OsB 2 has been synthesized for the first time by mechanochemical method. • Hexagonal OsB 2 crystallizes in P63/mmc space group (No. 194), a=2.916 Å and c=7.376 Å. • The hexagonal structure was confirmed by a transmission electron microscope. • No phase transformation was observed after being annealed at 1050 °C for 6 days. • 20 wt% of h-OsB 2 was transformed to o-OsB 2 after being sintered at 1500 °C for 5 min

  1. Thermal stability of hexagonal OsB2

    Science.gov (United States)

    Xie, Zhilin; Blair, Richard G.; Orlovskaya, Nina; Cullen, David A.; Andrew Payzant, E.

    2014-11-01

    The synthesis of novel hexagonal ReB2-type OsB2 ceramic powder was performed by high energy ball milling of elemental Os and B powders. Two different sources of B powder have been used for this mechanochemical synthesis. One B powder consisted of a mixture of amorphous and crystalline phases and a mixture of 10B and 11B isotopes with a fine particle size, while another B powder was a purely crystalline (rhombohedral) material consisting of enriched 11B isotope with coarse particle size. The same Os powder was used for the synthesis in both cases. It was established that, in the first case, the hexagonal OsB2 phase was the main product of synthesis with a small quantity of Os2B3 phase present after synthesis as an intermediate product. In the second case, where coarse crystalline 11B powder was used as a raw material, only Os2B3 boride was synthesized mechanochemically. The thermal stability of hexagonal OsB2 powder was studied by heating under argon up to 876 °C and cooling in vacuo down to -225 °C. During the heating, the sacrificial reaction 2OsB2+3O2→2Os+2B2O3 took place due to presence of O2/water vapor molecules in the heating chamber, resulting in the oxidation of B atoms and formation of B2O3 and precipitation of Os metal out of the OsB2 lattice. As a result of such phase changes during heating, the lattice parameters of hexagonal OsB2 changed significantly. The shrinkage of the a lattice parameter was recorded in 276-426 °C temperature range upon heating, which was attributed to the removal of B atoms from the OsB2 lattice due to oxidation followed by the precipitation of Os atoms and formation of Os metal. While significant structural changes occurred upon heating due to presence of O2, the hexagonal OsB2 ceramic demonstrated good phase stability upon cooling in vacuo with linear shrinkage of the lattice parameters and no phase changes detected during cooling.

  2. B2B Models for DoD Acquisition

    Science.gov (United States)

    2007-07-30

    product design, demand forecasting, asset management, and sales and marketing plans 35 Proctor & Gamble’s Private Industrial Network SOURCE: Laudon... B2B Models for DoD Acquisition 30 July 2007 by Magdi N. Kamel, Associate Professor Graduate School of Operational & Information Sciences...number. 1. REPORT DATE 30 JUL 2007 2. REPORT TYPE 3. DATES COVERED 00-00-2007 to 00-00-2007 4. TITLE AND SUBTITLE B2B Models for DoD

  3. Creating Competitive Advantage by Rethinking B2B Software Pricing

    OpenAIRE

    Adelstrand, Carl; Brostedt, Emil

    2016-01-01

    The choice of pricing model for software products is a complex procedure due to the different characteristics compared to physical products. This thesis investigates and compares software pricing models in a B2B setting, and describes how KAM plays a role in executing a pricing model. The research has been conducted as an opportunist case study on Adebro, a technology company in the B2B sector. The thesis have come to the following conclusions, with data from interviews and literature: Perpet...

  4. Scope of Internal Marketing in B2B Companies

    OpenAIRE

    Nigam, Niharika

    2007-01-01

    Abstract Previous studies have focused on "internal marketing" from services marketing perspective. There is, therefore, a great dearth of in-depth research on its application to other business types. This research attempts to find the scope of internal marketing in B2B companies. The purpose of this research is to closely examine the elements, their linkage, tools and applications of Internal marketing when applied to B2B settings. Internal marketing, the application of marketing managem...

  5. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2001-06-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.

  6. Novel high pressure hexagonal OsB2 by mechanochemistry

    Science.gov (United States)

    Xie, Zhilin; Graule, Moritz; Orlovskaya, Nina; Andrew Payzant, E.; Cullen, David A.; Blair, Richard G.

    2014-07-01

    Hexagonal OsB2, a theoretically predicted high-pressure phase, has been synthesized for the first time by a mechanochemical method, i.e., high energy ball milling. X-ray diffraction indicated that formation of hexagonal OsB2 begins after 2.5 h of milling, and the reaction reaches equilibrium after 18 h of milling. Rietveld refinement of the powder data indicated that hexagonal OsB2 crystallizes in the P63/mmc space group (No. 194) with lattice parameters of a=2.916 Å and c=7.376 Å. Transmission electron microscopy confirmed the appearance of the hexagonal OsB2 phase after high energy ball milling. in situ X-ray diffraction experiments showed that the phase is stable from -225 °C to 1050 °C. The hexagonal OsB2 powder was annealed at 1050 °C for 6 days in vacuo to improve crystallinity and remove strain induced during the mechanochemical synthesis. The structure partially converted to the orthorhombic phase (20 wt%) after fast current assisted sintering of hexagonal OsB2 at 1500 °C for 5 min. Mechanochemical approaches to the synthesis of hard boride materials allow new phases to be produced that cannot be prepared using conventional methods.

  7. Thermal stability of hexagonal OsB2

    International Nuclear Information System (INIS)

    Xie, Zhilin; Blair, Richard G.; Orlovskaya, Nina; Cullen, David A.; Andrew Payzant, E.

    2014-01-01

    The synthesis of novel hexagonal ReB 2 -type OsB 2 ceramic powder was performed by high energy ball milling of elemental Os and B powders. Two different sources of B powder have been used for this mechanochemical synthesis. One B powder consisted of a mixture of amorphous and crystalline phases and a mixture of 10 B and 11 B isotopes with a fine particle size, while another B powder was a purely crystalline (rhombohedral) material consisting of enriched 11 B isotope with coarse particle size. The same Os powder was used for the synthesis in both cases. It was established that, in the first case, the hexagonal OsB 2 phase was the main product of synthesis with a small quantity of Os 2 B 3 phase present after synthesis as an intermediate product. In the second case, where coarse crystalline 11 B powder was used as a raw material, only Os 2 B 3 boride was synthesized mechanochemically. The thermal stability of hexagonal OsB 2 powder was studied by heating under argon up to 876 °C and cooling in vacuo down to −225 °C. During the heating, the sacrificial reaction 2OsB 2 +3O 2 →2Os+2B 2 O 3 took place due to presence of O 2 /water vapor molecules in the heating chamber, resulting in the oxidation of B atoms and formation of B 2 O 3 and precipitation of Os metal out of the OsB 2 lattice. As a result of such phase changes during heating, the lattice parameters of hexagonal OsB 2 changed significantly. The shrinkage of the a lattice parameter was recorded in 276–426 °C temperature range upon heating, which was attributed to the removal of B atoms from the OsB 2 lattice due to oxidation followed by the precipitation of Os atoms and formation of Os metal. While significant structural changes occurred upon heating due to presence of O 2 , the hexagonal OsB 2 ceramic demonstrated good phase stability upon cooling in vacuo with linear shrinkage of the lattice parameters and no phase changes detected during cooling. - Graphical abstract: The in situ high temperature XRD

  8. Magnetoimpedance effect in Nanoperm alloys

    International Nuclear Information System (INIS)

    Hernando, B.; Alvarez, P.; Santos, J.D.; Gorria, P.; Sanchez, M.L.; Olivera, J.; Perez, M.J.; Prida, V.M.

    2006-01-01

    The influence of isothermal annealing (1 h at 600 deg. C in Ar atmosphere) on the soft magnetic properties and magnetoimpedance (MI) effect has been studied in ribbons of the following Nanoperm alloys: Fe 91 Zr 7 B 2 , Fe 88 Zr 8 B 4 , Fe 87 Zr 6 B 6 Cu 1 and Fe 8 Zr 1 B 1 . A maximum MI ratio of about 27% was measured for the nanocrystalline alloy Fe 87 Zr 6 B 6 Cu 1 at a driving frequency of 0.2 MHz. The thermal annealing led to magnetic softening for this alloy, while a hardening is observed for the Fe 8 Zr 1 B 1 alloy

  9. Interfacial Dzyaloshinskii-Moriya interaction sign in Ir/Co2FeAl systems investigated by Brillouin light scattering

    Science.gov (United States)

    Belmeguenai, M.; Gabor, M. S.; Roussigné, Y.; Petrisor, T.; Mos, R. B.; Stashkevich, A.; Chérif, S. M.; Tiusan, C.

    2018-02-01

    C o2FeAl (CFA) ultrathin films, of various thicknesses (0.9 nm ≤tCFA≤1.8 nm ), have been grown by sputtering on Si substrates, using Ir as a buffer layer. The magnetic properties of these structures have been studied by vibrating sample magnetometry (VSM), miscrostrip ferromagnetic resonance (MS-FMR), and Brillouin light scattering (BLS) in the Damon-Eshbach geometry. VSM characterizations show that films are mostly in-plane magnetized and the saturating field perpendicular to the film plane increases with decreasing CFA thickness suggesting the existence of a perpendicular interface anisotropy. The presence of a magnetic dead layer of 0.44 nm has been detected by VSM. The MS-FMR with the magnetic field applied perpendicularly to the film plane has been used to determine the gyromagnetic factor. The BLS measurements reveal a pronounced nonreciprocal spin wave propagation, due to the interfacial Dzyaloshinskii-Moriya interaction (DMI) induced by the Ir interface with CFA, which increases with decreasing CFA thickness. The DMI sign has been found to be the same (negative) as that of Pt/Co, in contrast to the ab initio calculation on Ir/Co, where it is found to be positive. The thickness dependence of the effective DMI constant shows the existence of two regimes similarly to that of the perpendicular anisotropy constant. The surface DMI constant Ds was estimated to be -0.37 pJ /m for the thickest samples, where a linear thickness dependence of the effective DMI constant has been observed.

  10. Thickness-dependent enhancement of damping in C o2FeAl /β -Ta thin films

    Science.gov (United States)

    Akansel, Serkan; Kumar, Ankit; Behera, Nilamani; Husain, Sajid; Brucas, Rimantas; Chaudhary, Sujeet; Svedlindh, Peter

    2018-04-01

    In the present work C o2FeAl (CFA) thin films were deposited by ion beam sputtering on Si (100) substrates at the optimized deposition temperature of 300 °C. A series of CFA films with different thicknesses (tCFA), 8, 10, 12, 14, 16, 18, and 20 nm, were prepared and all samples were capped with a 5-nm-thick β-Ta layer. The thickness-dependent static and dynamic properties of the films were studied by SQUID magnetometry, in-plane as well as out-of-plane broadband vector network analyzer-ferromagnetic resonance (FMR) measurements, and angle-dependent cavity FMR measurements. The saturation magnetization and the coercive field were found to be weakly thickness dependent and lie in the range 900-950 kA/m and 0.53-0.87 kA/m, respectively. The effective damping parameter (αeff) extracted from in-plane and out-of-plane FMR results reveals a 1/tCFA dependence, the values for the in-plane αeff being larger due to two-magnon scattering (TMS). The origin of the αeff thickness dependence is spin pumping into the nonmagnetic β-Ta layer and in the case of the in-plane αeff, also a thickness-dependent TMS contribution. From the out-of-plane FMR results, it was possible to disentangle the different contributions to αeff and to the extract values for the intrinsic Gilbert damping (αG) and the effective spin-mixing conductance (geff↑↓) of the CFA/ β-Ta interface, yielding αG=(1.1 ±0.2 ) ×10-3 and geff↑↓=(2.90 ±0.10 ) ×1019m-2 .

  11. Lattice Thermal Conductivity of Ultra High Temperature Ceramics ZrB2 and HfB2 from Atomistic Simulations

    Science.gov (United States)

    Lawson, John W.; Murray, Daw S.; Bauschlicher, Charles W., Jr.

    2011-01-01

    Atomistic Green-Kubo simulations are performed to evaluate the lattice thermal conductivity for single crystals of the ultra high temperature ceramics ZrB2 and HfB2 for a range of temperatures. Recently developed interatomic potentials are used for these simulations. Heat current correlation functions show rapid oscillations which can be identified with mixed metal-Boron optical phonon modes. Agreement with available experimental data is good.

  12. Pseudopotential approach to superconductivity in MgB2

    International Nuclear Information System (INIS)

    Sharma, K.S.; Bhargava, Nidhi; Jain, Ritu; Goyal, Varsha; Sharma, Ritu; Sharma, Smita

    2010-01-01

    Superconductivity in MgB 2 has been re-examined in BCS-Eliashberg framework by employing Mc-Millan's T c -equation and form factors of MgB 2 computed from the form factors of component metals (Model-I). The empty core model pseudopotential due to Ashcroft and random phase approximation form of dielectric screening due to Gellmann and Brueckner are used in the present work. An excellent agreement between the present values and other theoretically computed values of T c and with the relevant experimental data for MgB 2 confirms the validity of the present approach. The explicit dependence of λ and T c on the isotopic masses of Mg and B, as revealed from the present work, confirms the role of lattice vibrations in the superconducting behaviour of MgB 2 and the high value of T c in it may be attributed to the phonon mediated e-e interaction coupled with higher values of phonon frequencies due to light mass of B atoms. It has also been observed that the pseudo-atom model (Model-II) with appropriate choice of the potential parameter r c successfully explains high value of T c and isotope effect in MgB 2 , confirming the prominent role played by electron-phonon interaction in the high-T c superconductivity observed in MgB 2 . The isotope effect exponent α-values obtained from the two models are in complete agreement with each other and the present value α = 0.46 is also much closer to the BCS value of 0.5. Interaction strength N 0 V values obtained from the two models are also in perfect agreement with each other and the present value N 0 V = 0.48 suggests that MgB 2 is a strong coupling superconductor. (author)

  13. Pack cementation diffusion coatings for Fe-base and refractory alloys. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Rapp, R.A. [Ohio State Univ., Columbus, OH (United States). Dept. of Materials Science and Engineering

    1998-03-10

    With the aid of computer-assisted calculations of the equilibrium vapor pressures in halide-activated cementation packs, processing conditions have been identified and experimentally verified for the codeposition of two or more alloying elements in a diffusion coating on a variety of steels and refractory metal alloys. A new comprehensive theory to treat the multi-component thermodynamic equilibria in the gas phase for several coexisting solid phases was developed and used. Many different processes to deposit various types of coatings on several types of steels were developed: Cr-Si codeposition for low- or medium-carbon steels, Cr-Al codeposition on low-carbon steels to yield either a Kanthal-type composition (Fe-25Cr-4Al in wt.%) or else a (Fe, Cr){sub 3}Al surface composition. An Fe{sub 3}Al substrate was aluminized to achieve an FeAl surface composition, and boron was also added to ductilize the coating. The developmental Cr-lean ORNL alloys with exceptional creep resistance were Cr-Al coated to achieve excellent oxidation resistance. Alloy wires of Ni-base were aluminized to provide an average composition of Ni{sub 3}Al for use as welding rods. Several different refractory metal alloys based on Cr-Cr{sub 2}Nb have been silicided, also with germanium additions, to provide excellent oxidation resistance. A couple of developmental Cr-Zr alloys were similarly coated and tested.

  14. The effect warming time of mechanical properties and structural phase aluminum alloy nickel

    International Nuclear Information System (INIS)

    Husna Al Hasa, M.; Anwar Muchsin

    2011-01-01

    Ferrous aluminum alloys as fuel cladding will experience the process of heat treatment above the recrystallization temperature. Temperature and time of heat treatment will affect the nature of the metal. Heating time allows will affect change in mechanical properties, thermal and structure of the metal phase. This study aims to determine the effect of time of heat treatment on mechanical properties and phase metal alloys. Testing the mechanical properties of materials, especially violence done by the method of Vickers. Observation of microstructural changes made by metallographic-optical and phase structure were analyzed Based on the x-ray diffraction patterns Elemental analysis phase alloy compounds made by EDS-SEM. Test results show the nature of violence AlFeNiMg alloy by heating at 500°C with a warm-up time 1 hour, 2 hours and 3 hours respectively decreased range 94.4 HV, 87.6 HV and 85.1 HV. The nature of violence AlFeNi alloy showed a decrease in line with the longer heating time. Metallographic-optical observations show the microstructural changes with increasing heating time. Microstructure shows the longer the heating time trend equi axial shaped grain structure of growing and the results showed a trend analyst diffraction pattern formation and phase θ α phase (FeAl3) in the alloy. (author)

  15. Experimental Investigation on Mechanical and Turning Behavior of Al 7075/x% wt. TiB2-1% Gr In Situ Hybrid Composite

    Directory of Open Access Journals (Sweden)

    K. R. Ramkumar

    2015-01-01

    Full Text Available The present research work involves the study of AA 7075-TiB2-Gr in situ composite through stir casting route. This in situ method involves formation of reinforcements within the matrix by the chemical reaction of two or more compounds which also produces some changes in the matrix material within the vicinity. Titanium Diboride (TiB2 and graphite were the reinforcement in a matrix of AA 7075 alloy. The composite was prepared with the formation of the reinforcement inside the molten matrix by adding salts of Potassium Tetrafluoroborate (KBF4 and Potassium Hexafluorotitanate (K2TiF6. The samples were taken under casted condition and the properties of the composite were tested by conducting characterization using X-ray diffraction (XRD, hardness test, flexural strength by using three-point bend test, scanning electron microscope (SEM, optical microstructure, grain size analysis, and surface roughness. It was found that good/excellent mechanical properties were obtained in AA 7075-TiB2-Gr reinforced in situ hybrid composite compared to alloy due to particulate strengthening of ceramic particles of TiB2 in the matrix. Further, Al 7075-3% TiB2-1% Gr hybrid in situ composite exhibited improved machinability over the alloy and composites due to self-lubricating property given by the Gr particles in the materials.

  16. Dry cryomagnetic system with MgB2 coil

    Science.gov (United States)

    Abin, D. A.; Mineev, N. A.; Osipov, M. A.; Pokrovskii, S. V.; Rudnev, I. A.

    2017-12-01

    MgB2 may be the future superconducting wire material for industrial magnets due to it’s higher operation temperature and potentially lower cost than low temperature superconductors (LTS) have. We designed a compact cryomagnetic system with the use of MgB2. The possibility of creating a magnet with a central field of 5 T from a commercial MgB2 wire by the “react and wound” method was investigated. The magnetic system is cooled by a cryocooler through a copper bus. The magnet has a warm bore diameter of 4 cm. The design of a magnet consisting of three concentric solenoids is proposed: an internal one of high-temperature superconductor (HTS), an average of MgB2, and an external of NbTi. The operating current of the system is 100 A. Two pairs of current leads are used. A separate pair of current leads for power supplying NbTi coil allows testing of MgB2 and HTS coils in an external field. The load curves for each of the magnets are calculated.

  17. Studies on the intestinal absorption of vitamin B2

    International Nuclear Information System (INIS)

    Yamaguchi, Keiko; Moriwaki, Chiaki

    1978-01-01

    The intestinal absorption of vitamin B 2 was studied by in situ mesenteric perfusion system. Free form riboflavin (FR), FMN and FAD (1 mg each) were injected into the ligated jejunum of rat which was infused Krebs Ringer bicarbonate solution from the superior mesenteric artery. Perfusate was recovered from the mesenteric vein and the recoveries of the total riboflavin during 120 min after the administration of these 3 types vitamin B 2 were 1.0, 1.5 and 2.8%, respectively. Furthermore, riboflavin and its esters were detected in the perfusates from 14 C-FR and 14 C-FAD given rats. There was a considerable amount of labeled substance which was not vitamin B 2 derivatives in the radiopaperchromatogram of the perfusate of 14 C-FR dosed rats, and it is suggested that a portion of riboflavin is decomposed in the process of absorption. (auth.)

  18. B2B-myynnin nykytila ja haasteet Suomessa

    OpenAIRE

    Ylimaula, Jukka

    2014-01-01

    Tämä opinnäytetyö tutki B2B-myynnin nykytilaa valituissa suomalaisissa yrityksissä. Tutkimuksen tavoite oli selvittää myyntijohdon mielestä B2B-myynnissä tärkeitä asioita ja hahmottaa tapaa, jolla organisaatio toimii yhteistyössä myynnissä. Näin teemojen pohjalta opinnäytetyö pyrki muodostamaan ajankuvan suomalaisesta B2B-myynnistä. Opinnäytetyö muodostuu teoriaosasta ja empiirisestä osasta. Teoreettinen osuus tutkii myyntiä sekä myyjän että ostajan näkökulmasta. Myös asiakassuhteita ja m...

  19. Chemical vapor deposition of TiB2 on graphite

    International Nuclear Information System (INIS)

    Pierson, H.O.; Randich, E.; Mattox, D.M.

    1978-01-01

    This study is an experimental investigation of the coating of graphite with TiB 2 by chemical vapor deposition (CVD) using the hydrogen reduction of BCl 3 and TiCl 4 at 925 0 C and 1 atm. Reasonable matching of the thermal expansion of TiB 2 and graphite was necessary to eliminate cracking. A suitable graphite was POCO DFP-1. Adhesion was improved by having a slightly rough graphite surface. Heat treatment at 2000 0 C and above resulted in a certain degree of diffusion. No melting or solid phases other than TiB 2 and graphite were detected up to 2400 0 C. The coatings showed no failure when repeatedly submitted to an electron beam pulse of 2 KW/cm 2 for 0.8 sec

  20. ORM-Based Semantics of B2B Transactions

    Science.gov (United States)

    Balsters, H.; van Blommestein, F.

    After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely neglected by present implementations of standard EDI- or XML-messaging and by B2B webservice implementations. In this paper a precise model is given of the negotiation process. The requirements of a potential Buyer and the offer of a potential Seller are matched and, if the negotiation is successful, a contract is concluded. The negotiation process model is represented in ORM, extended with dynamic constraints. Our model may be implemented in the databases of the trading partners and in message- or service definitions.

  1. Densification and properties of HfB2 based materials

    International Nuclear Information System (INIS)

    Sonber, J.K.; Ch Murthy, T.S.R.; Bedse, R.D.; Subramanian, C.; Kumar, Sunil; Fotedar, R.K.; Krishnamurthy, N.; Suri, A.K.

    2011-01-01

    This paper presents the results of investigation carried out on densification and properties of HfB 2 based materials. Densification study of HfB 2 with and without sinter additive was carried out by hot pressing. TiSi 2 and CrSi 2 were used as sinter additive. Monolithic HfB 2 was densified to only 80%ρ th at 1850 deg C with a pressure of 35 MPa. Addition of 10 wt% TiSi 2 resulted in a density of 95% TD at a relatively low temperature of 1650 deg C and a low pressure of 20 MPa. Addition of 10% CrSi 2 resulted in a density of 99% TD at the same operating conditions. All the samples were characterized by SEM/EDS and mechanical property measurement. (author)

  2. Electromagnetic densification of MgB2/Cu wires

    International Nuclear Information System (INIS)

    Woźniak, M; Glowacki, B A

    2014-01-01

    Electromagnetic compaction of in situ MgB 2 /Cu wire has been achieved using a custom-built 200 J device. The monofilament core packing density was increased by 8% and up to 31% for unreacted and reacted wires respectively. The higher density of the MgB 2 core resulted in a critical current density increase of up to 75% in comparison to that for cold-drawn-only wire. Applying this treatment to a wire with Cu powder additions to the core and with an optimized heat treatment resulted in one of the highest ever reported values of J c for MgB 2 /Cu wires of 6.83 × 10 3  A cm −2 at 4.2 K and 6 T. (paper)

  3. Vitamin B2 (riboflavin content in cereal products

    Directory of Open Access Journals (Sweden)

    Soňa Škrovánková

    2010-01-01

    Full Text Available Vitamin B2 (riboflavin is a water-soluble essential vitamin. Nowadays an increased risk for riboflavin deficiency may be seen in people on special diets (diabetes mellitus, smokers or heavy alcohol drinkers. In the Czech diet the main sources of the vitamin intake are milk and dairy products followed by cereals and meat. Cereals are good source of this vitamin as it is widely and regularly consumed in different forms. Analyses of the vitamin B2 content in different types of cereal products (flours, breads, pastries, breakfast cereals, cooked pasta of Czech origin using HPLC with reversed phase and UV detection were done. The vitamin B2 content of chosen cereal products decreased in this progression: enriched wholemeal breakfast cereals (the best source of the vitamin, enriched wheat flours, breads – rye and wholemeal wheat breads, whole wheat and spelt flours, wheat bread, cooked whole wheat and rye spaghetti, wheat and multigrain pastries and finally scoured wheat flours.

  4. MgB2 superconducting wires basics and applications

    CERN Document Server

    2016-01-01

    The compendium gives a complete overview of the properties of MgB2 (Magnesium Diboride), a superconducting compound with a transition temperature of Tc = 39K, from the fundamental properties to the fabrication of multifilamentary wires and to the presentation of various applications. Written by eminent researchers in the field, this indispensable volume not only discusses superconducting properties of MgB2 compounds, but also describes known preparation methods of thin films and of bulk samples obtained under high pressure methods. A unique selling point of the book is the detailed coverage of various applications based on MgB2, starting with MRI magnets and high current cables, cooled by Helium (He) vapor. High current cables cooled by liquid hydrogen are also highlighted as an interesting alternative due to the shrinking He reserves on earth. Other pertinent subjects comprise permanent magnets, ultrafine wires for space applications and wind generator projects.

  5. A new superhard material: Osmium diboride OsB 2

    Science.gov (United States)

    Hebbache, M.; Stuparević, L.; Živković, D.

    2006-08-01

    Superhard materials have many industrial applications, wherever resistance to abrasion and wear are important. The synthesis of new superhard materials is one of the great challenges to scientists. We re-examined the phase diagram of the binary osmium-boron system and confirmed the existence of two hexagonal phases, OsB 1.1, Os 2B 3, and an orthorhombic phase, OsB 2. Almost nothing is known about the physical properties of osmium borides. Microhardness measurements show that OsB 2 is extremely hard. Ab initio calculations show that this is due to formation of covalent bonds between boron atoms. OsB 2 is also a low compressibility material. It can be used as hard coating.

  6. Construction of the irreducibles of B(2, 2)

    International Nuclear Information System (INIS)

    Melas, Evangelos

    2006-01-01

    The ordinary Bondi-Metzner-Sachs (BMS) group B is the common asymptotic symmetry group of all radiating, asymptotically flat, Lorentzian spacetimes. As such, B is the best candidate for the universal symmetry group of general relativity. However, in studying quantum gravity, spacetimes with signatures other than the usual Lorentzian one and complex spacetimes are frequently considered. Generalizations of B appropriate to these other signatures have been defined earlier. In particular, the generalization B(2, 2) appropriate to the ultrahyperbolic signature (+, +, -, -) has been described in detail, and the study of its irreducible unitary representations (IRs) of B(2, 2) has been initiated. The infinite little groups have been given explicitly, but the finite little groups have only been partially described. This study is completed by describing in detail the finite little groups and by giving all the necessary information in order to construct the IRs of B(2, 2) in all cases

  7. B2B-myyntiprosessi : case: Yritys X

    OpenAIRE

    Lamppu, Samuli

    2017-01-01

    Opinnäytetyön aiheena on B2B-myyntiprosessi yrityksessä x. Työn tavoitteena on kartoittaa yrityksen B2B-myyntiprosessin nykytila, tunnistaa mahdolliset ongelma-alueet ja tehdä tämän perusteella ehdotukset toimenpiteistä prosessin parantamiseksi. Työ tehdään suomalaisen PK-yrityksen toimeksiannosta. Opinnäytetyön taustalla on oma urani yrityksen yritysmyynnissä, ja työni kautta tunnistamani haasteet sekä mahdollisuudet, joita hyödyntämällä yritys voisi kehittää myyntitoimintaansa. Yritykse...

  8. Cosima B2B - Sales Automation for E-Procurement

    OpenAIRE

    Kießling, Werner (Prof. Dr.); Fischer, Stefan; Döring, Sven

    2006-01-01

    E-procurement is one of the fastest growing application areas for e-commerce. Though B2B transaction costs could be reduced recently by establishing XML based standards for electronic product catalogs and data interchange, B2B sales costs are still high due to the amount of human interaction. For the first time we present a fully automated electronic sales agent for e-procurement portals. The key technologies for this breakthrough are based on preferences modeled as strict partial orders, ena...

  9. How has IT impacted the B2B sales process?

    OpenAIRE

    Bjørnstad, Julia Jemli

    2017-01-01

    B2B sales role plays a major role in driving the economy, and this industry has been experiencing major changes over the year with the advances in technology which allow for more cost savings and driving for more efficient ways of conducting sales operations. The objective of this exploratory qualitative research paper was to raise interest in the role technology plays in the B2B sales process today from the salesperson’s view point. It was further partly built on previous rese...

  10. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...

  11. Aluminium base amorphous and crystalline alloys with Fe impurity

    International Nuclear Information System (INIS)

    Sitek, J.; Degmova, J.

    2006-01-01

    Aluminium base alloys show remarkable mechanical properties, however their low thermal stability still limits the technological applications. Further improvement of mechanical properties can be reached by partial crystallization of amorphous alloys, which gives rise to nanostructured composites. Our work was focused on aluminium based alloys with Fe, Nb and V additions. Samples of nominal composition Al 90 Fe 7 Nb 3 and Al 94 Fe 2 V 4 were studied in amorphous state and after annealing up to 873 K. From Moessbauer spectra taken on the samples in amorphous state the value of f-factor was determined as well as corresponding Debye temperatures were calculated. Annealing at higher temperatures induced nano and microcrystalline crystallization. Moessbauer spectra of samples annealed up to 573 K are fitted only by distribution of quadrupole doublets corresponding to the amorphous state. An increase of annealing temperature leads to the structural transformation, which consists in growth of nanometer sized aluminium nuclei. This is partly reflected in Moessbauer parameters. After annealing at 673 K intermetallic phase Al 3 Fe and other Al-Fe phases are created. In this case Moessbauer spectra are fitted by quadrupole doublets. During annealing up to 873 K large grains of Fe-Al phases are created. (authors)

  12. Solid state amorphisation in binary systems prepared by mechanical alloying

    International Nuclear Information System (INIS)

    Gonzalez, G.; Sagarzazu, A.; Bonyuet, D.; D'Angelo, L.; Villalba, R.

    2009-01-01

    In the present work a detailed study of amorphisation in different systems prepared by mechanical alloying under the same experimental conditions was carried out, milling up to 50 and 100 h in some cases. The systems studied were: AlTi, AlNi, AlFe, FeNi, FeCo, NiMo, NiW, NiCo, MoW, CoMo. These systems were chosen to study the effect of Al-transition metal, transition metal-transition metal and also systems with large and small negative heat of mixing, different and similar crystal structures, atomic sizes and diffusion coefficients. Calculations based on the Miedema model for alloy formation and amorphisation on all the alloys studied were performed. The experimental results from X-ray diffraction and transmission electron microscopy showed that the systems based on Fe (FeNi, FeCo and FeAl) did not amorphised, even after milling for 100 h, and formed a stable solid solution with a nanometric grain size of 7 nm. The systems NiMo, NiW, MoW and CoMo (systems with small negative heat of mixing), showed amorphisation after 50 h of milling. NiAl and TiAl form an intermediate amorphous phase after around 20 h of milling and with further milling they recrystallize into a fcc solid solution. Agreement between the theoretical calculations based on the Miedema model and the experimental results was found in most of the systems.

  13. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2012-04-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.         JEL Codes: D23, L86Keywords: Cost, Transaction Costs, Transactions

  14. Effect of ageing time 200 °C on microstructure behaviour of Al-Zn-Cu-Mg cast alloys

    Directory of Open Access Journals (Sweden)

    Pratiwi Diah Kusuma

    2017-01-01

    Full Text Available Al-Zn-Cu-Mg is heat treatable alloy that can be used in many hightech applications, such as aerospace and military. The main objective of this study is to investigate the influence of ageing process in microstrucure behaviour of Al-9Zn-5Cu-4Mg cast alloy by performing SEM analysis and its correlation with hardness tests of as-cast Al-9Zn-5Cu-4Mg alloy and heat treated Al-9Zn-5Cu-4Mg cast alloy. The results show the deployment of precipitation spread over the dendrite and also the presence of second phases Mg3Zn3Al2 , Cu2FeAl7 , CuAl2, and CuMgAl2 in as-cast Al-9Zn-5Cu-4Mg alloy. The presence of all these second phases are affecting to the toughness of aluminium alloy and the presence of MgZn2 leads the impairment of hardness value of heat-treated Al-9Zn-5Cu-5Mg cast alloy.

  15. Investigation of TaC–TaB2 ceramic composites

    Indian Academy of Sciences (India)

    ture and the mechanical properties of the composites were investigated. The results .... 300 nm. Jingangzuan in the TaC/TaB2 composites SPS for 10 min at different temperatures are .... [1] Liu L, Yea F, Hea X and Zhoua Y 2011 Mater. Chem.

  16. Canonical realizations of B2 approximately C2 Lie algebras

    International Nuclear Information System (INIS)

    Iosifescu, M.; Scutaru, H.

    1982-12-01

    Canonical realizations associated to subrepresentations of ad x ad, for B 2 apppoximately C 2 semisimple Lie algebras, have been determined. An algebraic foundation has been obtained for the constraints satisfied by the dinamical variables of the classical limit of the generalized Helium problem. (authors)

  17. Selenidation of epitaxial silicene on ZrB2

    NARCIS (Netherlands)

    Wiggers, F. B.; Yamada-Takamura, Y.; Kovalgin, A. Y.; de Jong, M. P.

    2018-01-01

    The deposition of elemental Se on epitaxial silicene on ZrB2 thin films was investigated with synchrotron-based core-level photoelectron spectroscopy and low-energy electron diffraction. The deposition of Se at room temperature caused the appearance of Si 2p peaks with chemical shifts of n × 0.51 ±

  18. Structural, electronic and magnetic properties of MnB2

    Indian Academy of Sciences (India)

    5Hassan II Academy of Science and Technology, Rabat, Morocco ... Abstract. The self-consistent ab-initio calculations, based on density functional theory approach and using the full ... The exchange interactions between the magnetic atoms Mn–Mn in MnB2 are ... involved, and on the local environment of the transition-.

  19. Microwave absorption studies of MgB2 superconductor

    Indian Academy of Sciences (India)

    band (9–. 10 GHz) spectrometer. Both polycrystalline pellet and single-grain MgB2, having nearly the same Tc (∼ 39 K) and same size (3×2×1 mm3), were used in the present investigations. Low field modulated microwave absorption signals ...

  20. Electronic structure and superconductivity of MgB 2

    Indian Academy of Sciences (India)

    Results of ab initio electronic structure calculations on the compound, MgB2, using the FPLAPW method employing GGA for the exchange–correlation energy are presented. Total energy minimization enables us to estimate the equilibrium volume, / ratio and the bulk modulus, all of which are in excellent agreement with ...

  1. Intelligent Information Integration in B2B Electronic Commerce

    NARCIS (Netherlands)

    Fensel, Dieter; Omelayenko, Borys; Ding, Ying; Klein, Michel; Flett, Alan; Schulten, Ellen; Botquin, Guy; Brown, Mike; Dabiri, Gloria

    2002-01-01

    Internet and web technology penetrates many aspects of our daily life. Its importance as a medium for business transactions will grow exponentially during the next few years. In terms of the involved market volume, the B2B area will hereby be the most interesting area. Also, it will be the place,

  2. Superconducting state in (W, Ta)5SiB2

    Science.gov (United States)

    Fukuma, M.; Kawashima, K.; Akimitsu, J.

    We characterize the superconducting state in a boro-silicide (W, Ta)5SiB2, with Tc of 6.5 K by means of magnetization, electrical resistivity, and specific heat measurements. As x increased, the transition temperature Tc abruptly enhances from 5.8 to 6.5 K. The magnetization versus magnetic field (M-H) curve indicated that (W, Ta)5SiB2 was a conventional type-II superconductor. The estimated lower critical field Hc1(0) and upper critical field Hc2(T) are about 121 Oe and 14.7 kOe, respectively. The penetration depth λ(0) and coherence length ξ(0) are calculated to be approximately 369 and 14.9 nm, respectively, using Ginzburg-Landau (GL) equations. Specific heat data shows the superconductivity in W4.5Ta0.5SiB2 belongs to a week-coupling BCS superconductor. Finally, we discuss the increasing of Tc in of (W, Ta)5SiB2 system.

  3. Preparation and characterization of MgB2 superconductor

    Indian Academy of Sciences (India)

    2Tata Institute of Fundamental Research, Homi Bhabha Road, Mumbai 400 005, India. Abstract. The MgB2 superconductor, synthesized using solid-state and liquid-phase sintering methods, have been characterized for various properties. The upper critical field, irreversibility line and critical current density have been ...

  4. 26 CFR 48.4161(b)-2 - Meaning of terms.

    Science.gov (United States)

    2010-04-01

    ... EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b)-2 Meaning of terms. (a... with the particular type of arrow shaft. (b) Parts and accessories—(1) In general. “Parts and... attachment to, a bow or arrow of the type described in section 4161(b)(1) and paragraph (a) of this section...

  5. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The

  6. Development of New B2B Venture Corporate Brand Identity

    DEFF Research Database (Denmark)

    Törmälä, Minna; Gyrd-Jones, Richard I.

    2017-01-01

    of interviews and archival data generated during a three-year period to examine the development of corporate brand over time. This study shows that the development of corporate brand identity and the context of the development of new B2B venture are closely intertwined processes and provides a framework...

  7. Microwave absorption studies of MgB 2 superconductor

    Indian Academy of Sciences (India)

    Microwave absorption studies have been carried out on MgB2 superconductor using a standard X-band EPR spectrometer. The modulated low-field microwave absorption signals recorded for polycrystalline (grain size ∼ 10m) samples suggested the absence of weak-link character. The field dependent direct microwave ...

  8. Itinerant magnetism in CeRh3B2

    DEFF Research Database (Denmark)

    Eriksson, Olle; Johansson, Börje; Brooks, M. S. S.

    1989-01-01

    Spin-polarized energy-band calculations, including spin-orbit coupling in the band Hamiltonian, have been performed on CeRh3B2. Good agreement is obtained between theory and experiment concerning the magnetic moment. It is also found that the magnetic moment varies strongly with volume and from...

  9. Insulator layer formation in MgB2 SIS junctions

    International Nuclear Information System (INIS)

    Shimakage, H.; Tsujimoto, K.; Wang, Z.; Tonouchi, M.

    2005-01-01

    The dependence of current-voltage characteristics on thin film deposition conditions was investigated using MgB 2 /AlN/NbN SIS junctions. By increasing the substrate temperature in AlN insulator deposition, the current density decreased and the normal resistance increased. The results indicated that an additional insulator layer between the MgB 2 and AlN formed, either before or during the AlN deposition. The thickness of the additional insulator layer was increased with an increase in the AlN deposition temperature. From the dependence of current density on the thickness of AlN in low temperature depositions, the thickness of the additional insulator layer was estimated to be 1-1.5 nm when the AlN insulator was deposited from 0.14 to 0.7 nm. Moreover, with the current density of MgB 2 /AlN/MgB 2 SIS junctions, further insulator layer formation was confirmed

  10. E-Business Models in B2B: Process Based Categorization and Analysis of B2B Models

    OpenAIRE

    Mahesh S. Raisinghani; Turan Melemez; Lijie Zou; Chris Paslowski; Irma Kimvidze; Susanne Taha; Klaus Simons

    2005-01-01

    The business models in business-to-business (B2B) e-commerce and their effectiveness have been a major topic of research in recent years. Due to the variety of existing models, it seems difficult to find a widely accepted categorization that can be analyzed and assessed. An in-depth study that provides a process-based approach to B2B e-commerce is presented and illustrated with examples from industry. A comparative examination of both the buy and the sell side based on a process-related appro...

  11. Directional crystallization of B4C-NbB2 and B4C-MoB2 eutectic compositions

    International Nuclear Information System (INIS)

    Paderno, Varvara; Paderno, Y.B.; Filippov, Vladimir; Liashchenko, Alfred

    2004-01-01

    We studied the directional crystallization of different compositions in B 4 C-NbB 2 and B 4 C-MoB 2 systems. The eutectic compositions for both systems are evaluated. It is shown that in the first system the rod-like eutectic structure is formed, in second, the 'Chinese hieroglyphics'. In both cases high hardness and high microplasticity are observed, which are much more than for individual component phases. These compositions may be considered as a new kind of self-strengthening composite materials

  12. OsB 2 and RuB 2, ultra-incompressible, hard materials: First-principles electronic structure calculations

    Science.gov (United States)

    Chiodo, S.; Gotsis, H. J.; Russo, N.; Sicilia, E.

    2006-07-01

    Recently it has been reported that osmium diboride has an unusually large bulk modulus combined with high hardness, and consequently is a most interesting candidate as an ultra-incompressible and hard material. The electronic and structural properties of the transition metal diborides OsB 2 and RuB 2 have been calculated within the local density approximation (LDA). It is shown that the high hardness is the result of covalent bonding between transition metal d states and boron p states in the orthorhombic structure.

  13. Friction stir weld assisted diffusion bonding of 5754 aluminum alloy to coated high strength steels

    International Nuclear Information System (INIS)

    Haghshenas, M.; Abdel-Gwad, A.; Omran, A.M.; Gökçe, B.; Sahraeinejad, S.; Gerlich, A.P.

    2014-01-01

    Highlights: • Successful lap joints of Al 5754 sheet to coated DP600 and 22MnB5 steels. • Negligible effect of welding speed on mechanical properties of Al 5754/22MnB5 joints. • Lower strength of Al 5754/22MnB5 joints compared with Al 5754/DP600 joints. - Abstract: In the present paper friction stir-induced diffusion bonding is used for joining sheets of 5754 aluminum alloy to coated high strength steels (DP600 and 22MnB5) by promoting diffusion bonding in an overlap configuration. Mechanical performance and microstructures of joints were analyzed by overlap shear testing, metallography, and X-ray diffraction. Our results show that the strength of joint is dependent upon tool travel speed and the depth of the tool pin relative to the steel surface. The thickness and types of intermetallic compounds formed at the interface play a significant role in achieving a joint with optimum performance. That is, the formation of high aluminum composition intermetallic compounds (i.e. Al 5 Fe 2 ) at the interface of the friction stir lap joint appeared to have a more negative effect on joint strength compared to the presence of high iron composition intermetallic phases (i.e. FeAl). This is in agreement with previously reported findings that FeAl intermetallic can improve the fracture toughness and interface strength in Al/St joints

  14. Evaluation of natural organic matter adsorption on Fe-Al binary oxide: Comparison with single metal oxides.

    Science.gov (United States)

    Kim, Kyung-Jo; Jang, Am

    2017-10-01

    The adsorption characteristics of three types of standard natural organic matter (NOM) on iron-aluminum (Fe-Al) binary oxide (FAO) and heated aluminum oxide (HAO) under natural surface water condition were investigated using various adsorption isotherms and kinetic models. FAO was synthesized by Fe oxide and Al oxide, mixed using the sol-gel hydrothermal method, and aluminum sulfate was used to make HAO. The amount of adsorbed NOM was increased to 79.6 mg g -1 for humic acid (HA), 101.1 mg g -1 for sodium alginate (SA) in the FAO, but the maximum adsorption capacity of bovine serum albumin (BSA) (461.3 mg g -1 ) was identified on the HAO. The adsorption of HA, BSA, and SA dramatically increased (>70%) on FAO in 5 min and HA was significantly removed (90%) among the three NOM. Mutual interaction among the adsorbed NOM (BSA) occurred on the HAO surface during adsorption due to formation of monolayer by protein molecules at neutral pH. The pseudo second order clearly represented the adsorption kinetics for both adsorbents. The equilibrium isotherm data of FAO was better exhibited by the Langmuir isotherm model than by the Freundlich isotherm, but HAO was a slightly non-linear Langmuir type. Also, the free energy, enthalpy, and entropy of adsorption were determined from the thermodynamic experiments. Adsorption on FAO was spontaneous and an exothermic process. Fluorescence excitation-emission matrix (FEEM) spectra were used to elucidate the variation in organic components. The results obtained suggests that the significant changes in the surface property of the adsorbent (large surface area, increased crystalline intensity, and fine particle size) were effectively determined by the Fe-synthesized Al oxide mixed using the sol-gel hydrothermal method. The results also suggest that the changes enhanced the adsorption capacity, whereby three NOM were notably removed on FAO regardless of NOM characteristics (hydrophobic and hydrophilic). Copyright © 2017 Elsevier

  15. Thermoelastic properties of ScB2, TiB2, YB4 and HoB4

    DEFF Research Database (Denmark)

    Waskowska, A.; Gerward, L.; Staun Olsen, J.

    2011-01-01

    (4)GPa). No pressure-induced phase transformations are observed in any of the above borides up to about 20GPa. A continuous temperature-driven orthorhombic distortion is observed for HoB4 below 285K. Values of the thermal expansion coefficient are reported for ScB2 and HoB4 at 293, 200 and 100K...

  16. Microstructure and Properties of (TiB2 + NiTi)/Ti Composite Coating Fabricated by Laser Cladding

    Science.gov (United States)

    Lin, Yinghua; Lei, Yongping; Fu, Hanguang; Lin, Jian

    2015-10-01

    Agglomerated TiB2 particle and network-like structure-reinforced titanium matrix composite coatings were prepared by laser cladding of the Ni + TiB2 + Ti preplaced powders on Ti-6Al-4V alloy. The network-like structure mainly consisted of NiTi and Ni3Ti. Through the experiment, it was found that the size of agglomerated particle gradually decreased with the increase of Ti content, but the number of the network-like structure first increased and then disappeared. In-situ reaction competition mechanism and the formation of network-like structure were discussed. The average micro-hardness gradually decreased with the increase of Ti content, but the average fracture toughness gradually increased. Meanwhile, the wear resistance of the coatings is higher than that of the substrate, but the wear loss of the coatings is gradually increased with the increase of Ti content.

  17. Mechanical properties and bending strain effect on Cu-Ni sheathed MgB2 superconducting tape

    International Nuclear Information System (INIS)

    Fu, Minyi; Chen, Jiangxing; Jiao, Zhengkuan; Kumakura, H.; Togano, K.; Ding, Liren; Zhang, Yong; Chen, Zhiyou; Han, Hanmin; Chen, Jinglin

    2004-01-01

    The Young's modulus (E) of Cu-Ni sheathed MgB 2 monofilament tape was measured using electric method. It is about 8.05 x 10 10 Pa, the same order of Cu and its alloys. We found that the lower E value of the MgB 2 component seemed to relate to the lower filament density. The benefits of pre-compression in filaments were discussed in terms of improving stress distribution in the wires and tapes during winding and operation of superconducting magnets. The magnetic field dependence of J c was investigated on the sample subjected to various strain levels through bending with different radii at 4.2 K

  18. Electronic and elastic properties of new semiconducting oP12-type RuB2 and OsB2

    International Nuclear Information System (INIS)

    Hao Xianfeng; Xu Yuanhui; Gao Faming

    2011-01-01

    Using first-principles total energy calculations we investigate the structural, elastic and electronic properties of new hypothetical oP 12 -type phase RuB 2 and OsB 2 . The calculations indicate that the oP 12 -type phase RuB 2 and OsB 2 are thermodynamically and mechanically stable. Remarkably, the new phases RuB 2 and OsB 2 are predicted to be semiconductors, and the appearance of band gaps is ascribed to the enhanced B-B covalent hybridization. Compared to metallic oP 6 -type RuB 2 and OsB 2 phases, the new phases possess similar mechanical properties and hardness. The combination of the probability of tunable electronic properties, strong stiffness and high hardness make RuB 2 and OsB 2 attractive and interesting for advanced applications.

  19. Electronic and elastic properties of new semiconducting oP(12)-type RuB(2) and OsB(2).

    Science.gov (United States)

    Hao, Xianfeng; Xu, Yuanhui; Gao, Faming

    2011-03-30

    Using first-principles total energy calculations we investigate the structural, elastic and electronic properties of new hypothetical oP(12)-type phase RuB(2) and OsB(2). The calculations indicate that the oP(12)-type phase RuB(2) and OsB(2) are thermodynamically and mechanically stable. Remarkably, the new phases RuB(2) and OsB(2) are predicted to be semiconductors, and the appearance of band gaps is ascribed to the enhanced B-B covalent hybridization. Compared to metallic oP(6)-type RuB(2) and OsB(2) phases, the new phases possess similar mechanical properties and hardness. The combination of the probability of tunable electronic properties, strong stiffness and high hardness make RuB(2) and OsB(2) attractive and interesting for advanced applications. © 2011 IOP Publishing Ltd

  20. Active Protection of an MgB2 Test Coil

    Science.gov (United States)

    Park, Dong Keun; Hahn, Seungyong; Bascuñán, Juan; Iwasa, Yukikazu

    2011-01-01

    This paper presents results of a study, experimental and computational, of a detect-and-activate-the-heater protection technique applied to a magnesium diboride (MgB2) test coil operated in semi-persistent mode. The test coil with a winding ID of 25 cm and wound with ~500-m long reacted MgB2 wire was operated at 4.2 K immersed in a bath of liquid helium. In this active technique, upon the initiation of a “hot spot” of a length ~10 cm, induced by a “quench heater,” a “protection heater” (PH) of ~600-cm long planted within the test coil is activated. The normal zone created by the PH is large enough to absorb the test coil’s entire initial stored energy and still keeps the peak temperature within the winding below ~260 K. PMID:22081754

  1. Observation of pseudogap in MgB2

    Science.gov (United States)

    Patil, S.; Medicherla, V. R. R.; Ali, Khadiza; Singh, R. S.; Manfrinetti, P.; Wrubl, F.; Dhar, S. K.; Maiti, Kalobaran

    2017-11-01

    We investigate the electronic structure of a specially prepared highly dense conventional high temperature superconductor, MgB2, employing high resolution photoemission spectroscopy. The spectral evolution close to the Fermi energy is commensurate to BCS descriptions as expected. However, the spectra in the wider energy range reveal the emergence of a pseudogap much above the superconducting transition temperature indicating an apparent departure from the BCS scenario. The energy scale of the pseudogap is comparable to the energy of the E2g phonon mode responsible for superconductivity in MgB2 and the pseudogap can be attributed to the effect of electron-phonon coupling on the electronic structure. These results reveal a scenario of the emergence of the superconducting gap within an electron-phonon coupling induced pseudogap and have significant implications in the study of high temperature superconductors.

  2. Investigation of pinning in MgB2 superconductors

    International Nuclear Information System (INIS)

    Mohammad, S.; Reissner, M.; Steiner, W.; Bauer, E.; Giovannini, M.

    2006-01-01

    Full text: The pinning behaviour of bulk MgB 2 superconductors is peculiar in many respects. Pinning seems to be stronger than in classical high T C materials and there seems to be no weak link problem in these compounds, giving hope to produce bulk samples and wires with current densities appropriate for technical applications. But, although many studies concerning the pinning behaviour in this compound appeared in recent years, the results are still contradictory. In the present work we present results of an investigation of the pinning behaviour by magnetic relaxation measurements of three MgB 2 samples: a pure one, a sample with 8 at% Al substitution and a sample with 10 wt% of SiC admixture. A comparison of different analyses methods is given. (author)

  3. Electrochemical Impedance Spectroscopy Of Metal Alloys

    Science.gov (United States)

    Macdowell, L. G.; Calle, L. M.

    1993-01-01

    Report describes use of electrochemical impedance spectroscopy (EIS) to investigate resistances of 19 alloys to corrosion under conditions similar to those of corrosive, chloride-laden seaside environment of Space Transportation System launch site. Alloys investigated: Hastelloy C-4, C-22, C-276, and B-2; Inconel(R) 600, 625, and 825; Inco(R) G-3; Monel 400; Zirconium 702; Stainless Steel 304L, 304LN, 316L, 317L, and 904L; 20Cb-3; 7Mo+N; ES2205; and Ferralium 255. Results suggest electrochemical impedance spectroscopy used to predict corrosion performances of metal alloys.

  4. VANADIUM ALLOYS

    Science.gov (United States)

    Smith, K.F.; Van Thyne, R.J.

    1959-05-12

    This patent deals with vanadium based ternary alloys useful as fuel element jackets. According to the invention the ternary vanadium alloys, prepared in an arc furnace, contain from 2.5 to 15% by weight titanium and from 0.5 to 10% by weight niobium. Characteristics of these alloys are good thermal conductivity, low neutron capture cross section, good corrosion resistance, good welding and fabricating properties, low expansion coefficient, and high strength.

  5. Comparison of three Ni-Hard I alloys

    Energy Technology Data Exchange (ETDEWEB)

    Dogan, Omer N.; Hawk, Jeffrey A.; Rice, J. (Texaloy Foundry Co., Inc., Floresville, Texas)

    2004-09-01

    This report documents the results of an investigation which was undertaken to reveal the similarities and differences in the mechanical properties and microstructural characteristics of three Ni-Hard I alloys. One alloy (B1) is ASTM A532 class IA Ni-Hard containing 4.2 wt. pct. Ni. The second alloy (B2) is similar to B1 but higher in Cr, Si, and Mo. The third alloy (T1) also falls in the same ASTM specification, but it contains 3.3 wt. pct. Ni. The alloys were evaluated in both as-cast and stress-relieved conditions except for B2, which was evaluated in the stress-relieved condition only. While the matrix of the high Ni alloys is composed of austenite and martensite in both conditions, the matrix of the low Ni alloy consists of a considerable amount of bainite, in addition to the martensite and the retained austenite in as cast condition, and primarily bainite, with some retained austenite, in the stress relieved condition. It was found that the stress relieving treatment does not change the tensile strength of the high Ni alloy. Both the as cast and stress relieved high Ni alloys had a tensile strength of about 350 MPa. On the other hand, the tensile strength of the low Ni alloy increased from 340 MPa to 452 MPa with the stress relieving treatment. There was no significant difference in the wear resistance of these alloys in both as-cast and stressrelieved conditions.

  6. COSIMA B2B - sales automation for e-procurement

    OpenAIRE

    Döring, Sven

    2004-01-01

    COSIMA B2B - sales automation for e-procurement / W. Kießling, S. Fischer, S. Döring. - In: International Conference on E-Commerce Technology : Proceedings / IEEE International Conference on E-Commerce Technology, CEC 2004 : 6 - 9 July 2004, San Diego, California / ed. by Martin Bichler ... - Los Alamitos, Calif. [u.a.] : IEEE Computer Society, 2004. - S. 59-68

  7. Customer satisfaction in B2B cloud services

    OpenAIRE

    Turunen, Helinä

    2013-01-01

    Tutkimuksen tavoitteena on kirjallisuuskatsauksen kautta esitellä B2B-pilvipalveluiden asiakastyytyväisyyteen vaikuttavia seikkoja, ja kuinka näitä seikkoja tulisi ottaa huomioon asiakastyytyväisyyden parantamisessa. Tässä tutkimuksessa verkkopohjaiseen liiketoimintaan liittyvää asiakastyytyväisyyden tutkimusta käytettiin pohjana etsiessä asiakastyytyväisyyteen vaikuttavia seikkoja pilvipalveluissa. Tutkimuksessa vertaillaan asiakastyytyväisyyteen vaikuttavia seikkoja vertailemalla tyytyväisy...

  8. Mass Customized Technical Textiles in the B2B Sector

    Science.gov (United States)

    Gebhardt, R.; Barteld, M.; Grafmüller, L.; Mosig, T.; Weiß, M.

    2017-10-01

    Mass Customization is a great opportunity for textile companies for both staying competitive in high-wage countries and offering inexpensive, customized products. Within the area of Technical Textiles, this study focuses on the B2B sector and shows the status quo, potentials and strengths. Both management and technological issues are addressed. For the former, business models and the value co-creation process are dealt with, for the latter, the focus is on modelling.

  9. Superconducting and Normal State Properties of OsB2*

    Science.gov (United States)

    Singh, Yogesh; Niazi, A.; Zong, X.; Suh, B. J.; Vannette, M. W.; Prozorov, R.; Johnston, D. C.

    2007-03-01

    OsB2 is a layered superhard metallic material that was found to superconduct below Tc= 2.1 K.^1 We report the first detailed measurements of the static and dynamic magnetic susceptibilities χ, electrical resistivity, heat capacity Cp, penetration depth, and ^11B NMR on OsB2 to characterize its superconducting and normal state properties. The results confirm that OsB2 is a bulk superconductor below Tc= 2.1 K@. Its properties can be described by a close to weak-coupling s-wave BCS model with an electron-phonon coupling constant λ= 0.4--0.5, δ(0)/(kBTc) 1.9, a small Ginzburg-Landau parameter κ of order 5 or less, and a small zero-temperature critical magnetic field of roughly 500 Oe. The ^11B NMR measurements in the normal state show a nuclear spin-lattice relaxation time T1= 2.1 s at room temperature and a Korringa law with T1T = 610 s.K at lower T, and a correspondingly small T-independent Knight shift. These results indicate a small s character of the conduction electron wave function at the B site at the Fermi level. Our results will be compared to corresponding data for MgB2.1. J. K. Vandenberg et al., Mater. Res. Bull. 10, 889 (1975).^*Supported by the USDOE under Contract No. W-7405-Eng-82. Permanent address: Dept. Phys., The Catholic Univ. Korea.

  10. $1$-string $B_2$-VPG representation of planar graphs

    Directory of Open Access Journals (Sweden)

    Therese Biedl

    2016-09-01

    Full Text Available In this paper, we prove that every planar graph has a 1-string $B_2$-VPG representation—a string representation using paths in a rectangular grid that contain at most two bends. Furthermore, two paths representing vertices $u,v$ intersect precisely once whenever there is an edge between $u$ and $v$. We also show that only a subset of the possible curve shapes is necessary to represent $4$-connected planar graphs.

  11. Effect of Aluminum and Silicon on Atmospheric Corrosion of Low-alloying Steel under Containing NaHSO3 Wet/dry Environment

    International Nuclear Information System (INIS)

    Xinhua, Chen; Junhua, Dong; Enhou, Han; Wei, Ke

    2008-01-01

    The atmospheric corrosion performance of Al-alloying Si-alloying and Al-Si-alloying steel were studied by wet/dry cyclic corrosion tests (CCT) at 30 .deg. C and 60% relative humidity (RH). The corrosion electrolyte used for CCT was 0.052 wt% NaHSO 3 (pH∼4) solution. The result of gravimetry demonstrated that Al-Si-bearing steels showed lower corrosion resistance than other rusted steels. But the rusted 0.7%Si-alloying steel showed a better corrosion resistance than rusted mild steel. Polarization curves demonstrated that Al-/Si-alloying and Al-Si-alloying improved the rest potential of steel at the initial stage: and accelerated the cathodic reduction and anodic dissolution after a rust layer formed on the surfaces of steels. XRD results showed that Al-Si-alloying decreased the volume fraction of Fe 3 O 4 and α-FeOOH. The recycle of acid accelerated the corrosion of steel at the initial stage. After the rust layer formed on the steel, the leak of rust destabilized the rust layer due to the dissolution of compound containing Al (such as FeAl 2 O 4 , (Fe, Si) 2 (Fe, Al)O 4 ). Al-Si-alloying is hence not suitable for improving the anti-corrosion resistance of steel in industrial atmosphere

  12. Microstructure and properties of TiB2-TiB reinforced titanium matrix composite coating by laser cladding

    Science.gov (United States)

    Lin, Yinghua; Yao, Jianhua; Lei, Yongping; Fu, Hanguang; Wang, Liang

    2016-11-01

    TiB2 particle and TiB short fiber reinforced titanium matrix composite coatings were prepared utilizing in situ synthesized technique by laser cladding on the surface of Ti6Al4V alloy. Through the experiment, it was found that the surface of the single-track coatings appeared in the depression, but it can be improved by laser track overlapping. With the increase of laser power density, the amount of TiB short fiber was increased, and the distribution of TiB2 and TiB became more uniform from the top to bottom. The micro-hardness of TiB2/TiB coating showed a gradient decreasing trend, and the average micro-hardness of the coatings was two-fold higher than that of the substrate. Due to the strengthening effect of TiB2 particle and TiB short fiber, the wear volume loss of the center of the coating was approximately 30% less than that of the Ti-6Al-4V substrate, and the wear mechanism of the coating was mild fatigue particle detachment.

  13. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  14. Phase 1 Final Technical Report - MgB2 Synthesis: Pushing to High Field Performance

    International Nuclear Information System (INIS)

    Bhatia, Mohit; McIntyre, Peter

    2009-01-01

    Accelerator Technology Corp. (ATC) has successfully completed its Phase 1 effort to develop rf plasma torch synthesis of MgB2 superconducting powder. The overall objective is to de-velop a way to introduce homogeneous alloying of C and SiC impurities into phase-pure MgB2. Several groups have attained remarkable benefits from such alloying in raising the upper critical field Hc2 from ∼14 T to ∼30 T (bulk) and ∼50 T (thin films). But no one has succeeded in pro-ducing that benefit homogeneously, so that current transport in a practical powder-in-tube (PIT) conductor is largely the same as without the alloying. ATC has conceived the possibility of attaining such homogeneity by passing aerosol suspen-sions of reactant powders through an rf plasma torch, with each reactant transported on a stream-line that heats it to an optimum temperature for the synthesis reaction. This procedure would uniquely access non-equilibrium kinetics for the synthesis reaction, and would provide the possi-bility to separately control the temperature and stoichiometry of each reactant as it enters the mixing region where synthesis occurs. It also facilitates the introduction of seed particles (e.g. nanoscale SiC) to dramatically enhance the rate of the synthesis reaction compared to gas-phase synthesis in rf plasma reported by Canfield and others. During the Phase 1 effort ATC commissioned its 60 kW 5 MHz rf source for a manufactur-ing-scale rf plasma torch. This effort required repair of numerous elements, integration of cooling and input circuits, and tuning of the load characteristics. The effort was successful, and the source has now been tested to ∼full power. Also in the Phase 1 effort we encountered a subsidiary but very important problem: the world is running out of the only present supply of phase-pure amorphous boron. The starting boron powder must be in the amorphous phase in order for the synthesis reaction to produce phase-pure MgB2. Even small contamination with

  15. Development of 9Al2O3{center_dot}2B2O3 whiskers reinforced piston by squeeze casting. Manufacturing process and characteristics of whiskers preform; Squeeze cast ho ni yoru 9Al2O3{center_dot}2B2O3 whisker kyoka piston no kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    Yamauchi, T; Suzuki, M; Takahashi, M; Takada, I; Toda, M [Suzuki Motor Co. Ltd., Shizuoka (Japan)

    1997-10-01

    The properties of 9Al2O3 {center_dot} 2B2O3 whisker reinforced aluminum alloy is excellent compared with conventional material at elevated temperatures. 9Al2O3 {center_dot} 2B2O3 whisker reinforced aluminum alloy was applied to the piston head of two cycle engines. This piston was produced by a squeeze casting process with the granulated whiskers preform which was infiltrated by a molten aluminum alloy under high pressure. Since the permeability of the granulated whiskers preform is larger than that of the uniform preform in which whiskers are distributed randomly and uniformly, it became possible to suppress the preform deformation using the developed preform. 7 refs., 8 figs., 2 tabs.

  16. MgB2 and Mg1-xAlxB2 single crystals: high pressure growth and physical properties

    International Nuclear Information System (INIS)

    Karpinski, J.; Kazakov, S.M.; Jun, J.; Zhigadlo, N.D.; Angst, M.; Puzniak, R.; Wisniewski, A.

    2004-01-01

    Single crystals of MgB 2 have been grown with a high pressure cubic anvil technique. They grow via the peritectic decomposition of the MgNB 9 ternary nitride. The crystals are of a size up to 2 x 1 x 0.1 mm 3 with a weight up to 230 μg. Typically they have transition temperatures between 38 and 38.6 K with a width of 0.3-0.5 K. Investigations of the P-T phase diagram prove that the MgB 2 phase is stable at least up to 2190 deg. C at high hydrostatic pressure in the presence of Mg vapor under high pressure. Substitution of aluminum for magnesium in single crystals leads to stepwise decrease of T c . This indicates a possible appearance of superstructures or phases with different T c 's. The upper critical field decreases with Al doping

  17. Layered Composite of TiC-TiB2 to Ti-6Al-4V in Graded Composition by Combustion Synthesis in High-gravity Field

    International Nuclear Information System (INIS)

    Huang Xuegang; Zhao Zhongmin; Zhang Long

    2013-01-01

    By taking combustion synthesis to prepare solidified TiB 2 matrix ceramic in high-gravity field, the layered composite of TiC-TiB 2 ceramic to Ti-6Al-4V substrate in graded composition was achieved. XRD, FESEM and EDS results showed that the bulk full-density solidified TiC-TiB 2 composite was composed of fine TiB 2 platelets, TiC irregular grains, a few of α-Al 2 O 3 inclusions and Cr alloy phases, and α'-Ti phases alternating with Ti-enriched carbides constituted the matrix of the joint in which fine TiB platelets were embedded, whereas some C, B atoms were also detected at the heat-affected zone of Ti-6A1-4V substrate. The layered composite of the solidified ceramic to Ti-6Al-4V substrate in graded composition with continuous microstructure was considered a result of fused joint and inter-diffusion between liquid ceramic and surface-molten Ti alloy, followed by TiB 2 -Ti peritectic reaction and subsequent eutectic reaction in TiC-TiB-Ti ternary system.

  18. Nonswelling alloy

    Science.gov (United States)

    Harkness, S.D.

    1975-12-23

    An aluminum alloy containing one weight percent copper has been found to be resistant to void formation and thus is useful in all nuclear applications which currently use aluminum or other aluminum alloys in reactor positions which are subjected to high neutron doses.

  19. Nonswelling alloy

    International Nuclear Information System (INIS)

    Harkness, S.D.

    1975-01-01

    An aluminum alloy containing one weight percent copper has been found to be resistant to void formation and thus is useful in all nuclear applications which currently use aluminum or other aluminum alloys in reactor positions which are subjected to high neutron doses

  20. Structural evolution of derived species on FeAl surface exposed to a N2 + SO2 atmosphere: Experimental and theoretical study

    International Nuclear Information System (INIS)

    Espinosa-Medina, M.A.; Liu, H.B.; Canizal, G.; Ascencio, J.A.

    2007-01-01

    Characterizations were performed by scanning electron microscopy analysis with energy dispersive spectrometry and scanning probe microscope for structural evolution of derived species on FeAl surface exposed to a N 2 + SO 2 atmosphere at high temperature. First principle calculations were also employed in order to clarify the formation of new product on the surface and its mechanism. The results demonstrate that the tendency of the structure with oxygen atoms involve a stronger interaction and lower energy to be formed with the surface and consequently the possible production of oxide-species is more probable and multiple aggregates with different shapes can be generated for the temperatures of 625 and 700 deg. C, with no preferential crystal habit. Sample treated at 775 deg. C denotes the production of hexagonal crystals, which is externally characterized by polyhedrons growing in axial direction as fibbers with flat faces that match with the alumina

  1. Evidence of formation of trans-Fe nuclei in Fe+Al interactions at 1.88 GeV using Cr-39 (DOP) detector

    International Nuclear Information System (INIS)

    Ganguly, A.K.; Chaudhuri, Biva

    1991-01-01

    A wedge-shaped aluminium target was irradiated with 1.88 A GeV Fe beam to study various features of Fe+Al nucleus-nucleus interaction and their dependence on target thickness. The detector employed was a stack of CR-39 (DOP) and Lexan plastic nuclear track detectors which have a characteristically high charge resolution property. To distinguish the actual events from background and buildup a selection criteria for easy and unambiguous rejection of unwanted interfering events the stack of detectors was placed at an angle of 60deg with respect to the beam. After irradiation the CR-39 (DOP) detectors were etched and the elliptic etch-pit diameters were scanned. The diameter distribution of the elliptic etch-pits exhibits the existence of trans Fe nuclei. The production of trans Fe fraction is seen to increase with the thickness of the aluminium target. The possible causes of this increase are being investigated. (author). 12 refs., 4 figs

  2. Suppression of steam explosions in tin and Fe-Al2O3 melts by increasing the viscosity of the coolant

    International Nuclear Information System (INIS)

    Nelson, L.S.; Guay, K.P.

    1986-01-01

    Steam explosions, energetic interactions that sometimes occur when a melt and water come together, can be suppressed by increasing the viscosity of the aqueous phase. This has been demonstrated both in the laboratory with drops of molten tin released into aqueous glycerol or cellulose gum solutions, and in one field-scale experiment where 50 kg of molten Fe-Al 2 O 3 was released into a cellulose gum solution; vigorous spontaneous explosions occurred in both situations when the cold liquid was water alone. There is a threshold solution viscosity near 0.015 Pa s, above which spontaneous tin drop explosions no longer occur. Increase of coolant viscosity might prevent injury to workers and damage to equipment in industrial processes where melts are normally handled near cooling water. (author)

  3. Enhancement of bradykinin and resensitization of its B2 receptor.

    Science.gov (United States)

    Marcic, B; Deddish, P A; Jackman, H L; Erdös, E G

    1999-03-01

    We studied the enhancement of the effects of bradykinin B2 receptor agonists by agents that react with active centers of angiotensin-converting enzyme (ACE) independent of enzymatic inactivation. The potentiation and the desensitization and resensitization of B2 receptor were assessed by measuring [3H]arachidonic acid release and [Ca2+]i mobilization in Chinese hamster ovary cells transfected to express human ACE and B2 receptor, or in endothelial cells with constitutively expressed ACE and receptor. Administration of bradykinin or its ACE-resistant analogue desensitized the receptor, but it was resensitized (arachidonic acid release or [Ca2+]i mobilization) by agents such as enalaprilat (1 micromol/L). Enalaprilat was inactive in the absence of ACE expression. La3+ (100 micromol/L) inhibited the apparent resensitization, probably by blocking the entry of extracellular calcium. Enalaprilat resensitized the receptor via ACE to release arachidonic acid by bradykinin at a lower concentration (5 nmol/L) than required to mobilize [Ca2+]i (1 micromol/L). Monoclonal antibodies inhibiting the ACE N-domain active center and polyclonal antiserum potentiated bradykinin. The snake venom peptide BPP5a and metabolites of angiotensin and bradykinin (angiotensin-[1-9], angiotensin-[1-7], bradykinin-[1-8]; 1 micromol/L) enhanced arachidonic acid release by bradykinin. Angiotensin-(1-9) and -(1-7) also resensitized the receptor. Enalaprilat potentiated the bradykinin effect in cells expressing a mutant ACE with a single N-domain active site. Agents that reacted with a single active site, on the N-domain or on the C-domain, potentiated bradykinin not by blocking its inactivation but by inducing crosstalk between ACE and the receptor. Enalaprilat enhanced signaling via ACE by Galphai in lower concentration than by Galphaq-coupled receptor.

  4. On heavy carbon doping of MgB2

    International Nuclear Information System (INIS)

    Kasinathan, Deepa; Lee, K.-W.; Pickett, W.E.

    2005-01-01

    Heavy carbon doping of MgB 2 is studied by first principles electronic structure studies of two types, an ordered supercell (Mg(B 1-x C x ) 2 , x 0.0833) and also the coherent potential approximation method that incorporates effects of B-C disorder. For the ordered model, the twofold degenerate σ-bands that are the basis of the high temperature superconductivity are split by 60 meV (i.e. 7 meV/% C) and the σ Fermi cylinders contain 0.070 holes/cell, compared to 0.11 for MgB 2 . A virtual crystal treatment tends to overestimate the rate at which σ holes are filled by substitutional carbon. The coherent potential approximation (CPA) calculations give the same rate of band filling as the supercell method. The occupied local density of states of C is almost identical to that of B in the upper 2 eV of the valence bands, but in the range -8 eV to -2 eV, C has a considerably larger density of states. The calculations indicate that the σ Fermi surface cylinders pinch off at the zone center only above the maximum C concentration x ∼ 0.10. These results indicate that Mg(B 1-x C x ) 2 as well as Mg 1-x Al x B 2 is a good system in which to study the evolution of the unusual electron-phonon coupling character and strength as the crucial σ hole states are filled

  5. B2B-verkkokaupan markkinointiviestintäsuunnitelma

    OpenAIRE

    Luoma, Hanna

    2015-01-01

    Opinnäytetyön aiheena oli luoda markkinointiviestintäsuunnitelma Yritys Oy:n kehitteillä olevalle verkkokaupalle. Työn tavoitteena oli markkinointiviestintäsuunnitelman avulla selvittää miten Yritys Oy:n B2B-verkkokauppa saadaan osaksi myyntitoimia ja miten se mahdollisimman tehokkaasti tuodaan asiakkaiden tietoisuuteen. Yritys Oy on vuonna 2003 perustettu perheyritys, jonka toiminta on kiinnitystekniikan tukkumyynti alan ammattilaisille. Yritys Oy:llä on useampi toimipiste ympäri Suomea...

  6. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  7. Properties of hot pressed MgB2/Ti tapes

    International Nuclear Information System (INIS)

    Kovac, P.; Husek, I.; Melisek, T.; Fedor, J.; Cambel, V.; Morawski, A.; Kario, A.

    2009-01-01

    Hot axial and hot isostatic pressing was applied for single-core MgB 2 /Ti tapes. Differences in transport current density, n-exponents and critical current anisotropy are discussed and related to the grain connectivity influenced by pressing. The magnetic Hall probe scanning measurements allowed observing the isolated regions for axially hot pressed sample attributed to the longitudinally oriented cracks introduced by pressing. The highest current densities were measured for the tape subjected to hot isostatic pressing due to improved connectivity.

  8. Specific heat of MgB_2 after irradiation

    OpenAIRE

    Wang, Yuxing; Bouquet, Frederic; Sheikin, Ilya; Toulemonde, Pierre; Revaz, Bernard; Eisterer, Michael; Weber, Harald W.; Hinderer, Joerg; Junod, Alain

    2002-01-01

    We studied the effect of disorder on the superconducting properties of polycrystalline MgB_2 by specific-heat measurements. In the pristine state, these measurements give a bulk confirmation of the presence of two superconducting gaps with 2 Delta 0 / k_B T_c = 1.3 and 3.9 with nearly equal weights. The scattering introduced by irradiation suppresses T_c and tends to average the two gaps although less than predicted by theory. We also found that by a suitable irradiation process by fast neutr...

  9. Bu-2470, a new peptide antibiotic complex. II. Structure determination of Bu-2470 A, B1, B2a and B2b.

    Science.gov (United States)

    Sugawara, K; Yonemoto, T; Konishi, M; Matsumoto, K; Miyaki, T; Kawaguchi, H

    1983-06-01

    The structures of Bu-2470 A, B1, B2a, and B2b have been determined. Bu-2470 A is a simple octapeptide having no fatty acid moiety, while Bu-2470 B1, B2a and B2b are octapeptides that have been acylated with a beta-hydroxy C11 or C10 fatty acid. The octapeptide structure of Bu-2470 components was found identical with that of octapeptin C1, hence generic names of octapeptin C0, C2, C3 and C4 are proposed for Bu-2470 A, B1, B2a and B2b, respectively.

  10. The purification step is not crucial in EIA measurements of thromboxane B2 and 11-dehydrothromboxane B2 in human plasma.

    Science.gov (United States)

    Sadilkova, Lenka; Paluch, Zoltan; Mottlova, Jirina; Bednar, Frantisek; Alusik, Stefan

    2012-01-01

    Thromboxane B2 (TxB2) and particularly 11-dehydrothromboxane B2 (11-dTxB2) are widely used as prognostic risk markers of platelet activation in cardiovascular diseases. The main errors in TxB2 and 11-dTxB2 determination include either low concentrations of circulating TxB2 (1 - 2 pg/mL) and 11-dTxB2 (0.9 - 4.3 pg/mL) or rather high transiency (mean TxB2 half-life is approximately 5 minutes) as well as an incorrect pre-analytical phase set up. The aim of this study was to investigate the impact of a widely used purification step on the results of enzyme immunosorbent assay (EIA)--based measurement of the two selected thromboxanes. For the purpose of this study, 20 plasma samples (10 healthy donors, 10 patients under treatment with acetylsalicylic acid) were screened for TxB2 and 11-dTxB2 concentrations using commercial competitive EIA kits (Cayman Chemicals, Tallinn, Estonia; Neogen, Lexington, KY, USA) with or without the introduction of the purification procedure. The purification step does not significantly affect the results of EIA measurements of the two of TxA2 metabolites (TxB2, 11-dTxB2) in human plasma. The levels of TxB2 and 11-dTxB2 determined in the plasma samples were not significantly changed (p < 0.05) when the purification step was omitted compared to the purified samples. This study establishes a protocol allowing for reliable and reproducible plasma TxB2 and 11-dTxB2 EIA measurement for routine basic screening of platelet function.

  11. MgB2-based superconductors for fault current limiters

    Science.gov (United States)

    Sokolovsky, V.; Prikhna, T.; Meerovich, V.; Eisterer, M.; Goldacker, W.; Kozyrev, A.; Weber, H. W.; Shapovalov, A.; Sverdun, V.; Moshchil, V.

    2017-02-01

    A promising solution of the fault current problem in power systems is the application of fast-operating nonlinear superconducting fault current limiters (SFCLs) with the capability of rapidly increasing their impedance, and thus limiting high fault currents. We report the results of experiments with models of inductive (transformer type) SFCLs based on the ring-shaped bulk MgB2 prepared under high quasihydrostatic pressure (2 GPa) and by hot pressing technique (30 MPa). It was shown that the SFCLs meet the main requirements to fault current limiters: they possess low impedance in the nominal regime of the protected circuit and can fast increase their impedance limiting both the transient and the steady-state fault currents. The study of quenching currents of MgB2 rings (SFCL activation current) and AC losses in the rings shows that the quenching current density and critical current density determined from AC losses can be 10-20 times less than the critical current determined from the magnetization experiments.

  12. Magnesium diboride(MgB2) wires for applications

    International Nuclear Information System (INIS)

    Patel, Dipak; Kim, Jung Ho

    2016-01-01

    Field and temperature dependence of the critical current density, Jc, were measured for both un-doped and carbon doped MgB 2 /Nb/Monel wires manufactured by Hyper Tech Research, Inc. In particular, carbon incorporation into the MgB 2 structure using malic acid additive and a chemical solution method can be advantageous because of the highly uniform mixing between the carbon and boron powders. At 4.2 K and 10 T, Jc was estimated to be 25,000 - 25,300 Acm -2 for the wire sintered at 600 degrees C for 4 hours. The irreversibility field, Birr, of the malic acid doped wire was approximately 21.0 - 21.8 T, as obtained from a linear extrapolation of the J-B characteristic. Interestingly enough, the Jc of the malic acid doped sample exceeds 10 5 Acm -2 at 6 T and 4.2 K, which is comparable to that of commercial Nb-Ti wires

  13. USING UML SCENARIOS IN B2B SYSTEMS

    Directory of Open Access Journals (Sweden)

    A. Jakimi

    2010-05-01

    Full Text Available Scenarios has become a popular technique for requirements elicitation and specification building. Since scenarios capture only partial descriptions of the system behavior, an approach for scenario composition and/or integration is needed to produce more complete specifications. The Unified Modeling Language (UML, which has become a standard notation for object-oriented modeling, provides a suitable framework for scenario acquisition using Use Case diagrams and Sequence or Collaboration diagrams. In this paper, we suggest an algorithmic and tool support for composing and integrating scenarios that are represented in form of sequence diagrams. We suggest four operators (;: sequential operator, ||: concurrent operator, ?: conditional operator and  * :iteration operator to compose a set of scenarios that describe a use case of a given system. In this paper, we suggest also to apply the scenario approach to B2B systems (Business to Business. We propose to develop B2B systems as a three activities process deriving formal specifications and code skeletons from UML scenarios. Activities of this proposed process are generally automatic and are supported by a set of developed algorithms and tools.

  14. B2FH, the Cosmic Microwave Background and Cosmology*

    Science.gov (United States)

    Burbidge, G.

    In this talk I shall start by describing how we set about and carried out the work that led to the publication of Burbidge et al. (1957, hereafter B2FH). I then shall try and relate this work and the circumstances that surrounded it to the larger problem of the origin and formation of the universe. Here it is necessary to look back at the way that ideas developed and how, in many situations, astronomers went astray. Of course this is a personal view, though I very strongly believe that if he were still here, it is the approach that Fred Hoyle would take. I start by describing the problems originally encountered by Gamow and his associates in trying to decide where the helium was made. This leads me to a modern discussion of the origin of 2D, 3He, 4He and 7Li, originally described by B2FH as due to the x-process. While it is generally argued, following Gamow, Alpher, and Herman, that these isotopes were synthesised in a big bang I shall show that it is equally likely that these isotopes were made in active galactic nuclei, as was the cosmic microwave background (CMB), in a cyclic universe model. The key piece of observational evidence is that the amount of energy released in the conversion of hydrogen to helium in the universe is very close to the energy carried by the CMB, namely ~4.5 × 10-13 erg cm-3.

  15. Vortex lattice structures in YNi2B2C

    International Nuclear Information System (INIS)

    Yethiraj, M.; Paul, D.M.; Tomy, C.V.; Forgan, E.M.

    1997-01-01

    The authors observe a flux lattice with square symmetry in the superconductor YNi 2 B 2 C when the applied field is parallel to the c-axis of the crystal. A square lattice observed previously in the isostructural magnetic analog ErNi 2 B 2 C was attributed to the interaction between magnetic order in that system and the flux lattice. Since the Y-based compound does not order magnetically, it is clear that the structure of the flux lattice is unrelated to magnetic order. In fact, they show that the flux lines have a square cross-section when the applied field is parallel to the c-axis of the crystal, since the measured penetration depth along the 100 crystal direction is larger than the penetration depth along the 110 by approximately 60%. This is the likely reason for the square symmetry of the lattice. Although they find considerable disorder in the arrangement of the flux lines at 2.5T, no melting of the vortex lattice was observed

  16. Transient oxidation of Al-deposited Fe-Cr-Al alloy foil

    International Nuclear Information System (INIS)

    Andoh, A.

    1997-01-01

    The oxide phases formed on an Al-deposited Fe-Cr-Al alloy foil and an Fe-Cr-Al alloy foil of the same levels of Al and (La+Ce) contents, and their oxidation kinetics have been studied in air at 1173 and 1373 K using TGA, XRD and SEM. Al deposition promotes the growth of metastable aluminas (θ-Al 2 O 3 , γ-Al 2 O 3 ). Scales consisting of θ-Al 2 O 3 and a small amount of α-Al 2 O 3 develop on the Al-deposited foil at 1173 K and exhibit the whisker-type morphology. In the early stage of oxidation at 1373 K, thick scales consisting of θ-Al 2 O 3 and α-Al 2 O 3 grow rapidly on the Al-deposited foil. The transformation from θ-Al 2 O 3 to α-Al 2 O 3 is very fast, and the scales result in only α-Al 2 O 3 . In contrast, α-Al 2 O 3 scales containing a minor amount of FeAl 2 O 4 develop on the alloy foil. The growth rate of α-Al 2 O 3 scales on the Al-deposited foil is smaller than that on the alloy foil and very close to that on NiAl at 1373 K. (orig.)

  17. Electrical Resistance Alloys and Low-Expansion Alloys

    DEFF Research Database (Denmark)

    Kjer, Torben

    1996-01-01

    The article gives an overview of electrical resistance alloys and alloys with low thermal expansion. The electrical resistance alloys comprise resistance alloys, heating alloys and thermostat alloys. The low expansion alloys comprise alloys with very low expansion coefficients, alloys with very low...... thermoelastic coefficients and age hardenable low expansion alloys....

  18. Material science and solid state physics studies with positive muon spin precession. [fe(a1) alloys

    Science.gov (United States)

    Stronach, C. E.

    1979-01-01

    The hyperfine field on the muon, B sub hf, at interstitial sites in dilute Fe(Al) alloys was measured for four different concentrations of Al and as a function of temperature by the muon spin rotation method. The magnitude of B sub hf, which is negative, decreases at rates ranging from 0.09 + or - 0.03% per at.% Al at 200 K to an asymptotic limit of 0.35 + or - far above 440 K. This behavior shows that sites near the Al impurity are weakly repulsive to the muon, with an interaction potential of 13 + or - 3 meV. In order to fit the temperature dependence of the hyperfine field, it is necessary to hypothesize the existence of a small concentration of unidentified defects, possibly dislocations, which are attractive to the muon. Although the Al impurity acts as a non-magnetic hole in the Fe lattice, the observed decrease in B sub hf is only 35% of the decrease in the bulk magnetization. It is concluded that B sub hf is determined mainly by the enhanced screening of conduction electrons in Fe and Fe(Al). Since the influence of the Al impurity on the neighboring Fe monents is very small, most of the change in B sub hf is therefore attributed to the increase in conduction electron polarization of the Al impurity.

  19. Phase and Microstructural Correlation of Spark Plasma Sintered HfB2-ZrB2 Based Ultra-High Temperature Ceramic Composites

    Directory of Open Access Journals (Sweden)

    Ambreen Nisar

    2017-07-01

    Full Text Available The refractory diborides (HfB2 and ZrB2 are considered as promising ultra-high temperature ceramic (UHTCs where low damage tolerance limits their application for the thermal protection system in re-entry vehicles. In this regard, SiC and CNT have been synergistically added as the sintering aids and toughening agents in the spark plasma sintered (SPS HfB2-ZrB2 system. Herein, a novel equimolar composition of HfB2 and ZrB2 has shown to form a solid-solution which then allows compositional tailoring of mechanical properties (such as hardness, elastic modulus, and fracture toughness. The hardness of the processed composite is higher than the individual phase hardness up to 1.5 times, insinuating the synergy of SiC and CNT reinforcement in HfB2-ZrB2 composites. The enhanced fracture toughness of CNT reinforced composite (up to a 196% increment surpassing that of the parent materials (ZrB2/HfB2-SiC is attributed to the synergy of solid solution formation and enhanced densification (~99.5%. In addition, the reduction in the analytically quantified interfacial residual tensile stress with SiC and CNT reinforcements contribute to the enhancement in the fracture toughness of HfB2-ZrB2-SiC-CNT composites, mandatory for aerospace applications.

  20. Very high upper critical fields in MgB2 produced by selective tuning of impurity scattering

    International Nuclear Information System (INIS)

    Gurevich, A; Patnaik, S; Braccini, V; Kim, K H; Mielke, C; Song, X; Cooley, L D; Bu, S D; Kim, D M; Choi, J H; Belenky, L J; Giencke, J; Lee, M K; Tian, W; Pan, X Q; Siri, A; Hellstrom, E E; Eom, C B; Larbalestier, D C

    2004-01-01

    We report a significant enhancement of the upper critical field H c2 of different MgB 2 samples alloyed with nonmagnetic impurities. By studying films and bulk polycrystals with different resistivities ρ, we show a clear trend of an increase in H c2 as ρ increases. One particular high resistivity film had a zero-temperature H c2 (0) well above the H c2 values of competing non-cuprate superconductors such as Nb 3 Sn and Nb-Ti. Our high-field transport measurements give record values H c2 perp (0) ∼ 34 T and H c2 par (0) ∼ 49 T for high resistivity films and H c2 (0) ∼ 29 T for untextured bulk polycrystals. The highest H c2 film also exhibits a significant upward curvature of H c2 (T) and a temperature dependence of the anisotropy parameter γ(T)=H c2 par / H c2 opposite to that of single crystals: γ(T) decreases as the temperature decreases, from γ(T c ) ∼ 2 γ(0) ∼ 1.5. This remarkable H c2 enhancement and its anomalous temperature dependence are a consequence of the two-gap superconductivity in MgB 2 , which offers special opportunities for further H c2 increases by tuning of the impurity scattering by selective alloying on Mg and B sites. Our experimental results can be explained by a theory of two-gap superconductivity in the dirty limit. The very high values of H c2 (T) observed suggest that MgB 2 can be made into a versatile, competitive high-field superconductor

  1. Matchmaking Framework for B2B E-Marketplaces

    Directory of Open Access Journals (Sweden)

    Fekete ZOLTAN ALPAR

    2010-01-01

    Full Text Available In the recent years trading on the Internet become more popular. Online businesses gradually replace more and more from the conventional business. Much commercial information is exchanged on the internet, especially using the e-marketplaces. The demand and supply matching process becomes complex and difficult on last twenty years since the e-marketplaces play an important role in business management. Companies can achieve significant cost reduction by using e-marketplaces in their trade activities and by using matchmaking systems on finding the corresponding supply for their demand and vice versa. In the literature were proposed many approaches for matchmaking. In this paper we present a conceptual framework of matchmaking in B2B e-marketplaces environment.

  2. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  3. Model of the Sgr B2 radio source

    International Nuclear Information System (INIS)

    Gosachinskij, I.V.; Khersonskij, V.K.

    1981-01-01

    The dynamical model of the gas cloud around the radio source Sagittarius B2 is suggested. This model describes the kinematic features of the gas in this source: contraction of the core and rotation of the envelope. The stability of the cloud at the initial stage is supported by the turbulent motion of the gas, turbulence energy dissipates due to magnetic viscosity. This process is occurring more rapidly in the dense core and the core begins to collapse but the envelope remains stable. The parameters of the primary cloud and some parameters (mass, density and size) of the collapse are calculated. The conditions in the core at the moment of its fragmentation into masses of stellar order are established [ru

  4. Widespread Occurrence of the Mycotoxin Fumonisin B-2 in Wine

    DEFF Research Database (Denmark)

    Mogensen, Jesper Mølgaard; Larsen, Thomas Ostenfeld; Nielsen, Kristian Fog

    2010-01-01

    Fumonisins are important mycotoxins because they are suspected to cause human and animal toxicoses by the consumption of contaminated corn-based food and feeds. However, with the discovery of fumonisin production in grapes by Aspergillus niger, wine may also be a fumonisin-containing commodity....... In the present study, we have developed a simple and quantitative cation-exchange-based purification method for the subsequent isotope dilution liquid chromatography tandem mass spectrometry (LC-MS/MS) determination of fumonisins in wine. A comparative study of seven different solid-phase extraction (SPE......) columns showed that polymeric mixed-mode reversed-phase (RP) cation-exchange columns were superior to classic silica-based cation and mixed-mode cation-exchange columns. A total of 77 wine samples from 13 countries were subsequently tested, and surprisingly, 18 (23%) were found to contain fumonisin B-2...

  5. Directional scanning tunneling spectroscopy in MgB2

    International Nuclear Information System (INIS)

    Iavarone, M.; Karapetrov, G.; Koshelev, A.E.; Kwok, W.K.; Crabtree, G.W.; Hinks, D.G.; Cook, R.; Kang, W.N.; Choi, E.M.; Kim, H.J.; Lee, S.I.

    2003-01-01

    The superconductivity in MgB 2 has a two-band character with the dominating band having a 2D character and the second band being isotropic in the three dimensions. We use tunneling microscopy and spectroscopy to reveal the two distinct energy gaps at Δ 1 =2.3 meV and Δ 2 =7.1 meV. Different spectral weights of the partial superconducting density of states are a reflection of different tunneling directions in this multi-band system. The results are consistent with the existence of two-band superconductivity in the presence of strong interband superconducting pair interaction and quasiparticle scattering. The temperature evolution of the tunneling spectra shows both gaps vanishing at the bulk T c

  6. Diatomic substitutionals in superconducting Nb(1-x)B2

    International Nuclear Information System (INIS)

    Farrell, H.H.; LaViolette, Randall A.; Lillo, T.M.

    2006-01-01

    Using first-principles, density functional theory calculations, we have shown that the increase in superconducting critical temperature to above 9 K experimentally observed for B-rich, off-stoichiometry NbB 2 material is associated with the formation of B-dimers on Nb sites rather than with the formation of Nb vacancies, as previously proposed. Our calculations show that certain of these B-dimer configurations have lower binding energies than do the vacancy structures. This result is pressure independent in the range between 0 and 10 GPa, and above. Further, the dimer-containing materials have a higher electronic density of states at the Fermi level than do the vacancy structures. Finally, the presence of B-dimers results in the splitting off of phonon normal modes. These last two factors are relevant to the improved superconducting properties

  7. Specific heat of MgB2 after irradiation

    International Nuclear Information System (INIS)

    Wang Yuxing; Bouquet, Frederic; Sheikin, Ilya; Toulemonde, Pierre; Revaz, Bernard; Eisterer, Michael; Weber, Harald W; Hinderer, Joerg; Junod, Alain

    2003-01-01

    We studied the effect of disorder on the superconducting properties of polycrystalline MgB 2 by specific-heat measurements. In the pristine state, these measurements give a bulk confirmation of the presence of two superconducting gaps with 2Δ 0 /k B T c =1.3 and 3.9 with nearly equal weights. The scattering introduced by irradiation suppresses T c and tends to average the two gaps although less than predicted by theory. We also found that by a suitable irradiation process by fast neutrons, a substantial bulk increase of dH c2 /dT at T c can be obtained without sacrificing more than a few degrees in T c . The upper critical field of the sample after irradiation exceeds 28 T at T→0

  8. Podwójna negacja w B 2 poematu Parmenidesa

    Directory of Open Access Journals (Sweden)

    Kazimierz MRÓWKA

    2012-12-01

    Full Text Available In our article we focus on an analysis of the structure of double negation in the poem of Parmenides,paying attention to the fragment B 2. The starting point for the analysis is the classificationof varieties of negation contained in Diogenes Laertius (VII.69-70: negation, denial,privation and double negation. We provide an example of double negation as given by Diogenes: “Not (is not a day ↔ it is a day”. In terms of the poetic expression the law of double negationserves to strengthen the goddess’ speech. However, in the context of Parmenides’ ontology, thelaw of double negation serves as an affirmation of “is”. Our goal is to give a detailed analysis ofthe structure of double negation. In the next step we introduce Euclid’s proofs by comparison.We show that all four forms of negation indicated by Diogenes occur in the Elements and thereis a richer set of the linguistic forms used as an expression of negation, including that of doublenegation. Finally, we show that Parmenides applies consciously the law of double negation,and the poem is the first philosophical text confirming the use of this law. In short, doublenegation can be summarized as follows: for the Stoics, in Diogenes Laertius (VII.69-70: “not(is not a day ↔ is a day”; for Euclid: “not (is not-equal ↔ is equal” (Elements, I.6. “is notlike that (.... is not around ... ↔ is around” (Elements VI.26; and in Parmenides: “is ↔ not(is not to be” (B 2, v. 3.

  9. Temperature-programmed reaction of CO2 reduction in the presence of hydrogen over Fe/Al2O3, Re/Al2O3 and Cr-Mn-O/Al2O3 catalysts

    International Nuclear Information System (INIS)

    Mirzabekova, S.R.; Mamedov, A.B.; Krylov, O.V.

    1996-01-01

    Regularities in CO 2 reduction have been studied using the systems Fe/Al 2 O 3 , Re/Al 2 O 3 and Cr-Mn-O/Al 2 O 3 under conditions of thermally programmed reaction by way of example. A sharp increase in the reduction rate in the course of CO 2 interaction with reduced Fe/Al 2 O 3 and Re/Al 2 O 3 , as well as with carbon fragments with addition in CO 2 flow of 1-2%H 2 , has been revealed. The assumption is made on intermediate formation of a formate in the process and on initiating effect of hydrogen on CO 2 reduction by the catalyst. Refs. 26, figs. 10

  10. Evaluation of Residual Stress Distribution and Relaxation on In Situ TiB2/7050 Al Composites

    Directory of Open Access Journals (Sweden)

    Kunyang Lin

    2018-04-01

    Full Text Available Interior residual stresses induced by quenching may cause distortion during subsequent machining processes. Hence, various strategies have been employed to relieve the interior residual stress, such as stretching, post treatment, and other techniques. In this study, the stress distribution inside TiB2/7050 Al composite extrusions was investigated and the effects of different methods on relieving the quenching-induced stress were compared. Firstly, three TiB2/7050 Al composite extrusions were treated by stretching, stretching and heat treatment, and stretching and cold treatment processes, respectively. Then, the multiple-cut contour method was employed to assess the residual stresses in the three workpieces. Experimental results indicate that the interior stress of TiB2/7050 Al composite extrusions after stretching ranges from −89 MPa to +55 MPa, which is larger than that in 7050 aluminum alloy, which ranges from −25 Pa to +25 MPa. The heat treatment performs better than the cold treatment to reduce the post-stretching residual stress, with a reduction of 23.2–46.4% compared to 11.3–40.8%, respectively. From the stress map, it is found that the stress distribution after the heat treatment is more uniform compared with that after the cold treatment.

  11. Microstructure and Tribological Performance of TiB2-NiCr Composite Coating Deposited by APS

    Directory of Open Access Journals (Sweden)

    Ning Zhang

    2017-12-01

    Full Text Available Nickel chromium (NiCr powders with different titanium diboride (TiB2 additions (20, 40 and 60 wt % were prepared with a mechanical alloying method and then sprayed using an air plasma spraying technology. The microstructure and phase composite of the powders and the cross-sections of deposited coatings were analyzed with a scanning electronic microscope and X-ray diffraction. The tribological performance of the coatings was studied using a pin-on-disk tribometer at room temperature. The weight loss of the as-sprayed coating was measured by using a high accuracy weighing balance. Cr3C2-25NiCr coating was produced and tested for comparison. The morphologies of the worn surface were then investigated. Parts of debris with some scratches were found, presenting typical signs of abrasive wear and showing slight adhesive wear on the surface. The 20 wt % additive TiB2 coating demonstrated the highest microhardness and the lowest coefficient of friction. The wear resistance of the metal-ceramic composites coatings was enhanced with the addition of TiB2.

  12. Parameters controlling the performance of AA319-type alloys Part II. Impact properties and fractography

    International Nuclear Information System (INIS)

    Li, Z.; Samuel, A.M.; Samuel, F.H.; Ravindran, C.; Doty, H.W.; Valtierra, S.

    2004-01-01

    The Charpy impact energy of Al-Si-Cu AA319-type alloys was measured in terms of the total absorbed energy. The Charpy specimens were machined from end-chilled castings to incorporate the effect of cooling rate on the impact properties. Unnotched specimens were used to increase the accuracy of the measurements, and to emphasize the effect of microstructure. The influence of the microconstituents on the impact strength was investigated by adding various alloying elements (i.e. Sr, Fe, and P) to the AA319 base alloy, and applying two different heat treatments (T5, and T6). The results show that strontium-modification enhances the impact properties, so that the Sr-modified AA319 alloy exhibits the highest impact properties compared to the base, and other alloys at any given dendrite arm spacing (DAS). The impact energy increases with increase in cooling rate, while iron, and phosphorus additions have a detrimental influence due, respectively, to the formation of β-Al 5 FeSi, and phosphorus oxide particles during solidification. T6 treatment assists in the even distribution, and dissolution of the microconstituents (including the block-like CuAl 2 particles) into the aluminum matrix. With more Cu available for strengthening during aging, the impact toughness is greatly enhanced. In the unmodified AA319 base alloy, crack initiation, and propagation occur mainly through Si-particle fracture, and the mechanism of void coalescence. In the Sr-modified, 1.2% Fe-containing 319 alloys, however, crack initiation takes place through fragmentation of β-Al 5 FeSi, Si, and CuAl 2 or Cu 2 FeAl 7 particles. Crack propagation occurs through cleavage of the β-Fe platelets, and fracture of the Cu-intermetallics, and brittle Si particles. Such samples exhibit very low impact energies

  13. Transformation from Al3BC phase to doped TiB2 or TiC particles in Al–Ti melts

    International Nuclear Information System (INIS)

    Tian, Wenjie; Li, Pengting; Gao, Tong; Nie, Jinfeng; Liu, Xiangfa

    2013-01-01

    Highlights: ► The reaction of phase Al 3 BC with Ti was investigated. ► The transformation leads to the formation of C-doped TiB 2 and B-doped TiC. ► The doped particles show macroporous and lamellar morphologies. ► A model was proposed to illustrate the transformation mechanism. ► Grain refinement performance of the Al–5Ti–0.8B–0.2C on A356 alloy is excellent. -- Abstract: An Al–8B–2C master alloy was added into Al–Ti melts to study the reaction of Al 3 BC phase with Ti. As a result, a new Al–5Ti–0.8B–0.2C master alloy was fabricated. The microstructures were studied by field emission scanning electron microscope (FESEM), X-ray diffraction (XRD) and transmission electron microscope (TEM). The analysis indicates that C-doped TiB 2 and B-doped TiC which show macroporous and lamellar morphologies are transformed from Al 3 BC. The transformation mechanism is also discussed in this work. Furthermore, the grain refinement performance of the Al–5Ti–0.8B–0.2C on A356 alloy was investigated

  14. Critical current density analysis of ex situ MgB2 wire by in-field and temperature Hall probe imaging

    International Nuclear Information System (INIS)

    Bartolome, E; Granados, X; Cambel, V; Fedor, J; Kovac, P; Husek, I

    2005-01-01

    The irreversible magnetic behaviour at different temperatures of an ex situ Fe-alloy/MgB 2 wire, exhibiting a granular compositional distribution, was studied using an in-field, high resolution Hall probe imaging system. Quantitative information about the local current density was obtained by solving the Biot-Savart inversion problem. The flux penetration and current distribution maps obtained can be attributed to a inhomogeneous compositional 'plum-cake-like' system, consisting of large, isolated MgB 2 agglomerations embedded in a matrix of finely distributed MgB 2 +MgO. The critical current densities within the grains and their evolution with the applied magnetic field and temperature have been obtained, and compared to the mean J c (H,T) in the matrix

  15. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Science.gov (United States)

    An, Jing; Song, Jinpeng; Liang, Guoxing; Gao, Jiaojiao; Xie, Juncai; Cao, Lei; Wang, Shiying; Lv, Ming

    2017-01-01

    The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure. PMID:28772821

  16. Effects of HfB2 and HfN Additions on the Microstructures and Mechanical Properties of TiB2-Based Ceramic Tool Materials

    Directory of Open Access Journals (Sweden)

    Jing An

    2017-04-01

    Full Text Available The effects of HfB2 and HfN additions on the microstructures and mechanical properties of TiB2-based ceramic tool materials were investigated. The results showed that the HfB2 additive not only can inhibit the TiB2 grain growth but can also change the morphology of some TiB2 grains from bigger polygons to smaller polygons or longer ovals that are advantageous for forming a relatively fine microstructure, and that the HfN additive had a tendency toward agglomeration. The improvement of flexural strength and Vickers hardness of the TiB2-HfB2 ceramics was due to the relatively fine microstructure; the decrease of fracture toughness was ascribed to the formation of a weaker grain boundary strength due to the brittle rim phase and the poor wettability between HfB2 and Ni. The decrease of the flexural strength and Vickers hardness of the TiB2-HfN ceramics was due to the increase of defects such as TiB2 coarse grains and HfN agglomeration; the enhancement of fracture toughness was mainly attributed to the decrease of the pore number and the increase of the rim phase and TiB2 coarse grains. The toughening mechanisms of TiB2-HfB2 ceramics mainly included crack bridging and transgranular fracture, while the toughening mechanisms of TiB2-HfN ceramics mainly included crack deflection, crack bridging, transgranular fracture, and the core-rim structure.

  17. Nanostructure characterization of Ni and B layers as artificial pinning centers in multilayered MgB2/Ni and MgB2/B superconducting thin films

    International Nuclear Information System (INIS)

    Sosiati, H.; Hata, S.; Doi, T.; Matsumoto, A.; Kitaguchi, H.; Nakashima, H.

    2013-01-01

    Highlights: ► Nanostructure characterization of Ni and B layers as artificial pinning centers (APCs). ► Relationship between nanostructure and J c property. ► Enhanced J c in parallel field by parallel APCs within the MgB 2 film. -- Abstract: Research on the MgB 2 /Ni and MgB 2 /B multilayer films fabricated by an electron beam (EB) evaporation technique have been extensively carried out. The critical current density, J c of MgB 2 /Ni and MgB 2 /B multilayer films in parallel fields has been suggested to be higher than that of monolayer MgB 2 film due to introducing the artificial pinning centers of nano-sized Ni and B layers. Nanostructure characterization of the artificial pinning centers in the multilayer films were examined by transmission electron microscopy (TEM) and scanning TEM (STEM-energy dispersive X-ray spectroscopy (STEM-EDS))–EDS to understand the mechanism of flux pinning. The growth of columnar MgB 2 grains along the film-thickness direction was recognized in the MgB 2 /Ni multilayer film, but not in the MgB 2 /B multilayer film. Nano-sized Ni layers were present as crystalline epitaxial layers which is interpreted that Ni atoms might be incorporated into the MgB 2 lattice to form (Mg,Ni)B 2 phase. On the other hand, nano-sized B layers were amorphous layers. Crystalline (Mg,Ni)B 2 layers worked more effectively than amorphous B-layers, providing higher flux-pinning force that resulted in higher J c of the MgB 2 /Ni multilayer film than the MgB 2 /B multilayer film

  18. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  19. Atomic-scale simulation study of some bulk and interfacial properties of iron aluminium ordered alloys

    International Nuclear Information System (INIS)

    Besson, Remy

    1997-01-01

    A semi-empirical potential was designed for B 2 and DO 3 iron aluminides and used to study point defects and grain boundaries in these compounds. At low temperature, departure from B 2 stoichiometry is accommodated with antisite defects; when T increases, iron vacancies appear and defects have a trend to form clusters, the structure of which is very sensitive to this departure. Our calculations, relying on T = 0 K formation energies, predict the nature of major defects, but lead to underestimated quantitative results, which may point out the essential role of atomic vibrations. In the stoichiometric B 2 compound, the diffusion of both species is induced by four-jump cycles involving iron vacancies. Although the agreement between our calculated activation energies and other experiments is good, the calculated diffusion coefficients are below the experimental ones. Here again, this discrepancy may be put down to the overlooking of phonon contributions. The second application concerns the atomic structures of the [001] (310) symmetric tilt grain boundary in the B 2 and DO 3 compounds. At low temperature, in the stoichiometric B 2 compound, we obtain an iron-rich single stable structure (pseudo-symmetric), whose structure is strongly influenced by the bulk composition (with intergranular segregation of the major element). In the stoichiometric DO 3 compound, many energetically equivalent structures exist, all being systematically aluminium-rich. The study of the B 2 grain boundary structure at high temperature shows a phase transition favouring a symmetric structure. Its high excess energy at low temperature emphasizes the influence of atomic vibrations in the interfacial properties of B 2 Fe-Al compounds. (author) [fr

  20. High temperature microhardness of ZrB2 single crystals

    International Nuclear Information System (INIS)

    Yi Xuan; Chen Chunhua; Otani, Shigeki

    2002-01-01

    Vickers microhardness of (0001), (101-bar 0) and (112-bar 0) planes of ZrB 2 single crystal prepared by the floating zone method has been investigated at various temperatures and loading times. As the temperature increases from 25 deg. C to 1000 deg. C, hardness drops from ∼20.9 GN m -2 of all planes to ∼7.85 GN m -2 for (0001) plane and ∼4.91 GN m -2 for (101-bar 0) and (112-bar 0) planes. The hardness of (101-bar 0) and (112-bar 0) planes exhibits almost same tendency and is always lower than that of (0001) plane by about 35%. The thermal softening coefficients of all three planes strongly depends on the temperature range with clear inflections at 400 deg. C and 700 deg. C. The loading time dependence of hardness is used to calculate the activation energy for creep. In addition, a relationship was found that shows the variation of hardness with temperature to be proportional to the variation with the loading time in a specific temperature range. (rapid communication)

  1. Lightweight MgB2 superconducting 10 MW wind generator

    Science.gov (United States)

    Marino, I.; Pujana, A.; Sarmiento, G.; Sanz, S.; Merino, J. M.; Tropeano, M.; Sun, J.; Canosa, T.

    2016-02-01

    The offshore wind market demands a higher power rate and more reliable turbines in order to optimize capital and operational costs. The state-of-the-art shows that both geared and direct-drive conventional generators are difficult to scale up to 10 MW and beyond due to their huge size and weight. Superconducting direct-drive wind generators are considered a promising solution to achieve lighter weight machines. This work presents an innovative 10 MW 8.1 rpm direct-drive partial superconducting generator using MgB2 wire for the field coils. It has a warm iron rotor configuration with the superconducting coils working at 20 K while the rotor core and the armature are at ambient temperature. A cooling system based on cryocoolers installed in the rotor extracts the heat from the superconducting coils by conduction. The generator's main parameters are compared against a permanent magnet reference machine, showing a significant weight and size reduction. The 10 MW superconducting generator concept will be experimentally validated with a small-scale magnetic machine, which has innovative components such as superconducting coils, modular cryostats and cooling systems, and will have similar size and characteristics as the 10 MW generator.

  2. Lightweight MgB2 superconducting 10 MW wind generator

    International Nuclear Information System (INIS)

    Marino, I; Pujana, A; Sarmiento, G; Sanz, S; Merino, J M; Tropeano, M; Sun, J; Canosa, T

    2016-01-01

    The offshore wind market demands a higher power rate and more reliable turbines in order to optimize capital and operational costs. The state-of-the-art shows that both geared and direct-drive conventional generators are difficult to scale up to 10 MW and beyond due to their huge size and weight. Superconducting direct-drive wind generators are considered a promising solution to achieve lighter weight machines. This work presents an innovative 10 MW 8.1 rpm direct-drive partial superconducting generator using MgB 2 wire for the field coils. It has a warm iron rotor configuration with the superconducting coils working at 20 K while the rotor core and the armature are at ambient temperature. A cooling system based on cryocoolers installed in the rotor extracts the heat from the superconducting coils by conduction. The generator’s main parameters are compared against a permanent magnet reference machine, showing a significant weight and size reduction. The 10 MW superconducting generator concept will be experimentally validated with a small-scale magnetic machine, which has innovative components such as superconducting coils, modular cryostats and cooling systems, and will have similar size and characteristics as the 10 MW generator. (paper)

  3. Bond deformation paths and electronic instabilities of ultraincompressible transition metal diborides: Case study of OsB2 and IrB2

    Science.gov (United States)

    Zhang, R. F.; Legut, D.; Wen, X. D.; Veprek, S.; Rajan, K.; Lookman, T.; Mao, H. K.; Zhao, Y. S.

    2014-09-01

    The energetically most stable orthorhombic structure of OsB2 and IrB2 is dynamically stable for OsB2 but unstable for IrB2. Both diborides have substantially lower shear strength in their easy slip systems than their metal counterparts. This is attributed to an easy sliding facilitated by out-of-plane weakening of metallic Os-Os bonds in OsB2 and by an in-plane bond splitting instability in IrB2. A much higher shear resistance of Os-B and B-B bonds than Os-Os ones is found, suggesting that the strengthened Os-B and B-B bonds are responsible for hardness enhancement in OsB2. In contrast, an in-plane electronic instability in IrB2 limits its strength. The electronic structure of deformed diborides suggests that the electronic instabilities of 5d orbitals are their origin of different bond deformation paths. Neither IrB2 nor OsB2 can be intrinsically superhard.

  4. The conserved nhaAR operon is drastically divergent between B2 and non-B2 Escherichia coli and is involved in extra-intestinal virulence.

    Science.gov (United States)

    Lescat, Mathilde; Reibel, Florence; Pintard, Coralie; Dion, Sara; Glodt, Jérémy; Gateau, Cecile; Launay, Adrien; Ledda, Alice; Cruveiller, Stephane; Cruvellier, Stephane; Tourret, Jérôme; Tenaillon, Olivier

    2014-01-01

    The Escherichia coli species is divided in phylogenetic groups that differ in their virulence and commensal distribution. Strains belonging to the B2 group are involved in extra-intestinal pathologies but also appear to be more prevalent as commensals among human occidental populations. To investigate the genetic specificities of B2 sub-group, we used 128 sequenced genomes and identified genes of the core genome that showed marked difference between B2 and non-B2 genomes. We focused on the gene and its surrounding region with the strongest divergence between B2 and non-B2, the antiporter gene nhaA. This gene is part of the nhaAR operon, which is in the core genome but flanked by mobile regions, and is involved in growth at high pH and high sodium concentrations. Consistently, we found that a panel of non-B2 strains grew faster than B2 at high pH and high sodium concentrations. However, we could not identify differences in expression of the nhaAR operon using fluorescence reporter plasmids. Furthermore, the operon deletion had no differential impact between B2 and non-B2 strains, and did not result in a fitness modification in a murine model of gut colonization. Nevertheless, sequence analysis and experiments in a murine model of septicemia revealed that recombination in nhaA among B2 strains was observed in strains with low virulence. Finally, nhaA and nhaAR operon deletions drastically decreased virulence in one B2 strain. This effect of nhaAR deletion appeared to be stronger than deletion of all pathogenicity islands. Thus, a population genetic approach allowed us to identify an operon in the core genome without strong effect in commensalism but with an important role in extra-intestinal virulence, a landmark of the B2 strains.

  5. Structural, mechanical, and electronic properties of TaB2, TaB, IrB2, and IrB: First-principle calculations

    International Nuclear Information System (INIS)

    Zhao Wenjie; Wang Yuanxu

    2009-01-01

    First-principle calculations were performed to investigate the structural, elastic, and electronic properties of TaB 2 , TaB, IrB 2 , and IrB. The calculated equilibrium structural parameters, shear modulus, and Young's modulus of TaB 2 are well consistent with the available experimental data, and TaB 2 with P6/mmm space group has stronger directional bonding between ions than WB 2 , OsB 2 , IrN 2 , and PtN 2 . For TaB 2 , the hexagonal P6/mmm structure is more stable than the orthorhombic Pmmn one, while for IrB 2 the orthorhombic Pmmn structure is the most stable one. The high shear modulus of P6/mmm phase TaB 2 is mainly due to the strong covalent π-bonding of B-hexagon in the (0001) plane. Such a B-hexagon network can strongly resist against an applied [112-bar0] (0001) shear deformation. Correlation between the hardness and the elastic constants of TaB 2 was discussed. The band structure shows that P6/mmm phase TaB 2 and Pmmn phase IrB 2 are both metallic. The calculations show that both TaB and IrB are elastically stable with the hexagonal P6 3 /mmc structure. - Elastic constant c 44 of TaB 2 is calculated to be 235 GPa. This value is exceptionally high, exceeding those of WB 2 , OsB 2 , WB 4 , OsN 2 , IrN 2 , and PtN 2 .

  6. Superconducting alloys

    International Nuclear Information System (INIS)

    Bowers, J.E.

    1976-01-01

    Reference is made to superconductors having high critical currents. The superconductor described comprises an alloy consisting of a matrix of a Type II superconductor which is a homogeneous mixture of 50 to 95 at.% Pb and 5 to 40 at.%Bi and/or 10 to 50 at.%In. Dispersed in the matrix is a material to provide pinning centres comprising from 0.01% to 20% by volume of the alloy; this material is a stable discontinuous phase of discrete crystalline particles of Cu, Mn, Te, Se, Ni, Ca, Cr, Ce, Ge or La, either in the form of the element or a compound with a component of the matrix. These particles should have an average diameter of not more than 2μ. A method for making this alloy is described. (U.K.)

  7. Microstructural characterization of LaB6-ZrB2 eutectic composites

    International Nuclear Information System (INIS)

    Wang Shengchang; Wei, W.J.; Zhang Litong

    2003-01-01

    Detail microstructure of LaB 6 -ZrB 2 composites has been characterized by TEM and HRTEM. The directionally solidified ZrB 2 fibers in LaB 6 matrix near LaB 6 -ZrB 2 eutectics present at least three growing relationship systems. In addition to previous report of [001]LaB 6 / [0001]ZrB 2 relationship, [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . were identified. Different with [001]LaB 6 / [0001]ZrB 2 system, the interfaces of [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . show non-coherent and clean interfaces. There is neither glassy phase nor reaction products found at the interfaces (orig.)

  8. The CVD ZrB2 as a selective solar absorber

    Science.gov (United States)

    Randich, E.; Allred, D. D.

    Coatings of ZrB2 and TiB2 for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB2 and 800 K for Z4B2. Both materials exhibit innate spectral selectivity with emittance at 375 K ranging from 0.06 to 0.09 and solar absorptance for ZrB2 ranging from 0.67 to 0.77 and solar absorptance for TiB2 ranging from 0.46 to 0.58. ZrB2 has better solar selectivity and more desirable oxidation behavior than TiB2. A 0.071 micrometer antireflection coating of Si3N4 deposited on the ZrB2 coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged.

  9. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  10. Thermal Vacuum Integrated System Test at B-2

    Science.gov (United States)

    Kudlac, Maureen T.; Weaver, Harold F.; Cmar, Mark D.

    2012-01-01

    The National Aeronautics and Space Administration (NASA) Glenn Research Center (GRC) Plum Brook Station (PBS) Space Propulsion Research Facility, commonly referred to as B-2, is NASA s third largest thermal vacuum facility. It is the largest designed to store and transfer large quantities of liquid hydrogen and liquid oxygen, and is perfectly suited to support developmental testing of chemical propulsion systems as well as fully integrated stages. The facility is also capable of providing thermal-vacuum simulation services to support testing of large lightweight structures, Cryogenic Fluid Management (CFM) systems, electric propulsion test programs, and other In-Space propulsion programs. A recently completed integrated system test demonstrated the refurbished thermal vacuum capabilities of the facility. The test used the modernized data acquisition and control system to monitor the facility during pump down of the vacuum chamber, operation of the liquid nitrogen heat sink (or cold wall) and the infrared lamp array. A vacuum level of 1.3x10(exp -4)Pa (1x10(exp -6)torr) was achieved. The heat sink provided a uniform temperature environment of approximately 77 K (140deg R) along the entire inner surface of the vacuum chamber. The recently rebuilt and modernized infrared lamp array produced a nominal heat flux of 1.4 kW/sq m at a chamber diameter of 6.7 m (22 ft) and along 11 m (36 ft) of the chamber s cylindrical vertical interior. With the lamp array and heat sink operating simultaneously, the thermal systems produced a heat flux pattern simulating radiation to space on one surface and solar exposure on the other surface. The data acquired matched pretest predictions and demonstrated system functionality.

  11. Microwave surface impedance of MgB2 thin film

    International Nuclear Information System (INIS)

    Jin, B B; Klein, N; Kang, W N; Kim, Hyeong-Jin; Choi, Eun-Mi; Lee, Sung-I K; Dahm, T; Maki, K

    2003-01-01

    The microwave surface impedance Z s = R s + jωμ 0 λ was measured with dielectric resonator techniques for two c-axis-oriented MgB 2 thin films. The temperature dependence of the penetration depth λ measured with a sapphire resonator at 17.93 GHz can be well fitted from 5 K close to T c by the standard BCS integral expression assuming the reduced energy gap Δ(0)/kT c to be as low as 1.13 and 1.03 for the two samples. From these fits the penetration depth at zero temperatures was determined to be 102 nm and 107 nm, respectively. The results clearly indicate the s-wave nature of the order parameter. The temperature dependence of surface resistance R s , measured with a rutile dielectric resonator, shows an exponential behaviour below about T c /2 with a reduced energy gap being consistent with the one determined from the λ data. The R s value at 4.2 K was found to be as low as 19 μΩ at 7.2 GHz, which is comparable with that of a high-quality high-temperature thin film of YBa 2 Cu 3 O 7 . A higher-order mode at 17.9 GHz was employed to determine the frequency f dependence of R s ∝ f n(T) . Our results revealed a decrease of n with increasing temperature ranging from n = 2 below 8 K to n 1 from 13 to 34 K

  12. Crystallization and Martensitic Transformation Behavior of Ti-Ni-Si Alloy Ribbons Prepared via Melt Spinning.

    Science.gov (United States)

    Park, Ju-Wan; Kim, Yeon-Wook; Nam, Tae-Hyun

    2018-09-01

    Ti-(50-x)Ni-xSi (at%) (x = 0.5, 1.0, 3.0, 5.0) alloy ribbons were prepared via melt spinning and their crystallization procedure and transformation behavior were investigated using differential scanning calorimtry, X-ray diffraction, and transmission electron microscopy. Ti-Ni-Si alloy ribbons with Si content less than 1.0 at% were crystalline, whereas those with Si content more than 3.0 at% were amorphous. Crystallization occurred in the sequence of amorphous →B2B2 → Ti5Si4 + TiNi3 → B2 + Ti5Si4 + TiNi3 + TiSi in the Ti-47.0Ni-3.0Si alloy and amorphous →R → R + Ti5Si4 + TiNi3 → R + Ti5Si4 + TiNi3 + TiSi in the Ti-45.0Ni-5.0Si alloy. The activation energy for crystallization was 189 ±8.6 kJ/mol for the Ti-47Ni-3Si alloy and 212±8.6 kJ/mol for the Ti-45Ni-5Si alloy. One-stage B2-R transformation behavior was observed in Ti-49.5Ni-0.5Si, Ti-49.0Ni-1.0Si, and Ti-47.0Ni- 3.0Si alloy ribbons after heating to various temperatures in the range of 873 K to 1073 K. In the Ti-45.0Ni-5.0Si alloy, one-stage B2-R transformation occurred after heating to 893 K, two-stage B2-R-B19' occurred after heating to 973 K, and two-stage B2-R-B19' occurred on cooling and one-stage B19'-B2 occurred on heating, after heating to 1073 K.

  13. Experiences and Future Expectations towards Online Courses--An Empirical Study of the B2C-and B2B-Segments

    Science.gov (United States)

    Krämer, Andreas; Böhrs, Sandra

    2016-01-01

    This article explores the future potential for the development of online courses. The findings are based on an empirical study with 3 sample groups: (1) B2C segment in Germany, (2) B2C segment in the United States, and (3) B2B segment (international). In the first step the status quo of the use of e-learning in general and online courses in…

  14. Study on Logistics Distribution Centers for B2C Online Shopping%B2C网购物流配送中心研究

    Institute of Scientific and Technical Information of China (English)

    侯凌燕; 尹军琪

    2011-01-01

    分析了我国B2C网购物流配送的现状,对其特点和难点作了分析,并提出了相应的B2C网购物流配送中心设计解决方案.%The paper analyzes the current status of the logistics and distribution operations for B2C online shopping in China, analyzes its characteristics and existing issues, and puts forth solutions for the design of logistics and distribution centers for B2C online shopping.

  15. Clinical relevance of ErbB-2/HER2 nuclear expression in breast cancer

    International Nuclear Information System (INIS)

    Schillaci, Roxana; Charreau, Eduardo H; Maronna, Esteban; Roa, Juan C; Elizalde, Patricia V; Guzmán, Pablo; Cayrol, Florencia; Beguelin, Wendy; Díaz Flaqué, María C; Proietti, Cecilia J; Pineda, Viviana; Palazzi, Jorge; Frahm, Isabel

    2012-01-01

    The biological relevance of nuclear ErbB-2/HER2 (NuclErbB-2) presence in breast tumors remains unexplored. In this study we assessed the clinical significance of ErbB-2 nuclear localization in primary invasive breast cancer. The reporting recommendations for tumor marker prognostic studies (REMARK) guidelines were used as reference. Tissue microarrays from a cohort of 273 primary invasive breast carcinomas from women living in Chile, a Latin American country, were examined for membrane (MembErbB-2) and NuclErbB-2 expression by an immunofluorescence (IF) protocol we developed. ErbB-2 expression was also evaluated by immunohistochemistry (IHC) with a series of antibodies. Correlation between NuclErbB-2 and MembErbB-2, and between NuclErbB-2 and clinicopathological characteristics of tumors was studied. The prognostic value of NuclErbB-2 in overall survival (OS) was evaluated using Kaplan-Meier method, and Cox model was used to explore NuclErbB-2 as independent prognostic factor for OS. The IF protocol we developed showed significantly higher sensitivity for detection of NuclErbB-2 than IHC procedures, while its specificity and sensitivity to detect MembErbB-2 were comparable to those of IHC procedures. We found 33.6% NuclErbB-2 positivity, 14.2% MembErbB-2 overexpression by IF, and 13.0% MembErbB-2 prevalence by IHC in our cohort. We identified NuclErbB-2 positivity as a significant independent predictor of worse OS in patients with MembErbB-2 overexpression. NuclErbB-2 was also a biomarker of lower OS in tumors that overexpress MembErbB-2 and lack steroid hormone receptors. We revealed a novel role for NuclErbB-2 as an independent prognostic factor of poor clinical outcome in MembErbB-2-positive breast tumors. Our work indicates that patients presenting NuclErbB-2 may need new therapeutic strategies involving specific blockage of ErbB-2 nuclear migration

  16. Clinical relevance of ErbB-2/HER2 nuclear expression in breast cancer

    Directory of Open Access Journals (Sweden)

    Schillaci Roxana

    2012-02-01

    Full Text Available Abstract Background The biological relevance of nuclear ErbB-2/HER2 (NuclErbB-2 presence in breast tumors remains unexplored. In this study we assessed the clinical significance of ErbB-2 nuclear localization in primary invasive breast cancer. The reporting recommendations for tumor marker prognostic studies (REMARK guidelines were used as reference. Methods Tissue microarrays from a cohort of 273 primary invasive breast carcinomas from women living in Chile, a Latin American country, were examined for membrane (MembErbB-2 and NuclErbB-2 expression by an immunofluorescence (IF protocol we developed. ErbB-2 expression was also evaluated by immunohistochemistry (IHC with a series of antibodies. Correlation between NuclErbB-2 and MembErbB-2, and between NuclErbB-2 and clinicopathological characteristics of tumors was studied. The prognostic value of NuclErbB-2 in overall survival (OS was evaluated using Kaplan-Meier method, and Cox model was used to explore NuclErbB-2 as independent prognostic factor for OS. Results The IF protocol we developed showed significantly higher sensitivity for detection of NuclErbB-2 than IHC procedures, while its specificity and sensitivity to detect MembErbB-2 were comparable to those of IHC procedures. We found 33.6% NuclErbB-2 positivity, 14.2% MembErbB-2 overexpression by IF, and 13.0% MembErbB-2 prevalence by IHC in our cohort. We identified NuclErbB-2 positivity as a significant independent predictor of worse OS in patients with MembErbB-2 overexpression. NuclErbB-2 was also a biomarker of lower OS in tumors that overexpress MembErbB-2 and lack steroid hormone receptors. Conclusions We revealed a novel role for NuclErbB-2 as an independent prognostic factor of poor clinical outcome in MembErbB-2-positive breast tumors. Our work indicates that patients presenting NuclErbB-2 may need new therapeutic strategies involving specific blockage of ErbB-2 nuclear migration.

  17. Estructura y propiedades del material compuesto de base cobre reforzado con partículas intermetálicas de TiB2. // Structure and properties of copper base reinforced with intermetallic particles of TiB2 material.

    Directory of Open Access Journals (Sweden)

    M. López J.

    2002-09-01

    copper base reinforced alloy by means ofdispersion of TiB2 intermetalic ceramic is carried out. The copper-ceramic mechanical mixture was obtainedalloying powdered copper of 140 mm size with 1% and 2% of TiB2 in volume, dispers e in a planetary mill ofmartens itic stainless of high energy, with 12 and 36 hours milling in argon atmosphere using reason ofbolls/mass load in 10:1 powder. The powdered alloy consolidation was carried out in two stages.The objective of the study, is to investigate the evolution of mechanical and electric properties associated tomicroestructure changes taken place by compactacion process and hot lamination.Key words. Copper alloy, mechanical properties, microestructure, hot rolling.

  18. Silicon Alloying On Aluminium Based Alloy Surface

    International Nuclear Information System (INIS)

    Suryanto

    2002-01-01

    Silicon alloying on surface of aluminium based alloy was carried out using electron beam. This is performed in order to enhance tribological properties of the alloy. Silicon is considered most important alloying element in aluminium alloy, particularly for tribological components. Prior to silicon alloying. aluminium substrate were painted with binder and silicon powder and dried in a furnace. Silicon alloying were carried out in a vacuum chamber. The Silicon alloyed materials were assessed using some techniques. The results show that silicon alloying formed a composite metal-non metal system in which silicon particles are dispersed in the alloyed layer. Silicon content in the alloyed layer is about 40% while in other place is only 10.5 %. The hardness of layer changes significantly. The wear properties of the alloying alloys increase. Silicon surface alloying also reduced the coefficient of friction for sliding against a hardened steel counter face, which could otherwise be higher because of the strong adhesion of aluminium to steel. The hardness of the silicon surface alloyed material dropped when it underwent a heating cycle similar to the ion coating process. Hence, silicon alloying is not a suitable choice for use as an intermediate layer for duplex treatment

  19. Surface Properties of the IN SITU Formed Ceramics Reinforced Composite Coatings on TI-3AL-2V Alloys

    Science.gov (United States)

    Liu, Peng; Guo, Wei; Hu, Dakui; Luo, Hui; Zhang, Yuanbin

    2012-04-01

    The synthesis of hard composite coating on titanium alloy by laser cladding of Al/Fe/Ni+C/Si3N4 pre-placed powders has been investigated in detail. SEM result indicated that a composite coating with metallurgical joint to the substrate was formed. XRD result indicated that the composite coating mainly consisted of γ-(Fe, Ni), FeAl, Ti3Al, TiC, TiNi, TiC0.3N0.7, Ti2N, SiC, Ti5Si3 and TiNi. Compared with Ti-3Al-2V substrate, an improvement of the micro-hardness and the wear resistance was observed for this composite coating.

  20. SURFACE PROPERTIES OF THE IN SITU FORMED CERAMICS REINFORCED COMPOSITE COATINGS ON TI-3AL-2V ALLOYS

    OpenAIRE

    PENG LIU; WEI GUO; DAKUI HU; HUI LUO; YUANBIN ZHANG

    2012-01-01

    The synthesis of hard composite coating on titanium alloy by laser cladding of Al/Fe/Ni+C/Si3N4 pre-placed powders has been investigated in detail. SEM result indicated that a composite coating with metallurgical joint to the substrate was formed. XRD result indicated that the composite coating mainly consisted of γ-(Fe, Ni), FeAl, Ti3Al, TiC, TiNi, TiC0.3N0.7, Ti2N, SiC, Ti5Si3 and TiNi. Compared with Ti-3Al-2V substrate, an improvement of the micro-hardness and the wear resistance was obser...

  1. Reduction of conductance mismatch in Fe/Al2O3/MoS2 system by tunneling-barrier thickness control

    Science.gov (United States)

    Hayakawa, Naoki; Muneta, Iriya; Ohashi, Takumi; Matsuura, Kentaro; Shimizu, Jun’ichi; Kakushima, Kuniyuki; Tsutsui, Kazuo; Wakabayashi, Hitoshi

    2018-04-01

    Molybdenum disulfide (MoS2) among two-dimensional semiconductor films is promising for spintronic devices because it has a longer spin-relaxation time with contrasting spin splitting than silicon. However, it is difficult to fabricate integrated circuits by the widely used exfoliation method. Here, we investigate the contact characteristics in the Fe/Al2O3/sputtered-MoS2 system with various thicknesses of the Al2O3 film. Current density increases with increasing thickness up to 2.5 nm because of both thermally-assisted and direct tunneling currents. On the other hand, it decreases with increasing thickness over 2.5 nm limited by direct tunneling currents. These results suggest that the Schottky barrier width can be controlled by changing thicknesses of the Al2O3 film, as supported by calculations. The reduction of conductance mismatch with this technique can lead to highly efficient spin injection from iron into the MoS2 film.

  2. Microstructure and tensile properties of Fe-40 at. pct Al alloys with C, Zr, Hf, and B additions

    Science.gov (United States)

    Gaydosh, D. J.; Draper, S. L.; Nathal, M. V.

    1989-01-01

    The influence of small additions of C, Zr, and Hf, alone or in combination with B, on the microstructure and tensile behavior of substoichiometric FeAl was investigated. Tensile properties were determined from 300 to 1100 K on powder which was consolidated by hot extrusion. All materials possessed some ductility at room temperature, although ternary additions generally reduced ductility compared to the binary alloy. Adding B to the C- and Zr-containing alloys changed the fracture mode from intergranular to transgranular and restored the ductility to approximately 5 percent elongation. Additions of Zr and Hf increased strength up to about 900 K. Fe6Al6Zr and Fe6Al6Hf precipitates, both with identical body-centered tetragonal structures, were identified as the principal second phase in these alloys. Strength decreased steadily as temperature increased above 700 K, as diffusion-assisted mechanisms became operative. Although all alloys had similar strengths at 1100 K, Hf additions significantly improved high-temperature ductility by suppressing cavitation.

  3. Microstructure evolution and mechanical properties of Ti−22Al−25Nb alloy joints brazed with Ti−Ni−Nb alloy

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y.; Cai, X.Q.; Yang, Z.W., E-mail: tjuyangzhenwen@163.com; Qiu, Q.W.; Wang, D.P.; Liu, Y.C.

    2016-10-01

    Ti{sub 45}Ni{sub 45}Nb{sub 10} (at.%) brazing alloy, fabricated by arc melting, was successfully used to braze Ti−22Al−25Nb (at.%) alloy. The microstructures of Ti{sub 45}Ni{sub 45}Nb{sub 10} brazing alloy and Ti−22Al−25Nb alloy brazed joints were analyzed using scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), electron backscatter diffraction (EBSD), and micro-area X-ray diffraction (XRD). The effects of the brazing parameters on the interfacial microstructure and mechanical properties of the Ti−22Al−25Nb alloy brazed joints were investigated. The results showed that the joint was primarily comprised of two characteristic zones: diffusion zone I and central zone II, and the reaction phases formed in the brazed joint were the B2, O, τ{sub 3}, and Ti{sub 2}Ni phase. The crystal orientation of B2 phase in diffusion zone I was consistent with that in the Ti−22Al−25Nb substrate. The O phase was precipitated from the B2 phase. As the brazing temperature or holding time increased, τ{sub 3} was gradually replaced by the B2 phase, and the Ti{sub 2}Ni phase decreased and ultimately disappeared. The maximum shear strength achieved at room temperature was 318 MPa when the joint was brazed at 1180 °C for 20 min, whereas it was 278 MPa at 650 °C. Crack primarily propagated in the τ{sub 3} compound, which was extremely hard and brittle, and partially traversed the B2 and O phases. - Highlights: • Ti{sub 45}Ni{sub 45}Nb{sub 10} alloy was successfully developed to braze Ti−22Al−25Nb alloy. • Ti−22Al−25Nb alloy was transformed from B2 phase into the O + B2 duplex phase after brazing. • Crystal orientation of B2 in joint was dependent on metal substrate. • Correlation between joint microstructure and mechanical properties was revealed. • Ti−22Al−25Nb brazed joint had excellent ambient and high temperature strength.

  4. Tumor Suppressor Activity of the EphB2 Receptor in Prostate Cancer

    National Research Council Canada - National Science Library

    Pasquale, Elena B

    2007-01-01

    Mutations have been recently identified in the EphB2 receptor gene in prostate cancer suggesting that EphB2, a member of the large Eph receptor tyrosine kinase family, is a tumor suppressor in prostate cancer...

  5. Tumor Suppressor Activity of the EphB2 Receptor in Prostate Cancer

    National Research Council Canada - National Science Library

    Pasquale, Elena B

    2006-01-01

    Mutations have been recently identified in the EphB2 receptor gene in prostate cancer suggesting that EphB2, a member of the large Eph receptor tyrosine kinase family, is a tumor suppressor in prostate cancer...

  6. Li2b2-Façade: Simulation of i2b2 Data Warehouse Server and Client for Interaction with Other Systems.

    Science.gov (United States)

    Majeed, Raphael W; Xu, Tingyan; Stöhr, Mark R; Röhrig, Rainer

    2017-01-01

    Since its release in 2004, the i2b2 data warehouse software has become a valuable tool for clinical researchers. Physicians can use its browser-based query frontend intuitively without additional training or reading through documentation. While the i2b2 software describes it's API as "REST", it is neither stateless nor does it follow the common guidelines for RESTful APIs. Thus, interfacing other software with i2b2's custom RPC-style XML-API is a very cumbersome process. To overcome these issues, we developed a lightweight software abstraction layer "lightweight i2b2 façade" (li2b2-façade).

  7. 17 CFR 240.13b2-1 - Falsification of accounting records.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Falsification of accounting records. 240.13b2-1 Section 240.13b2-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Reports § 240.13b2-1 Falsification of accounting records. No person shall directly or indirectly...

  8. 26 CFR 1.669(b)-2 - Manner of exercising election.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Manner of exercising election. 1.669(b)-2 Section 1.669(b)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED... Years Beginning Before January 1, 1969 § 1.669(b)-2 Manner of exercising election. (a) By whom election...

  9. Managing Innovation Through Social Media in B2B SME-Context

    DEFF Research Database (Denmark)

    Lutz, Salla; Madsen, Svend Ole; Brink, Tove

    2015-01-01

    This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business mode...

  10. Lectin receptor kinase LecRK-b2 localizes to plasma membrane and ...

    African Journals Online (AJOL)

    -b2, has been characterized. Confocal microscopy images showed that the LecRK-b2-GFP fusion protein is localized to plasma membrane. The results of yeast 2 hybrid showed that lectin domain of LecRK-b2 had selfinteraction, while the ...

  11. Nd: YAG laser treatment of aluminium-TiB2 coated: optimization of corrosion properties

    CSIR Research Space (South Africa)

    Popoola, PAI

    2011-06-01

    Full Text Available . Eutectics of TiB2/Al and TiB2/Ti were observed. The results of the tests indicate that TiB2 reinforcement does not give significant increase in microhardness of aluminium. The corrosion resistance of a single laser trackline MMC in a 3.65 % NaCl solution...

  12. 17 CFR 240.15b2-2 - Inspection of newly registered brokers and dealers.

    Science.gov (United States)

    2010-04-01

    ... brokers and dealers. 240.15b2-2 Section 240.15b2-2 Commodity and Securities Exchanges SECURITIES AND... Regulations Under the Securities Exchange Act of 1934 Registration of Brokers and Dealers § 240.15b2-2 Inspection of newly registered brokers and dealers. (a) Definition. For the purpose of this section the term...

  13. Influence of boron addition on the grain refinement and mechanical properties of AZ91 Mg alloy

    International Nuclear Information System (INIS)

    Suresh, M.; Srinivasan, A.; Ravi, K.R.; Pillai, U.T.S.; Pai, B.C.

    2009-01-01

    This article reports the effect of boron addition on the grain refinement efficiency and mechanical properties of AZ91 magnesium alloy. The results show that the addition of boron in the form of Al-4B master alloy, significantly refines the grain size of AZ91 alloy. This refinement is due to the presence of AlB 2 particles, which act as potential nucleants for Mg grains. Improved mechanical properties are obtained with the addition of boron due to the finer grains.

  14. Wettability of zirconium diboride ceramics by Ag, Cu and their alloys with Zr

    International Nuclear Information System (INIS)

    Muolo, M.L.; Ferrera, E.; Novakovic, R.; Passerone, A.

    2003-01-01

    Sintered ZrB 2 ceramics, pure and with 4 wt.% Ni as sintering aid, have been tested in contact with liquid Ag, Cu, Ag-Cu and Ag-Cu-Zr. ''Pure'' ZrB 2 ceramics are wetted by Ag-Zr alloys, and ZrB 2 /Ni ceramics also by pure Cu. The wetting behaviour is briefly discussed in terms of existing wetting theories

  15. A new approach to MgB2 superconducting magnet fabrication

    International Nuclear Information System (INIS)

    Miyazoe, A; Ando, T; Wada, H; Abe, H; Hirota, N; Sekino, M

    2008-01-01

    Fabrication of MgB 2 -based superconducting magnets has been attempted by a new approach using film coated on symmetric tubes. Superconducting MgB 2 films have been prepared on iron substrates by electroplating in molten electrolytes. The critical current (I c ) of the MgB 2 electroplating films at 4.2 K and at self-field was 15 A on the basis of 1 μV/cm of I c criterion. A model calculation has shown that MgB 2 -based superconducting magnets based on MgB 2 electroplating films have the potential to generate magnetic fields over 0.5 T

  16. Transport properties and exponential n-values of Fe/MgB2 tapes with various MgB2 particle sizes

    International Nuclear Information System (INIS)

    Lezza, P.; Abaecherli, V.; Clayton, N.; Senatore, C.; Uglietti, D.; Suo, H.L.; Fluekiger, R.

    2004-01-01

    Fe/MgB 2 tapes have been prepared starting with pre-reacted binary MgB 2 powders. As shown by resistive and inductive measurements, the reduction of particle size to a few microns by ball milling has little influence on B c2 , while the superconducting properties of the individual MgB 2 grains are essentially unchanged. Reducing the particle size causes an enhancement of B irr from 14 to 16 T, while J c has considerably increased at high fields, its slope J c (B) being reduced. At 4.2 K, values of 5.3 x 10 4 and 1.2 x 10 3 A/cm 2 were measured at 3.5 and 10 T, respectively, suggesting a dominant role of the conditions at the grain interfaces. A systematic variation of these conditions at the interfaces is undertaken in order to determine the limit of transport properties for Fe/MgB 2 tapes. The addition of 5% Mg to MgB 2 powder was found to affect neither J c nor B c2 . For the tapes with the highest J c values, very high exponential n factors were measured: n=148, 89 and 17 at 3.5, 5 and 10 T, respectively and measurements of critical current versus applied strain have been performed. The mechanism leading to high transport critical current densities of filamentary Fe/MgB 2 tapes based on MgB 2 particles is discussed

  17. Ball-milling and AlB2 addition effects on the hydrogen sorption properties of the CaH2 + MgB2 system

    International Nuclear Information System (INIS)

    Schiavo, B.; Girella, A.; Agresti, F.; Capurso, G.; Milanese, C.

    2011-01-01

    Research highlights: → Calcium hydride + magnesium-aluminum borides as candidates for hydrogen storage. → Long time ball milling improves hydrogen sorption kinetics of the CaH 2 +MgB 2 system. → Coexistence of MgB 2 and AlB 2 does not improve hydrogen sorption performances. → Total substitution of MgB 2 with AlB 2 improves the system kinetics and reversibility. → Below 400 deg. C almost the full hydrogen capacity of the CaH 2 + AlB 2 system is reached. - Abstract: Among the borohydrides proposed for solid state hydrogen storage, Ca(BH 4 ) 2 is particularly interesting because of its favourable thermodynamics and relatively cheap price. Composite systems, where other species are present in addition to the borohydride, show some advantages in hydrogen sorption properties with respect to the borohydrides alone, despite a reduction of the theoretical storage capacity. We have investigated the milling time influence on the sorption properties of the CaH 2 + MgB 2 system from which Ca(BH 4 ) 2 and MgH 2 can be synthesized by hydrogen absorption process. Manometric and calorimetric measurements showed better kinetics for long time milled samples. We found that the total substitution of MgB 2 with AlB 2 in the starting material can improve the sorption properties significantly, while the co-existence of both magnesium and aluminum borides in the starting mixture did not cause any improvement. Rietveld refinements of the X-ray powder diffraction spectra were used to confirm the hypothesized reactions.

  18. Synergistic alloying effect on microstructural evolution and mechanical properties of Cu precipitation-strengthened ferritic alloys

    International Nuclear Information System (INIS)

    Wen, Y.R.; Li, Y.P.; Hirata, A.; Zhang, Y.; Fujita, T.; Furuhara, T.; Liu, C.T.; Chiba, A.; Chen, M.W.

    2013-01-01

    We report the influence of alloying elements (Ni, Al and Mn) on the microstructural evolution of Cu-rich nanoprecipitates and the mechanical properties of Fe–Cu-based ferritic alloys. It was found that individual additions of Ni and Al do not give rise to an obvious strengthening effect, compared with the binary Fe–Cu parent alloy, although Ni segregates at the precipitate/matrix interface and Al partitions into Cu-rich precipitates. In contrast, the co-addition of Ni and Al results in the formation of core–shell nanoprecipitates with a Cu-rich core and a B2 Ni–Al shell, leading to a dramatic improvement in strength. The coarsening rate of the core–shell precipitates is about two orders of magnitude lower than that of monolithic Cu-rich precipitates in the binary and ternary Fe–Cu alloys. Reinforcement of the B2 Ni–Al shells by Mn partitioning further improves the strength of the precipitation-strengthened alloys by forming ultrastable and high number density core–shell nanoprecipitates

  19. Fusion welding of Fe-added lap joints between AZ31B magnesium alloy and 6061 aluminum alloy by hybrid laser-tungsten inert gas welding technique

    International Nuclear Information System (INIS)

    Qi, Xiao-dong; Liu, Li-ming

    2012-01-01

    Highlights: → Hybrid Laser-TIG fusion welding technique was used for joining Mg to Al alloys. → Laser defocusing amount determined penetration depth inside Al alloy of joints. → The addition of Fe interlayer suppressed Mg-Al intermetallics greatly in joints. → A maximum joint strength with optimum thickness of Fe interlayer was obtained. → Excessive addition of Fe interlayer was adverse for the strength improvement. -- Abstract: AZ31B magnesium alloy and 6061-T6 aluminum alloy were lap joined together with the addition of Fe interlayer by fusion welding of hybrid laser-tungsten inert gas (TIG) technique. The influence of location of laser focal spot (LFS) on joint penetration depth and that of the depth on joint strength were investigated. The results showed that when the LFS was just on the surface of Al plate, the deepest penetration could be obtained, which contributed to the improvement of shear strength of Fe-added joints, but not to the elevation of the strength of Mg/Al direct joints. The addition of Fe interlayer suppressed massive production of Mg-Al intermetallics but produced Fe-Al intermetallics in the fusion zone of the joints, whose micro-hardness was extremely high and was also adverse for the enhancement of joint shear strength. The effect of Fe-interlayer thickness on the joint shear strength was also examined, and the maximum shear strength of Fe-added joint could achieve 100 MPa with 0.13 mm thick Fe interlayer. The fracture modes of 0.07 and 0.13 mm Fe-interlayer-added joints were both quasi-cleavage, while those of direct and 0.22 mm interlayer-added joints were completely cleavage. The theoretical shear strength of the Fe-added joints was also discussed.

  20. High pressure studies of A2Mo3O12 negative thermal expansion materials (A2=Al2, Fe2, FeAl, AlGa)

    International Nuclear Information System (INIS)

    Young, Lindsay; Gadient, Jennifer; Gao, Xiaodong; Lind, Cora

    2016-01-01

    High pressure powder X-ray diffraction studies of several A 2 Mo 3 O 12 materials (A 2 =Al 2 , Fe 2 , FeAl, and AlGa) were conducted up to 6–7 GPa. All materials adopted a monoclinic structure under ambient conditions, and displayed similar phase transition behavior upon compression. The initial isotropic compressibility first became anisotropic, followed by a small but distinct drop in cell volume. These patterns could be described by a distorted variant of the ambient pressure polymorph. At higher pressures, a distinct high pressure phase formed. Indexing results confirmed that all materials adopted the same high pressure phase. All changes were reversible on decompression, although some hysteresis was observed. The similarity of the high pressure cells to previously reported Ga 2 Mo 3 O 12 suggested that this material undergoes the same sequence of transitions as all materials investigated in this paper. It was found that the transition pressures for all phase changes increased with decreasing radius of the A-site cations. - Graphical abstract: Overlay of variable pressure X-ray diffraction data of Al 2 Mo 3 O 12 collected in a diamond anvil cell. Both subtle and discontinuous phase transitions are clearly observed. - Highlights: • The high pressure behavior of A 2 Mo 3 O 12 (A=Al, Fe, (AlGa), (AlFe)) was studied. • All compounds undergo the same sequence of pressure-induced phase transitions. • The phase transition pressures correlate with the average size of the A-site cation. • All transitions were reversible with hysteresis. • Previously studied Ga 2 Mo 3 O 12 undergoes the same sequence of transitions.

  1. Thickness Dependence of the Dzyaloshinskii-Moriya Interaction in Co2 FeAl Ultrathin Films: Effects of Annealing Temperature and Heavy-Metal Material

    Science.gov (United States)

    Belmeguenai, M.; Roussigné, Y.; Bouloussa, H.; Chérif, S. M.; Stashkevich, A.; Nasui, M.; Gabor, M. S.; Mora-Hernández, A.; Nicholson, B.; Inyang, O.-O.; Hindmarch, A. T.; Bouchenoire, L.

    2018-04-01

    The interfacial Dzyaloshinskii-Moriya interaction (IDMI) is investigated in Co2FeAl (CFA) ultrathin films of various thicknesses (0.8 nm ≤tCFA≤2 nm ) grown by sputtering on Si substrates, using Pt, W, Ir, and MgO buffer or/and capping layers. Vibrating sample magnetometry reveals that the magnetization at saturation (Ms ) for the Pt- and Ir-buffered films is higher than the usual Ms of CFA due to the proximity-induced magnetization (PIM) in Ir and Pt estimated to be 19% and 27%, respectively. The presence of PIM in these materials is confirmed using x-ray resonant magnetic reflectivity. Moreover, while no PIM is induced in W, higher PIM is obtained with Pt when it is used as a buffer layer rather than a capping layer. Brillouin light scattering in the Damon-Eshbach geometry is used to investigate the thickness dependences of the IDMI constants from the spin-wave nonreciprocity and the perpendicular anisotropy field versus the annealing temperature. The IDMI sign is found to be negative for Pt /CFA and Ir /CFA , while it is positive for W /CFA . The thickness dependence of the effective IDMI constant for stacks involving Pt and W shows the existence of two regimes similar to that of the perpendicular anisotropy constant due to the degradation of the interfaces as the CFA thickness approaches a critical thickness. The surface IDMI and anisotropy constants of each stack are determined for the thickest samples where a linear thickness dependence of the effective IDMI constant and the effective magnetization are observed. The interface anisotropy and IDMI constants investigated for the Pt /CFA /MgO system show different trends with the annealing temperature. The decrease of the IDMI constant with increasing annealing temperature is probably due to the electronic structure changes at the interfaces, while the increase of the interface anisotropy constant is coherent with the interface quality and disorder enhancement.

  2. First-principles studies for the stability of a graphene-like boron layer on CrB2(0001) and MoB2(0001)

    International Nuclear Information System (INIS)

    Qin Na; Liu Shiyu; Li Zhen; Zhao Hui; Wang Sanwu

    2011-01-01

    With extensive first-principles density-functional-theory calculations, we investigate the stability and the atomic and electronic structures of the CrB 2 (0001) and MoB 2 (0001) surfaces, each with two different terminations. It is found that the boron-terminated surface is energetically more favorable over the wide range of thermodynamically allowed chemical potentials than the metal-terminated surface for both CrB 2 (0001) and MoB 2 (0001), suggesting a stable layer of graphene-like boron on the surfaces. Our results also show the similarities and the differences in relaxation and in bonding characteristics between the boron-terminated and metal-terminated surfaces.

  3. Isothermal section of the Ti-Si-B system at 1250 ° C in the Ti-TiSi2-TiB2 region

    OpenAIRE

    Ramos, Alfeu Saraiva; Baldan, Renato; Nunes, Carlos Angelo; Coelho, Gilberto Carvalho; Suzuki, Paulo Atsushi; Rodrigues, Geovani

    2013-01-01

    A partial isothermal section (Ti-TiSi2-TiB2 region) of the ternary Ti-Si-B system at 1250 ° C was determined from heat-treated alloys prepared via arc melting. Microstructural characterization has been carried out through scanning electron microscopy (SEM), x-ray diffraction (xRD) and wavelength dispersive spectrometry (WDS). The results have shown the stability of the near stoichiometric Ti6Si2B phase and a negligible solubility of boron in the Ti-silicides as well as of Si in the Ti-borides...

  4. [[Length polymorphism of minisatellite repeat B2-VNTR of the bradykinin B2 receptor gene in healthy Russians and in patients with coronary heart disease].

    Science.gov (United States)

    Suchkova, I O; Pavlinova, L I; Larionova, E E; Alenina, N V; Solov'ev, K V; Baranova, T V; Belotserkovskaia, E V; Sasina, L K; Bader, M; Denisenko, A D; Mustafina, O E; Khusnutdinova, E K; Patkin, E L

    2014-01-01

    Bradykinin B2 receptor is involved in many processes, including the regulation of blood pressure and smooth muscle contraction, vasodilation, inflammation, edema, cell proliferation, pain. It is suggested that this receptor may be one of the factors that have cardioprotective and infarct-limiting effects. It is assumed that certain genetic variants in both coding and non-coding regions ofBDKRB2 gene may influence its expression. In the 3'-untranslated region of BDKRB2 exon 3 the minisatellite repeat B2-VNTR is located. B2-VNTR has previously been shown to affect the BDKRB2 mRNA stability. Therefore, it is important to perform the molecular genetic analysis of this minisatellite in patients with different forms of coronary heart disease in order to reveal possible associations between specific B2-VNTR alleles and certain clinical forms of coronary heart disease. In the present study, a comparative analysis of the allele and genotype frequencies of B2-VNTR was carried out in groups of healthy individuals and patients with two clinical forms of coronary heart disease (angina pectoris and myocardial infarction), ethnically Russian. The results of the B2-VNTR length polymorphism analysis indicate that this tandem repeat may be attributed to a class of low polymorphic and non-hypervariable minisatellite. In all analyzed groups we revealed three B2-VNTR alleles, consisting of 43, 38 and 33 repeat units. Alleles of 43 and 33 repeats were major in all investigated groups. No statistically significant differences were found in the B2-VNTR allele and genotype frequencies between men and women in control group, and also between healthy men and men with angina pectoris and myocardial infarction. Thus, B2-VNTR length polymorphism was not associated with these clinical forms of coronary heart disease in Russian men. However, we do not exclude the possibility of association between the B2-VNTR short alleles (38 and 33 repeats) and cardioprotective effects of bradykinin B2 receptor

  5. Nanodispersed boriding of titanium alloy

    International Nuclear Information System (INIS)

    Kostyuk, K.O.; Kostyuk, V.O.

    2015-01-01

    The problem of improving the operational reliability of machines is becoming increasingly important due to the increased mechanical, thermal and other loads on the details. There are many surface hardening methods for machines parts which breakdown begins with surface corruption. The most promising methods are chemical-thermal treatment. The aim of this work is to study the impact of boriding on the structure and properties of titanium alloy. Materials and Methods: The material of this study is VT3-1 titanium alloy. The boriding were conducted using nanodispersed powder blend based on boric substances. It is established that boriding of paste compounds allows obtaining the surface hardness within 30 - 29 GPa and with declining to 27- 26 GPa in layer to the transition zone (with total thickness up to 110 μm) owing to changes of the layer phase composition where T 2 B, TiB, TiB 2 titanium borides are formed. The increasing of chemical-thermal treatment time from 15 minutes to 2 hours leads to thickening of the borated layer (30 - 110 μm) and transition zone (30 - 190 μm). Due to usage of nanodispersed boric powder, the boriding duration is decreasing in 2 - 3 times. This allows saving time and electric energy. The developed optimal mode of boriding the VT3-1 titanium alloy allows obtaining the required operational characteristics and to combine the saturation of the surface layer with atomic boron and hardening

  6. Electronic structure, chemical bonding, phase stability, and ground-state properties of YNi2-x(Co/Cu)xB2C

    International Nuclear Information System (INIS)

    Ravindran, P.; Johansson, B.; Eriksson, O.

    1998-01-01

    In order to understand the role of Ni site substitution on the electronic structure and chemical bonding in YNi 2 B 2 C, we have made systematic electronic-structure studies on YNi 2 B 2 C as a function of Co and Cu substitution using the supercell approach within the local density approximation. The equilibrium volume, bulk modulus (B 0 ) and its pressure derivative (B 0 ' ), Grueneisen constant (γ G ), Debye temperature (Θ D ), cohesive energy (E c ), and heat of formation (ΔH) are calculated for YNi 2-x (Co/Cu) x B 2 C (x=0,0.5,1.0,1.5,2). From the total energy, electron-energy band structure, site decomposed density of states, and charge-density contour we have analyzed the structural stability and chemical bonding behavior of YNi 2 B 2 C as a function of Co/Cu substitution. We find that the simple rigid band model successfully explains the electronic structure and structural stability of Co/Cu substitution for Ni. In addition to studying the chemical bonding and electronic structure we present a somewhat speculative analysis of the general trends in the behavior of critical temperature for superconductivity as a function of alloying. copyright 1998 The American Physical Society

  7. Note: Progress on the use of MgB2 superconducting joint technique for the development of MgB2 magnets for magnetic resonance imaging (MRI).

    Science.gov (United States)

    Kim, Y G; Song, J B; Kim, J C; Kim, J M; Yoo, B H; Yun, S B; Hwang, D Y; Lee, H G

    2017-08-01

    This note presents a superconducting joint technique for the development of MgB 2 magnetic resonance imaging (MRI) magnets. The MgB 2 superconducting joint was fabricated by a powder processing method using Mg and B powders to establish a wire-bulk-wire connection. The joint resistance measured using a field-decay method was magnets operating in the persistent current mode.

  8. Cloning and Expression of ORFV B2L Gene%羊口疮病毒B2L基因克隆及表达

    Institute of Scientific and Technical Information of China (English)

    赵文博; 李瑞航; 贺鹏亮; 李朋娅; 王梦醒; 杨春华; 于永忠; 崔玉东

    2015-01-01

    为了获得羊口疮病毒囊膜蛋白。以羊口疮病毒基因组为模板,利用羊口疮病毒B2L基因特异性引物,进行PCR扩增,回收以及纯化PCR产物,连接到PMD18-T载体上,测序结果表明B2L基因全长1137 bp,编码379个氨基酸。再将B2L基因克隆至pET-30a,构建原核表达载体pET30a-B2L。经菌液PCR、酶切鉴定以及SDS-PAGE等方法表明成功构建原核表达载体,这将为今后的单抗制备以及羊口疮病毒的疫苗研究打下基础。%To obtain ORFV envelope protein and take ORFV genome as template,ORFV B2L gene was used as specific primers to amplify PCR and recovery and purify PCR products. Connected PCR products to PMD18-T vector,the sequence result showed that full-length of B2L gene was 1137 bp,and Encoding was 379 amino acids. B2L gene was cloned into pET-30a to construct prokaryotic expression vector pET30a-B2L. Prokaryotic expression vector was constructed by the methods of bacterium liquid PCR, enzyme identification and SDS-PAGE,which would provide the research basis of monoclonal antibody and ORFV vaccine in the future.

  9. Role of Erbin in ErbB2-dependent breast tumor growth

    Science.gov (United States)

    Tao, Yanmei; Shen, Chengyong; Luo, Shiwen; Traoré, Wilfried; Marchetto, Sylvie; Santoni, Marie-Josée; Xu, Linlin; Wu, Biao; Shi, Chao; Mei, Jinghong; Bates, Ryan; Liu, Xihui; Zhao, Kai; Xiong, Wen-Cheng; Borg, Jean-Paul; Mei, Lin

    2014-01-01

    ErbB2 (v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2), a receptor tyrosine kinase of the ErbB family, is overexpressed in around 25% of breast cancers. In addition to forming a heterodimer with other ErbB receptors in response to ligand stimulation, ErbB2 can be activated in a ligand-independent manner. We report here that Erbin, an ErbB2-interacting protein that was thought to act as an antitumor factor, is specifically expressed in mammary luminal epithelial cells and facilitates ErbB2-dependent proliferation of breast cancer cells and tumorigenesis in MMTV-neu transgenic mice. Disruption of their interaction decreases ErbB2-dependent proliferation, and deletion of the PDZ domain in Erbin hinders ErbB2-dependent tumor development in MMTV-neu mice. Mechanistically, Erbin forms a complex with ErbB2, promotes its interaction with the chaperon protein HSP90, and thus prevents its degradation. Finally, ErbB2 and Erbin expression correlates in human breast tumor tissues. Together, these observations establish Erbin as an ErbB2 regulator for breast tumor formation and progression. PMID:25288731

  10. Preparation and Microstructure of Porous ZrB2 Ceramics Using Reactive Spark Plasma Sintering Method

    Institute of Scientific and Technical Information of China (English)

    YUAN Huiping; LI Junguo; SHEN Qiang; ZHANG Lianmeng

    2015-01-01

    Zirconium oxide (ZrO2) and boron carbide (B4C) were added to ZrB2 raw powders to prepare ZrB2 porous ceramics by reactive spark plasma sintering (RSPS). The reactions between ZrO2 and B4C which produce ZrB2 and gas (such as CO and B2O3) result in pore formation. X-Ray Diffraction results indicated that the products phase was ZrB2 and the reaction was completed after the RSPS process. The porosity could be controlled by changing the ratio of synthesized ZrB2 to raw ZrB2 powders. The porosity of porous ceramics with 20 wt% and 40 wt% synthsized ZrB2 are 0.185 and 0.222, respectivly. And dense ZrB2-SiC ceramic with a porosity of 0.057 was prepared under the same conditions for comparison. The pores were homogeneously distributed within the microstructure of the porous ceramics. The results indicate a promising method for preparing porous ZrB2-based ceramics.

  11. Microhardness and microstructure evolution of TiB2 reinforced Inconel 625/TiB2 composite produced by selective laser melting

    Science.gov (United States)

    Zhang, Baicheng; Bi, Guijun; Nai, Sharon; Sun, Chen-nan; Wei, Jun

    2016-06-01

    In this study, micron-size TiB2 particles were utilized to reinforce Inconel 625 produced by selective laser melting. Exceptional microhardness 600-700 HV0.3 of the composite was obtained. In further investigation, the microstructure and mechanical properties of Inconel 625/TiB2 composite can be significantly influenced by addition of TiB2 particles during SLM. It was found that the long directional columnar grains observed from SLM-processed Inconel 625 were totally changed to fine dendritic matrix due to the addition of TiB2 particles. Moreover, with laser energy density (LED) of 1200 J/m, a Ti, Mo rich interface around TiB2 particles with fine thickness can be observed by FESEM and EDS. The microstructure evolution can be determined by different laser energy density (LED): under 1200 J/m, γ phase in dendrite grains; under 600 J/m, γ phase in combination of dendritic and acicular grains; under 400 J/m, γ phase acicular grains. Under optimized LED 1200 J/m, the dynamic nanohardness (8.62 GPa) and elastic modulus (167 GPa) of SLM-processed Inconel 625/TiB2 composite are higher compared with those of SLM-processed Inconel 625 (3.97 GPa and 135 GPa, respectively).

  12. Lattice Thermal Conductivity of Ultra High Temperature Ceramics (UHTC) ZrB2 and HfB2 from Atomistic Simulations

    Science.gov (United States)

    Lawson, John W.; Daw, Murray S.; Bauschlicher, Charles W.

    2012-01-01

    Ultra high temperature ceramics (UHTC) including ZrB2 and HfB2 have a number of properties that make them attractive for applications in extreme environments. One such property is their high thermal conductivity. Computational modeling of these materials will facilitate understanding of fundamental mechanisms, elucidate structure-property relationships, and ultimately accelerate the materials design cycle. Progress in computational modeling of UHTCs however has been limited in part due to the absence of suitable interatomic potentials. Recently, we developed Tersoff style parameterizations of such potentials for both ZrB2 and HfB2 appropriate for atomistic simulations. As an application, Green-Kubo molecular dynamics simulations were performed to evaluate the lattice thermal conductivity for single crystals of ZrB2 and HfB2. The atomic mass difference in these binary compounds leads to oscillations in the time correlation function of the heat current, in contrast to the more typical monotonic decay seen in monoatomic materials such as Silicon, for example. Results at room temperature and at elevated temperatures will be reported.

  13. Heat treatment influence on the structural and magnetic properties of the intermetallic Fe56.25Al43.75 alloy prepared by mechanical alloying and arc-melted

    Science.gov (United States)

    Trujillo Hernández, J. S.; Tabares, J. A.; Pérez Alcázar, G. A.

    2014-04-01

    Alloys of the Fe56.25Al43.75 system were prepared by mechanical alloying (MA) using a high energy planetary ball mill, with milling times in the range from 12 up to 96 h named MA0 samples. The sample milled for 48 hours was heat treated at 700 °C for 9 days. Then this sample was milled for times of 1, 4, 8, 12, 24, and 48 h, named MA1 samples. Additionally, and for comparison, it was prepared a Fe56.25Al43.75 sample by arc-melting method. For all samples, the structural and magnetic study was conducted by X-rays diffraction (XRD) and Mössbauer spectrometry (MS). The XRD results show that the system is nanostructured and the MA0 samples present only the BCC disordered phase, whose lattice parameter remains relatively constant with milling time. For MA1 samples it was identify the FeAl, Fe3Al, FeO and α-Fe phases. The Mössbauer spectra for all samples were fitted by using a hyperfine magnetic field distribution (HMFD), and a paramagnetic site for all the times used here. The ferromagnetism increases when milling time increases, and this is a consequence of the structural disorder induced by mechanical alloying.

  14. Developing precipitation hardenable high entropy alloys

    Science.gov (United States)

    Gwalani, Bharat

    High entropy alloys (HEAs) is a concept wherein alloys are constructed with five or more elements mixed in equal proportions; these are also known as multi-principle elements (MPEs) or complex concentrated alloys (CCAs). This PhD thesis dissertation presents research conducted to develop precipitation-hardenable high entropy alloys using a much-studied fcc-based equi-atomic quaternary alloy (CoCrFeNi). Minor additions of aluminium make the alloy amenable for precipitating ordered intermetallic phases in an fcc matrix. Aluminum also affects grain growth kinetics and Hall-Petch hardenability. The use of a combinatorial approach for assessing composition-microstructure-property relationships in high entropy alloys, or more broadly in complex concentrated alloys; using laser deposited compositionally graded AlxCrCuFeNi 2 (0 mechanically processed via conventional techniques. The phase stability and mechanical properties of these alloys have been investigated and will be presented. Additionally, the activation energy for grain growth as a function of Al content in these complex alloys has also been investigated. Change in fcc grain growth kinetic was studied as a function of aluminum; the apparent activation energy for grain growth increases by about three times going from Al0.1CoCrFeNi (3% Al (at%)) to Al0.3CoCrFeNi. (7% Al (at%)). Furthermore, Al addition leads to the precipitation of highly refined ordered L12 (gamma') and B2 precipitates in Al0.3CoCrFeNi. A detailed investigation of precipitation of the ordered phases in Al0.3CoCrFeNi and their thermal stability is done using atom probe tomography (APT), transmission electron microscopy (TEM) and Synchrotron X-ray in situ and ex situ analyses. The alloy strengthened via grain boundary strengthening following the Hall-Petch relationship offers a large increment of strength with small variation in grain size. Tensile strength of the Al0.3CoFeNi is increased by 50% on precipitation fine-scale gamma' precipitates

  15. Preubiquitinated chimeric ErbB2 is constitutively endocytosed and subsequently degraded in lysosomes

    Energy Technology Data Exchange (ETDEWEB)

    Vuong, Tram Thu [Institute of Clinical Medicine, University of Oslo, Rikshospitalet, 0027 Oslo (Norway); Berger, Christian [Department of Pathology, Oslo University Hospital, Rikshospitalet, P.O. Box 4950 Nydalen, 0424 Oslo (Norway); Bertelsen, Vibeke; Rødland, Marianne Skeie [Institute of Clinical Medicine, University of Oslo, Rikshospitalet, 0027 Oslo (Norway); Stang, Espen [Department of Pathology, Oslo University Hospital, Rikshospitalet, P.O. Box 4950 Nydalen, 0424 Oslo (Norway); Madshus, Inger Helene, E-mail: i.h.madshus@medisin.uio.no [Institute of Clinical Medicine, University of Oslo, Rikshospitalet, 0027 Oslo (Norway); Department of Pathology, Oslo University Hospital, Rikshospitalet, P.O. Box 4950 Nydalen, 0424 Oslo (Norway)

    2013-02-01

    The oncoprotein ErbB2 is endocytosis-deficient, probably due to its interaction with Heat shock protein 90. We previously demonstrated that clathrin-dependent endocytosis of ErbB2 is induced upon incubation of cells with Ansamycin derivatives, such as geldanamycin and its derivative 17-AAG. Furthermore, we have previously demonstrated that a preubiquitinated chimeric EGFR (EGFR-Ub{sub 4}) is constitutively endocytosed in a clathrin-dependent manner. We now demonstrate that also an ErbB2-Ub{sub 4} chimera is endocytosed constitutively and clathrin-dependently. Upon expression, the ErbB2-Ub{sub 4} was further ubiquitinated, and by Western blotting, we demonstrated the formation of both Lys48-linked and Lys63-linked polyubiquitin chains. ErbB2-Ub{sub 4} was constitutively internalized and eventually sorted to late endosomes and lysosomes where the fusion protein was degraded. ErbB2-Ub{sub 4} was not cleaved prior to internalization. Interestingly, over-expression of Ubiquitin Interaction Motif-containing dominant negative fragments of the clathrin adaptor proteins epsin1 and Eps15 negatively affected endocytosis of ErbB2. Altogether, this argues that ubiquitination is sufficient to induce clathrin-mediated endocytosis and lysosomal degradation of the otherwise plasma membrane localized ErbB2. Also, it appears that C-terminal cleavage is not required for endocytosis. -- Highlights: ► A chimera containing ErbB2 and a tetra-Ubiquitin chain internalizes constitutively. ► Receptor fragmentation is not required for endocytosis of ErbB2. ► Ubiquitination is sufficient to induce endocytosis and degradation of ErbB2. ► ErbB2-Ub4 is internalized clathrin-dependently.

  16. Evolution, development, and communication of branding in B2B markets

    OpenAIRE

    Seyedghorban, Zahra

    2017-01-01

    While, branding was traditionally viewed as having limited significance in business-to-business (B2B) markets, existing research not only acknowledges its existence, but emphasises its strategic importance in enhancing organisations’ competitive positions and financial performance. Given the fragmented research on B2B branding, there is a need to first provide a comprehensive review of B2B branding literature as a field of study by conducting a bibliometric investigation (Essay 1). The result...

  17. Preubiquitinated chimeric ErbB2 is constitutively endocytosed and subsequently degraded in lysosomes

    International Nuclear Information System (INIS)

    Vuong, Tram Thu; Berger, Christian; Bertelsen, Vibeke; Rødland, Marianne Skeie; Stang, Espen; Madshus, Inger Helene

    2013-01-01

    The oncoprotein ErbB2 is endocytosis-deficient, probably due to its interaction with Heat shock protein 90. We previously demonstrated that clathrin-dependent endocytosis of ErbB2 is induced upon incubation of cells with Ansamycin derivatives, such as geldanamycin and its derivative 17-AAG. Furthermore, we have previously demonstrated that a preubiquitinated chimeric EGFR (EGFR-Ub 4 ) is constitutively endocytosed in a clathrin-dependent manner. We now demonstrate that also an ErbB2-Ub 4 chimera is endocytosed constitutively and clathrin-dependently. Upon expression, the ErbB2-Ub 4 was further ubiquitinated, and by Western blotting, we demonstrated the formation of both Lys48-linked and Lys63-linked polyubiquitin chains. ErbB2-Ub 4 was constitutively internalized and eventually sorted to late endosomes and lysosomes where the fusion protein was degraded. ErbB2-Ub 4 was not cleaved prior to internalization. Interestingly, over-expression of Ubiquitin Interaction Motif-containing dominant negative fragments of the clathrin adaptor proteins epsin1 and Eps15 negatively affected endocytosis of ErbB2. Altogether, this argues that ubiquitination is sufficient to induce clathrin-mediated endocytosis and lysosomal degradation of the otherwise plasma membrane localized ErbB2. Also, it appears that C-terminal cleavage is not required for endocytosis. -- Highlights: ► A chimera containing ErbB2 and a tetra-Ubiquitin chain internalizes constitutively. ► Receptor fragmentation is not required for endocytosis of ErbB2. ► Ubiquitination is sufficient to induce endocytosis and degradation of ErbB2. ► ErbB2-Ub4 is internalized clathrin-dependently.

  18. Study of Microstructure of the Al-Fe Alloys After Hot Rolling Deformation

    Science.gov (United States)

    Jabłońska, Magdalena Barbara; Rodak, Kinga; Bednarczyk, Iwona

    The aim of the paper is a microstructure analysis of alloys from the Al-Fe system after hot rolling tests, conducted by using a scanning transmission electron microscopy STEM and scanning electron microscope equipped with EBSD detector. Hot rolling was carried out at Technical University of Ostrava, Faculty of Metallurgy and Material Engineering, Institute of Modelling and Control of Forming Processes. The samples were heated to a temperature of 1200°C. The EBSD and STEM techniques have been applied in order to determine the influence of chemical composition and deformation parameters on structural changes. The microstructure analysis has included parameters such us: grain/sub-grain size, area fraction of grains/subgrains, misorientation angles, grains/subgrains shape aspect ratio and dislocations structure. The research structure techniques in scanning-transmission electron microscopy revealed numerous FeAl28 alloy phase separations of secondary nucleating sites favoured energetically, which are the boundary of grains/subgrains and dislocations. These changes in the structure of the test results have been confirmed by EBSD, which revealed the presence of grains/subgrains misorientation angle boundaries above 15°.

  19. Translating VDM to Alloy

    DEFF Research Database (Denmark)

    Lausdahl, Kenneth

    2013-01-01

    specifications. However, to take advantage of the automated analysis of Alloy, the model-oriented VDM specifications must be translated into a constraint-based Alloy specifications. We describe how a sub- set of VDM can be translated into Alloy and how assertions can be expressed in VDM and checked by the Alloy...

  20. Desarrollo y caracterización de un material compuesto de matriz de aluminio 6061 y partículas de TiB2

    Directory of Open Access Journals (Sweden)

    Plaza, L. M.

    2010-12-01

    Full Text Available The incorporation of ceramic particles has been one of the ways developed to improve the mechanical properties of aluminium alloys during the last years. The main objective of this work has been to develop the manufacturing process of the reinforced aluminium alloy and analyse its mechanical properties and microstructure. Details about an innovative MMC manufacturing process and the results obtained in the development of a new family of TiB2- reinforced aluminium alloys for forging and extrusion applications are presented. It has been observed that the considered manufacturing process, consisting in the fabrication of particles by SHS and their incorporation into the selected alloy, is a feasible process to manufacture reinforced alloys that can be subsequently extruded or forged. The final result is the development of a material suitable for extrusion and forging applications and that presents an improvement of fatigue and tensile properties of the matrix alloy.Una de las vías desarrolladas, en los últimos años, para la mejora de las propiedades mecánicas de las aleaciones de aluminio es la de la incorporación de refuerzos cerámicos en forma de partículas cerámicas. El objetivo principal del trabajo ha sido desarrollar el proceso de fabricación de una aleación de aluminio 6061 reforzada con partículas de diboruro de titanio, TiB2, y analizar las propiedades del material obtenido. Se ha observado que el proceso de fabricación planteado, consistente en la fabricación de las partículas por medio del proceso de síntesis autopropagada a alta temperatura SHS (Self propagating high temperature synthesis y su posterior incorporación a la aleación 6061, es un proceso viable para la fabricación de aleaciones reforzadas adecuadas para la realización de procesos subsiguientes de extrusión o forja. El resultado final es la obtención de un material adecuado para la fabricación de componentes extruidos y que presenta una mejora de sus

  1. Al-doped MgB_2 materials studied using electron paramagnetic resonance and Raman spectroscopy

    International Nuclear Information System (INIS)

    Bateni, Ali; Somer, Mehmet; Erdem, Emre; Repp, Sergej; Weber, Stefan

    2016-01-01

    Undoped and aluminum (Al) doped magnesium diboride (MgB_2) samples were synthesized using a high-temperature solid-state synthesis method. The microscopic defect structures of Al-doped MgB_2 samples were systematically investigated using X-ray powder diffraction, Raman spectroscopy, and electron paramagnetic resonance. It was found that Mg-vacancies are responsible for defect-induced peculiarities in MgB_2. Above a certain level of Al doping, enhanced conductive properties of MgB_2 disappear due to filling of vacancies or trapping of Al in Mg-related vacancy sites.

  2. Electronic and structural properties of TiB2: Bulk, surface, and nanoscale effects

    International Nuclear Information System (INIS)

    Volonakis, George; Tsetseris, Leonidas; Logothetidis, Stergios

    2011-01-01

    Titanium diboride (TiB 2 ), is a widely used hard material that comprises graphene-like layers of B and intercalated Ti atoms. Here we report the results of extensive first-principles calculations on key properties of bulk TiB 2 , TiB 2 surfaces, and TiB 2 nanocrystals (NCs). The computational approach is first validated based on the agreement between calculated structural and electronic properties of bulk TiB 2 and available experimental and theoretical data. We then obtain the formation energies for several surface cuts and use these values to construct TiB 2 NCs based on the Wulff theorem. Finally, we demonstrate by studying the adsorption of small molecules that hydrogen and oxygen adatoms can be attached through strongly exothermic chemisorption reactions on TiB 2 surfaces. Likewise, water molecules bind on various TiB 2 surfaces and NC facets, with an energetic preference for the latter. The results are relevant to applications that depend on reactivity-related TiB 2 properties, for example resistance to corrosion and interactions with water-based solutions.

  3. Study of preparation of TiB2 by TiC in Al melts

    International Nuclear Information System (INIS)

    Ding Haimin; Liu Xiangfa; Nie Jinfeng

    2012-01-01

    TiB 2 particles are prepared by TiC in Al melts and the characteristics of them are studied. It is found that TiC particles are unstable when boron exists in Al melts with high temperature and will transform to TiB 2 and Al 4 C 3 . Most of the synthesized TiB 2 particles are regular hexagonal prisms with submicron size. The diameter of the undersurfaces of these prisms is ranging from 200 nm to 1 μm and the height is ranging from 100 nm to 300 nm. It is considered that controlling the transformation from TiC to TiB 2 is an effective method to prepare small and uniform TiB 2 particles. - Highlights: ► TiC can easily transform into TiB 2 in Al melts. ► TiB 2 formed by TiC will grow into regular hexagonal prisms with submicron size. ► Controlling the transformation from TiC to TiB 2 is an effective method to prepare small and uniform TiB 2 particles.

  4. First-principles calculations for elastic properties of OsB2 under pressure

    International Nuclear Information System (INIS)

    Yang Junwei; Chen Xiangrong; Luo Fen; Ji Guangfu

    2009-01-01

    The structure, elastic properties and elastic anisotropy of orthorhombic OsB 2 are investigated by density functional theory method with the ultrasoft pseudopotential scheme in the frame of the generalized gradient approximation (GGA) as well as local density approximation (LDA). The obtained structural parameters, elastic constants, elastic anisotropy and Debye temperature for OsB 2 under pressure are consistent with the available experimental data and other theoretical results. It is found that the elastic constants, bulk modulus and Debye temperature of OsB 2 tend to increase with increasing pressure. It is predicted that OsB 2 is not a superhard material from our calculations.

  5. First-principles calculations for elastic properties of OsB 2 under pressure

    Science.gov (United States)

    Yang, Jun-Wei; Chen, Xiang-Rong; Luo, Fen; Ji, Guang-Fu

    2009-11-01

    The structure, elastic properties and elastic anisotropy of orthorhombic OsB 2 are investigated by density functional theory method with the ultrasoft pseudopotential scheme in the frame of the generalized gradient approximation (GGA) as well as local density approximation (LDA). The obtained structural parameters, elastic constants, elastic anisotropy and Debye temperature for OsB 2 under pressure are consistent with the available experimental data and other theoretical results. It is found that the elastic constants, bulk modulus and Debye temperature of OsB 2 tend to increase with increasing pressure. It is predicted that OsB 2 is not a superhard material from our calculations.

  6. Chemically vapor-deposited ZrB2 as a selective solar absorber

    International Nuclear Information System (INIS)

    Randich, E.; Allred, D.D.

    1981-01-01

    Coatings of ZrB 2 and TiB 2 for photothermal solar absorber applications were prepared using chemical vapor deposition (CVD) techniques. Oxidation tests suggest a maximum temperature limit for air exposure of 600 K for TiB 2 and 800 K for ZrB 2 . Both materials exhibit innate spectral selectivity with an emittance at 375 K ranging from 0.06 to 0.09, a solar absorptance for ZrB 2 ranging from 0.67 to 0.77 and a solar absorptance for TiB 2 ranging from 0.46 to 0.59. ZrB 2 has better solar selectivity and more desirable oxidation behavior than TiB 2 . A 0.071 μm antireflection coating of Si 3 N 4 deposited onto the ZrB 2 coating leads to an increase in absorptance from 0.77 to 0.93, while the emittance remains unchanged. (Auth.)

  7. Structural, optical, and thermal properties of MAX-phase Cr2AlB2

    Science.gov (United States)

    Li, Xiao-Hong; Cui, Hong-Ling; Zhang, Rui-Zhou

    2018-04-01

    First-principles calculations of the structural, optical, and thermal properties of Cr2AlB2 are performed using the pseudopotential plane-wave method within the generalized gradient approximation (GGA). Calculation of the elastic constant and phonon dispersion indicates that Cr2AlB2 is mechanically and thermodynamically stable. Analysis of the band structure and density of states indicates that Cr2AlB2 is metallic. The thermal properties under increasing temperature and pressure are investigated using the quasi-harmonic Debye model. The results show that anharmonic effects on Cr2AlB2 are important at low temperature and high pressure. The calculated equilibrium primitive cell volume is 95.91 Å3 at T = 300 K, P = 0 GPa. The ability of Cr2AlB2 to resist volume changes becomes weaker with increasing temperature and stronger with increasing pressure. Analysis of optical properties of Cr2AlB2 shows that the static dielectric function of Cr2AlB2 is 53.1, and the refractive index n 0 is 7.3. If the incident light has a frequency exceeding 16.09 eV, which is the plasma frequency of Cr2AlB2, Cr2AlB2 changes from metallic to dielectric material.

  8. ErbB-2 nuclear function in breast cancer growth, metastasis and resistance to therapy.

    Science.gov (United States)

    Elizalde, Patricia V; Cordo Russo, Rosalía I; Chervo, Maria F; Schillaci, Roxana

    2016-12-01

    Approximately 15-20% of breast cancers (BC) show either membrane overexpression of ErbB-2 (MErbB-2), a member of the ErbBs family of receptor tyrosine kinases, or ERBB2 gene amplification. Until the development of MErbB-2-targeted therapies, this BC subtype, called ErbB-2-positive, was associated with increased metastatic potential and poor prognosis. Although these therapies have significantly improved overall survival and cure rates, resistance to available drugs is still a major clinical issue. In its classical mechanism, MErbB-2 activates downstream signaling cascades, which transduce its effects in BC. The fact that ErbB-2 is also present in the nucleus of BC cells was discovered over twenty years ago. Also, compelling evidence revealed a non-canonical function of nuclear ErbB-2 as a transcriptional regulator. As a deeper understanding of nuclear ErbB-2 actions would be crucial to the disclosure of its role as a biomarker and a target of therapy in BC, we will here review its function in BC, in particular, its role in growth, metastatic spreading and response to currently available MErbB-2-positive BC therapies. © 2016 Society for Endocrinology.

  9. Usability perspective on social media sites' adoption in the B2B context

    OpenAIRE

    Lacka, Ewelina; Chong, Alain

    2016-01-01

    While social media sites have been successfully adopted and used in the B2C context, they are perceived to be irrelevant in B2B marketing. This is due to marketers' perception of poor usability of these sites in the B2B sector. This study investigates the usability of social media sites when adopted for B2B marketing purposes in the one of world's largest social media market: China. Specifically, by extending the Technology Acceptance Model with Nielsen's Model of Attributes of System Accepta...

  10. Short range order in FeCo-X alloys

    International Nuclear Information System (INIS)

    Fultz, B.

    1988-01-01

    Moessbauer spectrometry was used to study the kinetics of chemical ordering in FeCo and in FeCo alloyed with ternary solutes. With respect to the binary FeCo alloy, the kinetics of B2 ordering were slowed when 2% of 4d- or 5d-series ternary solute atoms were present, but 3p- and 3d-series ternary solutes had little effect on ordering kinetics. The relaxation of order around the ternary solute atoms could be discerned in Moessbauer spectra, and it seems that the development of B2 short range order is influenced by structural relaxations around the ternary solute atoms. Different thermal treatments were shown to cause different relaxations of and correlations, suggesting that Moessbauer spectrometry can be used to identify different kinetic paths of ordering in ternary alloys. (orig.)

  11. Effect of aluminium on formation of metastable phases in titanium-niobium alloys

    International Nuclear Information System (INIS)

    Trenogina, T.L.; Derevyanko, V.N.; Vozilkin, V.A.

    2001-01-01

    Specific features of phase transformations in the alloy of Ti-20Nb-29Al (at.%) are investigated in comparison with those in the aluminium-free Ti-21Nb alloy. It is states that in the alloy Ti-20Nb-29Al on quenching the ordering of β-solid solution takes place with B2-structure formation. The B2-matrix experiences decomposition with the formation of ordered Ω 0 -phase which field ranges up to 700 deg C. The investigation results show that the sequence of phase formation in Ti-Nb-Al and aluminium-free alloys is much the same. The only difference between them is the formation of ordered phases in the alloy Ti-20Nb-29Al [ru

  12. Synthesis and Mechanical Characterization of Binary and Ternary Intermetallic Alloys Based on Fe-Ti-Al by Resonant Ultrasound Vibrational Methods.

    Science.gov (United States)

    Chanbi, Daoud; Ogam, Erick; Amara, Sif Eddine; Fellah, Z E A

    2018-05-07

    Precise but simple experimental and inverse methods allowing the recovery of mechanical material parameters are necessary for the exploration of materials with novel crystallographic structures and elastic properties, particularly for new materials and those existing only in theory. The alloys studied herein are of new atomic compositions. This paper reports an experimental study involving the synthesis and development of methods for the determination of the elastic properties of binary (Fe-Al, Fe-Ti and Ti-Al) and ternary (Fe-Ti-Al) intermetallic alloys with different concentrations of their individual constituents. The alloys studied were synthesized from high purity metals using an arc furnace with argon flow to ensure their uniformity and homogeneity. Precise but simple methods for the recovery of the elastic constants of the isotropic metals from resonant ultrasound vibration data were developed. These methods allowed the fine analysis of the relationships between the atomic concentration of a given constituent and the Young’s modulus or alloy density.

  13. Damping characteristics of a Ti40.5Ni49.5Zr10 shape memory alloy

    International Nuclear Information System (INIS)

    Hsieh, S.F.; Wu, S.K.

    2005-01-01

    Ti 40.5 Ni 49.5 Zr 10 alloy undergoes B2-bar B19' martensitic transformation. Damping capacities of B19' and B2 phases of this alloy are lower than those of Ti 51 Ni 49 alloy due to Zr atoms solid-soluted hardening. Transformation temperatures of this alloy decrease, but transformation peak heights Q max -1 increase with increasing aging time at 300 o C due to the formation of finer (001) M twins for specimens aged longer. The Q max -1 peaks of the slightly cold-rolled Ti 40.5 Ni 49.5 Zr 10 alloy are higher than those of the as-annealed alloy, which may be because the thinner twins are induced by small deformation

  14. Neutron diffraction studies of magnetic ordering in superconducting ErNi2B2C and TmNi2B2C in an applied magnetic field

    DEFF Research Database (Denmark)

    Toft, Katrine Nørgaard

    The field-induced magnetic structures of ErNi2B2C and TmNi2B2C in are especially interesting because the field suppresses the superconducting order parameter and therefore the magnetic properties can be studied while varying the strength ofsuperconductivity. ErNi2B2C: For magnetic fields along all.......483,0,0). The appearance of the QN phase wasinitially believed to be caused by the suppression of superconductivity. This suppression should make it favorable to create a magnetic order with a Q-vector determined by the maximum in the magnetic susceptibility at the Fermi surface nesting vector QN.The phase diagram...... three symmetry directions, the observed magnetic structures have a period corresponding to the Fermi surface nesting structure. The phase diagrams present all the observed magnetic structures.Two results remain unresolved: 1. When applying the magnetic field along [010], the minority domain (QNB = (0,Q...

  15. TiAu based shape memory alloys for high temperature applications

    International Nuclear Information System (INIS)

    Wadood, Abdul; Yamabe-Mitarai, Yoko; Hosoda, Hideki

    2014-01-01

    TiAu (equiatomic) exhibits phase transformaion from B2 (ordered bcc) to thermo-elastic orthorhombic B19 martensite at about 875K and thus TiAu is categorized as high temperature shape memory alloy. In this study, recent research and developments related to TiAu based high temperature shape memory alloys will be discussed in the Introduction part. Then some results of our research group related to strengthening of TiAu based high temperature shape memory alloys will be presented. Potential of TiAu based shape memory alloys for high temperature shape memory materials applications will also be discussed

  16. Low-temperature synthesis of ZrB2 powder from oxides using Na

    Directory of Open Access Journals (Sweden)

    Haruhiko Morito

    2017-12-01

    Full Text Available ZrB2 was synthesized by heating a mixture of ZrO2, B2O3, and Na in a molar ratio of 1:1:5 at 873–1273 K. While unreacted ZrO2 remained in the sample synthesized at 873 K, single phase ZrB2 powders were obtained at temperatures ≥1073 K. The diameters of the ZrB2 particles obtained at 1073 and 1273 K were 0.1–20 and 10–100 μm, respectively. Single phase ZrB2 was also obtained at 873 K when the starting material was rich in B2O3 and Na (ZrO2:B2O3:Na = 1:5:15. This route yielded fine particle aggregates of ZrB2, which were found to be <0.1 μm in size.

  17. 22 CFR 9b.2 - Press correspondents employed by United States media organizations.

    Science.gov (United States)

    2010-04-01

    ... media organizations. 9b.2 Section 9b.2 Foreign Relations DEPARTMENT OF STATE GENERAL REGULATIONS... employed by United States media organizations must: (a) Present to the Office of Press Relations... news media organizations; (3) Date of birth; (4) Place of birth; (5) Sex; (6) Citizenship; (7) Social...

  18. SerpinB2 is critical to Th2 immunity against enteric nematode infection

    Science.gov (United States)

    SerpinB2, a member of the serine protease inhibitor family, is expressed by macrophages and up-regulated significantly by inflammation. Recent studies implicated a role for SerpinB2 in the control of Th1 and Th2 immune responses, but the mechanisms of these effects are unknown. In the current study...

  19. Formation of MgB2 at ambient temperature with an electrochemical process: a plausible mechanism

    International Nuclear Information System (INIS)

    Jadhav, A B; Subhedar, K M; Hyam, R S; Talaptra, A; Sen, Pintu; Bandyopadhyay, S K; Pawar, S H

    2005-01-01

    The binary intermetallic MgB 2 superconductor has been synthesized by many research groups. However, the mechanism of its formation is not clearly understood. In this communication, a comprehensive mechanism of the formation of MgB 2 from Le Chatelier's principle of equilibrium reaction has been explained both for solid-state reaction and electrodeposition methods. (rapid communication)

  20. In situ synthesis of NiAl–NbB2 composite powder through combustion synthesis

    International Nuclear Information System (INIS)

    Shokati, Ali Akbar; Parvin, Nader; Sabzianpour, Naser; Shokati, Mohammad; Hemmati, Ali

    2013-01-01

    Highlights: ► A Novel NiAl matrix composite powder with 0–40 wt.% NbB 2 was synthesized. ► Composite powders were synthesized by thermal explosion reaction of Ni–Al–Nb–B system. ► Microhardness of NiAl considerably increased with raising NbB 2 content. ► Synthesized composite powders is a good candidate as precursor for thermal barrier application. - Abstract: Synthesis of a novel NiAl matrix composite powder reinforced with 0–40 wt.% NbB 2 by combustion synthesis in thermal explosion mode was investigated. The elemental powders of Ni, Al, Nb, and amorphous boron were used as starting material. For all compositions final products consisted of only the NiAl and NbB 2 phases. Coarser NbB 2 with a relatively uniform distribution in NiAl matrix was formed with rising NbB 2 content. Microhardness of NiAl considerably increased from 377 ± 13 HV 0.05 to 866 ± 81 HV 0.05 for NiAl with 40 wt.% NbB 2 . High microhardness, proper size and distribution of NbB 2 in NiAl matrix make it a good candidate as precursor for thermal spray application.

  1. Neutron diffraction studies of Ho1-xYxNi2B2C compounds

    DEFF Research Database (Denmark)

    Chang, L.J.; Tomy, C.V.; Paul, D.M.K.

    1996-01-01

    Neutron diffraction measurements have been carried out to investigate the nature of magnetic ordering in Ho(1-x)Y(x)Ni(2)B(2)C (x = 0, 0.1 and 0.2) compounds. HoNi(2)B(2)C shows a complex type of magnetic ordering below the superconducting transition, with a commensurate antiferromagnetic ordering...

  2. Tissue-specific alternative splicing and expression of ATP1B2 gene ...

    African Journals Online (AJOL)

    After heat-stress, the expression levels of the different transcripts were lower in different tissues; however, the expression of the ATP1B2-complete transcript increased in heart and lung tissues. The results of this research provide some useful information for further studies into the function of the bovine ATP1B2 gene.

  3. Measurement of the anisotropy ratios in MgB2 single crystals

    International Nuclear Information System (INIS)

    Kim, Heon-Jung; Kang, Byeongwon; Lee, Hyun-Sook; Lee, Sung-Ik

    2006-01-01

    We present our recent measurements on the anisotropy ratios of MgB 2 single crystals. Our measurements indicate that the anisotropy ratios of the penetration depth and of the upper critical field have different magnitudes and temperature dependences, as predicted by theoretical calculations. These results imply that the two-gap nature can strongly influence the superconducting properties of MgB 2

  4. 26 CFR 1.6031(b)-2T - REMIC reporting requirements (temporary). [Reserved

    Science.gov (United States)

    2010-04-01

    ... requirements (temporary). [Reserved] ... 26 Internal Revenue 13 2010-04-01 2010-04-01 false REMIC reporting requirements (temporary). [Reserved] 1.6031(b)-2T Section 1.6031(b)-2T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE...

  5. 29 CFR 783.26 - The section 6(b)(2) minimum wage requirement.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false The section 6(b)(2) minimum wage requirement. 783.26... The section 6(b)(2) minimum wage requirement. Section 6(b), with paragraph (2) thereof, requires the... prescribed by” paragraph (1) of the subsection is the minimum wage rate applicable according to the schedule...

  6. 17 CFR 270.24b-2 - Filing copies of sales literature.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Filing copies of sales literature. 270.24b-2 Section 270.24b-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. Copies of material filed with the Commission for the sole purpose of complying with section 24(b...

  7. Automated Report Generation for Research Data Repositories: From i2b2 to PDF.

    Science.gov (United States)

    Thiemann, Volker S; Xu, Tingyan; Röhrig, Rainer; Majeed, Raphael W

    2017-01-01

    We developed an automated toolchain to generate reports of i2b2 data. It is based on free open source software and runs on a Java Application Server. It is sucessfully used in an ED registry project. The solution is highly configurable and portable to other projects based on i2b2 or compatible factual data sources.

  8. Aging behavior of an in-situ TiB2/Al-Cu-Li-x matrix composite

    International Nuclear Information System (INIS)

    Shen, Yanwei; Hong, Tianran; Geng, Jiwei; Han, Gaoyang; Chen, Dong; Li, Xianfeng; Wang, Haowei

    2017-01-01

    Transmission electron microscopy, differential scanning calorimetry and hardness tests have been performed on an in-situ TiB 2 /Al-3.3Cu-1.0Li-0.60Mg-0.40Ag-0.14Zr-0.13Si composite to study its aging behavior at 175 °C. A cubic phase suspected to be the σ (Al 5 Cu 6 Mg 2 ) phase or its variant is precipitated at all aging stages studied, and this phase is not typically observed in the Al-Cu-Li alloys. The primary hardening (aging for 3 h) phases consist of δ′ (Al 3 Li), β′ (Al 3 Zr) and the cubic phase. After aging for 18 h, all precipitates including T 1 (Al 2 CuLi), S (Al 2 CuMg), θ′ (Al 2 Cu), δ′, β′ and the cubic phase have appeared, and the formation of T 1 and S results in a rapid increase in hardness. With prolonging of aging time, the apparent coarsening of T 1 and S results in a decline in hardness. - Highlights: •The aging behavior of an in-situ TiB 2 /Al-Cu-Li-x composite was studied. •A cubic phase suspected to be σ (Al 5 Cu 6 Mg 2 ) or its variant was precipitated. •The hardness change was dominated by the evolution of T 1 (Al 2 CuLi) and S (Al 2 CuMg).

  9. Steel alloys

    International Nuclear Information System (INIS)

    Bloom, E.E.; Stiegler, J.O.; Rowcliffe, A.F.; Leitnaker, J.M.

    1977-01-01

    The invention deals with a fuel element for fast breeder reactors. It consits essentially of a uranium oxide, nitride, or carbide or a mixture of these fuels with a plutonium or thorium oxide, nitride, or carbide. The fuel elements are coated with an austenitic stainless steel alloy. Inside the fuel elements, vacancies or small cavities are produced by neutron effects which causes the steel coating to swell. According to the invention, swelling is prevented by a modification of type 304, 316, 321, or 12 K 72HV commercial steels. They consist mainly of Fe, Cr, and Ni in a ratio determined by a temary diagram. They may also contain 1.8 to 2.3% by weight of Mo and a fraction of Si (0.7 to 2% by weight) and Ti(0.10 to 0.5% by weight) to prevent cavity formation. They are structurally modified by cold working. (IHOE) [de

  10. Social Media within a B2B context : A qualitative study about how industrial corporations can use social media to maintain B2B relationships

    OpenAIRE

    Andersén, Sophia; Bengtsson, Annie; Gilén, Sandra

    2014-01-01

    The last thirty years there has been a dramatic change in relationship marketing. The use of computers connected to the Internet at work places has increased over time and social media is widely used in marketing strategies. Social media is a new phenomenon to communicate with each other, it enables market information based on individual consumer’s experiences. Therefore managers are seeking a way to incorporate social media into their strategies, but this is more common within B2C than B2B. ...

  11. Dirac State in the FeB2 Monolayer with Graphene-Like Boron Sheet.

    Science.gov (United States)

    Zhang, Haijun; Li, Yafei; Hou, Jianhou; Du, Aijun; Chen, Zhongfang

    2016-10-12

    By introducing the commonly utilized Fe atoms into a two-dimensional (2D) honeycomb boron network, we theoretically designed a new Dirac material of FeB 2 monolayer with a Fermi velocity in the same order of graphene. The electron transfer from Fe atoms to B networks not only effectively stabilizes the FeB 2 networks but also leads to the strong interaction between the Fe and B atoms. The Dirac state in FeB 2 system primarily arises from the Fe d orbitals and hybridized orbital from Fe-d and B-p states. The newly predicted FeB 2 monolayer has excellent dynamic and thermal stabilities and is also the global minimum of 2D FeB 2 system, implying its experimental feasibility. Our results are beneficial to further uncovering the mechanism of the Dirac cones and providing a feasible strategy for Dirac materials design.

  12. Nonlinear Elasticity of Borocarbide Superconductor YNi2B2C: A First-Principles Study

    Directory of Open Access Journals (Sweden)

    Lili Liu

    2017-01-01

    Full Text Available First-principles calculations combined with homogeneous deformation methods are used to investigate the second- and third-order elastic constants of YNi2B2C with tetragonal structure. The predicted lattice constants and second-order elastic constants of YNi2B2C agree well with the available data. The effective second-order elastic constants are obtained from the second- and third-order elastic constants for YNi2B2C. Based on the effective second-order elastic constants, Pugh’s modulus ratio, Poisson’s ratio, and Vickers hardness of YNi2B2C under high pressure are further investigated. It is shown that the ductility of YNi2B2C increases with increasing pressure.

  13. Towards a Cryogen-Free MgB2-Based Superconducting Radio Frequency Accelerating Cavities

    Science.gov (United States)

    Nassiri, Alireza

    Studies on the application of Magnesium diboride (MgB2) superconducting films have shown promise for use with the radio-frequency (SRF) accelerating cavities. MgB2\\ coating is a potential candidate to replace bulk niobium (Nb) SRF cavities. The ultimate goal of our research is to demonstrate MgB2 coating on copper cavities to allow operation at about 20 K or so as a result of the high transition temperature (Tc) of MgB2 and taking advantage of the excellent thermal conductivity of copper. Here, we will report on our recent experimental results of applying hybrid physical-chemical vapor deposition (HPCVD) to grow MgB2 films on 2-inch diameter copper discs as well as on a 2.8 GHz resonator cavity *Work supported by the U.S. Department of Energy, Office of Science, under Contract No. DE-AC02-06H11357.

  14. c-erbB-2 expression and benefit from adjuvant chemotherapy and radiotherapy of breast cancer

    International Nuclear Information System (INIS)

    Staal, O.; Sullivan, S.; Wingren, S.; Skoog, L.; Rutqvist, L.E.; Nordenskjoeld, B.; Carstensen, J.M.

    1995-01-01

    Frozen tissue from primary tumours of 152 premenopausal breast cancer patients, who participated in a trial comparing radiotherapy with adjuvant chemotherapy (cyclophosphamide, methotrexate, 5-fluorouracil, CMF), was analysed for c-erbB-2 protein expression, measured by flow cytometry. The relative risk of distant recurrence or death in the chemotherapy group as compared with the radiotherapy group was 3.0 (95% confidence interval (CI) 1.1-7.8) for patients whose tumours showed high c-erbB-2 levels and 0.87 (95% CI 0.43-1.7) for those with tumours with low levels of c-erbB-2 protein. Patients with highly proliferative tumours that did not overexpress c-erbB-2 benefited most, in terms of survival, from CMF. In addition, we found an increased risk of locoregional recurrence for tumours overexpressing c-erbB-2 when radiotherapy was replaced by chemotherapy. (author)

  15. Effects of sintering conditions on critical current properties and microstructures of MgB2 bulks

    International Nuclear Information System (INIS)

    Yamamoto, Akiyasu; Shimoyama, Jun-ichi; Ueda, Shinya; Katsura, Yukari; Iwayama, Isao; Horii, Shigeru; Kishio, Kohji

    2005-01-01

    The effects of heating conditions on critical current properties and microstructures of undoped MgB 2 bulks were systematically studied. Strong correlation was observed between J c and microstructures. The network structure with an excellent inter-grain connectivity of MgB 2 grains contributed to high-J c under low magnetic fields, and small grain size of MgB 2 enhanced the grain boundary flux pinning. Long time heating at low temperatures below the melting point of magnesium was discovered to be most effective for synthesis of MgB 2 bulks having strongly connected MgB 2 network structure with small grains. The sample heated at 550 deg. C for 1200 h recorded a high-J c of 4.02 x 10 5 A cm -2 at 20 K in self-field, while high-temperature and long time heating brought a significant grain growth which resulted in low J c

  16. Thermoluminescence kinetic parameters of different amount La-doped ZnB2O4

    International Nuclear Information System (INIS)

    Kucuk, Nil; Gozel, Aziz Halit; Yüksel, Mehmet; Dogan, Tamer; Topaksu, Mustafa

    2015-01-01

    The kinetic parameters of 1%, 2%, 3% and 4% La-doped ZnB 2 O 4 phosphors (i.e. ZnB 2 O 4 :0.01La, ZnB 2 O 4 :0.02La, ZnB 2 O 4 :0.03La and ZnB 2 O 4 :0.04La) synthesized by nitric acid method have been calculated. Thermoluminescence (TL) glow curves of ZnB 2 O 4 :La phosphors after beta-irradiation showed a very well defined main peak having the maximum temperature at around 200 °C and a shoulder peak at around 315 °C with a constant heating rate of 5 °C/s. The kinetic parameters of ZnB 2 O 4 :La phosphors TL glow peaks (i.e. order of kinetics (b), activation energies (E a ) and frequency factors (s)) have been determined and evaluated by Computerized Glow Curve Deconvolution (CGCD), and Peak Shape (PS) methods using the glow curve data. From the results, it can conclude that the values of E a obtained with these methods for ZnB 2 O 4 :La phosphors are consistent with each other, but the s values differ considerably. - Highlights: • Calculation of TL kinetic parameters for La-doped ZnB 2 O 4 . • La-doped ZnB 2 O 4 was synthesized by nitric acid method. • Well defined main peak at about 200 °C

  17. LytB1 and LytB2 of Mycobacterium tuberculosis Are Not Genetically Redundant.

    Directory of Open Access Journals (Sweden)

    Amanda Claire Brown

    Full Text Available Mycobacterium tuberculosis synthesises isoprenoid precursors via the MEP/DOXP pathway and at least five enzymes in the pathway (Dxs1, Dxr/IspC, IspD, IspF, and GcpE/IspG are required for growth in vitro. We investigated the role of LytB (IspH in M. tuberculosis; M. tuberculosis is unusual in that it has two homologs-LytB1 and LytB2. We were unable to delete the lytB2 gene unless we provided an additional copy elsewhere, demonstrating that this is the essential homolog. We expressed lytB1 from the lytB2 promoter and confirmed that this could not complement for loss of function of lytB2, despite LytB1 possessing all the previously described conserved critical residues. Interestingly the sole LytB homolog of Mycobacterium smegmatis was able to compensate for loss of LytB2 in M. tuberculosis. We tested translational fusions of LytB1 and LytB2 for functionality in M. tuberculosis, but only a fusion with 90% N-terminal LytB2 and 10% C-terminal LytB1 was functional. In order to identify the key difference between the two proteins, site directed mutagenesis was used to change LytB2 residues into their counterparts in LytB1. None of these amino acid substitutions was essential for function and all lytB2 mutant alleles were functional. In contrast, mutation of the key residues for [Fe4S4] cluster formation, as well as a catalytic residue in LytB1 did not result in functional complementation. Thus, although LytB1 and LytB2 are not genetically redundant, this is not dependent on small amino acid changes, but is likely to be a result of major overall structural differences.

  18. Adoption of the B2SAFE EUDAT replication service by the EPOS community

    Science.gov (United States)

    Cacciari, Claudio; Fares, Massimo; Fiameni, Giuseppe; Michelini, Alberto; Danecek, Peter; Wittenburg, Peter

    2014-05-01

    B2SAFE is the EUDAT service for moving and replicating data between sites and storage systems for different purposes. The goal of B2SAFE is to keep the data from a repository safe by replicating it across different geographical and administrative zones according to a set of well-defined policies. It is also a way to store large volumes of data permanently at those sites which are providing powerful on-demand data analysis facilities. In particular, B2SAFE operates on the domain of registered data where data objects are referable via persistent identifiers (PIDs). B2SAFE is more than just copying data because the PIDs must be carefully managed when data objects are moved or replicated. The EUDAT B2SAFE Service offers functionality to replicate datasets across different data centres in a safe and efficient way while maintaining all information required to easily find and query information about the replica locations. The information about the replica locations and other important information is stored in PID records, each managed in separate administrative domains. The B2SAFE Service is implemented as an iRODS module providing a set of iRODS rules or policies to interface with the EPIC handle API and uses the iRODS middleware to replicate datasets from a source data (or community) centre to a destination data centre. The definition of the dataset(s) to replicate is flexible and up to the communities using the B2SAFE service. While the B2SAFE is internally using the EPIC handle API, communities have the choice to use any PID system they prefer to assign PIDs to their digital objects. A reference to one or more EUDAT B2SAFE PIDs is returned by the B2SAFE service when a dataset is replicated. The presentation will introduce the problem space of B2SAFE, presents the achievements that have been made during the last year for enabling communities to make use of the B2SAFE service, demonstrates a EPOS use cases, outlines the commonalities and differences between the policies

  19. Aspirin Hydrolysis in Plasma Is a Variable Function of Butyrylcholinesterase and Platelet-activating Factor Acetylhydrolase 1b2 (PAFAH1b2)*

    Science.gov (United States)

    Zhou, Gang; Marathe, Gopal K.; Hartiala, Jaana; Hazen, Stanley L.; Allayee, Hooman; Tang, W. H. Wilson; McIntyre, Thomas M.

    2013-01-01

    Aspirin is rapidly hydrolyzed within erythrocytes by a heterodimer of PAFAH1b2/PAFAH1b3 but also in plasma by an unidentified activity. Hydrolysis in both compartments was variable, with a 12-fold variation in plasma among 2226 Cleveland Clinic GeneBank patients. Platelet inhibition by aspirin was suppressed in plasma that rapidly hydrolyzed aspirin. Plasma aspirin hydrolysis was significantly higher in patients with coronary artery disease compared with control subjects (16.5 ± 4.4 versus 15.1 ± 3.7 nmol/ml/min; p = 3.4 × 10−8). A genome-wide association study of 2054 GeneBank subjects identified a single locus immediately adjacent to the BCHE (butyrylcholinesterase) gene associated with plasma aspirin hydrolytic activity (lead SNP, rs6445035; p = 9.1 × 10−17). However, its penetrance was low, and plasma from an individual with an inactivating mutation in BCHE still effectively hydrolyzed aspirin. A second aspirin hydrolase was identified in plasma, the purification of which showed it to be homomeric PAFAH1b2. This is distinct from the erythrocyte PAFAH1b2/PAFAH1b3 heterodimer. Inhibitors showed that both butyrylcholinesterase (BChE) and PAFAH1b2 contribute to aspirin hydrolysis in plasma, with variation primarily reflecting non-genetic variation of BChE activity. Therefore, aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2. Hydrolytic effectiveness varies widely primarily from non-genetic variation of BChE activity that affects aspirin bioavailability in blood and the ability of aspirin to inhibit platelet aggregation. PMID:23508960

  20. Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2).

    Science.gov (United States)

    Zhou, Gang; Marathe, Gopal K; Hartiala, Jaana; Hazen, Stanley L; Allayee, Hooman; Tang, W H Wilson; McIntyre, Thomas M

    2013-04-26

    Aspirin is rapidly hydrolyzed within erythrocytes by a heterodimer of PAFAH1b2/PAFAH1b3 but also in plasma by an unidentified activity. Hydrolysis in both compartments was variable, with a 12-fold variation in plasma among 2226 Cleveland Clinic GeneBank patients. Platelet inhibition by aspirin was suppressed in plasma that rapidly hydrolyzed aspirin. Plasma aspirin hydrolysis was significantly higher in patients with coronary artery disease compared with control subjects (16.5 ± 4.4 versus 15.1 ± 3.7 nmol/ml/min; p = 3.4 × 10(-8)). A genome-wide association study of 2054 GeneBank subjects identified a single locus immediately adjacent to the BCHE (butyrylcholinesterase) gene associated with plasma aspirin hydrolytic activity (lead SNP, rs6445035; p = 9.1 × 10(-17)). However, its penetrance was low, and plasma from an individual with an inactivating mutation in BCHE still effectively hydrolyzed aspirin. A second aspirin hydrolase was identified in plasma, the purification of which showed it to be homomeric PAFAH1b2. This is distinct from the erythrocyte PAFAH1b2/PAFAH1b3 heterodimer. Inhibitors showed that both butyrylcholinesterase (BChE) and PAFAH1b2 contribute to aspirin hydrolysis in plasma, with variation primarily reflecting non-genetic variation of BChE activity. Therefore, aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2. Hydrolytic effectiveness varies widely primarily from non-genetic variation of BChE activity that affects aspirin bioavailability in blood and the ability of aspirin to inhibit platelet aggregation.

  1. SrBeB2O5: Growth, crystal structure and optical properties

    International Nuclear Information System (INIS)

    Yao, Wenjiao; Wang, Xiaoshan; Huang, Hongwei; Xu, Tao; Jiang, Xingxing; Wang, Xiaoyang; Lin, Zheshuai; Chen, Chuangtian

    2014-01-01

    Graphical abstract: The crystal displays a layered configuration along c axis with the wrinkled infinite (BeB 2 O 5 ) ∞ layers. Display Omitted - Highlights: • A new beryllium borate SrBeB 2 O 5 was synthesized. • A layered structure (BeB 2 O 5 ) ∞ was formed by BO 3 triangles and B/BeO 4 tetrahedrons. • SrBeB 2 O 5 has a very wide transparency range of wavelengths from 200 nm to 1800 nm. • A-site ions impact greatly on the structures of beryllium borates. - Abstract: A novel beryllium borate SrBeB 2 O 5 is discovered for the first time through traditional solid state reaction and high temperature solution method. The framework of the structure is composed by two-dimensional [BeB 2 O 5 ] layers determined from single-crystal X-ray diffraction data. The further structural analysis of beryllium borates reveals that the arrangement of anionic groups attributes to the structural stability. Moreover, the influences of the A-site cations on the structural features of fundamental building blocks in the alkaline or alkaline earth beryllium borates are discussed. The UV–Vis–NIR diffuse-reflectance pattern reveals that this compound has a very wide transparency range of wavelengths down to 200 nm. In addition, the properties of SrBeB 2 O 5 were also characterized by powder X-ray diffraction, differential scanning calorimetry, and IR spectroscopy

  2. MgB2 thick films on three-dimensional structures fabricated by HPCVD

    Science.gov (United States)

    Guo, Zhengshan; Cai, Xingwei; Liao, Xuebin; Chen, Yiling; Yang, Can; Niu, Ruirui; Luo, Wenhao; Huang, Zigeng; Feng, Qingrong; Gan, Zizhao

    2018-06-01

    Magnetic shielding has been a key factor in the measurement of ultra-weak magnetic fields, especially for shielding from low frequency electromagnetic noise. With the recent development of superconducting quantum interference devices, superconducting magnetic shielding has become an important area of research. MgB2 has shown great potential in magnetic shielding for its remarkable superconducting properties, the feasibility of its use in this capacity having been demonstrated by MgB2 bulk samples. However, the potential for application of such bulk samples is limited. In this work, we have investigated the possibility of the fabrication of MgB2 films on three-dimensional (3D) structures using a hybrid physical‑chemical vapor deposition system. MgB2 films 10 μm thick have been fabricated on the outer surface of a polycrystalline Al2O3 cylinder. The deposited film showed a transition temperature (TC) of 39 K and J C of 5.1 × 105 A · cm‑2, which are comparable to those of planar MgB2 films. This work shows the feasibility of depositing MgB2 films onto a 3D structure, and sheds light on the potential use of MgB2 films in superconducting magnetic shielding.

  3. Platelet thromboxane B2-formation in end-stage kidney disease and after kidney transplantation

    International Nuclear Information System (INIS)

    Stefanovic, V.; Lecic, N.

    1986-01-01

    The aim of this work was to analyse TxB 2 formation by platelets in endstage kidney disease patients and in kidney graft recipients. Four groups of patients were studied: 12 preterminal chronic renal failure patients, 42 patients on maintenance hemodialysis, 8 patients on CAPD and 11 grafted patients. TxB 2 production by platelets was determined in serum following spontaneous blood clotting for 1/2 h at 37 0 C. Hemodialysis patients generated 80.7 ± 9.6 ng/ml (mean ± S.E.M.) of TxB 2 which was significantly (p 2 formation in hemodialysis patients had no relationship with the residual kidney function. Patients on CAPD produced 65.0 ± 12.7 ng/ml of TxB 2 . Very low TxB 2 generation was obtained also in preterminal chronic renal failure patients (57.0 ± 11.8 ng/ml). Kidney graft recipients had a mean TxB 2 production of 81.6 ± 24.2 ng/ml with a range from 12.5-200 ng/ml. Very low TxB 2 was formed in grafted patients with renal failure. (orig.) [de

  4. Antitumor and angiostatic activities of the antimicrobial peptide dermaseptin B2.

    Science.gov (United States)

    van Zoggel, Hanneke; Carpentier, Gilles; Dos Santos, Célia; Hamma-Kourbali, Yamina; Courty, José; Amiche, Mohamed; Delbé, Jean

    2012-01-01

    Recently, we have found that the skin secretions of the Amazonian tree frog Phyllomedusa bicolor contains molecules with antitumor and angiostatic activities and identified one of them as the antimicrobial peptide dermaseptin (Drs) B2. In the present study we further explored the in vitro and in vivo antitumor activity of this molecule and investigated its mechanism of action. We showed that Drs B2 inhibits the proliferation and colony formation of various human tumor cell types, and the proliferation and capillary formation of endothelial cells in vitro. Furthermore, Drs B2 inhibited tumor growth of the human prostate adenocarcinoma cell line PC3 in a xenograft model in vivo. Research on the mechanism of action of Drs B2 on tumor PC3 cells demonstrated a rapid increasing amount of cytosolic lactate dehydrogenase, no activation of caspase-3, and no changes in mitochondrial membrane potential. Confocal microscopy analysis revealed that Drs B2 can interact with the tumor cell surface, aggregate and penetrate the cells. These data together indicate that Drs B2 does not act by apoptosis but possibly by necrosis. In conclusion, Drs B2 could be considered as an interesting and promising pharmacological and therapeutic leader molecule for the treatment of cancer.

  5. Antitumor and angiostatic activities of the antimicrobial peptide dermaseptin B2.

    Directory of Open Access Journals (Sweden)

    Hanneke van Zoggel

    Full Text Available Recently, we have found that the skin secretions of the Amazonian tree frog Phyllomedusa bicolor contains molecules with antitumor and angiostatic activities and identified one of them as the antimicrobial peptide dermaseptin (Drs B2. In the present study we further explored the in vitro and in vivo antitumor activity of this molecule and investigated its mechanism of action. We showed that Drs B2 inhibits the proliferation and colony formation of various human tumor cell types, and the proliferation and capillary formation of endothelial cells in vitro. Furthermore, Drs B2 inhibited tumor growth of the human prostate adenocarcinoma cell line PC3 in a xenograft model in vivo. Research on the mechanism of action of Drs B2 on tumor PC3 cells demonstrated a rapid increasing amount of cytosolic lactate dehydrogenase, no activation of caspase-3, and no changes in mitochondrial membrane potential. Confocal microscopy analysis revealed that Drs B2 can interact with the tumor cell surface, aggregate and penetrate the cells. These data together indicate that Drs B2 does not act by apoptosis but possibly by necrosis. In conclusion, Drs B2 could be considered as an interesting and promising pharmacological and therapeutic leader molecule for the treatment of cancer.

  6. ErbB2 resembles an autoinhibited invertebrate epidermal growth factor receptor

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Diego; Klein, Daryl E.; Lemmon, Mark A.; (UPENN-MED)

    2009-09-25

    The orphan receptor tyrosine kinase ErbB2 (also known as HER2 or Neu) transforms cells when overexpressed, and it is an important therapeutic target in human cancer. Structural studies have suggested that the oncogenic (and ligand-independent) signalling properties of ErbB2 result from the absence of a key intramolecular 'tether' in the extracellular region that autoinhibits other human ErbB receptors, including the epidermal growth factor (EGF) receptor. Although ErbB2 is unique among the four human ErbB receptors, here we show that it is the closest structural relative of the single EGF receptor family member in Drosophila melanogaster (dEGFR). Genetic and biochemical data show that dEGFR is tightly regulated by growth factor ligands, yet a crystal structure shows that it, too, lacks the intramolecular tether seen in human EGFR, ErbB3 and ErbB4. Instead, a distinct set of autoinhibitory interdomain interactions hold unliganded dEGFR in an inactive state. All of these interactions are maintained (and even extended) in ErbB2, arguing against the suggestion that ErbB2 lacks autoinhibition. We therefore suggest that normal and pathogenic ErbB2 signalling may be regulated by ligands in the same way as dEGFR. Our findings have important implications for ErbB2 regulation in human cancer, and for developing therapeutic approaches that target novel aspects of this orphan receptor.

  7. Rapidly solidified Ti-25Al-Nb alloys

    International Nuclear Information System (INIS)

    Ward, C.H.; Broderick, T.F.; Jackson, A.G.; Rowe, R.G.; Froes, F.H.

    1987-01-01

    Alloys based on the Ti-25Al-Nb intermetallic system were studied to determine the effects of rapid solidification on structure. Compositions ranging from 12 to 30 at% niobium which are beyond the α/sub 2/ single phase field were evaluated. Alloys were prepared using a melt spinning process. The resulting ribbons were characterized using transmission electron microscopy and x-ray diffraction. The alloys were all found to have a retained ordered B2 structure in the melt spun condition with an antiphase domain size that significantly decreased with increasing niobium content. ''Tweed-like'' striations, indicating planar shear strain, were observed in all compositions. The characteristic diffraction pattern of an ordered ''omega-type'' phase was found to occur in the patterns taken from the 12 at% niobium alloy

  8. Acoustic properties of TiNiMoFe base alloys

    International Nuclear Information System (INIS)

    Gyunter, V.Eh.; Chernyshev, V.I.; Chekalkin, T.L.

    2000-01-01

    The regularity of changing the acoustic properties of the TiNi base alloys in dependence on the alloy composition and impact temperature is studied. It is shown that the oscillations of the TiNiMoFe base alloys within the temperature range of the B2 phase existence and possible appearance of the martensite under the load differ from the traditional materials oscillations. After excitation of spontaneous oscillations within the range of M f ≤ T ≤ M d there exists the area of long-term and low-amplitude low-frequency acoustic oscillations. It is established that free low-frequency oscillations of the TH-10 alloy sample are characterized by the low damping level in the given temperature range [ru

  9. Comparing the effect of processing temperature on microstructure and mechanical behavior of (ZrSiO4 or TiB2)/aluminum composites

    International Nuclear Information System (INIS)

    Abdizadeh, H.; Baharvandi, H.R.; Moghaddam, K. Shirvani

    2008-01-01

    Recently, a large number of metal matrix composites have been developed for high-performance applications. The first requirement for superior performance of a composite material is the homogeneous distribution of the reinforcing phase. In particulate-reinforced composites, any agglomeration of reinforcement particles deteriorates the mechanical properties of composite. Stir casting route has been used to achieve homogeneity of particle distribution throughout the matrix. In present study, ZrSiO 4 and TiB 2 particles were incorporated in A356.1 alloy. The size of ZrSiO 4 and TiB 2 particles was 1 μm. Reinforcement particles were added to melted aluminum at different temperatures above pure aluminum melting point (750, 850, 950 deg. C). The volume fraction of reinforcement particles was 5%. After addition of reinforcement, stirring was continued for 12 min for better distribution and better solidification conditions. The microstructure and mechanical behavior of prepared composites were studied. Scanning electron microscopy and X-ray diffraction were used to investigate dispersion of reinforcement particles in aluminum matrix and chemical composition of composites. Hardness and tensile tests were carried out to test mechanical properties. The results of these experiments show that the mechanical properties and microstructure of composites were changed by increasing temperature; also the best condition of ZrSiO 4 case was 750 deg. C but 850 deg. C for TiB 2

  10. Anticonvulsant activity of B2, an adenosine analog, on chemical convulsant-induced seizures.

    Directory of Open Access Journals (Sweden)

    Min Li

    Full Text Available Epilepsy is a chronic neurological disorder characterized by recurrent seizures. However, approximately one-third of epilepsy patients still suffer from uncontrolled seizures. Effective treatments for epilepsy are yet to be developed. N (6-(3-methoxyl-4-hydroxybenzyl adenine riboside (B2 is a N(6-substitued adenosine analog. Here we describe an investigation of the effects and mechanisms of B2 on chemical convulsant-induced seizures. Seizures were induced in mice by administration of 4-aminopyridine (4-AP, pentylenetetrazol (PTZ, picrotoxin, kainite acid (KA, or strychnine. B2 has a dose-related anticonvulsant effect in these chemical-induced seizure models. The protective effects of B2 include increased latency of seizure onset, decreased seizure occurrence, shorter seizure duration and reduced mortality rate. Radioligand binding and cAMP accumulation assays indicated that B2 might be a functional ligand for both adenosine A1 and A2A receptors. Furthermore, DPCPX, a selective A1 receptor antagonist, but not SCH58261, a selective A2A receptor antagonist, blocked the anticonvulsant effect of B2 on PTZ-induced seizure. c-Fos is a cellular marker for neuronal activity. Immunohistochemical and western blot analyses indicated that B2 significantly reversed PTZ-induced c-Fos expression in the hippocampus. Together, these results indicate that B2 has significant anticonvulsant effects. The anticonvulsant effects of B2 may be attributed to adenosine A1 receptor activation and reduced neuronal excitability in the hippocampus. These observations also support that the use of adenosine receptor agonist may be a promising approach for the treatment of epilepsy.

  11. Effect of V content on the microstructure and mechanical properties of Mo2FeB2 based cermets

    International Nuclear Information System (INIS)

    Yu, Haizhou; Zheng, Yong; Liu, Wenjun; Zheng, Jianzhi; Xiong, Weihao

    2010-01-01

    Four series of cermets with V content between 0 and 7.5 wt.% in 2.5 wt.% increments were studied by scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDX) and X-ray diffractometry (XRD). The transverse rupture strength (TRS), hardness (HRA) and fracture toughness (K IC ) were also measured. It was found that the grain size was affected by the V content. The cermets with 2.5 wt.% V addition exhibited the smallest grain size. An increasing V content decreased the wettability of the binder on the Mo 2 FeB 2 hard phase, and accordingly resulted in the increase of porosity and aggregation of ceramic grains. EDS results showed that V addition occurred primarily in the hard phase, with a little amount in the Fe alloy binder. In addition, the content of Mo element in the binder decreased with increasing V content. The cermets with 2.5 wt.% V addition showed the highest TRS, hardness and fracture toughness of 2350 MPa, HRA 90.6 and 15.1 MPa m 1/2 , respectively.

  12. Procyanidin dimer B2-mediated IRAK-M induction negatively regulates TLR4 signaling in macrophages

    Energy Technology Data Exchange (ETDEWEB)

    Sung, Nak-Yun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Yang, Mi-So [Department of Microbiology, Infection Signaling Network Research Center, College of Medicine, Chungnam National University, Daejeon (Korea, Republic of); Song, Du-Sub [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Kim, Jae-Kyung; Park, Jong-Heum; Song, Beom-Seok; Park, Sang-Hyun; Lee, Ju-Woon [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Park, Hyun-Jin [School of life sciences and Biotechnology, Korea University 5-ka, Anam-Dong, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Kim, Jae-Hun [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Baek, E-mail: ebbyun80@kaeri.re.kr [Advanced Radiation Technology Institute, Korea Atomic Energy Research Institute, Jeongeup 580-185 (Korea, Republic of); Byun, Eui-Hong, E-mail: ehbyun80@kongju.ac.k [Department of Food Science and Technology, Kongju National University, Yesan 340-800 (Korea, Republic of)

    2013-08-16

    Highlights: •Pro B2 elevated the expression of IRAK-M, a negative regulator of TLR signaling. •LPS-induced expression of cell surface molecules was inhibited by Pro B2. •LPS-induced production of pro-inflammatory cytokines was inhibited by Pro B2. •Pro B2 inhibited LPS-induced activation of MAPKs and NF-κB through IRAK-M. •Pro B2 inactivated naïve T cells by inhibiting LPS-induced cytokines via IRAK-M. -- Abstract: Polyphenolic compounds have been found to possess a wide range of physiological activities that may contribute to their beneficial effects against inflammation-related diseases; however, the molecular mechanisms underlying this anti-inflammatory activity are not completely characterized, and many features remain to be elucidated. In this study, we investigated the molecular basis for the down-regulation of toll-like receptor 4 (TLR4) signal transduction by procyanidin dimer B2 (Pro B2) in macrophages. Pro B2 markedly elevated the expression of the interleukin (IL)-1 receptor-associated kinase (IRAK)-M protein, a negative regulator of TLR signaling. Lipopolysaccharide (LPS)-induced expression of cell surface molecules (CD80, CD86, and MHC class I/II) and production of pro-inflammatory cytokines (tumor necrosis factor-α, IL-1β, IL-6, and IL-12p70) were inhibited by Pro B2, and this action was prevented by IRAK-M silencing. In addition, Pro B2-treated macrophages inhibited LPS-induced activation of mitogen-activated protein kinases such as extracellular signal-regulated kinase 1/2, p38, and c-Jun N-terminal kinase and the translocation of nuclear factor κB and p65 through IRAK-M. We also found that Pro B2-treated macrophages inactivated naïve T cells by inhibiting LPS-induced interferon-γ and IL-2 secretion through IRAK-M. These novel findings provide new insights into the understanding of negative regulatory mechanisms of the TLR4 signaling pathway and the immune-pharmacological role of Pro B2 in the immune response against the development

  13. B2B-uutiskirjeen visuaalisen ilmeen kehitys — Case Tamtron Solutions Oy

    OpenAIRE

    Salo, Sari

    2014-01-01

    Opinnäytetyön tarkoituksena oli kehittää Tamtron Solutions Oy:n uutiskirjeelle uusi visuaalinen ilme. Yrityksen lähettämästä uutiskirjeestä yritysasiakkaille puhutaan B2B-uutiskirjeenä. Tamtron Solutions Oy halusi B2B-uutiskirjeen avulla tehostaa markkinointia, kasvattaa myyntiä ja luoda uusia asiakassuhteita. Yritys halusi toteuttaa markkinointikampanjan B2B-uutiskirjeen muodossa rakennusalan yrityksille. Yritys valitsi kampanjan kohderyhmäksi rakennusalan yritykset, koska lakimuutos rakennu...

  14. Growth of high quality large area MgB2 thin films by reactive evaporation

    OpenAIRE

    Moeckly, Brian H.; Ruby, Ward S.

    2006-01-01

    We report a new in-situ reactive deposition thin film growth technique for the production of MgB2 thin films which offers several advantages over all existing methods and is the first deposition method to enable the production of high-quality MgB2 films for real-world applications. We have used this growth method, which incorporates a rotating pocket heater, to deposit MgB2 films on a variety of substrates, including single-crystalline, polycrystalline, metallic, and semiconductor materials u...

  15. First principle study of UHTC ternary diboride, Cr2AlB2

    Science.gov (United States)

    Rastogi, Anugya; Rajpoot, Priyanka; Verma, U. P.

    2018-04-01

    In this paper ab-initio study of the structural, electronic and optical properties of ternary metal boride Cr2AlB2 using full potential linear augmented plane wave (FP-LAPW) method based on the density functional theory (DFT). The study of structural properties shows that Cr2AlB2 is metallic in nature and have orthorhombic crystal structure. The optical properties show that it possess anisotropic behavior, which have wide applications in electricity production through concentration of solar power (CSP) technology. To the best of our knowledge, theoretical study of the optical properties of Cr2AlB2 is reported for the first time.

  16. Strategic B2B customer experience management: the importance of outcomes-based measures

    OpenAIRE

    Zolkiewski, Judy; Story, Victoria; Burton, Jamie; Chan, Paul; Gomes, Andre; Hunter-Jones, Philippa; O’Malley, Lisa; Peters, Linda D.; Raddats, Chris; Robinson, William

    2017-01-01

    Purpose\\ud \\ud The purpose of this paper is to critique the adequacy of efforts to capture the complexities of customer experience in a business-to-business (B2B) context using input–output measures. The paper introduces a strategic customer experience management framework to capture the complexity of B2B service interactions and discusses the value of outcomes-based measurement.\\ud Design/methodology/approach\\ud \\ud This is a theoretical paper that reviews extant literature related to B2B cu...

  17. Using service design methods for B2b service brand concept development: Case company

    OpenAIRE

    Molina Escalante, Hugo

    2014-01-01

    A short time before this study was initiated, a small B2b service company had just began op-erating its business without a brand of it’s own. The company owners were looking to design an innovative brand for their business. The purpose of this thesis was to develop the brand for this service Company in the B2b context, using practical service design and Strategic design research methods. This thesis report represents a framework for developing a B2b service brand using research methods c...

  18. Soliton cellular automaton associated with Dn(1)-crystal B2,s

    Science.gov (United States)

    Misra, Kailash C.; Wilson, Evan A.

    2013-04-01

    A solvable vertex model in ferromagnetic regime gives rise to a soliton cellular automaton which is a discrete dynamical system in which site variables take on values in a finite set. We study the scattering of a class of soliton cellular automata associated with the U_q(D_n^{(1)})-perfect crystal B2, s. We calculate the combinatorial R matrix for all elements of B2, s ⊗ B2, 1. In particular, we show that the scattering rule for our soliton cellular automaton can be identified with the combinatorial R matrix for U_q(A_1^{(1)}) oplus U_q(D_{n-2}^{(1)})-crystals.

  19. Mechanochemical synthesis of nanocrystalline Fe and Fe–B magnetic alloys

    International Nuclear Information System (INIS)

    Mohammadi, Majid; Ghasemi, Ali; Tavoosi, Majid

    2016-01-01

    Mechanochemical synthesis and magnetic characterization of nanocrystalline Fe and Fe–B magnetic alloys was the goal of this study. In this regard, different Fe_2O_3–B_2O_3 powder mixtures with sufficient amount of CaH_2 were milled in a planetary ball mill in order to produce nanocrystalline Fe, Fe_9_5B_5 and Fe_8_5B_1_5 alloys. The produced samples were characterized using X-ray diffraction (XRD), differential scanning calorimetry (DSC), scanning electron microscopy (SEM) and vibrating sample magnetometer (VSM). The results showed that, nanocrystalline Fe, Fe_9_5B_5 and Fe_8_5B_1_5 alloys can be successfully synthesized by the reduction reaction of Fe_2O_3 and B_2O_3 with CaH_2 during mechanical alloying. The structure of produced Fe_9_5B_5 and Fe_8_5B_1_5 alloys was a combination of Fe and Fe_2B phases with average crystallite sizes of about 15 and 10 nm, respectively. The produced nanocrystalline alloys exhibited soft magnetic properties with the coercivity and saturation of magnetization in the range of 170–240 Oe and 9–28 emu/g, respectively. Increasing the boron content has a destructive effect on soft magnetic properties of Fe–B alloys. - Highlights: • We study the mechanochemical synthesis of nanocrystalline boron, Fe and Fe–B alloys. • We study the reduction reaction of B_2O_3–CaH_2 during milling. • We study the reduction reaction of Fe_2O_3–CaH_2 during milling. • We study the reduction reaction of Fe_2O_3–B_2O_3–CaH_2 during milling. • We study the effect of B on magnetic properties of nanocrystalline Fe–B alloys.

  20. Improving magnetic properties of MgB_2 bulk superconductors by synthetic engine oil treatment

    International Nuclear Information System (INIS)

    Taylan Koparan, E.; Savaskan, B.; Yanmaz, E.

    2016-01-01

    Highlights: • The effects of synthetic engine oil treatment on magnetic properties of bulk MgB_2 superconductors has been first time investigated and reported. • Synthetic engine oil used as a product which is cheap and a rich carbon source obviously has improved the superconducting magnetic properties of MgB_2. • The critical current density of all of MgB_2 samples immersed at different standby time in engine oil in whole field range has been better than that of the pure MgB_2 sample. • The MgB_2 sample immersed at 300 min standby time in synthetic engine oil has the best performance compared to other samples. - Abstract: The present study focuses on the effects of standby time of the MgB_2 samples immersed in synthetic engine oil on the critical current density ( J_c(H)), magnetic field dependence of the pinning force density f_p(b) and T_c performances of MgB_2 bulk superconductors. Synthetic engine oil was used as a product which is cheap and a rich carbon source. Manufactured MgB_2 pellet samples were immersed at different standby time of 30 min, 120 min, 300 min and 1440 min in synthetic engine oil after the first heating process. Finally, MgB_2 samples immersed in synthetic engine oil were sintered at 1000 °C and kept for 15 min in Ar atmosphere. The critical current density of all of MgB_2 samples immersed at different standby time in engine oil in whole field range was better than that of the pure MgB_2 sample because of the number of the pinning centers. The MgB_2 sample immersed at 300 min standby time in synthetic engine oil has the best performance compared to other samples. The J_c value for the pure sample is 2.0 × 10"3 A/cm"2, whereas for the MgB_2 sample immersed at 300 min standby time in engine oil the J_c is enhanced to 4.8 × 10"3 A/cm"2 at 5 K and 3 T. The superconducting transition temperature (T_c) did not change with the increasing standby time of the samples in synthetic engine oil at all. The best diamagnetic property was

  1. Alloy Fabrication Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — At NETL’s Alloy Fabrication Facility in Albany, OR, researchers conduct DOE research projects to produce new alloys suited to a variety of applications, from gas...

  2. Controlled Thermal Expansion Alloys

    Data.gov (United States)

    National Aeronautics and Space Administration — There has always been a need for controlled thermal expansion alloys suitable for mounting optics and detectors in spacecraft applications.  These alloys help...

  3. Electronic structure of alloys

    International Nuclear Information System (INIS)

    Ehrenreich, H.; Schwartz, L.M.

    1976-01-01

    The description of electronic properties of binary substitutional alloys within the single particle approximation is reviewed. Emphasis is placed on a didactic exposition of the equilibrium properties of the transport and magnetic properties of such alloys. Topics covered include: multiple scattering theory; the single band alloy; formal extensions of the theory; the alloy potential; realistic model state densities; the s-d model; and the muffin tin model. 43 figures, 3 tables, 151 references

  4. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  5. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  6. Phthalocyanine doping to improve critical current densities in MgB2 tapes

    International Nuclear Information System (INIS)

    Zhang Xianping; Ma Yanwei; Wang Dongliang; Gao Zhaoshun; Wang Lei; Qi Yanpeng; Awaji, Satoshi; Watanabe, Kazuo; Mossang, Eric

    2009-01-01

    Phthalocyanine-doped MgB 2 tapes were prepared by the in situ powder-in-tube method. The relationships between the critical current properties, crystallinity and microstructure were studied as a function of the phthalocyanine doping level. It is found that both H irr and H c2 were improved when MgB 2 samples were doped with phthalocyanine, which are mainly attributed to the effective carbon substitution and enhanced flux pinning strength caused by very fine grain sizes. Furthermore, compared to pure samples, the MgO content remained almost unchanged in all doped tapes, which is very beneficial to having better grain connectivity in MgB 2 . Significantly improved J c was obtained in the phthalocyanine-doped MgB 2 tapes, especially under high magnetic fields.

  7. Tissue-specific alternative splicing and expression of ATP1B2 gene

    African Journals Online (AJOL)

    user6

    2012-05-15

    May 15, 2012 ... retention; these isoforms were found in liver, kidney, muscle and breast tissues. ... lower levels than the complete ATP1B2 gene transcript in all the ... temperature. ... growth, differentiation, and disease (Zhou et al., 2002;.

  8. Progress in the deposition of MgB2 thin films

    International Nuclear Information System (INIS)

    Xi, X X; Pogrebnyakov, A V; Zeng, X H; Redwing, J M; Xu, S Y; Li, Qi; Liu, Zi-Kui; Lettieri, J; Vaithyanathan, V; Schlom, D G; Christen, H M; Zhai, H Y; Goyal, A

    2004-01-01

    An MgB 2 thin film deposition technology is the first critical step in the development of superconducting electronics utilizing the 39 K superconductor. It turned out to be a challenging task due to the volatility of Mg and phase stability of MgB 2 , the low sticking coefficients of Mg at elevated temperatures, and the reactivity of Mg with oxygen. A brief overview of current deposition techniques is provided here from a thermodynamic perspective, with an emphasis on a very successful technique for high quality in situ epitaxial MgB 2 films, the hybrid physical-chemical vapour deposition. Examples of heterostructures of MgB 2 with other materials are also presented

  9. The Importance of Brand on B2B Markets: Expert Interviews with Hilti AG Managers

    Directory of Open Access Journals (Sweden)

    Martin Konečný

    2013-12-01

    Full Text Available This paper investigates the importance of brand building in the business-to-business world. Not only B2C companies must take branding into account and put it among their top priorities in order to survive and succeed on the market. The first part of the article deals with the theoretical background of brand importance and market specifics of B2B markets and results in the setting of two hypotheses. The following research has to find out how the managers of a pure business-to-business company perceive the importance of a brand; moreover, it has to evaluate the importance of eight specific brand building factors. Fourteen expert interviews document the growing of brands in the B2B market and their main aspects. At the end of the article, we will focus on future implications for B2B management.

  10. Molecular-Beam Epitaxially Grown MgB2 Thin Films and Superconducting Tunnel Junctions

    Directory of Open Access Journals (Sweden)

    Jean-Baptiste Laloë

    2011-01-01

    Full Text Available Since the discovery of its superconducting properties in 2001, magnesium diboride has generated terrific scientific and engineering research interest around the world. With a of 39 K and two superconducting gaps, MgB2 has great promise from the fundamental point of view, as well as immediate applications. Several techniques for thin film deposition and heterojunction formation have been established, each with its own advantages and drawbacks. Here, we will present a brief overview of research based on MgB2 thin films grown by molecular beam epitaxy coevaporation of Mg and B. The films are smooth and highly crystalline, and the technique allows for virtually any heterostructure to be formed, including all-MgB2 tunnel junctions. Such devices have been characterized, with both quasiparticle and Josephson tunneling reported. MgB2 remains a material of great potential for a multitude of further characterization and exploration research projects and applications.

  11. Data of evolutionary structure change: 1VL8B-2UVDE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1VL8B-2UVDE 1VL8 2UVD B E VFDLRGRVALVTGGSRGLGFGIAQGLAEAGCSVVVASRN...seq1> --MLKGKVALVTGASRGIGRAIAIDLAKQGANVVVNYAGNEQKANEVVDEIKKL-GSDAIAVRADVANA...D E 2UVDE VNYAGNEQKAN E 2UVDE EIKKL-GSDAI 2 2UVD E 2UVDE

  12. Lectin receptor kinase LecRK-b2 localizes to plasma membrane and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-07-20

    Jul 20, 2009 ... Furthermore, the recombinant LecRK-b2 protein exhibited autophosphorylation ... absence of ligand (Giranton et al., 2000; Shimosato et al.,. 2007), while some ..... Elicitin and Mediates INF1-induced Cell Death. Planta, 228: ...

  13. Controlled indole-3-acetaldoxime production through ethanol-induced expression of CYP79B2

    DEFF Research Database (Denmark)

    Mikkelsen, M.D.; Fuller, V.L.; Hansen, Bjarne Gram

    2009-01-01

    Indole-3-acetaldoxime (IAOx) is a key branching point between primary and secondary metabolism. IAOx serves as an intermediate in the biosynthesis of indole glucosinolates (I-GLSs), camalexin and the plant hormone indole-3-acetic acid (IAA). The cytochrome P450s CYP79B2 and CYP79B3 catalyze......OH)-inducible CYP79B2 construct into double (cyp79b2 cyp79b3) or triple (cyp79b2 cyp79b3 cyp83b1) mutant lines. We show EtOH-dependent induction of camalexin and identify a number of candidate IAA homeostasis- or defense-related genes by clustered microarray analysis. The transgenic mutant lines are thus promising...

  14. Gibberellic acid, amino acids (glycine and L-leucine), vitamin B2 ...

    African Journals Online (AJOL)

    SAM

    2014-03-14

    Mar 14, 2014 ... vitamin B2 and zinc as factors affecting the production pigments by Monascus ..... in a nitrogen-deficient medium, the B-group vitamins, both single ... citrinin production in the industrial important strain Monascus purpureus ...

  15. Investigations into the PbO-TeO2-B2O3 glass system

    International Nuclear Information System (INIS)

    Basariya, F.P.; Gugushvili, G.M.

    1975-01-01

    Based on the results of investigations of the system A-TeO 2 -B 2 O 3 and from the ternary phase diagram a region is determined of stable nonorganic glasses of the system PbO-TeO 2 -B 2 O 3 noncrystallizable at a temperature of 300 0 C and showing satisfactory chemical stability, as well as satisfactory isolation properties up to 300 0 C. On addition of an optimum amount of tellurium oxide one can obtain low-melting glasses with a temperature interval of 250-300 0 C. It is established that the substitution of PbO by TeO 2 or B 2 O 3 , or TeO 2 by B 2 O 3 leads to a decrease in the glass density. (author)

  16. Novel Peptide/Protein Delivery System Targeting erbB2-Overexpressing Breast Cancer Cells

    National Research Council Canada - National Science Library

    Yu, Dihua

    2002-01-01

    .... During this funding year, we focused on the delivery of erbB2 signal-blocking ESP peptides (objective 2) . Because of the complexity of biotin-penetratin-AHNP-ESP, the synthesis was unsuccessful...

  17. Safety Analysis Report: X17B2 beamline Synchrotron Medical Research Facility

    International Nuclear Information System (INIS)

    Gmuer, N.F.; Thomlinson, W.

    1990-02-01

    This report contains a safety analysis for the X17B2 beamline synchrotron medical research facility. Health hazards, risk assessment and building systems are discussed. Reference is made to transvenous coronary angiography

  18. Pressure induced structural phase transition of OsB 2: First-principles calculations

    Science.gov (United States)

    Ren, Fengzhu; Wang, Yuanxu; Lo, V. C.

    2010-04-01

    Orthorhombic OsB 2 was synthesized at 1000 °C and its compressibility was measured by using the high-pressure X-ray diffraction in a Diacell diamond anvil cell from ambient pressure to 32 GPa [R.W. Cumberland, et al. (2005)]. First-principles calculations were performed to study the possibility of the phase transition of OsB 2. An analysis of the calculated enthalpy shows that orthorhombic OsB 2 can transfer to the hexagonal phase at 10.8 GPa. The calculated results with the quasi-harmonic approximation indicate that this phase transition pressure is little affected by the thermal effect. The calculated phonon band structure shows that the hexagonal P 6 3/ mmc structure (high-pressure phase) is stable for OsB 2. We expect the phase transition can be further confirmed by the experimental work.

  19. 1300 micron continuum observations of the Sagittarius B2 molecular cloud core

    International Nuclear Information System (INIS)

    Goldsmith, P.F.; Snell, R.L.; Lis, D.C.

    1987-01-01

    Observations with 23-arcsec angular resolution are obtained of the continuum emission at 1300 microns wavelength from the central region of the Sgr B2 molecular cloud, which contains the north and middle high-mass star-forming regions and associated radio continuum and maser sources. The spatial resolution of the present data shows that the 1300-micron continuum emission peak is located at Sgr B2(N), in contrast to the midinfrared emission, which is centered on Sgr B2(M). Comparison with 53 micron data having comparable angular resolution suggests that there is optically thick foreground dust which prevents detection of Sgr B2(N) at wavelengths not greater than 100 microns. Within the about 1.5 x 3.5 pc region mapped, the total mass is 500,000 solar masses and the mean H2 density is 300,000/cu cm, somewhat larger than found in previous investigations. 27 references

  20. Successful treatment of hereditary angioedema with bradykinin B2-receptor antagonist icatibant.

    Science.gov (United States)

    Krause, Karoline; Metz, Martin; Zuberbier, Torsten; Maurer, Marcus; Magerl, Markus

    2010-04-01

    The bradykinin B2 receptor antagonist icatibant has recently become available for treating hereditary angioedema. Our observations demonstrate icatibant to be effective and safe for the treatment of both, abdominal and cutaneous attacks in a practice setting beyond clinical studies.