WorldWideScience

Sample records for azospirillum brasilense tarrand

  1. Aerotactic response of Azospirillum brasilense.

    OpenAIRE

    Barak, R.; I. Nur; Okon, Y.; Henis, Y.

    1982-01-01

    Five strains of Azospirillum brasilense and two of Azospirillum spp., from Israel, responded to self-created and preformed oxygen gradients by forming aerotactic bands in capillary tubes and actively moving toward a specific zone with low dissolved oxygen. Increasing the oxygen concentration in capillaries containing phosphate buffer increased the number of attracted bacteria and decreased band velocity. High O2 concentrations and H2O2 temporarily repulsed the bacteria, causing the formation ...

  2. Vertical movement of Azospirillum brasilense in soil

    International Nuclear Information System (INIS)

    Plant growth promoting rhizobacteria like Azospirillum brasilense have considerable potential in increasing crop productivity. The success of bacterial inoculation in fields however, depends on their root colonizing ability. These bacteria, applied either through seed pelleting or directly to the soil are distributed along roots through active or passive movements. 32P labelled A.brasilense has been used to study their movements in sandy loam soils. (author). 5 refs., 2 figs

  3. Fructose catabolism in Azospirillum brasilense and Azospirillum lipoferum.

    OpenAIRE

    1984-01-01

    The pathways for catabolism of fructose were investigated in the type strains of Azospirillum lipoferum and Azospirillum brasilense grown aerobically with (NH4)2SO4 as the nitrogen source. When grown on fructose, the former species possessed a complete Entner-Doudoroff pathway, whereas the latter species lacked activity for glucose-6-phosphate dehydrogenase. Both species possessed a complete catabolic Embden-Meyerhof-Parnas pathway. Neither species possessed the key enzyme of the hexose monop...

  4. Hydrogen oxidation in Azospirillum brasilense

    Energy Technology Data Exchange (ETDEWEB)

    Tibelius, K.

    1984-01-01

    Hydrogen oxidation by Azospirillum brasilense Sp7 was studied in N/sub 2/-fixing and NH/sub 4//sup +/-grown batch cultures. The K/sub m/ for H/sub 2/ of O/sub 2/-dependent H/sup 3/H oxidation in whole cells was 9 uM. The rates of H/sup 3/H and H/sub 2/ oxidation were very similar, indicating that the initial H/sub 2/ activation step in the overall H/sub 2/ oxidation reaction was not rate-limiting and that H/sup 3/H oxidation was a valid measure of H/sub 2/-oxidation activity. Hydrogen-oxidation activity was inhibited irreversibly by air. In N-free cultures the O/sub 2/ optima for O/sub 2/-dependent H/sub 2/ oxidation, ranging from 0.5-1.25% O/sub 2/ depending on the phase of growth, were significantly higher than those of C/sub 2/H/sub 2/ reduction, 0.15-0.35%, suggesting that the H/sub 2/-oxidation system may have a limited ability to aid in the protection of nitrogenase against inactivation by O/sub 2/. Oxygen-dependent H/sub 2/ oxidation was inhibited by NO/sub 2//sup +/, NO, CO, and C/sub 2/H/sub 2/ with apparent K/sub 1/ values of 20, 0.4, 28, and 88 uM, respectively. Hydrogen-oxidation activity was 50 to 100 times higher in denitrifying cultures when the terminal electron acceptor for growth was N/sub 2/O rather than NO/sub 3//sup -/, possibly due to the irreversible inhibition of hydrogenase by NO/sub 2//sup -/ and NO in NO/sub 3//sup -/-grown cultures.

  5. [Biosynthesis of gold nanoparticles by Azospirillum brasilense].

    Science.gov (United States)

    Kupriashina, M A; Vetchinkina, E P; Burov, A M; Ponomareva, E G; Nikitina, V E

    2014-01-01

    Plant-associated nitrogen-fixing soil bacteria Azospirillum brasilense were shown to reduce the gold of chloroauric acid to elemental gold, resulting in formation of gold nanoparicles. Extracellular phenoloxidizing enzymes (laccases and Mn peroxidases) were shown to participate in reduction of Au+3 (HAuCl4) to Au(0). Transmission electron microscopy revealed accumulation of colloidal gold nanoparticles of diverse shape in the culture liquid of A. brasilense strains Sp245 and Sp7. The size of the electron-dense nanospheres was 5 to 50 nm, and the size of nanoprisms varied from 5 to 300 nm. The tentative mechanism responsible for formation of gold nanoparticles is discussed. PMID:25423733

  6. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    OpenAIRE

    Valerio Orlandini; Giovanni Emiliani; Marco Fondi; Isabel Maida; Elena Perrin; Renato Fani

    2014-01-01

    Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmi...

  7. Biofilm formation by Azospirillum brasilense: microbial socialization in the rhizosphere

    OpenAIRE

    Cerqueira, Francisco Diogo de Almeida, 1990-

    2015-01-01

    Tese de mestrado. Biologia (Microbiologia Aplicada). Universidade de Lisboa, Faculdade de Ciências, 2014 Azospirillum brasilense is a remarkable Plant-Growth Promoting Rhizobacteria (PGPR), with great potential as agricultural inoculant for several crops. Several isolates of this species have been produced as inoculant by some companies and applied in the agriculture as a biofertilizer. Therefore, there is a great interest in gathering more scientific knowledge that improves A. brasilense ...

  8. Temperature inhibition of siderophore production in Azospirillum brasilense.

    OpenAIRE

    Bachhawat, A K; Ghosh, S.

    1989-01-01

    The effect of growth at 42 degrees C on the different components of the siderophore-mediated iron transport that are induced by iron limitation in Azospirillum brasilense was examined. Biosynthesis of the siderophore spirilobactin was strongly inhibited (20-fold) by growth at 42 degrees C, whereas the transport of iron by the ferric-spirilobactin transport system and the induction of the iron-regulated outer membrane proteins were unaffected.

  9. Metabolism of various carbon sources by Azospirillum brasilense.

    OpenAIRE

    Westby, C A; Cutshall, D S; Vigil, G V

    1983-01-01

    Azospirillum brasilense Sp7 and two mutants were examined for 19 carbon metabolism enzymes. The results indicate that this nitrogen fixer uses the Entner-Doudoroff pathway for gluconate dissimilation, lacks a catabolic but has an anabolic Embden-Meyerhof-Parnas hexosephosphate pathway, has amphibolic triosephosphate enzymes, lacks a hexose monophosphate shunt, and has lactate dehydrogenase, malate dehydrogenase, and glycerokinase. The mutants are severely deficient in phosphoglycerate and pyr...

  10. Analysis of Indole-3-Acetic Acid and Related Indoles in Culture Medium from Azospirillum lipoferum and Azospirillum brasilense

    OpenAIRE

    Crozier, Alan; Arruda, Paulo; Janie M Jasmim; Monteiro, Ana Maria; Sandberg, Göran

    1988-01-01

    Analysis of neutral and acidic ethyl acetate extracts from culture medium of Azospirillum brasilense 703Ebc by high-performance liquid chromatography (HPLC) and combined gas chromatography-mass spectrometry demonstrated the presence of indole-3-acetic acid (IAA), indole-3-ethanol, indole-3-methanol, and indole-3-lactic acid. IAA in media of 20 strains of A. brasilense and Azospirillum lipoferum was analyzed quantitatively by both the colorimetric Salkowski assay and HPLC-based isotopic diluti...

  11. Inoculation of maize with Azospirillum brasilense in the seed furrow

    Directory of Open Access Journals (Sweden)

    Tâmara Prado de Morais

    2016-06-01

    Full Text Available ABSTRACT Several studies addressing the inoculation of cereals with diazotrophic microorganisms can be found in the literature. However, in many experiments, investigators have overlooked the feasibility of applying these microorganisms to the furrow together with the seed, and the effect of bacterial concentration on phytostimulation. The aim of this work was to evaluate the effect of doses of an inoculant based on Azospirillum brasilense, applied to the seed furrow when planting maize, combined with different doses of nitrogen fertiliser. The experiment was carried out in the field, in soil of the cerrado region of Brazil. An experimental design of randomised blocks in bands was adopted, comprising nitrogen (40, 100, 200 and 300 kg ha-1 and doses of an A. brasilense-based liquid inoculant applied to the seed furrow (0, 100, 200, 300 and 400 mL ha-1. The dose of 200 mL ha-1Azospirillum was noteworthy for grain production. This is the first report of the effective application of Azospirillum in the seed furrow when planting maize in the cerrado region of Brazil.

  12. Directed mutagenesis affects recombination in Azospirillum brasilense nif genes

    Directory of Open Access Journals (Sweden)

    C.P. Nunes

    2000-12-01

    Full Text Available In order to improve the gene transfer/mutagenesis system for Azospirillum brasilense, gene-cartridge mutagenesis was used to replace the nifD gene with the Tn5 kanamycin resistance gene. The construct was transferred to A. brasilense by electrotransformation. Of the 12 colonies isolated using the suicide plasmid pSUP202 as vector, only four did not show vector integration into the chromosome. Nevertheless, all 12 colonies were deficient in acetylene reduction, indicating an Nif- phenotype. Four Nif- mutants were analyzed by Southern blot, using six different probes spanning the nif and Km r genes and the plasmid vector. Apparently, several recombination events occurred in the mutant genomes, probably caused mainly by gene disruption owing to the mutagenesis technique used: resistance gene-cartridge mutagenesis combined with electrotransformation.Com o objetivo de melhorar os sistemas de transferência gênica e mutagênese para Azospirillum brasilense, a técnica de mutagênese através do uso de um gene marcador ("gene-cartridge mutagenesis" foi utilizada para substituir a região genômica de A. brasilense correspondente ao gene nifD por um segmento de DNA do transposon Tn5 contendo o gene que confere resistência ao antibiótico canamicina. A construção foi transferida para a linhagem de A. brasilense por eletrotransformação. Doze colônias transformantes foram isoladas com o plasmídeo suicida pSUP202 servindo como vetor. Dessas, somente quatro não possuíam o vetor integrado no cromossomo da bactéria. Independentemente da integração ou não do vetor, as 12 colônias foram deficientes na redução do gás acetileno, evidenciando o fenótipo Nif -. Quatro mutantes Nif - foram analisados através da técnica de Southern blot, utilizando-se seis diferentes fragmentos contendo genes nif, de resistência à canamicina e do vetor como sondas. Os resultados sugerem a ocorrência de eventos recombinacionais variados no genoma dos mutantes. A

  13. Azospirillum brasilense siderophores with antifungal activity against Colletotrichum acutatum.

    Science.gov (United States)

    Tortora, María L; Díaz-Ricci, Juan C; Pedraza, Raúl O

    2011-04-01

    Anthracnose, caused by the fungus Colletotrichum acutatum is one of the most important diseases in strawberry crop. Due to environmental pollution and resistance produced by chemical fungicides, nowadays biological control is considered a good alternative for crop protection. Among biocontrol agents, there are plant growth-promoting bacteria, such as members of the genus Azospirillum. In this work, we demonstrate that under iron limiting conditions different strains of A. brasilense produce siderophores, exhibiting different yields and rates of production according to their origin. Chemical assays revealed that strains REC2 and REC3 secrete catechol type siderophores, including salicylic acid, detected by thin layer chromatography coupled with fluorescence spectroscopy and gas chromatography-mass spectrometry analysis. Siderophores produced by them showed in vitro antifungal activity against C. acutatum M11. Furthermore, this latter coincided with results obtained from phytopathological tests performed in planta, where a reduction of anthracnose symptoms on strawberry plants previously inoculated with A. brasilense was observed. These outcomes suggest that some strains of A. brasilense could act as biocontrol agent preventing anthracnose disease in strawberry. PMID:21234749

  14. Application of the Indirect Immunoperoxidase Stain Technique to the Flagella of Azospirillum brasilense

    OpenAIRE

    Hall, Patrick G.; Krieg, Noel R.

    1984-01-01

    An indirect immunoperoxidase stain was used to demonstrate by electron microscopy that an antigenic difference exists between the polar flagellum and the lateral flagella of Azospirillum brasilense ATCC 29145.

  15. Interaction of Azospirillum brasilense and Glomus intrarradix in Sugar Cane Roots

    OpenAIRE

    Bellone, Carlos H.; de Bellone Silvia, Carrizo

    2011-01-01

    Fifteen-day-old variety NA 56-79 sugar cane seedlings were inoculated with Azospirillum brasilense and Glomus intrarradix. This article aims at examining changes in sugar cane root seedlings inoculated with Glomus intrarradix and Azospirillum brasilense, the increase in microbial biomass and the acetylene reduction process as well. The internal root colonization was studied 20 days after inoculation using scanning and a transmission electron microscope. Both microorganisms entered the sugar c...

  16. Aggregation of the rhizospheric bacterium Azospirillum brasilense in response to oxygen

    Science.gov (United States)

    Abdoun, Hamid; McMillan, Mary; Pereg, Lily

    2016-04-01

    Azospirillum brasilense spp. have ecological, scientific and agricultural importance. As model plant growth promoting rhizobacteria they interact with a large variety of plants, including important food and cash crops. Azospirillum strains are known for their production of plant growth hormones that enhance root systems and for their ability to fix nitrogen. Azospirillum cells transform in response to environmental cues. The production of exopolysaccharides and cell aggregation during cellular transformation are important steps in the attachment of Azospirillum to roots. We investigate signals that induce cellular transformation and aggregation in the Azospirillum and report on the importance of oxygen to the process of aggregation in this rhizospheric bacterium.

  17. Isolation of behavioral mutants of Azospirillum brasilense by using Tn5 lacZ.

    OpenAIRE

    van Rhijn, P; Vanstockem, M; Vanderleyden, J.; De Mot, R

    1990-01-01

    Tn5 lacZ mutants were generated with Azospirillum brasilense 7030 by mating that strain with Escherichia coli strains carrying suicide plasmid pCIB100 or pCIB110. Kanamycin-resistant Azospirillum colonies were obtained with a maximum frequency of 10(-6) per recipient cell. The potential of Tn5 lacZ for random transposon mutagenesis coupled to transcription analysis in A. brasilense 7030 was demonstrated. Sixty percent of all Kmr A. brasilense 7030 mutants expressed beta-galactosidase activity...

  18. Accessing inoculation methods of maize and wheat with Azospirillum brasilense.

    Science.gov (United States)

    Fukami, Josiane; Nogueira, Marco Antonio; Araujo, Ricardo Silva; Hungria, Mariangela

    2016-03-01

    The utilization of inoculants containing Azospirillum is becoming more popular due to increasing reports of expressive gains in grain yields. However, incompatibility with pesticides used in seed treatments represents a main limitation for a successful inoculation. Therefore, in this study we searched for alternatives methods for seed inoculation of maize and wheat, aiming to avoid the direct contact of bacteria with pesticides. Different doses of inoculants containing Azospirillum brasilense were employed to perform inoculation in-furrow, via soil spray at sowing and via leaf spray after seedlings had emerged, in comparison to seed inoculation. Experiments were conducted first under greenhouse controlled conditions and then confirmed in the field at different locations in Brazil. In the greenhouse, most parameters measured responded positively to the largest inoculant dose used in foliar sprays, but benefits could also be observed from both in-furrow and soil spray inoculation. However, our results present evidence that field inoculation with plant-growth promoting bacteria must consider inoculant doses, and point to the need of fine adjustments to avoid crossing the threshold of growth stimulation and inhibition. All inoculation techniques increased the abundance of diazotrophic bacteria in plant tissues, and foliar spray improved colonization of leaves, while soil inoculations favored root and rhizosphere colonization. In field experiments, inoculation with A. brasilense allowed for a 25 % reduction in the need for N fertilizers. Our results have identified alternative methods of inoculation that were as effective as the standard seed inoculation that may represent an important strategy to avoid the incompatibility between inoculant bacteria and pesticides employed for seed treatment. PMID:26759120

  19. Transposon Mutagenesis of Azospirillum brasilense and Azospirillum lipoferum: Physical Analysis of Tn5 and Tn5-Mob Insertion Mutants

    OpenAIRE

    Vanstockem, Mark; Michiels, Kris; Vanderleyden, Jos; Van Gool, August P.

    1987-01-01

    Tn5-induced insertion mutants were generated in Azospirillum brasilense Sp7 and A. lipoferum SpBr17 by mating with Escherichia coli strains carrying suicide plasmid vectors. The sources of Tn5 were the suicide plasmids pGS9 and pSUP2021. Kanamycin-resistant Azospirillum colonies appeared from crosses with E. coli at maximum frequencies of 10−7 per recipient cell. Transposon Tn5 also conferred streptomycin resistance on Azospirillum colonies as was observed earlier for Rhizobium sp. Eight Tn5-...

  20. Metabolic Adaptations of Azospirillum brasilense to Oxygen Stress by Cell-to-Cell Clumping and Flocculation

    OpenAIRE

    Bible, Amber N.; Khalsa-Moyers, Gurusahai K.; Mukherjee, Tanmoy; Green, Calvin S.; Mishra, Priyanka; Purcell, Alicia; Aksenova, Anastasia; Gregory B Hurst; Alexandre, Gladys

    2015-01-01

    The ability of bacteria to monitor their metabolism and adjust their behavior accordingly is critical to maintain competitiveness in the environment. The motile microaerophilic bacterium Azospirillum brasilense navigates oxygen gradients by aerotaxis in order to locate low oxygen concentrations that can support metabolism. When cells are exposed to elevated levels of oxygen in their surroundings, motile A. brasilense cells implement an alternative response to aerotaxis and form transient clum...

  1. Cloning and expression in Escherichia coli of the Azospirillum brasilense Sp7 gene encoding ampicillin resistance.

    OpenAIRE

    Verreth, C; Cammue, B; Swinnen, P; Crombez, D; Michielsen, A; Michiels, K.; Gool, A. van; Vanderleyden, J.

    1989-01-01

    The Azospirillum brasilense ATCC 29145 gene coding for beta-lactamase was cloned in Escherichia coli. The gene was expressed in E. coli from its own promoter as a 30-kilodalton protein, conferring resistance to high levels of beta-lactam antibiotics. The DNA sequence containing the beta-lactamase gene was found to be highly amplified in the Azospirillum genome, scattered in the chromosomal as well as in the plasmidic DNA.

  2. Cellular Responses during Morphological Transformation in Azospirillum brasilense and Its flcA Knockout Mutant

    OpenAIRE

    Hou, Xingsheng; McMillan, Mary; Joëlle V. F. Coumans; Poljak, Anne; Raftery, Mark J.; Pereg, Lily

    2014-01-01

    FlcA is a response regulator controlling flocculation and the morphological transformation of Azospirillum cells from vegetative to cyst-like forms. To understand the cellular responses of Azospirillum to conditions that cause morphological transformation, proteins differentially expressed under flocculation conditions in A. brasilense Sp7 and its flcA knockout mutant were investigated. Comparison of 2-DE protein profiles of wild-type (Sp7) and a flcA deletion mutant (Sp7-flcAΔ) revealed a to...

  3. Survival of Azospirillum brasilense in the Bulk Soil and Rhizosphere of 23 Soil Types

    OpenAIRE

    Bashan, Y.; Puente, M. E.; Rodriguez-Mendoza, M. N.; Toledo, G.; Holguin, G.; Ferrera-Cerrato, R.; Pedrin, S.

    1995-01-01

    The survival of Azospirillum brasilense Cd and Sp-245 in the rhizosphere of wheat and tomato plants and in 23 types of plant-free sterilized soils obtained from a wide range of environments in Israel and Mexico was evaluated. Large numbers of A. brasilense cells were detected in all the rhizospheres tested, regardless of soil type, bacterial strain, the origin of the soil, or the amount of rainfall each soil type received prior to sampling. Survival of A. brasilense in soils without plants di...

  4. Oxidative and antioxidative responses in the wheat-Azospirillum brasilense interaction.

    Science.gov (United States)

    Méndez-Gómez, Manuel; Castro-Mercado, Elda; Alexandre, Gladys; García-Pineda, Ernesto

    2016-03-01

    Azospirillum is a plant growth-promoting rhizobacteria (PGPR) able to enhance the growth of wheat. The aim of this study was to test the effect of Azospirillum brasilense cell wall components on superoxide (O2·(-)) production in wheat roots and the effect of oxidative stress on A. brasilense viability. We found that inoculation with A. brasilense reduced O2·(-) levels by approx. 30 % in wheat roots. Inoculation of wheat with papain-treated A. brasilense, a Cys protease, notably increased O2·(-) production in all root tissues, as was observed by the nitro blue tetrazolium (NBT) reduction. However, a 24-h treatment with rhizobacteria lipopolysaccharides (50 and 100 μg/mL) alone did not affect the pattern of O2·(-) production. Analysis of the effect of plant cell wall components on A. brasilense oxidative enzyme activity showed no changes in catalase activity but a decrease in superoxide dismutase activity in response to polygalacturonic acid treatment. Furthermore, A. brasilense growth was only affected by high concentrations of H2O2 or paraquat, but not by sodium nitroprusside. Our results suggest that rhizobacterial cell wall components play an important role in controlling plant cell responses and developing tolerance of A. brasilense to oxidative stress produced by the plant. PMID:25952083

  5. brasilense nativa de Tamaulipas, México

    Directory of Open Access Journals (Sweden)

    J. L. Hernández-Mendoza

    2008-01-01

    Full Text Available La bacteria Azospirillum brasilense [Tarrand et al., 1979] metaboliza el triptófano y produce diversos metabolitos; entre ellos, el ácido indolacético. En este trabajo se utilizó la cepa CBG 497 de A. brasilense aislada de maíz para identificar los metabolitos producidos a partir de triptófano en laboratorio. Entre los metabolitos identificados destacan los ácidos antranílico e indolacético. El ácido antranílico es un compuesto intermediario en la síntesis y degradación del triptófano y, junto con el ácido indolacético, estaría involucrado en la capacidad promotora del crecimiento vegetal de A. brasilense

  6. Repressor Mutant Forms of the Azospirillum brasilense NtrC Protein

    OpenAIRE

    Huergo, Luciano F.; Assumpção, Marcelo C.; Emanuel M. Souza; Steffens, M. Berenice R.; Yates, M. Geoffrey; Chubatsu, Leda S; Pedrosa, Fábio O.

    2004-01-01

    The Azospirillum brasilense mutant strains FP8 and FP9, after treatment with nitrosoguanidine, showed a null Nif phenotype and were unable to use nitrate as their sole nitrogen source. Sequencing of the ntrC genes revealed single nucleotide mutations in the NtrC nucleotide-binding site. The phenotypes of these strains are discussed in relation to their genotypes.

  7. Complete Genome Sequence of the Model Rhizosphere Strain Azospirillum brasilense Az39, Successfully Applied in Agriculture.

    Science.gov (United States)

    Rivera, Diego; Revale, Santiago; Molina, Romina; Gualpa, José; Puente, Mariana; Maroniche, Guillermo; Paris, Gastón; Baker, David; Clavijo, Bernardo; McLay, Kirsten; Spaepen, Stijn; Perticari, Alejandro; Vazquez, Martín; Wisniewski-Dyé, Florence; Watkins, Chris; Martínez-Abarca, Francisco; Vanderleyden, Jos; Cassán, Fabricio

    2014-01-01

    We present the complete genome sequence of Azospirillum brasilense Az39, isolated from wheat roots in the central region of Argentina and used as inoculant in extensive and intensive agriculture during the last four decades. The genome consists of 7.39 Mb, distributed in six replicons: one chromosome, three chromids, and two plasmids. PMID:25059863

  8. Control of Nitrogenase Reactivation by the GlnZ Protein in Azospirillum brasilense

    OpenAIRE

    Klassen, Giseli; Emanuel M. Souza; Yates, M. Geoffrey; Rigo, Liu Un; Inaba, Juliana; de Oliveira Pedrosa, Fábio

    2001-01-01

    The glnZ mutant of Azospirillum brasilense (strain 7611) showed only partial recovery (20 to 40%) after 80 min of ammonia-induced nitrogenase switch-off, whereas the wild type recovered totally within 10 min. In contrast, the two strains showed identical anoxic-induced switch-on/switch-off, indicating no cross talk between the two reactivation mechanisms.

  9. Enhancement of Wheat Root Colonization and Plant Development by Azospirillum brasilense Cd. Following Temporary Depression of Rhizosphere Microflora

    OpenAIRE

    Bashan, Yoav

    1986-01-01

    Inoculation of wheat with Azospirillum brasilense, combined with the application of four fungal and bacterium-inhibiting substances to which A. brasilense is resistant in the soil, decreased the rhizosphere population, while it increased wheat root colonization by A. brasilense, even in cases of poor inoculation. The inoculation significantly increased the following wheat plant parameters as well: plant dry weight, number of tillers per plant, spikelet fertility, harvest index, and grain yiel...

  10. Azospirillum brasilense ameliorates the response of Arabidopsis thaliana to drought mainly via enhancement of ABA levels.

    Science.gov (United States)

    Cohen, Ana C; Bottini, Rubén; Pontin, Mariela; Berli, Federico J; Moreno, Daniela; Boccanlandro, Hernán; Travaglia, Claudia N; Piccoli, Patricia N

    2015-01-01

    Production of phytohormones is one of the main mechanisms to explain the beneficial effects of plant growth-promoting rhizobacteria (PGPR) such as Azospirillum sp. The PGPRs induce plant growth and development, and reduce stress susceptibility. However, little is known regarding the stress-related phytohormone abscisic acid (ABA) produced by bacteria. We investigated the effects of Azospirillum brasilense Sp 245 strain on Arabidopsis thaliana Col-0 and aba2-1 mutant plants, evaluating the morphophysiological and biochemical responses when watered and in drought. We used an in vitro-grown system to study changes in the root volume and architecture after inoculation with Azospirillum in Arabidopsis wild-type Col-0 and on the mutant aba2-1, during early growth. To examine Arabidopsis development and reproductive success as affected by the bacteria, ABA and drought, a pot experiment using Arabidopsis Col-0 plants was also carried out. Azospirillum brasilense augmented plant biomass, altered root architecture by increasing lateral roots number, stimulated photosynthetic and photoprotective pigments and retarded water loss in correlation with incremented ABA levels. As well, inoculation improved plants seed yield, plants survival, proline levels and relative leaf water content; it also decreased stomatal conductance, malondialdehyde and relative soil water content in plants submitted to drought. Arabidopsis inoculation with A. brasilense improved plants performance, especially in drought. PMID:24796562

  11. Regulation of fructose uptake and catabolism by succinate in Azospirillum brasilense.

    OpenAIRE

    Mukherjee, A; S. Ghosh

    1987-01-01

    Fructose uptake and catabolism in Azospirillum brasilense is dependent on three fructose-inducible enzymes (fru-enzymes): (i) enzyme I and (ii) enzyme II of the phosphoenolpyruvate:fructose phosphotransferase system and (iii) 1-phosphofructokinase. In minimal medium containing 3.7 mM succinate and 22 mM fructose as sources of carbon, growth of A. brasilense was diauxic, succinate being utilized in the first phase of growth and fructose in the second phase with a lag period between the two gro...

  12. Structure of the polysaccharides from the lipopolysaccharide of Azospirillum brasilense Jm125A2.

    Science.gov (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A

    2015-10-30

    Two polysaccharides were obtained by mild acid degradation of the lipopolysaccharide of associative nitrogen-fixing bacteria Azospirillum brasilense Jm125A2 isolated from the rhizosphere of a pearl millet. The following structures of the polysaccharides were established by sugar and methylation analyses, Smith degradation, and (1)H and (13)C NMR spectroscopy: [Formula: see text] Structure 1 has been reported earlier for a polysaccharide from A. brasilense S17 (Fedonenko YP, Konnova ON, Zdorovenko EL, Konnova SA, Zatonsky GV, Shaskov AS, Ignatov VV, Knirel YA. Carbohydr Res 2008;343:810-6), whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. PMID:26343325

  13. Purification and binding analysis of the nitrogen fixation regulatory NifA protein from Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    L.M.P. Passaglia

    1998-11-01

    Full Text Available NifA protein activates transcription of nitrogen fixation operons by the alternative sigma54 holoenzyme form of RNA polymerase. This protein binds to a well-defined upstream activator sequence (UAS located at the -200/-100 position of nif promoters with the consensus motif TGT-N10-ACA. NifA of Azospirillum brasilense was purified in the form of a glutathione-S-transferase (GST-NifA fusion protein and proteolytic release of GST yielded inactive and partially soluble NifA. However, the purified NifA was able to induce the production of specific anti-A. brasilense NifA-antiserum that recognized NifA from A. brasilense but not from K. pneumoniae. Both GST-NifA and NifA expressed from the E. coli tac promoter are able to activate transcription from the nifHDK promoter but only in an A. brasilense background. In order to investigate the mechanism that regulates NifA binding capacity we have used E. coli total protein extracts expressing A. brasilense nifA in mobility shift assays. DNA fragments carrying the two overlapping, wild-type or mutated UAS motifs present in the nifH promoter region revealed a retarded band of related size. These data show that the binding activity present in the C-terminal domain of A. brasilense NifA protein is still functional even in the presence of oxygen.

  14. Identification of a phosphoenolpyruvate:fructose 1-phosphotransferase system in Azospirillum brasilense.

    OpenAIRE

    Gupta, K. D.; S. Ghosh

    1984-01-01

    An inducible phosphoenolpyruvate:fructose phosphotransferase system has been detected in Azospirillum brasilense, which requires a minimum of two components of the crude extracts for activity: (i) a soluble fraction (enzyme I) and (ii) a membrane fraction (enzyme II). The uninduced cells neither show any uptake of fructose nor express activity of either of these two enzyme fractions. C-1 of fructose is the site of phosphorylation. This phosphotransferase system does not accept glucose as a su...

  15. Growth and yield of corn hybrids in response to association with Azospirillum brasilense and nitrogen fertilization

    OpenAIRE

    2015-01-01

    There is a growing interest in optimizing the positive effects of the association between Azospirillum bacteria and corn crop in order to reduce the use of nitrogen fertilizers. This study aimed to evaluate the inoculation efficiency of an A. brasilense-based commercial product in association with different rates of nitrogen fertilization in two corn genotypes. The experiment was arranged in a 2 x 2 x 5 factorial randomized block design, with four replications. The treatments consisted of two...

  16. Regulatory mutation that controls nif expression and histidine transport in Azospirillum brasilense.

    OpenAIRE

    Fischer, M.; Levy, E; Geller, T

    1986-01-01

    Mutagenesis of Azospirillum brasilense with nitrosoguanidine and selection on ethylenediamine yielded prototrophs which fixed nitrogen in the presence of ammonia. Nitrogenase activity in mutant strains exceeded that of the wild type three- to sixfold. The same mutants were also constitutive for histidine transport. Enzyme activities involved in ammonia assimilation were not affected by the mutation. The data suggest that the mutation occurred at a site which regulates nif and histidine transp...

  17. Fourier transform infrared spectroscopic study of intact cells of the nitrogen-fixing bacterium Azospirillum brasilense

    Science.gov (United States)

    Kamnev, A. A.; Ristić, M.; Antonyuk, L. P.; Chernyshev, A. V.; Ignatov, V. V.

    1997-06-01

    The data of Fourier transform infrared (FTIR) spectroscopic measurements performed on intact cells of the soil nitrogen-fixing bacterium Azospirillum brasilense grown in a standard medium and under the conditions of an increased metal uptake are compared and discussed. The structural FTIR information obtained is considered together with atomic absorption spectrometry (AAS) data on the content of metal cations in the bacterial cells. Some methodological aspects concerning preparation of bacterial cell samples for FTIR measurements are also discussed.

  18. [Determination of Azospirillum Brasilense Cells With Bacteriophages via Electrooptical Analysis of Microbial Suspensions].

    Science.gov (United States)

    Gulii, O I; Karavayeva, O A; Pavlii, S A; Sokolov, O I; Bunin, V D; Ignatov, O V

    2015-01-01

    The dependence-of changes in the electrooptical properties of Azospirillum brasilense cell suspension Sp7 during interaction with bacteriophage ΦAb-Sp7 on the number and time of interactions was studied. Incubation of cells with bacteriophage significantly changed the electrooptical signal within one minute. The selective effect of bacteriophage ΦAb on 18 strains of bacteria of the genus Azospirillum was studied: A. amazonense Ami4, A. brasilense Sp7, Cd, Sp107, Sp245, Jm6B2, Brl4, KR77, S17, S27, SR55, SR75, A. halopraeferans Au4, A. irakense KBC1, K A3, A. lipoferum Sp59b, SR65 and RG20a. We determined the limit of reliable determination of microbial cells infected with bacteriophage: - 10(4) cells/mL. The presence of foreign cell cultures of E. coli B-878 and E. coli XL-1 did not complicate the detection of A brasilense Sp7 cells with the use of bacteriophage ΦAb-Sp7. The results demonstrated that bacteriophage (ΦAb-Sp7 can be used for the detection of Azospirillum microbial cells via t electrooptical analysis of cell suspensions. PMID:26204775

  19. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability. PMID:26263623

  20. Quantification of Azospirillum brasilense FP2 Bacteria in Wheat Roots by Strain-Specific Quantitative PCR.

    Science.gov (United States)

    Stets, Maria Isabel; Alqueres, Sylvia Maria Campbell; Souza, Emanuel Maltempi; Pedrosa, Fábio de Oliveira; Schmid, Michael; Hartmann, Anton; Cruz, Leonardo Magalhães

    2015-10-01

    Azospirillum is a rhizobacterial genus containing plant growth-promoting species associated with different crops worldwide. Azospirillum brasilense strains exhibit a growth-promoting effect by means of phytohormone production and possibly by N2 fixation. However, one of the most important factors for achieving an increase in crop yield by plant growth-promoting rhizobacteria is the survival of the inoculant in the rhizosphere, which is not always achieved. The objective of this study was to develop quantitative PCR protocols for the strain-specific quantification of A. brasilense FP2. A novel approach was applied to identify strain-specific DNA sequences based on a comparison of the genomic sequences within the same species. The draft genome sequences of A. brasilense FP2 and Sp245 were aligned, and FP2-specific regions were filtered and checked for other possible matches in public databases. Strain-specific regions were then selected to design and evaluate strain-specific primer pairs. The primer pairs AzoR2.1, AzoR2.2, AzoR5.1, AzoR5.2, and AzoR5.3 were specific for the A. brasilense FP2 strain. These primer pairs were used to monitor quantitatively the population of A. brasilense in wheat roots under sterile and nonsterile growth conditions. In addition, coinoculations with other plant growth-promoting bacteria in wheat were performed under nonsterile conditions. The results showed that A. brasilense FP2 inoculated into wheat roots is highly competitive and achieves high cell numbers (∼10(7) CFU/g [fresh weight] of root) in the rhizosphere even under nonsterile conditions and when coinoculated with other rhizobacteria, maintaining the population at rather stable levels for at least up to 13 days after inoculation. The strategy used here can be applied to other organisms whose genome sequences are available. PMID:26187960

  1. Genome Sequence of Azospirillum brasilense CBG497 and Comparative Analyses of Azospirillum Core and Accessory Genomes provide Insight into Niche Adaptation

    OpenAIRE

    Victor González; Alberto Mendoza Herrera; Valérie Barbe; Zoé Rouy; Claire Prigent-Combaret; Benoît Drogue; Stéphanie Borland; Erika Acosta-Cruz; Luis Lozano; Florence Wisniewski-Dyé; Patrick Mavingui

    2012-01-01

    Bacteria of the genus Azospirillum colonize roots of important cereals and grasses, and promote plant growth by several mechanisms, notably phytohormone synthesis. The genomes of several Azospirillum strains belonging to different species, isolated from various host plants and locations, were recently sequenced and published. In this study, an additional genome of an A. brasilense strain, isolated from maize grown on an alkaline soil in the northeast of Mexico, strain CBG497, was obtained. Co...

  2. Residual effect of nitrogen fertilization and Azospirillum brasilense inoculation in the maize culture
    Efeito residual da adubação nitrogenada e inoculação de Azospirillum brasilense na cultura do milho

    OpenAIRE

    Jackson Huzar Novakowiski; Aníbal de Moraes; Margarete Kimie Falbo; Itacir Eloi Sandini; Jaqueline Huzar Novakowiski; Nicole Colombari Cheng

    2011-01-01

    The diazotrophic bacteria Azospirillum brasilense is an organism able to fix nitrogen of atmosphere and produce plant hormones. Nevertheless, there is lack of information with regard to use in field conditions, especially in production systems that have presence of animals in a determined year period. The objective of paper was to evaluate the association of the nitrogen residual effect of fertilization in pasture winter and the inoculation with A. brasilense in the maize culture. Were carrie...

  3. Reduction of selenite by Azospirillum brasilense with the formation of selenium nanoparticles.

    Science.gov (United States)

    Tugarova, Anna V; Vetchinkina, Elena P; Loshchinina, Ekaterina A; Burov, Andrei M; Nikitina, Valentina E; Kamnev, Alexander A

    2014-10-01

    The ability to reduce selenite (SeO(3)(2-)) ions with the formation of selenium nanoparticles was demonstrated in Azospirillum brasilense for the first time. The influence of selenite ions on the growth of A. brasilense Sp7 and Sp245, two widely studied wild-type strains, was investigated. Growth of cultures on both liquid and solid (2 % agar) media in the presence of SeO(3)(2-) was found to be accompanied by the appearance of the typical red colouration. By means of transmission electron microscopy (TEM), electron energy loss spectroscopy (EELS) and X-ray fluorescence analysis (XFA), intracellular accumulation of elementary selenium in the form of nanoparticles (50 to 400 nm in diameter) was demonstrated for both strains. The proposed mechanism of selenite-to-selenium (0) reduction could involve SeO(3)(2-) in the denitrification process, which has been well studied in azospirilla, rather than a selenite detoxification strategy. The results obtained point to the possibility of using Azospirillum strains as endophytic or rhizospheric bacteria to assist phytoremediation of, and cereal cultivation on, selenium-contaminated soils. The ability of A. brasilense to synthesise selenium nanoparticles may be of interest to nanobiotechnology for "green synthesis" of bioavailable amorphous red selenium nanostructures. PMID:24863127

  4. Optimization of biofloc production in Azospirillum brasilense (MTCC-125) and evaluation of its adherence with the roots of certain crops

    OpenAIRE

    Joe, Melvin; Karthikeyan, M. B.; Sekar, C.; Deiveekasundaram, M.

    2010-01-01

    The phenomenon of flocculation in Azospirillum brasilense (MTCC-125) was studied under different combinations of carbon and nitrogen sources. Fructose and Potassium nitrate at a pH of 6.4 in the cultural medium favour a higher bio-floc production. The biofloc was studied for root adhesion and its survival efficiency in the rhizoplane and rhizosphere of certain crops such as sorghum and sunflower under dryland condition. It has been demonstrated that the flocculated cultures of Azospirillum we...

  5. Enzyme-Linked Immunosorbent Assay for Specific Identification and Enumeration of Azospirillum brasilense Cd. in Cereal Roots †

    OpenAIRE

    Levanony, Hanna; Bashan, Yoav; Kahana, Zvi E.

    1987-01-01

    The enzyme-linked immunosorbent assay is suggested as a reliable, sensitive, and highly specific method for the identification and enumeration of Azospirillum brasilense Cd. As few as 105 CFU/ml can be practically identified by this method. At higher bacterial numbers, sensitivity increased linearly up to 5 × 108 CFU/ml, yielding useful standard curves. No cross-reaction was found either with different closely related Azospirillum strains or with other rhizosphere bacteria. The method allows ...

  6. [Isolation and purification of Mn-peroxidase from Azospirillum brasilense Sp245].

    Science.gov (United States)

    Kupriashina, M A; Selivanov, N Iu; Nikitina, V E

    2012-01-01

    Homogenous Mn-peroxidase of a 26-fold purity grade was isolated from a culture of Azospirillum brasilense Sp245 cultivated on a medium containing 0.1 mM pyrocatechol. The molecular weight of the enzyme is 43 kD as revealed by electrophoresis in SDS-PAAG. It was shown that the use of pyrocatechol and 2,2'-azino-bis(3-ethylbenzotiazoline-6-sulfonate) at concentrations of 0.1 and I mM as inductors increased the Mn-peroxidase activity by a factor of 3. PMID:22567881

  7. Mutants with Enhanced Nitrogenase Activity in Hydroponic Azospirillum brasilense-Wheat Associations

    OpenAIRE

    Pereg Gerk, Lily; Gilchrist, Kate; Kennedy, Ivan R.

    2000-01-01

    The effect of a mutation affecting flocculation, differentiation into cyst-like forms, and root colonization on nitrogenase expression by Azospirillum brasilense is described. The gene flcA of strain Sp7 restored these phenotypes in spontaneous mutants of both strains Sp7 and Sp245. Employing both constitutive pLA-lacZ and nifH-lacZ reporter fusions expressed in situ, the colony morphology, colonization pattern, and potential for nitrogenase activity of spontaneous mutants and flcA Tn5-induce...

  8. Increased acidification in the rhizosphere of cactus seedlings induced by Azospirillum brasilense

    Science.gov (United States)

    Carrillo, Angel; Li, Ching; Bashan, Yoav

    2002-08-01

    Acidification of the rhizosphere of cactus seedlings (giant cardon, Pachycereus pringlei) after inoculation with the plant growth-promoting bacterium Azospirillum brasilense Cd, in the presence or absence of ammonium and nitrate, was studied to understand how to increase growth of cardon seedlings in poor desert soils. While ammonium enhanced rhizosphere and liquid culture acidification, inoculation with the bacteria enhanced it further. On the other hand, nitrate increased pH of the rhizosphere, but combined with the bacterial inoculation, increase in pH was significantly smaller. Bacterial inoculation with ammonium enhanced plant growth.

  9. Azospirillum brasilense locus coding for phosphoenolpyruvate:fructose phosphotransferase system and global regulation of carbohydrate metabolism.

    OpenAIRE

    Chattopadhyay, S; Mukherjee, A.; Ghosh, S.

    1993-01-01

    Mutants of Azospirillum brasilense unable to grow on fructose include ones affected only on fructose (Fru-) and others impaired on many or all carbohydrates through interference with induction of their specific pathways (Car-). Both types of mutants could be complemented by a cosmid in broad-host-range vector pLAFR1 containing a 27.5-kb genomic insert, Car(-)-complementing activity depending on a 2.2-kb fragment, and Fru(-)-complementing activity depending on an overlapping 9.6-kb fragment.

  10. Effect of Azospirillum brasilense inoculation on urease activity in soil and gamma-sterilized soil

    International Nuclear Information System (INIS)

    Azospirillum spp. is considered a PGPR (plant growth promoting rhyzobacteria) bacterium, besides this interest, there is little information about its effects on other functional microbial groups or on soil enzymes. In this paper, the impact that Azospirillum brasilense 7001 inoculation has on urease activity expression in a Typic Argiudoll was studied. Evolution of urease activity of soil and of gamma irradiation (25 KGy) sterilized soil, and the inoculated strain survival were tested. The relation between soil urease activity and soil NH4+-N was also determined. In γ-sterilized soil, urease activity of inoculated soil increased with time, showing significant differences with regard to the control soil without inoculum at day 15. In non-sterile soil, urease activity decreased during the studied period in all treatments; in inoculated soil, it showed higher or lower values than the control depending on sampling time. Azospirillum survival was important and different according to soil condition conditions. The negative relation between NH4+-N concentration and soil urease activity (r2 = 0.62) was observed in inoculated soil. The role of the addition of autoclaved inoculum in the urease activity expression is discussed. The research proves that in both studied situations Azospirillum modified soil urease activity, and that the competition with native microorganisms and soil NH4+-N may affect this bacterium capacity. (author)

  11. Phenotypic Changes Resulting from Distinct Point Mutations in the Azospirillum brasilense glnA Gene, Encoding Glutamine Synthetase

    OpenAIRE

    Van Dommelen, Anne; Keijers, Veerle; Wollebrants, An; Vanderleyden, Jozef

    2003-01-01

    Sequencing the glnA genes of two chemically induced Azospirillum brasilense glutamine synthetase mutants revealed an Arg→Cys mutation, corresponding to the glutamate binding site, in one mutant and an Asp→Asn mutation, corresponding to the ammonium binding site, in the second mutant. The phenotypic changes in these mutants are discussed in relation to their genotypes.

  12. Metabolic Adaptations of Azospirillum brasilense to Oxygen Stress by Cell-to-Cell Clumping and Flocculation

    Science.gov (United States)

    Bible, Amber N.; Khalsa-Moyers, Gurusahai K.; Mukherjee, Tanmoy; Green, Calvin S.; Mishra, Priyanka; Purcell, Alicia; Aksenova, Anastasia; Hurst, Gregory B.

    2015-01-01

    The ability of bacteria to monitor their metabolism and adjust their behavior accordingly is critical to maintain competitiveness in the environment. The motile microaerophilic bacterium Azospirillum brasilense navigates oxygen gradients by aerotaxis in order to locate low oxygen concentrations that can support metabolism. When cells are exposed to elevated levels of oxygen in their surroundings, motile A. brasilense cells implement an alternative response to aerotaxis and form transient clumps by cell-to-cell interactions. Clumping was suggested to represent a behavior protecting motile cells from transiently elevated levels of aeration. Using the proteomics of wild-type and mutant strains affected in the extent of their clumping abilities, we show that cell-to-cell clumping represents a metabolic scavenging strategy that likely prepares the cells for further metabolic stresses. Analysis of mutants affected in carbon or nitrogen metabolism confirmed this assumption. The metabolic changes experienced as clumping progresses prime cells for flocculation, a morphological and metabolic shift of cells triggered under elevated-aeration conditions and nitrogen limitation. The analysis of various mutants during clumping and flocculation characterized an ordered set of changes in cell envelope properties accompanying the metabolic changes. These data also identify clumping and early flocculation to be behaviors compatible with the expression of nitrogen fixation genes, despite the elevated-aeration conditions. Cell-to-cell clumping may thus license diazotrophy to microaerophilic A. brasilense cells under elevated oxygen conditions and prime them for long-term survival via flocculation if metabolic stress persists. PMID:26407887

  13. [Localization of denitrification genes in plasmid DNA of bacteria Azospirillum brasilense].

    Science.gov (United States)

    Petrova, L P; Varshalomidze, O É; Shelud'ko, A V; Katsy, E I

    2010-07-01

    In 85-Mda plasmid (p85) of plant-associated bacteria Azospirillum brasilense Sp245 model strain, the genes encoding copper-containing nitrite reductase (nirK); heterodimeric NO-reductase (norCB); NorQ and NorD proteins affecting synthesis and (or) activation of NirK and (or) NO-reductase (norQD); catalytic subunit I ofcytochrom c oxidase (CccoN); presumable NO sensor carrying two hemeerythrine domains (orf181); and an enzyme required for synthesis of presumable NO antagonist, homocystein (metC) were identified. In the same region of p85, orf293 encoding transcriptional regulator of LysR type, orf208 whose protein product carries a formylmethanofuran dehydrogenase subunit E domain, and an orf164-encoding conservative secretory protein with unknown function were also found. Localization of a set of denitrification genes in the plasmid DNA A. brasilense Sp245 adjacent to IS elements ISAzba1 and ISAzba2 indicates potential mobility of these genes and high probability of their horizontal transfer among populations of rhizospheric bacteria. A site homologous to p85 nirK-orf208-orf181 genes was detected in the 115 kb plasmid of A. brasilense Sp7 type strain. PMID:20795494

  14. Sequencing and complementation analysis of the nifUSV genes from Azospirillum brasilense.

    Science.gov (United States)

    Frazzon, J; Schrank, I S

    1998-02-15

    The functionality of nitrogenase in diazotrophic bacteria is dependent upon nif genes other than the structural nifH, D, and K genes which encode the enzyme subunit proteins. Such genes are involved in the activation of nif gene expression, maturation of subunit proteins, cofactor biosynthesis, and electron transport. In this work, approximately 5500 base pairs located within the major nif gene cluster of Azospirillum brasilense Sp7 have been sequenced. The deduced open reading frames were compared to the nif gene products of Azotobacter vinelandii and other diazotrophs. This analysis indicates the presence of five ORFs encoding ORF2, nifU, nifS, nifV, and ORF4 in the same sequential organization as found in other organisms. Consensus sigma 54 and NifA binding sites are present in the putative promoter region upstream of ORF2 in the A. brasilense sequence. The nifV gene of A. brasilense but not nifU or nifS complemented corresponding mutants strains of A. vinelandii. PMID:9503607

  15. Growth and yield of corn hybrids in response to association with Azospirillum brasilense and nitrogen fertilization

    Directory of Open Access Journals (Sweden)

    Deniele Marini

    2015-02-01

    Full Text Available There is a growing interest in optimizing the positive effects of the association between Azospirillum bacteria and corn crop in order to reduce the use of nitrogen fertilizers. This study aimed to evaluate the inoculation efficiency of an A. brasilense-based commercial product in association with different rates of nitrogen fertilization in two corn genotypes. The experiment was arranged in a 2 x 2 x 5 factorial randomized block design, with four replications. The treatments consisted of two corn hybrids (30F53 and CD386; with and without inoculation with a commercial product based on A. brasilense and five nitrogen rates (0, 40, 80, 120 and 160 kg ha-1. The variables plant height, basal stem diameter, leaf area, shoot dry matter, leaf nitrogen content, length and diameter of the cob, weight of 100 grains and grain yield were evaluated. Inoculation with A. brasilense provided increases of 11 and 12% in leaf area and shoot dry matter, respectively. There were differences in the response of the corn hybrids for most variables and the increase in nitrogen supply provided increments in the growth and yield of corn.

  16. Metabolic adaptations of Azospirillum brasilense to oxygen stress by cell-to-cell clumping and flocculation.

    Science.gov (United States)

    Bible, Amber N; Khalsa-Moyers, Gurusahai K; Mukherjee, Tanmoy; Green, Calvin S; Mishra, Priyanka; Purcell, Alicia; Aksenova, Anastasia; Hurst, Gregory B; Alexandre, Gladys

    2015-12-01

    The ability of bacteria to monitor their metabolism and adjust their behavior accordingly is critical to maintain competitiveness in the environment. The motile microaerophilic bacterium Azospirillum brasilense navigates oxygen gradients by aerotaxis in order to locate low oxygen concentrations that can support metabolism. When cells are exposed to elevated levels of oxygen in their surroundings, motile A. brasilense cells implement an alternative response to aerotaxis and form transient clumps by cell-to-cell interactions. Clumping was suggested to represent a behavior protecting motile cells from transiently elevated levels of aeration. Using the proteomics of wild-type and mutant strains affected in the extent of their clumping abilities, we show that cell-to-cell clumping represents a metabolic scavenging strategy that likely prepares the cells for further metabolic stresses. Analysis of mutants affected in carbon or nitrogen metabolism confirmed this assumption. The metabolic changes experienced as clumping progresses prime cells for flocculation, a morphological and metabolic shift of cells triggered under elevated-aeration conditions and nitrogen limitation. The analysis of various mutants during clumping and flocculation characterized an ordered set of changes in cell envelope properties accompanying the metabolic changes. These data also identify clumping and early flocculation to be behaviors compatible with the expression of nitrogen fixation genes, despite the elevated-aeration conditions. Cell-to-cell clumping may thus license diazotrophy to microaerophilic A. brasilense cells under elevated oxygen conditions and prime them for long-term survival via flocculation if metabolic stress persists. PMID:26407887

  17. Cellular responses during morphological transformation in Azospirillum brasilense and Its flcA knockout mutant.

    Directory of Open Access Journals (Sweden)

    Xingsheng Hou

    Full Text Available FlcA is a response regulator controlling flocculation and the morphological transformation of Azospirillum cells from vegetative to cyst-like forms. To understand the cellular responses of Azospirillum to conditions that cause morphological transformation, proteins differentially expressed under flocculation conditions in A. brasilense Sp7 and its flcA knockout mutant were investigated. Comparison of 2-DE protein profiles of wild-type (Sp7 and a flcA deletion mutant (Sp7-flcAΔ revealed a total of 33 differentially expressed 2-DE gel spots, with 22 of these spots confidently separated to allow protein identification. Analysis of these spots by liquid chromatography-tandem mass spectrometry (LC-MS/MS and MASCOT database searching identified 48 proteins (≥10% emPAI in each spot. The functional characteristics of these proteins included carbon metabolism (beta-ketothiolase and citrate synthase, nitrogen metabolism (Glutamine synthetase and nitric oxide synthase, stress tolerance (superoxide dismutase, Alkyl hydroperoxidase and ATP-dependent Clp protease proteolytic subunit and morphological transformation (transducer coupling protein. The observed differences between Sp7 wild-type and flcA- strains enhance our understanding of the morphological transformation process and help to explain previous phenotypical observations. This work is a step forward in connecting the Azospirillum phenome and genome.

  18. Mutational analysis of GlnB residues critical for NifA activation in Azospirillum brasilense.

    Science.gov (United States)

    Inaba, Juliana; Thornton, Jeremy; Huergo, Luciano Fernandes; Monteiro, Rose Adele; Klassen, Giseli; Pedrosa, Fábio de Oliveira; Merrick, Mike; de Souza, Emanuel Maltempi

    2015-02-01

    PII proteins are signal transduction that sense cellular nitrogen status and relay this signals to other targets. Azospirillum brasilense is a nitrogen fixing bacterium, which associates with grasses and cereals promoting beneficial effects on plant growth and crop yields. A. brasilense contains two PII encoding genes, named glnB and glnZ. In this paper, glnB was mutagenised in order to identify amino acid residues involved in GlnB signaling. Two variants were obtained by random mutagenesis, GlnBL13P and GlnBV100A and a site directed mutant, GlnBY51F, was obtained. Their ability to complement nitrogenase activity of glnB mutant strains of A. brasilense were determined. The variant proteins were also overexpressed in Escherichia coli, purified and characterized biochemically. None of the GlnB variant forms was able to restore nitrogenase activity in glnB mutant strains of A. brasilense LFH3 and 7628. The purified GlnBY51F and GlnBL13P proteins could not be uridylylated by GlnD, whereas GlnBV100A was uridylylated but at only 20% of the rate for wild type GlnB. Biochemical and computational analyses suggest that residue Leu13, located in the α helix 1 of GlnB, is important to maintain GlnB trimeric structure and function. The substitution V100A led to a lower affinity for ATP binding. Together the results suggest that NifA activation requires uridylylated GlnB bound to ATP. PMID:25644954

  19. Co{sup 2 + } interaction with Azospirillum brasilense Sp7 cells: a {sup 57}Co emission Moessbauer spectroscopic study

    Energy Technology Data Exchange (ETDEWEB)

    Kamnev, Alexander A.; Tugarova, Anna V. [Russian Academy of Sciences, Institute of Biochemistry and Physiology of Plants and Microorganisms (Russian Federation); Biro, Borbala [Hungarian Academy of Sciences, Research Institute for Soil Science and Agricultural Chemistry (Hungary); Kovacs, Krisztina, E-mail: kkriszti@chem.elte.hu; Homonnay, Zoltan; Kuzmann, Erno; Vertes, Attila [Eoetvoes Lorand University, Institute of Chemistry (Hungary)

    2012-03-15

    Preliminary {sup 57}Co emission Moessbauer spectroscopic data were obtained for the soil bacterium Azospirillum brasilense Sp7 (T = 80 K) in frozen {sup 57}Co{sup 2 + }-containing suspensions and in their dried residues. The Moessbauer parameters were compared with those for A. brasilense strain Sp245 differing from strain Sp7 by ecological behaviour. Live cells of both strains showed metabolic transformations of {sup 57}Co{sup 2 + } within an hour. Differences in the parameters observed for the two strains under similar conditions suggest dissimilarities in their metabolic response to Co{sup 2 + }.

  20. Structural studies of the polysaccharides from the lipopolysaccharides of Azospirillum brasilense Sp246 and SpBr14.

    Science.gov (United States)

    Sigida, Elena N; Fedonenko, Yuliya P; Shashkov, Alexander S; Grinev, Vyacheslav S; Zdorovenko, Evelina L; Konnova, Svetlana A; Ignatov, Vladimir V; Knirel, Yuriy A

    2014-10-29

    Lipopolysaccharides from closely related Azospirillum brasilense strains, Sp246 and SpBr14, were obtained by phenol-water extraction. Mild acid hydrolysis of the lipopolysaccharides followed by GPC on Sephadex G-50 resulted in polysaccharide mixtures. On the basis of sugar and methylation analyses, Smith degradation and (1)H and (13)C NMR spectroscopy data, it was concluded that both bacteria possess the same two distinct polysaccharides having structures 1 and 2: [structure: see text]. Structure 1 has been reported earlier for a polysaccharide of A. brasilense 54 [Fedonenko et al., 2011] whereas to our knowledge structure 2 has not been hitherto found in bacterial polysaccharides. PMID:25240180

  1. Co2 + interaction with Azospirillum brasilense Sp7 cells: a 57Co emission Mössbauer spectroscopic study

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Biró, Borbála; Kovács, Krisztina; Homonnay, Zoltán; Kuzmann, Ernő; Vértes, Attila

    2012-03-01

    Preliminary 57Co emission Mössbauer spectroscopic data were obtained for the soil bacterium Azospirillum brasilense Sp7 ( T = 80 K) in frozen 57Co2 + -containing suspensions and in their dried residues. The Mössbauer parameters were compared with those for A. brasilense strain Sp245 differing from strain Sp7 by ecological behaviour. Live cells of both strains showed metabolic transformations of 57Co2 + within an hour. Differences in the parameters observed for the two strains under similar conditions suggest dissimilarities in their metabolic response to Co2 + .

  2. Genome Sequence of Azospirillum brasilense CBG497 and Comparative Analyses of Azospirillum Core and Accessory Genomes provide Insight into Niche Adaptation

    Directory of Open Access Journals (Sweden)

    Victor González

    2012-09-01

    Full Text Available Bacteria of the genus Azospirillum colonize roots of important cereals and grasses, and promote plant growth by several mechanisms, notably phytohormone synthesis. The genomes of several Azospirillum strains belonging to different species, isolated from various host plants and locations, were recently sequenced and published. In this study, an additional genome of an A. brasilense strain, isolated from maize grown on an alkaline soil in the northeast of Mexico, strain CBG497, was obtained. Comparative genomic analyses were performed on this new genome and three other genomes (A. brasilense Sp245, A. lipoferum 4B and Azospirillum sp. B510. The Azospirillum core genome was established and consists of 2,328 proteins, representing between 30% to 38% of the total encoded proteins within a genome. It is mainly chromosomally-encoded and contains 74% of genes of ancestral origin shared with some aquatic relatives. The non-ancestral part of the core genome is enriched in genes involved in signal transduction, in transport and in metabolism of carbohydrates and amino-acids, and in surface properties features linked to adaptation in fluctuating environments, such as soil and rhizosphere. Many genes involved in colonization of plant roots, plant-growth promotion (such as those involved in phytohormone biosynthesis, and properties involved in rhizosphere adaptation (such as catabolism of phenolic compounds, uptake of iron are restricted to a particular strain and/or species, strongly suggesting niche-specific adaptation.

  3. Electro-optical study of the exposure of Azospirillum brasilense carbohydrate epitopes.

    Science.gov (United States)

    Guliy, Olga I; Matora, Larisa Yu; Dykman, Lev A; Staroverov, Sergey A; Burygin, Gennady L; Bunin, Viktor D; Burov, Andrei M; Ignatov, Oleg V

    2015-01-01

    The exposure of Azospirillum brasilense carbohydrate epitopes was investigated by electro-optical analysis of bacterial cell suspensions. To study changes in the electro-optical (EO) properties of the suspensions, we used antibodies generated to the complete lipopolysaccharide of A. brasilense type strain Sp7 and also antibodies to the smooth and rough O polysaccharides of Sp7. After 18 hr of culture growth, the EO signal of the suspension treated with antibodies to smooth O polysaccharide was approximately 20% lower than that of the suspension treated with antibodies to complete lipopolysaccharide (control). After 72 hr of culture growth, the strongest EO signal was observed for the cells treated with antibodies to rough O polysaccharide (approximately 46% greater than the control), whereas for the cells treated with antibodies to smooth O polysaccharide, it was much lower (approximately 23% of the control). These data were confirmed by electron microscopy. The results of the study may have importance for the rapid evaluation of changes in lipopolysaccharide form in microbial biotechnology, when the antigenic composition of the bacterial surface requires close control. PMID:25273383

  4. Physiological and biochemical characterization of Azospirillum brasilense strains commonly used as plant growth-promoting rhizobacteria.

    Science.gov (United States)

    Di Salvo, Luciana P; Silva, Esdras; Teixeira, Kátia R S; Cote, Rosalba Esquivel; Pereyra, M Alejandra; García de Salamone, Inés E

    2014-12-01

    Azospirillum is a plant growth-promoting rhizobacteria (PGPR) genus vastly studied and utilized as agriculture inoculants. Isolation of new strains under different environmental conditions allows the access to the genetic diversity and improves the success of inoculation procedures. Historically, the isolation of this genus has been performed by the use of some traditional culture media. In this work we characterized the physiology and biochemistry of five different A. brasilense strains, commonly used as cereal inoculants. The aim of this work is to contribute to pose into revision some concepts concerning the most used protocols to isolate and characterize this bacterium. We characterized their growth in different traditional and non-traditional culture media, evaluated some PGPR mechanisms and characterized their profiles of fatty acid methyl esters and carbon-source utilization. This work shows, for the first time, differences in both profiles, and ACC deaminase activity of A. brasilense strains. Also, we show unexpected results obtained in some of the evaluated culture media. Results obtained here and an exhaustive knowledge revision revealed that it is not appropriate to conclude about bacterial species without analyzing several strains. Also, it is necessary to continue developing studies and laboratory techniques to improve the isolation and characterization protocols. PMID:25138314

  5. Nitric oxide metabolism and indole acetic acid biosynthesis cross-talk in Azospirillum brasilense SM.

    Science.gov (United States)

    Koul, Vatsala; Tripathi, Chandrakant; Adholeya, Alok; Kochar, Mandira

    2015-04-01

    Production of nitric oxide (NO) and the presence of NO metabolism genes, nitrous oxide reductase (nosZ), nitrous oxide reductase regulator (nosR) and nitric oxide reductase (norB) were identified in the plant-associated bacterium (PAB) Azospirillum brasilense SM. NO presence was confirmed in all overexpressing strains, while improvement in the plant growth response of these strains was mediated by increased NO and indole-3-acetic acid (IAA) levels in the strains. Electron microscopy showed random distribution to biofilm, with surface colonization of pleiomorphic Azospirilla. Quantitative IAA estimation highlighted a crucial role of nosR and norBC in regulating IAA biosynthesis. The NO quencher and donor reduced/blocked IAA biosynthesis by all strains, indicating their common regulatory role in IAA biosynthesis. Tryptophan (Trp) and l-Arginine (Arg) showed higher expression of NO genes tested, while in the case of ipdC, only Trp and IAA increased expression, while Arg had no significant effect. The highest nosR expression in SMnosR in the presence of IAA and Trp, along with its 2-fold IAA level, confirmed the relationship of nosR overexpression with Trp in increasing IAA. These results indicate a strong correlation between IAA and NO in A. brasilense SM and suggest the existence of cross-talk or shared signaling mechanisms in these two growth regulators. PMID:25700632

  6. Expression of the structural gene, laf1, encoding the flagellin of the lateral flagella in Azospirillum brasilense Sp7.

    OpenAIRE

    Moens, S.; M. Schloter; Vanderleyden, J.

    1996-01-01

    The induction of the lateral flagella of Azospirillum brasilense Sp7 was studied by using a translational fusion between the laf1 promoter and gusA. The fusion was induced when cells were grown on solid media but not when they were grown in broth. The fusion was also induced by incubation of liquid-grown cells with an anti-polar flagellum polyclonal antiserum. Hindrance of polar-flagellum rotation is suggested to be the signal for this induction.

  7. [INFLUENCE OF AZOSPIRILLUM BRASILENSE 10/1 ON ASSOCIATIVE NITROGEN FIXATION AND INTRAVARIETAL POLYMORPHISM OF SPRING TRITICALE].

    Science.gov (United States)

    Patika, V P; Nadkernichna, O V; Shahovnina, O O

    2015-01-01

    It is shown, that the perspective Ukrainian sorts of spring triticale characterizes by considerable polymorphism by associative N2-fixing ability in root zone of plants. Application of active strain Azospirillum brasilense 10/1 promotes the decline of variability of this sign within the limits of sort, increase potential nitrogen activity is on the average in 3,2-4,7 times and also distributing normalizations in the selections of the inoculated plants. PMID:26638482

  8. Comparison of two Cellulomonas strains and their interaction with Azospirillum brasilense in degradation of wheat straw and associated nitrogen fixation

    Energy Technology Data Exchange (ETDEWEB)

    Halsall, D.M.; Gibson, A.H.

    1986-04-01

    A mutant strain of Cellulomonas sp. CS1-17 was compared with Cellulomonas gelida 2480 as the cellulolytic component of a mixed culture which was responsible for the breakdown of wheat straw to support asymbiotic nitrogen fixation by Azospirillum brasilense Sp7 (ATCC 29145). Cellulomonas sp. strain CS1-17 was more efficient than was C. gelida in cellulose breakdown at lower oxygen concentrations and, in mixed culture with A. brasilense, it supported higher nitrogenase activity(C/sub 2/H/sub 2/ reduction) and nitrogen fixation with straw as the carbon source. Based on gravimetric determinations of straw breakdown and total N determinations, the efficiency of nitrogen fixation was 72 and 63 mg of N per g of straw utilized for the mixtures containing Cellulomonas sp. and C. gelida, respectively. Both Cellulomonas spp. and Azospirillum spp. exhibited a wide range of pH tolerance. When introduced into sterilized soil, the Cellulomonas sp.-Azospirillum brasilense association was more effective in nitrogen fixation at a pH of 7.0 than at the native soil pH (5.6). This was also true of the indigenous diazotrophic microflora of this soil. The potential implications of this work to the field situation are discussed. 16 references.

  9. Tryptophan, thiamine and indole-3-acetic acid exchange between Chlorella sorokiniana and the plant growth-promoting bacterium Azospirillum brasilense.

    Science.gov (United States)

    Palacios, Oskar A; Gomez-Anduro, Gracia; Bashan, Yoav; de-Bashan, Luz E

    2016-06-01

    During synthetic mutualistic interactions between the microalga Chlorella sorokiniana and the plant growth-promoting bacterium (PGPB) Azospirillum brasilense, mutual exchange of resources involved in producing and releasing the phytohormone indole-3-acetic acid (IAA) by the bacterium, using tryptophan and thiamine released by the microalga, were measured. Although increased activities of tryptophan synthase in C. sorokiniana and indole pyruvate decarboxylase (IPDC) in A. brasilense were observed, we could not detect tryptophan or IAA in the culture medium when both organisms were co-immobilized. This indicates that no extra tryptophan or IAA is produced, apart from the quantities required to sustain the interaction. Over-expression of the ipdC gene occurs at different incubation times: after 48 h, when A. brasilense was immobilized alone and grown in exudates of C. sorokiniana and at 96 h, when A. brasilense was co-immobilized with the microalga. When A. brasilense was cultured in exudates of C. sorokiniana, increased expression of the ipdC gene, corresponding increase in activity of IPDC encoded by the ipdC gene, and increase in IAA production were measured during the first 48 h of incubation. IAA production and release by A. brasilense was found only when tryptophan and thiamine were present in a synthetic growth medium (SGM). The absence of thiamine in SGM yielded no detectable IAA. In summary, this study demonstrates that C. sorokiniana can exude sufficient tryptophan and thiamine to allow IAA production by a PGPB during their interaction. Thiamine is essential for IAA production by A. brasilense and these three metabolites are part of a communication between the two microorganisms. PMID:27090758

  10. Characterization of two trpE genes encoding anthranilate synthase α-subunit in Azospirillum brasilense

    International Nuclear Information System (INIS)

    The previous report from our laboratory has recently identified a new trpE gene (termed trpE 2) which exists independently in Azospirillum brasilense Yu62. In this study, amplification of trpE(G) (termed trpE 1(G) here) confirmed that there are two copies of trpE gene, one trpE being fused into trpG while the other trpE existed independently. This is First report to suggest that two copies of the trpE gene exist in this bacterium. Comparison of the nucleotide sequence demonstrated that putative leader peptide, terminator, and anti-terminator were found upstream of trpE 1(G) while these sequence features did not exist in front of trpE 2. The β-galactosidase activity of an A. brasilense strain carrying a trpE 2-lacZ fusion remained constant at different tryptophan concentrations, but the β-galactosidase activity of the same strain carrying a trpE 1(G)-lacZ fusion decreased as the tryptophan concentration increased. These data suggest that the expression of trpE 1(G) is regulated at the transcriptional level by attenuation while trpE 2 is constantly expressed. The anthranilate synthase assays with trpE 1(G)- and trpE 2- mutants demonstrated that TrpE1(G) fusion protein is feedback inhibited by tryptophan while TrpE2 protein is not. We also found that both trpE 1(G) and trpE 2 gene products were involved in IAA synthesis

  11. Hydrogenase activity in Azospirillum brasilense is inhibited by nitrite, nitric oxide, carbon monoxide, and acetylene

    Energy Technology Data Exchange (ETDEWEB)

    Tibelius, K.H.; Knowles, R.

    1984-10-01

    Nitrite, NO, CO, and C/sub 2/H/sub 2/ inhibited O/sub 2/-dependent H/sub 2/ uptake (H/sup 3/H oxidation) in denitrifying Azospirillum brasilense Sp7 grown anaerobically on N/sub 2/O or NO/sub 3//sup -/. The apparent K/sub i/ values for inhibition of O/sub 2/-dependent H/sub 2/ uptake were 20 ..mu..M for NO/sub 2//sup -/, 0.4 ..mu..M for NO, 28 ..mu..M for CO, and 88 ..mu..M for C/sub 2/H/sub 2/. These inhibitors also affected methylene blue-dependent H/sub 2/ uptake, presumably by acting directly on the hydrogenase. Nitrite and NO inhibited H/sub 2/ uptake irreversibly, whereas inhibition due to CO was easily reversed by repeatedly evacuating and backfilling with N/sub 2/. The C/sub 2/H/sub 2/ inhibition was not readily reversed, partly due to difficulty in removing the last traces of this gas from solution. The NO/sub 2//sup -/ inhibition of malate-dependent respiration was readily reversed by repeatedly washing the cells, in contrast to the effect of NO/sub 2//sup -/ on H/sub 2/-dependent respiration. These results suggest that the low hydrogenase activities observed in NO/sub 3//sup -/-grown cultures of A. brasilense may be due to the irreversible inhibition of hydrogenase by NO/sub 2//sup -/ and NO produced by NO/sub 3//sup -/ reduction.

  12. Mutants with enhanced nitrogenase activity in hydroponic Azospirillum brasilense-wheat associations.

    Science.gov (United States)

    Pereg Gerk, L; Gilchrist, K; Kennedy, I R

    2000-05-01

    The effect of a mutation affecting flocculation, differentiation into cyst-like forms, and root colonization on nitrogenase expression by Azospirillum brasilense is described. The gene flcA of strain Sp7 restored these phenotypes in spontaneous mutants of both strains Sp7 and Sp245. Employing both constitutive pLA-lacZ and nifH-lacZ reporter fusions expressed in situ, the colony morphology, colonization pattern, and potential for nitrogenase activity of spontaneous mutants and flcA Tn5-induced mutants were established. The results of this study show that the ability of Sp7 and Sp245 mutant strains to remain in a vegetative form improved their ability to express nitrogenase activity in association with wheat in a hydroponic system. Restoring the cyst formation and colonization pattern to the spontaneous mutant Sp7-S reduced nitrogenase activity rates in association with plants to that of the wild-type Sp7. Although Tn5-induced flcA mutants showed higher potentials for nitrogenase expression than Sp7, their potentials were lower than that of Sp7-S, indicating that other factors in this strain contribute to its exceptional nitrogenase activity rates on plants. The lack of lateral flagella is not one of these factors, as Sp7-PM23, a spontaneous mutant impaired in swarming and lateral-flagellum production but not in flocculation, showed wild-type nitrogenase activity and expression. The results also suggest factors of importance in evolving an effective symbiosis between Azospirillum and wheat, such as increasing the availability of microaerobic niches along the root, increased supply of carbon sources by the plant, and the retention of the bacterial cells in vegetative form for faster metabolism. PMID:10788397

  13. [A STUDY OF THE ISOLATED BACTERIOPHAGE ΦAB-SP7 ADSORPTION ON THE CELL SURFACE OF THE AZOSPIRILLUM BRASILENSE SP7].

    Science.gov (United States)

    Guliy, O I; Karavaeva, O A; Velikov, V A; Sokolov, O I; Pavily, S A; Larionova, O S; Burov, A M; Ignatov, O V

    2016-01-01

    The bacteriophage ΦAb-Sp7 was isolated from the cells of the Azospirillum brasilense Sp7. The morphology, size of the gram-negative colonies, and range of lytic activity against other strains and species of the genus Azospirillum was tested. The isolated phage DNA was examined using electrophoretic and restriction analysis, and the size of the genome were established. The electron microscopy. resuIts show that the phage (capsid) has a strand-like form. The electron microscopy study of the bacteriophage ΦAb-Sp7 adsorption on the A. brasilense Sp7 bacterial surface was performed. PMID:27145602

  14. Crecimiento de Azospirillum brasilense en presencia de disacáridos: sacarosa y lactosa

    Directory of Open Access Journals (Sweden)

    Yudyt Díaz-Saez

    2013-01-01

    Full Text Available La obtención de biopolímeros a partir de fermentaciones bacterianas requiere de la selección adecuada de las condiciones del proceso. Se evaluó el crecimiento de la cepa Azospirillum brasilense 8-INICA en medio líquido suplementado con disacáridos. Las mediciones se realizaron a las 23 h de incubación con la determinación de la densidad óptica, la concentración de azúcares reductores y concentración de carbohidratos totales, así como la determinación del pH del sobrenadante. Se confirmó el máximo desarrollo de la biomasa para 33 oC y 7,2 g.L-1 de sal con sacarosa, y 40 oC y 3,5 g.L-1 de sal con lactosa. Se estableció que las condiciones más favorables para la producción de exopolisacáridos se encuentran a temperaturas y concentraciones elevadas de sal para un medio con lactosa; y bajas temperaturas a concentraciones elevadas de sal en presencia de sacarosa. Se constató la marcada influencia de la temperatura en el crecimiento, y la acción positiva de la concentración salina en los mecanismos de supervivencia del micro- organismo.

  15. Toxicidade de herbicidas utilizados na cultura da cana-de-açúcar à bactéria diazotrófica Azospirillum brasilense Toxicity of herbicides applied on sugarcane to the diazotrophic bacterium Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    S.O Procópio

    2011-01-01

    Full Text Available Objetivou-se neste trabalho identificar herbicidas utilizados na cultura da cana-de-açúcar que não alteram o crescimento ou a capacidade de fixação biológica de nitrogênio (FBN da bactéria diazotrófica Azospirillum brasi lense. Dezoito herbicidas - paraquat, ametryn, amicarbazone, diuron, metribuzin, [hexazinone + diuron], [hexazinone + clomazone], clomazone, isoxaflutole, sulfentrazone, oxyfluorfen, imazapic, imazapyr, [trifloxysulfuron-sodium + ametryn], S-metolachlor, glyphosate, MSMA e 2,4-D - foram testados em suas doses comerciais quanto ao impacto sobre o crescimento da bactéria em meio líquido DIGs. As variáveis capacidade de suporte de crescimento (carrying capacity do meio de cultura, duração da fase lag e tempo de geração de A. brasilense foram calculadas a partir de dados de densidade ótica obtidos, em intervalos regulares, durante a incubação de culturas por 55 h. O impacto dos herbicidas na atividade da nitrogenase de A. brasilense foi avaliado em meio semissólido NFb, sem N, pela técnica da atividade de redução do acetileno (ARA. Os efeitos dos herbicidas sobre as variáveis de crescimento e ARA foram comparados ao controle pelo teste de Dunnett. Paraquat, oxyfluorfen, [trifloxysulfuron-sodium + ametryn] e glyphosate reduziram a capacidade do meio DIGs em suportar o crescimento de A. brasilense. Esse efeito foi associado ao aumento da duração da fase lag e do tempo de geração para [trifloxysulfuron-sodium + ametryn] e ao aumento no tempo de geração para glyphosate. MSMA, paraquat e amicarbazone reduzem a FBN in vitro de A. brasilense, porém essa redução é mais severa na presença do paraquat. Os demais herbicidas não alteram o crescimento e a FBN de A. brasilense.The objective of this work was to identify the herbicides applied on sugarcane that do not affect the growth nor the process of biological nitrogen fixation (BNF of the diazotrophic bacterium Azospirillum brasilense. Commercial doses of

  16. The ipdC, hisC1 and hisC2 genes involved in indole-3-acetic production used as alternative phylogenetic markers in Azospirillum brasilense.

    Science.gov (United States)

    Jijón-Moreno, Saúl; Marcos-Jiménez, Cynthia; Pedraza, Raúl O; Ramírez-Mata, Alberto; de Salamone, I García; Fernández-Scavino, Ana; Vásquez-Hernández, Claudia A; Soto-Urzúa, Lucia; Baca, Beatriz E

    2015-06-01

    Plant growth-promoting bacteria of the genus Azospirillum are present in the rhizosphere and as endophytes of many crops. In this research we studied 40 Azospirillum strains isolated from different plants and geographic regions. They were first characterized by 16S rDNA restriction analysis, and their phylogenetic position was established by sequencing the genes 16S rDNA, ipdC, hisC1, and hisC2. The latter three genes are involved in the indole-3-pyruvic acid (IPyA) biosynthesis pathway of indole-3-acetic acid (IAA). Furthermore, the suitability of the 16S-23S rDNA intergenic spacer sequence (IGS) for the differentiation of closely related Azospirillum taxa and development of PCR protocols allows for specific detection of strains. The IGS-RFLP analysis enabled intraspecies differentiation, particularly of Azospirillum brasilense and Azospirillum lipoferum strains. Results demonstrated that the ipdC, hisC1, and hisC2 genes are highly conserved in all the assessed A. brasilense isolates, suggesting that these genes can be used as an alternative phylogenetic marker. In addition, IAA production determined by HPLC ranged from 0.17 to 98.2 μg mg(-1) protein. Southern hybridization with the A. brasilense ipdC gene probe did not show, a hybridization signal with A. lipoferum, Azospirillum amazonense, Azospirillum halopreferans and Azospirillum irakense genomic DNA. This suggests that these species produce IAA by other pathways. Because IAA is mainly synthesized via the IPyA pathway in A. brasilense strains, a species that is used worldwide in agriculture, the identification of ipdC, hisC1, and hisC2 genes by PCR may be suitable for selecting exploitable strains. PMID:25842039

  17. Enhanced activity of ADP glucose pyrophosphorylase and formation of starch induced by Azospirillum brasilense in Chlorella vulgaris.

    Science.gov (United States)

    Choix, Francisco J; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E

    2014-05-10

    ADP-glucose pyrophosphorylase (AGPase) regulates starch biosynthesis in higher plants and microalgae. This study measured the effect of the bacterium Azospirillum brasilense on AGPase activity in the freshwater microalga Chlorella vulgaris and formation of starch. This was done by immobilizing both microorganisms in alginate beads, either replete with or deprived of nitrogen or phosphorus and all under heterotrophic conditions, using d-glucose or Na-acetate as the carbon source. AGPase activity during the first 72h of incubation was higher in C. vulgaris when immobilized with A. brasilense. This happened simultaneously with higher starch accumulation and higher carbon uptake by the microalgae. Either carbon source had similar effects on enzyme activity and starch accumulation. Starvation either by N or P had the same pattern on AGPase activity and starch accumulation. Under replete conditions, the population of C. vulgaris immobilized alone was higher than when immobilized together, but under starvation conditions A. brasilense induced a larger population of C. vulgaris. In summary, adding A. brasilense enhanced AGPase activity, starch formation, and mitigation of stress in C. vulgaris. PMID:24576433

  18. Chemical synthesis of the tetrasaccharide repeating unit of the O-polysaccharide isolated from Azospirillum brasilense SR80.

    Science.gov (United States)

    Sarkar, Vikramjit; Mukhopadhyay, Balaram

    2015-04-10

    A linear strategy has been developed for the synthesis of the tetrasaccharide repeating unit of the O-polysaccharide from Azospirillum brasilense SR80. Stepwise glycosylation of the rationally protected thioglycoside donors activated by NIS in the presence of La(OTf)3 furnished the target tetrasaccharide. The glycosylation reactions resulted in the formation of the desired linkage with absolute stereoselectivity and afforded the required derivatives in good to excellent yields. The phthalimido group has been used as the precursor of the desired acetamido group to meet the requirement of 1,2-trans glycosidic linkage. PMID:25681691

  19. Gold(III) reduction by the rhizobacterium Azospirillum brasilense with the formation of gold nanoparticles.

    Science.gov (United States)

    Tugarova, Anna V; Burov, Andrei M; Burashnikova, Marina M; Kamnev, Alexander A

    2014-01-01

    For the soil nitrogen-fixing bacterium Azospirillum brasilense, the ability to reduce [AuCl4](-) and to form gold nanoparticles (GNPs) has been demonstrated, with the appearance of a mauve tint of the culture. To validate the shapes and chemical nature of nanoparticles, transmission electron microscopy (TEM) and X-ray fluorescence analysis were used. For the widely studied agriculturally important wild-type strains A. brasilense Sp7 and Sp245, GNPs formed after 10 days of incubation of cell biomass with 0.25 mM [AuCl4](-) were shown (using TEM) to be mainly of spherical form (5 to 20 nm in diameter), with rare occasional triangles. In the course of cultivation with [AuCl4](-), after 5 days, a mauve tint was already visible for cells of strain Sp245.5, after 6 days for Sp245 and after 10 days for Sp7. Thus, for the mutant strain Sp245.5 (which has significant differences in the structure and composition of cell-surface polysaccharides as compared with Sp245), a more rapid formation of GNPs was observed. Moreover, their TEM images (also obtained after 10 days) showed different shapes: nano-sized spheres, triangles, hexagons and rods, as well as larger round-shaped flower-like nanoparticles about 100 nm in size. Since by the time of GNP formation in our experiments the cells were found to be already not viable, this confirms the dominating role of cell surface structure and chemical composition in shaping the GNPs formed in the course of [AuCl4](-) reduction to Au(0). This finding may be useful for understanding the natural biogeochemical mechanisms of gold reduction and formation of GNPs involving microorganisms. The data obtained may also help in developing protocols for environmentally friendly synthesis of nanoparticles and possible use of bacterial cells with modified surface structure and composition for their fabrication. PMID:24276540

  20. INOCULAÇÃO DE Azospirillum brasilense NA QUALIDADE FISIOLÓGICA DE SEMENTES DE MILHO DOCE

    Directory of Open Access Journals (Sweden)

    SOUZA, Epitácio José de

    2014-06-01

    Full Text Available The aimed of this study was to survey the physiological quality of sweet corn seeds submitted to inoculation of Azospirillum brasilense in different periods and dilutions in water. The experiment was conducted on the entirely randomized design with four replications in a factorial (4 x 4 more a witness without inoculation of A. brasilense. Were evaluated four periods between the inoculation and installation of the tests (0, 24, 48 and 72 hours and four dilutions of the inoculant in water (1:0, 1:1, 1:2 and 1:3. Were utilized seeds of sweet corn evaluated Tropical Plus hybrids and commercial strains of A. brasilense Ab-Ab-V5 and V6, in the dose of the commercial product 4 mL kg-1 seed. The parameters evaluated were germination, first count of germination, percentage of abnormal seeds, emergency, emergency speed index, length of epicotyl and of root, mass of the dry matter of shoots and of root. The dilution of A. brasilense in water did not affect no one parameter evaluated on the seeds of sweet corn, and the increase in the time between inoculation and the installation of the tests provide reduction on the first count of germination, speed emergency index and mass of dry matter of roots. It is concluded that, under laboratory conditions, inoculation of A. brasilense not benefits to germination and seed vigor of sweet corn. Objetivou-se avaliar a qualidade fisiológica de sementes de milho doce submetidas à inoculação de Azospirillum brasilense em diferentes períodos e diluições em água. O experimento foi conduzido no delineamento inteiramente casualizado, com quatro repetições em esquema fatorial (4 x 4, mais uma testemunha que não recebeu inoculação de A. brasilense. Foram avaliados quatro períodos entre a inoculação e a instalação dos testes (0, 24, 48 e 72 horas e quatro diluições do inoculante em água (1:0, 1:1, 1:2 e 1:3. Foram utilizadas sementes de milho doce híbrido comercial Tropical Plus e as estirpes de A

  1. Convergent synthesis of a tetrasaccharide repeating unit of the O-specific polysaccharide from the cell wall lipopolysaccharide of Azospirillum brasilense strain Sp7

    OpenAIRE

    Mandal, Pintu Kumar; Dhara, Debashis; Misra, Anup Kumar

    2014-01-01

    A straightforward convergent synthesis has been carried out for the tetrasaccharide repeating unit of the O-specific cell wall lipopolysaccharide of the strain Sp7 of Azospirillum brasilense. The target tetrasaccharide has been synthesized from suitably protected monosaccharide intermediates in 42% overall yield in seven steps by using a [2 + 2] block glycosylation approach.

  2. Convergent synthesis of a tetrasaccharide repeating unit of the O-specific polysaccharide from the cell wall lipopolysaccharide of Azospirillum brasilense strain Sp7

    Directory of Open Access Journals (Sweden)

    Pintu Kumar Mandal

    2014-01-01

    Full Text Available A straightforward convergent synthesis has been carried out for the tetrasaccharide repeating unit of the O-specific cell wall lipopolysaccharide of the strain Sp7 of Azospirillum brasilense. The target tetrasaccharide has been synthesized from suitably protected monosaccharide intermediates in 42% overall yield in seven steps by using a [2 + 2] block glycosylation approach.

  3. Residual effect of nitrogen fertilization and Azospirillum brasilense inoculation in the maize cultureEfeito residual da adubação nitrogenada e inoculação de Azospirillum brasilense na cultura do milho

    Directory of Open Access Journals (Sweden)

    Jackson Huzar Novakowiski

    2011-12-01

    Full Text Available The diazotrophic bacteria Azospirillum brasilense is an organism able to fix nitrogen of atmosphere and produce plant hormones. Nevertheless, there is lack of information with regard to use in field conditions, especially in production systems that have presence of animals in a determined year period. The objective of paper was to evaluate the association of the nitrogen residual effect of fertilization in pasture winter and the inoculation with A. brasilense in the maize culture. Were carried two experiments in Guarapuava (PR in season 2008/09 with randomized block design with split plots in three replication. The main parcel consisted of application 5 levels of N (0, 75, 150, 225 e 300 kg ha-1 in pasture of black oat and ryegrass occupied by bovines and 4 treatments in the maize (T1 = control; T2 = inoculation of A. brasilense; T3 = 75 kg ha-1 of N; T4 = 150 kg ha-1 of N. Were evaluated: plants population, ears per plant, productivity, mass thousand grains, damage grains, row per ear and grains per row. There was residual effect of nitrogen applied in the pasture on maize culture. The mass thousand grains and the number of rows per ear of maize presented quadratic response for increase of nitrogen level in the pasture. The inoculation of A. brasilense provided higher productivity than control same with increase the nitrogen level applied in the pasture, with quadratic response in the experiment 1 and linear in the experiment 2.A bactéria diazotrófica Azospirillum brasilense é um organismo capaz de fixar nitrogênio da atmosfera e produzir hormônios vegetais. No entanto, há carência de informações a respeito de seu uso em condições de campo, sobretudo em sistemas de produção que tem a presença de animais em um determinado período do ano. O objetivo do trabalho foi avaliar a associação do efeito residual da adubação nitrogenada na pastagem de inverno e a inoculação de A. brasilense na cultura do milho. Foram conduzidos dois

  4. Maize growth promotion by inoculation with Azospirillum brasilense and metabolites of Rhizobium tropici enriched on lipo-chitooligosaccharides (LCOs).

    Science.gov (United States)

    Marks, Bettina Berquó; Megías, Manuel; Ollero, Francisco Javier; Nogueira, Marco Antonio; Araujo, Ricardo Silva; Hungria, Mariangela

    2015-12-01

    There is an increasing interest in the development and use of inoculants carrying plant growth-promoting bacteria (PGPB) in crops of agronomic interest. The great majority of the inoculants commercialized worldwide contain rhizobia for legume crops, but the use of PGPB as Azospirillum spp. for non-legume is expanding, as well as of inoculants combining microorganisms and microbial metabolites. In this study we evaluated the effects of inoculants containing Azospirillum brasilense with or without metabolites of Rhizobium tropici strain CIAT 899 highly enriched in lipo-chitooligosaccharides (LCOs) in six field experiments performed for three summer crop seasons in Brazil with maize (Zea mays L.). Inoculants and metabolites were applied either at sowing by seed inoculation, or by leaf spray at the V3 stage of plant growth. Improvement in shoot dry weight (SDW) and total N accumulated in shoots (TNS) by single, but especially by dual inoculation was observed in some of the experiments. Statistically significant increases in grain yield in relation to the non-inoculated control were observed in five out of six experiments when maize was inoculated with Azospirillum supplied with enriched metabolites of R. tropici applied by seed or leaf spray inoculation. The results give strength to the development of a new generation of inoculants carrying microorganisms and microbial molecules. PMID:26567001

  5. Involvement of indole-3-acetic acid produced by Azospirillum brasilense in accumulating intracellular ammonium in Chlorella vulgaris.

    Science.gov (United States)

    Meza, Beatriz; de-Bashan, Luz E; Bashan, Yoav

    2015-01-01

    Accumulation of intracellular ammonium and activities of the enzymes glutamine synthetase (GS) and glutamate dehydrogenase (GDH) were measured when the microalgae Chlorella vulgaris was immobilized in alginate with either of two wild type strains of Azospirillum brasilense or their corresponding indole-3-acetic acid (IAA)-attenuated mutants. After 48 h of immobilization, both wild types induced higher levels of intracellular ammonium in the microalgae than their respective mutants; the more IAA produced, the higher the intracellular ammonium accumulated. Accumulation of intracellular ammonium in the cells of C. vulgaris followed application of four levels of exogenous IAA reported for A. brasilense and its IAA-attenuated mutants, which had a similar pattern for the first 24 h. This effect was transient and disappeared after 48 h of incubation. Immobilization of C. vulgaris with any bacteria strain induced higher GS activity. The bacterial strains also had GS activity, comparable to the activity detected in C. vulgaris, but weaker than when immobilized with the bacteria. When net activity was calculated, the wild type always induced higher GS activity than IAA-attenuated mutants. GDH activity in most microalgae/bacteria interactions resembled GS activity. When complementing IAA-attenuated mutants with exogenous IAA, GS activity in co-immobilized cultures matched those of the wild type A. brasilense immobilized with the microalga. Similarity occurred when the net GS activity was measured, and was higher with greater quantities of exogenous IAA. It is proposed that IAA produced by A. brasilense is involved in ammonium uptake and later assimilation by C. vulgaris. PMID:25554489

  6. Co2 +  interaction with Azospirillum brasilense Sp7 cells: a 57Co emission Mössbauer spectroscopic study

    International Nuclear Information System (INIS)

    Preliminary 57Co emission Mössbauer spectroscopic data were obtained for the soil bacterium Azospirillum brasilense Sp7 (T = 80 K) in frozen 57Co2 + -containing suspensions and in their dried residues. The Mössbauer parameters were compared with those for A. brasilense strain Sp245 differing from strain Sp7 by ecological behaviour. Live cells of both strains showed metabolic transformations of 57Co2 +  within an hour. Differences in the parameters observed for the two strains under similar conditions suggest dissimilarities in their metabolic response to Co2 + .

  7. Effect of Azospirillum brasilense and Burkholderia unamae Bacteria on Maize Photosynthetic Activity Evaluated Using the Photoacoustic Technique

    Science.gov (United States)

    Gordillo-Delgado, F.; Marín, E.; Calderón, A.

    2016-09-01

    In this work, the photosynthetic process of maize plants ( Zea mays), which were grown using seeds inoculated with plant growth promoting bacteria Azospirillum brasilense and Burkholderia unamae, was monitored. Photothermal and photobaric signals obtained by a time-resolved photoacoustic measurement configuration were used for measuring the oxygen evolution rate in situ. A frequency-resolved configuration of the method was utilized to determine the oxygen diffusion coefficient and the thermal diffusivity of the maize leaves. The latter parameters, which can be used as indicators of the photosynthetic activity of maize, are found to vary according to the plant-microbe interaction. Treatment with plant growth promoting bacteria induced a decrease in the oxygen diffusion coefficient of about 20 %.

  8. Mössbauer spectroscopic study of 57Fe metabolic transformations in the rhizobacterium Azospirillum brasilense Sp245

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Kovács, Krisztina; Biró, Borbála; Homonnay, Zoltán; Kuzmann, Ernő

    2014-04-01

    Preliminary 57Fe transmission Mössbauer spectroscopic data were obtained for the first time for live cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp245) grown aerobically with 57FeIII-nitrilotriacetate (NTA) complex as a sole source of iron. The results obtained have shown that live cells actively reduce part of the assimilated iron(III) to iron(II), the latter amounting up to 33 % of total cellular iron after 18 h of growth, and 48 % after additional 3 days of storage of the dense wet cell suspension in nutrient-free saline solution in air at room temperature (measured at 80 K). The cellular iron(II) was found to be represented by two quadrupole doublets of different high-spin forms, while the parameters of the cellular iron(III) were close to those typical for bacterioferritins.

  9. Spectroscopic characterization of cell membranes and their constituents of the plant-associated soil bacterium Azospirillum brasilense

    Science.gov (United States)

    Kamnev, A. A.; Antonyuk, L. P.; Matora, L. Yu.; Serebrennikova, O. B.; Sumaroka, M. V.; Colina, M.; Renou-Gonnord, M.-F.; Ignatov, V. V.

    1999-05-01

    Structural and compositional features of bacterial membranes and some of their isolated constituents (cell surface lipopolysaccharide, phospholipids) of the plant-growth-promoting diazotrophic rhizobacterium Azospirillum brasilense (wild-type strain Sp245) were characterized using Fourier transform infrared (FTIR) spectroscopy and some other techniques. FTIR spectra of the cell membranes were shown to comprise the main vibration modes of the relevant lipopolysaccharide and protein components which are believed to be involved in associative plant-bacterium interactions, as well as of phospholipid constituents. The role and functions of metal cations in the structural organization and physicochemical properties of bacterial cell membranes are also discussed considering their accumulation in the membranes from the culture medium.

  10. Fourier transform Raman spectroscopic characterisation of cells of the plant-associated soil bacterium Azospirillum brasilense Sp7

    Science.gov (United States)

    Kamnev, A. A.; Tarantilis, P. A.; Antonyuk, L. P.; Bespalova, L. A.; Polissiou, M. G.; Colina, M.; Gardiner, P. H. E.; Ignatov, V. V.

    2001-05-01

    Structural and compositional features of bacterial cell samples and of lipopolysaccharide-protein complex isolated from the cell surface of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp7) were characterised using Fourier transform (FT) Raman spectroscopy. The structural spectroscopic information obtained is analysed and considered together with analytical data on the content of metal cations (Co 2+, Cu 2+ and Zn 2+) in the bacterial cells grown in a standard medium as well as in the presence of each of the cations (0.2 mM). The latter, being taken up by bacterial cells from the culture medium in significant amounts, were shown to induce certain metabolic changes in the bacterium revealed in FT-Raman spectra, which is discussed from the viewpoint of bacterial response to environmental stresses.

  11. Biofertilization with Azospirillum brasilense improves in vitro culture of Handroanthus ochraceus, a forestry, ornamental and medicinal plant.

    Science.gov (United States)

    Llorente, Berta E; Alasia, María A; Larraburu, Ezequiel E

    2016-01-25

    Biofertilization with plant growth-promoting rhizobacteria is a potential alternative to plant productivity. Here, in vitro propagation of Handroanthus ochraceus (yellow lapacho), a forest crop with high economic and environmental value, was developed using the Azospirillum brasilense strains Cd and Az39 during rhizogenesis. Epicotiles of in vitro plantlets were multiplied in Woody Plant Medium (WPM). For rooting, elongated shoots were transferred to auxin-free Murashige-Skoog medium with Gamborg's vitamins and WPM, both at half salt concentration (½MSG and ½WPM), and inoculated with Cd or Az39 at the base of each shoot. Anatomical studies were performed using leaves cleared and stained with safranin for optical microscopy and leaves and roots metalized with gold-palladium for scanning electron microscopy (SEM). In ½WPM auxin-free medium, A. brasilense Cd inoculation produced 55% of rooting, increased root fresh and dry weight (45% and 77%, respectively), and led to lower stomata size and density with similar proportion of open and closed stomata. Both strains selectively increased the size or density of glandular trichomes in ½MSG. Moreover, bacteria were detected on the root surface by SEM. In conclusion, the difference in H. ochraceus response to A. brasilense inoculation depends on the strain and the plant culture media. Cd strain enhanced rooting in auxin-free ½WPM and produced plantlets with features similar to those expected in ex vitro plants. This work presents an innovative in vitro approach using beneficial plant-microorganism interaction as an ecologically compatible strategy in plant biotechnology. PMID:26255131

  12. Respuesta de tres cultivares de maíz a la inoculación con Azospirillum brasilense bajo cuatro diferentes dosis de nitrógeno

    OpenAIRE

    Andrés González Huerta; Delfina de Jesús Pérez López; Omar Franco Mora; Artemio Balbuena Melgarejo; Francisco Gutiérrez Rodríguez; Heladio Romero Salas

    2011-01-01

    En el municipio de Huamuxtitlán, estado de Guerrero, México, se evaluó la respuesta de los materiales de maíz VS-535, H-507 y criollo veracruzano en las dosis de 0, 30, 60 y 90 kg de nitrógeno ha-1, con y sin Azospirillum brasilense. En el sintético VS- 535 se registró el mayor rendimiento de grano (5.23 t ha-1). En las dosis de 0, 30, 60 y 90 kg de N ha-1 se registraron 4.38, 4.36, 4.81 y 4.93 t ha-1, respectivamente. La diferencia entre aplicar o no Azospirillum brasilense (promedio sobre l...

  13. Accumulation fatty acids of in Chlorella vulgaris under heterotrophic conditions in relation to activity of acetyl-CoA carboxylase, temperature, and co-immobilization with Azospirillum brasilense

    Science.gov (United States)

    Leyva, Luis A.; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E.

    2014-10-01

    The relation between fatty acid accumulation, activity of acetyl-CoA carboxylase (ACC), and consequently lipid accumulation was studied in the microalgae Chlorella vulgaris co-immobilized with the plant growth-promoting bacterium Azospirillum brasilense under dark heterotrophic conditions with Na acetate as a carbon source. In C. vulgaris immobilized alone, cultivation experiments for 6 days showed that ACC activity is directly related to fatty acid accumulation, especially in the last 3 days. In co-immobilization experiments, A. brasilense exerted a significant positive effect over ACC activity, increased the quantity in all nine main fatty acids, increased total lipid accumulation in C. vulgaris, and mitigated negative effects of nonoptimal temperature for growth. No correlation between ACC activity and lipid accumulation in the cells was established for three different temperatures. This study demonstrated that the interaction between A. brasilense and C. vulgaris has a significant effect on fatty acid and lipid accumulation in the microalgae.

  14. Accumulation of fatty acids in Chlorella vulgaris under heterotrophic conditions in relation to activity of acetyl-CoAcarboxylase, temperature, and co-immobilization with Azospirillum brasilense [corrected].

    Science.gov (United States)

    Leyva, Luis A; Bashan, Yoav; Mendoza, Alberto; de-Bashan, Luz E

    2014-10-01

    The relation between fatty acid accumulation, activity of acetyl-CoA carboxylase (ACC), and consequently lipid accumulation was studied in the microalgae Chlorella vulgaris co-immobilized with the plant growth-promoting bacterium Azospirillum brasilense under dark heterotrophic conditions with Na acetate as a carbon source. In C. vulgaris immobilized alone, cultivation experiments for 6 days showed that ACC activity is directly related to fatty acid accumulation, especially in the last 3 days. In co-immobilization experiments, A. brasilense exerted a significant positive effect over ACC activity, increased the quantity in all nine main fatty acids, increased total lipid accumulation in C. vulgaris, and mitigated negative effects of nonoptimal temperature for growth. No correlation between ACC activity and lipid accumulation in the cells was established for three different temperatures. This study demonstrated that the interaction between A. brasilense and C. vulgaris has a significant effect on fatty acid and lipid accumulation in the microalgae. PMID:25129521

  15. Influence of soil saprophyte fungus Chaetomium cochliodes on associative system "Triticum aestivum – Azospirillum brasilense"

    OpenAIRE

    E. P. Kopylov; A. A. Zhidenko

    2009-01-01

    In laboratory and vegetative experiments the ability of soil ascomycete C. cochliodes 3250 to promote the penetration of Azospirillum nitrogen-fixing bacteria into roots’ inner tissues was shown. At the same time the endophytic association: spring wheat – Azospirillum nitrogen-fixing bacteria – soil saprophyte ascomycete C. cochliodes 3250 is forming. It allows activating the nitrogen fixation in the spring wheat roots zone and biosynthetic processes in plants, in particular: to raise glutami...

  16. [Genome Rearrangements in Azospirillum brasilense Sp7 with the Involvement of the Plasmid pRhico and the Prophage phiAb-Cd].

    Science.gov (United States)

    Katsy, E I; Petrova, L P

    2015-12-01

    Alphaproteobacteria of the species Azospirillum brasilense have a multicomponent genome that undergoes frequent spontaneous rearrangements, yielding changes in the plasmid profiles of strains. Specifically, variants (Cd, Sp7.K2, Sp7.1, Sp7.4, Sp7.8, etc.) of the type strainA. brasilense Sp7 that had lost a 115-MDa plasmid were previously selected. In many of them, the molecular weight of a 90-MDa plasmid (p90 or pRhico), which is a kind of "depot" for glycopolymer biosynthesis genes, increased. In this study, a collection of primers was designed to the plasmid pRhico and to the DNA of prophage phiAb-Cd integrated in it. The use ofthese primers in polymerase chain reactions allowed the detection of the probable excision of phiAb-Cd phage from the DNA of A. brasilense variants Sp7.4 and Sp7.8 and other alterations of the pRhico structure in A. brasilense strains Cd, Sp7.K2, and Sp7.8. The developed primers and PCR conditions may be recoin mended for primary analysis of spontaneous plasmid rearrangements in A. brasilense Sp7 and related strains. PMID:27055294

  17. Azospirillum IV

    Energy Technology Data Exchange (ETDEWEB)

    Klingmuller, W.

    1988-01-01

    This book's contents include: Advances in the genetics of Azospirillum brasilense Sp7: Use of Tn5 mutagenesis for gene mapping and identification; Characterization of DNA segments adjacent to the nifHDK genes of Azospirillum brasilense by Sp7 Tn5 site-directed mutagenesis; Selection at the chemostat of Azospirillum brasilense Cd N/sub 2/-fixing at high O/sub 2/ pressure. Root hair deformation induced on maize and medicago by an Azospirillum transconjugant containing a Rhizobium meliloti nodulation region. Azospirilla are bacteria that live in association with the roots of many grain crops. Since these bacteria bind molecular nitrogen from the air and excrete plant growth substances, interest has focussed on their potential to increase crop yields.

  18. Azospirillum IV

    International Nuclear Information System (INIS)

    This book's contents include: Advances in the genetics of Azospirillum brasilense Sp7: Use of Tn5 mutagenesis for gene mapping and identification; Characterization of DNA segments adjacent to the nifHDK genes of Azospirillum brasilense by Sp7 Tn5 site-directed mutagenesis; Selection at the chemostat of Azospirillum brasilense Cd N2-fixing at high O2 pressure. Root hair deformation induced on maize and medicago by an Azospirillum transconjugant containing a Rhizobium meliloti nodulation region. Azospirilla are bacteria that live in association with the roots of many grain crops. Since these bacteria bind molecular nitrogen from the air and excrete plant growth substances, interest has focussed on their potential to increase crop yields

  19. Vescicular-arbuscular mycorrhiza and Azospirillum brasilense rhizocoenosis in pearlmillet in a semi-arid soil

    International Nuclear Information System (INIS)

    A field experiment was conducted in an alluvial sandy loam soil using Pearlmillet as the test crop to study the effect of Vescicular-Arbuscular Mycorrhiza (VAM) and Azospirillum with phosphorus on yield and other parameters. Dual inoculation gave a significant increase in Azospirillum and VAM infection in root over the control plants, and resulted in significant increase in grain yield. Combined inoculation alongwith N and P application showed maximum P uptake. Nitrogen fixation increased with plant growth with dually inoculated N and P treatment, The effect was more pronounced in the presence of phosphrous indicating that P is required for nitrogen fixation. (author)

  20. Expression and characterization of an N-truncated form of the NifA protein of Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    C.Y. Nishikawa

    2012-02-01

    Full Text Available Azospirillum brasilense is a nitrogen-fixing bacterium associated with important agricultural crops such as rice, wheat and maize. The expression of genes responsible for nitrogen fixation (nif genes in this bacterium is dependent on the transcriptional activator NifA. This protein contains three structural domains: the N-terminal domain is responsible for the negative control by fixed nitrogen; the central domain interacts with the RNA polymerase σ54 co-factor and the C-terminal domain is involved in DNA binding. The central and C-terminal domains are linked by the interdomain linker (IDL. A conserved four-cysteine motif encompassing the end of the central domain and the IDL is probably involved in the oxygen-sensitivity of NifA. In the present study, we have expressed, purified and characterized an N-truncated form of A. brasilense NifA. The protein expression was carried out in Escherichia coli and the N-truncated NifA protein was purified by chromatography using an affinity metal-chelating resin followed by a heparin-bound resin. Protein homogeneity was determined by densitometric analysis. The N-truncated protein activated in vivo nifH::lacZ transcription regardless of fixed nitrogen concentration (absence or presence of 20 mM NH4Cl but only under low oxygen levels. On the other hand, the aerobically purified N-truncated NifA protein bound to the nifB promoter, as demonstrated by an electrophoretic mobility shift assay, implying that DNA-binding activity is not strictly controlled by oxygen levels. Our data show that, while the N-truncated NifA is inactive in vivo under aerobic conditions, it still retains DNA-binding activity, suggesting that the oxidized form of NifA bound to DNA is not competent to activate transcription.

  1. Expression and characterization of an N-truncated form of the NifA protein of Azospirillum brasilense

    Energy Technology Data Exchange (ETDEWEB)

    Nishikawa, C.Y.; Araújo, L.M.; Kadowaki, M.A.S.; Monteiro, R.A.; Steffens, M.B.R.; Pedrosa, F.O.; Souza, E.M.; Chubatsu, L.S. [Departamento de Bioquímica e Biologia Molecular, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2012-01-27

    Azospirillum brasilense is a nitrogen-fixing bacterium associated with important agricultural crops such as rice, wheat and maize. The expression of genes responsible for nitrogen fixation (nif genes) in this bacterium is dependent on the transcriptional activator NifA. This protein contains three structural domains: the N-terminal domain is responsible for the negative control by fixed nitrogen; the central domain interacts with the RNA polymerase σ{sup 54} factor and the C-terminal domain is involved in DNA binding. The central and C-terminal domains are linked by the interdomain linker (IDL). A conserved four-cysteine motif encompassing the end of the central domain and the IDL is probably involved in the oxygen-sensitivity of NifA. In the present study, we have expressed, purified and characterized an N-truncated form of A. brasilense NifA. The protein expression was carried out in Escherichia coli and the N-truncated NifA protein was purified by chromatography using an affinity metal-chelating resin followed by a heparin-bound resin. Protein homogeneity was determined by densitometric analysis. The N-truncated protein activated in vivo nifH::lacZ transcription regardless of fixed nitrogen concentration (absence or presence of 20 mM NH{sub 4}Cl) but only under low oxygen levels. On the other hand, the aerobically purified N-truncated NifA protein bound to the nifB promoter, as demonstrated by an electrophoretic mobility shift assay, implying that DNA-binding activity is not strictly controlled by oxygen levels. Our data show that, while the N-truncated NifA is inactive in vivo under aerobic conditions, it still retains DNA-binding activity, suggesting that the oxidized form of NifA bound to DNA is not competent to activate transcription.

  2. Expression and characterization of an N-truncated form of the NifA protein of Azospirillum brasilense

    International Nuclear Information System (INIS)

    Azospirillum brasilense is a nitrogen-fixing bacterium associated with important agricultural crops such as rice, wheat and maize. The expression of genes responsible for nitrogen fixation (nif genes) in this bacterium is dependent on the transcriptional activator NifA. This protein contains three structural domains: the N-terminal domain is responsible for the negative control by fixed nitrogen; the central domain interacts with the RNA polymerase σ54 factor and the C-terminal domain is involved in DNA binding. The central and C-terminal domains are linked by the interdomain linker (IDL). A conserved four-cysteine motif encompassing the end of the central domain and the IDL is probably involved in the oxygen-sensitivity of NifA. In the present study, we have expressed, purified and characterized an N-truncated form of A. brasilense NifA. The protein expression was carried out in Escherichia coli and the N-truncated NifA protein was purified by chromatography using an affinity metal-chelating resin followed by a heparin-bound resin. Protein homogeneity was determined by densitometric analysis. The N-truncated protein activated in vivo nifH::lacZ transcription regardless of fixed nitrogen concentration (absence or presence of 20 mM NH4Cl) but only under low oxygen levels. On the other hand, the aerobically purified N-truncated NifA protein bound to the nifB promoter, as demonstrated by an electrophoretic mobility shift assay, implying that DNA-binding activity is not strictly controlled by oxygen levels. Our data show that, while the N-truncated NifA is inactive in vivo under aerobic conditions, it still retains DNA-binding activity, suggesting that the oxidized form of NifA bound to DNA is not competent to activate transcription

  3. Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.

    Science.gov (United States)

    Truan, Daphné; Bjelić, Saša; Li, Xiao-Dan; Winkler, Fritz K

    2014-07-29

    The trimeric PII signal transduction proteins regulate the function of a variety of target proteins predominantly involved in nitrogen metabolism. ATP, ADP and 2-oxoglutarate (2-OG) are key effector molecules influencing PII binding to targets. Studies of PII proteins have established that the 20-residue T-loop plays a central role in effector sensing and target binding. However, the specific effects of effector binding on T-loop conformation have remained poorly documented. We present eight crystal structures of the Azospirillum brasilense PII protein GlnZ, six of which are cocrystallized and liganded with ADP or ATP. We find that interaction with the diphosphate moiety of bound ADP constrains the N-terminal part of the T-loop in a characteristic way that is maintained in ADP-promoted complexes with target proteins. In contrast, the interactions with the triphosphate moiety in ATP complexes are much more variable and no single predominant interaction mode is apparent except for the ternary MgATP/2-OG complex. These conclusions can be extended to most investigated PII proteins of the GlnB/GlnK subfamily. Unlike reported for other PII proteins, microcalorimetry reveals no cooperativity between the three binding sites of GlnZ trimers for any of the three effectors under carefully controlled experimental conditions. PMID:24846646

  4. Tripartite symbiosis of Lentil (Lense culinaris L.), Mycorrhiza and Azospirillum brasilense under Rainfed Condition

    OpenAIRE

    Ardakani, M. Reza; Maleki, Sadegh; Aghayari, Fayaz; Rejali, Farhad; Faregh, Amir. H.

    2014-01-01

    A field experiment was conducted aiming to determine the possibility of improving the lentil performance when co-inoculated with Vesicular Arbuscular Mycorrhiza (VAM) fungi and Azospirillum under natural rain-fed conditions, in Iran. Results showed the substantial impact of VAM fungi on grain protein, root colonization and shoot dry weight. Highest value for shoot dry weight recorded in plants which inoculated with G. intraradices and highest values for root colonization and grain protein con...

  5. Assessing the efficacy of co-inoculation of wheat seedlings with the associative bacteria Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245.

    Science.gov (United States)

    Yegorenkova, Irina V; Tregubova, Kristina V; Burygin, Gennady L; Matora, Larisa Y; Ignatov, Vladimir V

    2016-03-01

    Co-inoculation of associative bacteria, which have high nitrogen-fixing activity, tolerance for environmental conditions, and the ability to compete with the natural microflora, is used widely to enhance the growth and yields of agricultural plants. We evaluated the ability of 2 co-inoculated plant-growth-promoting rhizobacteria, Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245, to colonize roots of wheat (Triticum aestivum L. 'Saratovskaya 29') seedlings, and we assessed the morphometric parameters of wheat early in its development. Analysis by ELISA with polyclonal antibodies raised against the exopolysaccharide of P. polymyxa 1465 and the lipopolysaccharide of A. brasilense Sp245 demonstrated that the root-colonizing activity of A. brasilense was higher when the bacterium was co-inoculated with P. polymyxa than when it was inoculated singly. Immunofluorescence microscopy with Alexa Fluor 532-labeled antibodies revealed sites of attachment of co-inoculated P. polymyxa and A. brasilense and showed that the 2 bacteria colonized similar regions of the roots. Co-inoculation exerted a negative effect on wheat seedling development, inhibiting root length by 17.6%, total root weight by 11%, and total shoot weight by 12%. Under certain conditions, dual inoculation of wheat may prove ineffective, apparently owing to the competition between the rhizobacteria for colonization sites on the plant roots. The findings from this study may aid in developing techniques for mixed bacterial inoculation of cultivated plants. PMID:26863134

  6. Accumulation of intra-cellular polyphosphate in Chlorella vulgaris cells is related to indole-3-acetic acid produced by Azospirillum brasilense.

    Science.gov (United States)

    Meza, Beatriz; de-Bashan, Luz E; Hernandez, Juan-Pablo; Bashan, Yoav

    2015-06-01

    Accumulation of intra-cellular phosphate, as polyphosphate, was measured when the microalga Chlorella vulgaris was immobilized in alginate with either of two wild-type strains of the microalgae growth-promoting bacterium Azospirillum brasilense or their corresponding IAA-attenuated mutants. Wild type strains of A. brasilense induced higher amounts of intra-cellular phosphate in Chlorella than their respective mutants. Calculations comparing intra-cellular phosphate accumulation by culture or net accumulation by the cell and the amount of IAA that was produced by each of these strains revealed that higher IAA was linked to higher accumulations of intra-cellular phosphate. Application of four levels of exogenous IAA reported for A. brasilense and their IAA-attenuated mutants to cultures of C. vulgaris enhanced accumulation of intra-cellular phosphate; the higher the content of IAA per culture or per single cell, the higher was the amount of accumulated phosphate. When an IAA-attenuated mutant was complemented with exogenous IAA, accumulation of intra-cellular phosphate at the culture level was even higher than phosphate accumulation with the respective wild type strains. When calculating the net accumulation of intra-cellular phosphate in the complementation experiment, net intra-cellular phosphate induced by the IAA-attenuated mutant was completely restored and was similar to the wild strains. We propose that IAA produced by A. brasilense is linked to polyphosphate accumulation in C. vulgaris. PMID:25797155

  7. Study of the rhizobacterium Azospirillum brasilense Sp245 using Mössbauer spectroscopy with a high velocity resolution: Implication for the analysis of ferritin-like iron cores

    Science.gov (United States)

    Alenkina, I. V.; Oshtrakh, M. I.; Tugarova, A. V.; Biró, B.; Semionkin, V. A.; Kamnev, A. A.

    2014-09-01

    The results of a comparative study of two samples of the rhizobacterium Azospirillum brasilense (strain Sp245) prepared in different conditions and of human liver ferritin using Mössbauer spectroscopy with a high velocity resolution demonstrated the presence of ferritin-like iron (i.e. iron similar to that found in ferritin-like proteins) in the bacterium. Mössbauer spectra of these samples were fitted in two ways: as a rough approximation using a one quadrupole doublet fit (the homogeneous iron core model) and using a superposition of quadrupole doublets (the heterogeneous iron core model). Both results demonstrated differences in the Mössbauer parameters for mammalian ferritin and for bacterial ferritin-like iron. Moreover, some differences in the Mössbauer parameters were observed between the two samples of A. brasilense Sp245 related to the differences in their preparation conditions.

  8. Physiological, structural and molecular traits activated in strawberry plants after inoculation with the plant growth-promoting bacterium Azospirillum brasilense REC3.

    Science.gov (United States)

    Guerrero-Molina, M F; Lovaisa, N C; Salazar, S M; Martínez-Zamora, M G; Díaz-Ricci, J C; Pedraza, R O

    2015-05-01

    The plant growth-promoting strain REC3 of Azospirillum brasilense, isolated from strawberry roots, prompts growth promotion and systemic protection against anthracnose disease in this crop. Hence, we hypothesised that A. brasilense REC3 can induce different physiological, structural and molecular responses in strawberry plants. Therefore, the aim of this work was to study these traits activated in Azospirillum-colonised strawberry plants, which have not been assessed until now. Healthy, in vitro micropropagated plants were root-inoculated with REC3 under hydroponic conditions; root and leaf tissues were sampled at different times, and oxidative burst, phenolic compound content, malondialdehyde (MDA) concentration, callose deposition, cell wall fortification and gene expression were evaluated. Azospirillum inoculation enhanced levels of soluble phenolic compounds after 12 h post-inoculation (hpi), while amounts of cell wall bound phenolics were similar in inoculated and control plants. Other early responses activated by REC3 (at 24 hpi) were a decline of lipid peroxidation and up-regulation of strawberry genes involved in defence (FaPR1), bacterial recognition (FaFLS2) and H₂O₂ depuration (FaCAT and FaAPXc). The last may explain the apparent absence of oxidative burst in leaves after bacterial inoculation. Also, REC3 inoculation induced delayed structural responses such as callose deposition and cell wall fortification (at 72 hpi). Results showed that A. brasilense REC3 is capable of exerting beneficial effects on strawberry plants, reinforcing their physiological and cellular characteristics, which in turns contribute to improve plant performance. PMID:25280241

  9. Evidence for ferritin as dominant iron-bearing species in the rhizobacterium Azospirillum brasilense Sp7 provided by low-temperature/in-field Mössbauer spectroscopy.

    Science.gov (United States)

    Kovács, Krisztina; Kamnev, Alexander A; Pechoušek, Jiří; Tugarova, Anna V; Kuzmann, Ernő; Machala, Libor; Zbořil, Radek; Homonnay, Zoltán; Lázár, Károly

    2016-02-01

    For the ubiquitous diazotrophic rhizobacterium Azospirillum brasilense, which has been attracting the attention of researchers worldwide for the last 35 years owing to its significant agrobiotechnological and phytostimulating potential, the data on iron acquisition and its chemical speciation in cells are scarce. In this work, for the first time for azospirilla, low-temperature (at 80 K, 5 K, as well as at 2 K without and with an external magnetic field of 5 T) transmission Mössbauer spectroscopic studies were performed for lyophilised biomass of A. brasilense (wild-type strain Sp7 grown with (57)Fe(III) nitrilotriacetate complex as the sole source of iron) to enable quantitative chemical speciation analysis of the intracellular iron. In the Mössbauer spectrum at 80 K, a broadened quadrupole doublet of high-spin iron(III) was observed with a few percent of a high-spin iron(II) contribution. In the spectrum measured at 5 K, a dominant magnetically split component appeared with the parameters typical of ferritin species from other bacteria, together with a quadrupole doublet of a superparamagnetic iron(III) component and a similarly small contribution from the high-spin iron(II) component. The Mössbauer spectra recorded at 2 K (with or without a 5 T external field) confirmed the assignment of ferritin species. About 20 % of total Fe in the dry cells of A. brasilense strain Sp7 were present in iron(III) forms superparamagnetic at both 5 and 2 K, i.e. either different from ferritin cores or as ferritin components with very small particle sizes. Graphical abstract Low-temperature Mössbauer spectroscopic data for lyophilised biomass of the rhizobacterium Azospirillum brasilense Sp7 provide quantitative information on various cellular FeIII and FeII chemical species. PMID:26769130

  10. Convergent synthesis of a tetrasaccharide repeating unit of the O-specific polysaccharide from the cell wall lipopolysaccharide of Azospirillum brasilense strain Sp7

    OpenAIRE

    Pintu Kumar Mandal; Debashis Dhara; Anup Kumar Misra

    2014-01-01

    A straightforward convergent synthesis has been carried out for the tetrasaccharide repeating unit of the O-specific cell wall lipopolysaccharide of the strain Sp7 of Azospirillum brasilense. The target tetrasaccharide has been synthesized from suitably protected monosaccharide intermediates in 42% overall yield in seven steps by using a [2 + 2] block glycosylation approach.

  11. The cyclic-di-GMP diguanylate cyclase CdgA has a role in biofilm formation and exopolysaccharide production in Azospirillum brasilense.

    Science.gov (United States)

    Ramírez-Mata, Alberto; López-Lara, Lilia I; Xiqui-Vázquez, Ma Luisa; Jijón-Moreno, Saúl; Romero-Osorio, Angelica; Baca, Beatriz E

    2016-04-01

    In bacteria, proteins containing GGDEF domains are involved in production of the second messenger c-di-GMP. Here we report that the cdgA gene encoding diguanylate cyclase A (CdgA) is involved in biofilm formation and exopolysaccharide (EPS) production in Azospirillum brasilense Sp7. Biofilm quantification using crystal violet staining revealed that inactivation of cdgA decreased biofilm formation. In addition, confocal laser scanning microscopy analysis of green-fluorescent protein-labeled bacteria showed that, during static growth, the biofilms had differential levels of development: bacteria harboring a cdgA mutation exhibited biofilms with considerably reduced thickness compared with those of the wild-type Sp7 strain. Moreover, DNA-specific staining and treatment with DNase I, and epifluorescence studies demonstrated that extracellular DNA and EPS are components of the biofilm matrix in Azospirillum. After expression and purification of the CdgA protein, diguanylate cyclase activity was detected. The enzymatic activity of CdgA-producing cyclic c-di-GMP was determined using GTP as a substrate and flavin adenine dinucleotide (FAD(+)) and Mg(2)(+) as cofactors. Together, our results revealed that A. brasilense possesses a functional c-di-GMP biosynthesis pathway. PMID:26708984

  12. Characterization of Cell Surface and EPS Remodeling of Azospirillum brasilense Chemotaxis-like 1 Signal Transduction Pathway mutants by Atomic Force Microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Billings, Amanda N [ORNL; Siuti, Piro [ORNL; Bible, Amber [University of Tennessee, Knoxville (UTK); Alexandre, Gladys [University of Tennessee, Knoxville (UTK); Retterer, Scott T [ORNL; Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must quickly sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the modulation of multiple cellular responses, including motility, EPS production, and cell-to-cell interactions. Recently, the Che1 chemotaxis-like pathway from Azospirillum brasilense was shown to modulate flocculation. In A. brasilense, cell surface properties, including EPS production, are thought to play a direct role in promoting flocculation. Using atomic force microscopy (AFM), we have detected distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains that are absent in the wild type strain. Whereas the wild type strain produces a smooth mucosal extracellular matrix, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition and lectin-binding assays suggest that the composition of EPS components in the extracellular matrix differs between the cheA1 and cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that mutations in the Che1 pathway that result in increased flocculation are correlated with distinctive changes in the extracellular matrix structure produced by the mutants, including likely changes in the EPS structure and/or composition.

  13. Characterization of cell surface and extracellular matrix remodeling of Azospirillum brasilense chemotaxis-like 1 signal transduction pathway mutants by atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the regulation of multiple behaviors in response to changes in the environment, including motility patterns, exopolysaccharide production, and cell-to-cell interactions. In Azospirillum brasilense, cell surface properties, including exopolysaccharide production, are thought to play a direct role in promoting flocculation. Recently, the Che1 chemotaxis-like pathway from A. brasilense was shown to modulate flocculation, suggesting an associated modulation of cell surface properties. Using atomic force microscopy, distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains were detected. Whereas the wild-type strain produces a smooth mucosal extracellular matrix after 24 h, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition, lectin-binding assays, and comparison of lipopolysaccharides profiles suggest that the extracellular matrix differs between the cheA1 and the cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that disruption of the Che1 pathway is correlated with distinctive changes in the extracellular matrix, which likely result from changes in surface polysaccharides structure and/or composition.

  14. Effect of ATP and 2-oxoglutarate on the in vitro interaction between the NifA GAF domain and the GlnB protein of Azospirillum brasilense

    Energy Technology Data Exchange (ETDEWEB)

    Sotomaior, P.; Araújo, L.M.; Nishikawa, C.Y.; Huergo, L.F.; Monteiro, R.A.; Pedrosa, F.O.; Chubatsu, L.S.; Souza, E.M. [Departamento de Bioquímica e Biologia Molecular, Universidade Federal do Paraná, Curitiba, PR (Brazil)

    2012-09-21

    Azospirillum brasilense is a diazotroph that associates with important agricultural crops and thus has potential to be a nitrogen biofertilizer. The A. brasilense transcription regulator NifA, which seems to be constitutively expressed, activates the transcription of nitrogen fixation genes. It has been suggested that the nitrogen status-signaling protein GlnB regulates NifA activity by direct interaction with the NifA N-terminal GAF domain, preventing the inhibitory effect of this domain under conditions of nitrogen fixation. In the present study, we show that an N-terminal truncated form of NifA no longer required GlnB for activity and lost regulation by ammonium. On the other hand, in trans co-expression of the N-terminal GAF domain inhibited the N-truncated protein in response to fixed nitrogen levels. We also used pull-down assays to show in vitro interaction between the purified N-terminal GAF domain of NifA and the GlnB protein. The results showed that A. brasilense GlnB interacts directly with the NifA N-terminal domain and this interaction is dependent on the presence of ATP and 2-oxoglutarate.

  15. Effect of ATP and 2-oxoglutarate on the in vitro interaction between the NifA GAF domain and the GlnB protein of Azospirillum brasilense

    International Nuclear Information System (INIS)

    Azospirillum brasilense is a diazotroph that associates with important agricultural crops and thus has potential to be a nitrogen biofertilizer. The A. brasilense transcription regulator NifA, which seems to be constitutively expressed, activates the transcription of nitrogen fixation genes. It has been suggested that the nitrogen status-signaling protein GlnB regulates NifA activity by direct interaction with the NifA N-terminal GAF domain, preventing the inhibitory effect of this domain under conditions of nitrogen fixation. In the present study, we show that an N-terminal truncated form of NifA no longer required GlnB for activity and lost regulation by ammonium. On the other hand, in trans co-expression of the N-terminal GAF domain inhibited the N-truncated protein in response to fixed nitrogen levels. We also used pull-down assays to show in vitro interaction between the purified N-terminal GAF domain of NifA and the GlnB protein. The results showed that A. brasilense GlnB interacts directly with the NifA N-terminal domain and this interaction is dependent on the presence of ATP and 2-oxoglutarate

  16. PRODUTIVIDADE DO TRIGO IRRIGADO SUBMETIDO À APLICAÇÃO DE NITROGÊNIO E À INOCULAÇÃO COM AZOSPIRILLUM BRASILENSE

    Directory of Open Access Journals (Sweden)

    Pedro Henrique Marques Paula Nunes

    2015-02-01

    Full Text Available Inocular sementes de trigo com Azospirillum brasilense pode ser benéfico à cultura do trigo, bem como reduzir a necessidade de aplicação de N. No entanto, são escassos trabalhos que mensurem o benefício dessa prática no trigo irrigado com expectativa de alta produtividade e demanda de N. Objetivou-se com este trabalho avaliar a produtividade e o conteúdo de N na planta do trigo irrigado, submetido a doses de N, com ou sem a inoculação com A. brasilense. Foram conduzidos dois experimentos em 2011 e repetidos em 2012. Em cada ano de cultivo, instalou-se um experimento na área considerada de baixa disponibilidade de N no solo (cultivo em sucessão ao milho e outro na com alta disponibilidade (cultivo em sucessão à soja ou cenoura. Os tratamentos consistiram de cinco doses de N e da inoculação ou não com A. brasilense. As doses de N testadas foram 20, 60, 100, 140 e 180 kg ha-1 na área com baixa disponibilidade de N e 20, 50, 80, 110 e 140 kg ha-1 na com alta disponibilidade. O teor de N na folha índice foi aumentado pela inoculação com A. brasilense. Entretanto, o N absorvido não foi influenciado pela inoculação da bactéria. As doses de N aumentaram a produtividade do trigo e esse aumento foi mais evidente no cultivo na área com baixa disponibilidade de N no solo.

  17. ESTUDIO DEL EFECTO QUIMIOTÁCTICO DE LOS EXUDADOS RADICALES DEL ARROZ SOBRE Azospirillum brasilense Sp7 Y A. brasilense R5(15. PRODUCCIÓN DE AUXINAS POR AMBAS CEPAS

    Directory of Open Access Journals (Sweden)

    Mabel Pazos

    2003-01-01

    Full Text Available El género Azospirillum agrupa bacterias diazotróficas de vida libre, ampliamente encontradas en suelos tropicales y subtropicales, en asociación con raíces de cultivos de importancia económica como arroz, trigo y diversas especies vegetales. La gran mayoría de los estudios realizados con este género han demostrado su distribución prácticamente universal y sus numerosos efectos sobre el crecimiento de las plantas que coloniza. En este trabajo se demuestra el efecto quimiotáctico que ejercen los exudados radicales del arroz variedad J-104 sobre dos cepas de A. brasilense (R5(15 y Sp7, así como la capacidad de ambas de producir auxinas 16.60 mg.mL-1 y 11.82 mg.mL-1 respectivamente.

  18. Características agronômicas do trigo em função de Azospirillum brasilense, ácidos húmicos e nitrogênio em casa de vegetação

    OpenAIRE

    Luan F. O. S. Rodrigues; Vandeir F. Guimarães; Mônica B. da Silva; Artur S. Pinto Junior; Jeferson Klein; Andreia C. P. R. da Costa

    2014-01-01

    Objetivou-se, neste estudo, verificar o efeito do uso combinado de Azospirillum brasilense, ácidos húmicos e diferentes doses de nitrogênio nas características agronômicas do trigo. Os experimentos foram instalados no dia 21 de maio de 2011 e a colheita foi procedida no dia 13 de setembro de 2011. O delineamento experimental adotado foi o de blocos casualizados em esquema fatorial 4 x 4, com quatro repetições. O primeiro fator se refere à combinação da estirpe Ab-V5 de A. brasilense com os ác...

  19. Synthesis of the tetrasaccharide repeating unit of the O-glycan from the polar flagellum flagellin of Azospirillum brasilense Sp7.

    Science.gov (United States)

    Pal, Kumar Bhaskar; Mukhopadhyay, Balaram

    2014-12-01

    Chemical synthesis of the tetrasaccharide repeating unit of the O-glycan from the polar flagellum flagellin of Azospirillum brasilense Sp7 in the form of its p-methoxyphenyl glycoside is reported. The required glycosidic linkages have been accomplished by activation of thioglycosides with N-iodosuccinimide in the presence of H2SO4-silica. H2SO4-silica was found to be an effective alternative to the classical acid promoters like TfOH or TMSOTf and it can lead to the formation of both 1,2-cis and 1,2-trans glycosidic linkages depending on the protecting group manipulation and control of the reaction condition. PMID:25299938

  20. A SAM-dependent methyltransferase cotranscribed with arsenate reductase alters resistance to peptidyl transferase center-binding antibiotics in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Singh, Sudhir; Singh, Chhaya; Tripathi, Anil Kumar

    2014-05-01

    The genome of Azospirillum brasilense harbors a gene encoding S-adenosylmethionine-dependent methyltransferase, which is located downstream of an arsenate reductase gene. Both genes are cotranscribed and translationally coupled. When they were cloned and expressed individually in an arsenate-sensitive strain of Escherichia coli, arsenate reductase conferred tolerance to arsenate; however, methyltransferase failed to do so. Sequence analysis revealed that methyltransferase was more closely related to a PrmB-type N5-glutamine methyltransferase than to the arsenate detoxifying methyltransferase ArsM. Insertional inactivation of prmB gene in A. brasilense resulted in an increased sensitivity to chloramphenicol and resistance to tiamulin and clindamycin, which are known to bind at the peptidyl transferase center (PTC) in the ribosome. These observations suggested that the inability of prmB:km mutant to methylate L3 protein might alter hydrophobicity in the antibiotic-binding pocket of the PTC, which might affect the binding of chloramphenicol, clindamycin, and tiamulin differentially. This is the first report showing the role of PrmB-type N5-glutamine methyltransferases in conferring resistance to tiamulin and clindamycin in any bacterium. PMID:24573606

  1. Sequencing and promoter analysis of the nifENXorf3orf5fdxAnifQ operon from Azospirillum brasilense Sp7

    Directory of Open Access Journals (Sweden)

    Potrich D.P.

    2001-01-01

    Full Text Available A 40-kb DNA region containing the major cluster of nif genes has been isolated from the Azospirillum brasilense Sp7 genome. In this region three nif operons have been identified: nifHDKorf1Y, nifENXorf3orf5fdxAnifQ and orf2nifUSVorf4. The operons containing nifENX and nifUSV genes are separated from the structural nifHDKorf1Y operon by about 5 kb and 10 kb, respectively. The present study shows the sequence analysis of the 6045-bp DNA region containing the nifENX genes. The deduced amino acid sequences from the open reading frames were compared to the nif gene products of other diazotrophic bacteria and indicate the presence of seven ORFs, all reading in the same direction as that of the nifHDKorf1Y operon. Consensus sigma54 and NifA-binding sites are present only in the promoter region upstream of the nifE gene. This promoter is activated by NifA protein and is approximately two-times less active than the nifH promoter, as indicated by the ß-galactosidase assays. This result suggests the differential expression of the nif genes and their respective products in Azospirillum.

  2. Promoter-trap identification of wheat seed extract-induced genes in the plant-growth-promoting rhizobacterium Azospirillum brasilense Sp245.

    Science.gov (United States)

    Pothier, Joël F; Wisniewski-Dyé, Florence; Weiss-Gayet, Michèle; Moënne-Loccoz, Yvan; Prigent-Combaret, Claire

    2007-10-01

    Azospirillum strains have been used as plant-growth-promoting rhizobacteria (PGPR) of cereal crops, but their adaptation to the root remains poorly understood. Here, we used a global approach based on differential fluorescence induction (DFI) promoter trapping to identify genes of the wheat isolate Azospirillum brasilense Sp245 that are induced in the presence of spring wheat seed extracts. Fluorescence-based flow cytometry sorting of Sp245 cells was validated using PlacZ, PsbpA and PnifH promoters and egfp. A random promoter library was constructed by cloning 1-3 kb Sp245 fragments upstream of a promoterless version of egfp in the promoter-trap plasmid pOT1e (genome coverage estimated at threefold). Exposure to spring wheat seed extracts obtained using a methanol solution led to the detection of 300 induced DFI clones, and upregulation by seed extracts was confirmed in vitro for 46 clones. Sequencing of 21 clones enabled identification of seven promoter regions. Five of them displayed upregulation once inoculated onto spring wheat seedlings. Their downstream sequence was similar to (i) a predicted transcriptional regulator, (ii) a serine/threonine protein kinase, (iii) two conserved hypothetical proteins, or (iv) the copper-containing dissimilatory nitrite reductase NirK. Two of them were also upregulated when inoculated on winter wheat and pea but not on maize, whereas the three others (including PnirK) were upregulated on the three hosts. The amounts of nitrate and/or nitrite present in spring wheat seed extracts were sufficient for PnirK upregulation. Overall, DFI promoter trapping was useful to reveal Azospirillum genes involved in the interaction with the plant. PMID:17906157

  3. Gene encoding γ-carbonic anhydrase is cotranscribed with argC and induced in response to stationary phase and high CO2 in Azospirillum brasilense Sp7

    Directory of Open Access Journals (Sweden)

    Mishra Mukti N

    2010-07-01

    Full Text Available Abstract Background Carbonic anhydrase (CA is a ubiquitous enzyme catalyzing the reversible hydration of CO2 to bicarbonate, a reaction underlying diverse biochemical and physiological processes. Gamma class carbonic anhydrases (γ-CAs are widespread in prokaryotes but their physiological roles remain elusive. At present, only γ-CA of Methanosarcina thermophila (Cam has been shown to have CA activity. Genome analysis of a rhizobacterium Azospirillum brasilense, revealed occurrence of ORFs encoding one β-CA and two γ-CAs. Results One of the putative γ-CA encoding genes of A. brasilense was cloned and overexpressed in E. coli. Electrometric assays for CA activity of the whole cell extracts overexpressing recombinant GCA1 did not show CO2 hydration activity. Reverse transcription-PCR analysis indicated that gca1 in A. brasilense is co-transcribed with its upstream gene annotated as argC, which encodes a putative N-acetyl-γ-glutamate-phosphate reductase. 5'-RACE also demonstrated that there was no transcription start site between argC and gca1, and the transcription start site located upstream of argC transcribed both the genes (argC-gca1. Using transcriptional fusions of argC-gca1 upstream region with promoterless lacZ, we further demonstrated that gca1 upstream region did not have any promoter and its transcription occurred from a promoter located in the argC upstream region. The transcription of argC-gca1 operon was upregulated in stationary phase and at elevated CO2 atmosphere. Conclusions This study shows lack of CO2 hydration activity in a recombinant protein expressed from a gene predicted to encode a γ-carbonic anhydrase in A. brasilense although it cross reacts with anti-Cam antibody raised against a well characterized γ-CA. The organization and regulation of this gene along with the putative argC gene suggests its involvement in arginine biosynthetic pathway instead of the predicted CO2 hydration.

  4. Nitrogen uptake by Azospirillum brasilense inoculated barley (Hordeum vulgare L.) as influenced by N and P fertilization

    International Nuclear Information System (INIS)

    Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N0P1 (0 kg N and 30 kg P2O5 ha-1) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs

  5. Adubação nitrogenada associada à inoculação com Azospirillum brasilense e Herbaspirillum seropedicae na cultura do milho

    Directory of Open Access Journals (Sweden)

    Janaína Dartora

    2013-10-01

    Full Text Available Bactérias dos gêneros Azospirillum e Herbaspirillum são fixadoras de nitrogênio (N atmosférico e consideradas promotoras do crescimento vegetal. Desta forma, desenvolveu-se o presente trabalho com o objetivo de avaliar o desenvolvimento e a produtividade do milho em resposta à inoculação de A. brasilense e H. seropedicae associada à adubação nitrogenada. O experimento foi conduzido em delineamento experimental de blocos ao acaso em esquema fatorial 4 x 5, com quatro repetições. Os tratamentos foram constituídos da inoculação de sementes (testemunha, estirpe de A. brasilense - Ab-V5, estirpe de H. seropedicae - SmR1 e combinação Ab-V5 + SmR1 e doses de N (0, 40, 80, 120 e 160 kg ha-1 de N. Foram avaliados: diâmetro basal do colmo, altura de planta, matéria seca de parte aérea e área foliar, nas fases vegetativa e reprodutiva, e produtividade. A adubação nitrogenada favoreceu o desenvolvimento da cultura até a máxima dose estudada. A inoculação combinada das estirpes proporcionou incrementos de 12% na matéria seca de parte aérea e 7% na produtividade em relação à testemunha indicando benefícios da combinação de bactérias diazotróficas que interagem de forma diferenciada com a planta.

  6. Chemical composition and deoxynivalenol in wheat of Central- Southern Paraná: nitrogen fertilization in top dressing associated with Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    Thiago Montagner Souza

    2014-02-01

    Full Text Available The impact of agricultural management practices on the quality of grain was evaluated in wheat (Triticum aestivum L. BRS Tangará from the South Central region of Paraná State (Ponta Grossa in the crop years of 2010 and 2011. The field trial was carried out in succession with soybean (2010 and corn (2011. The treatments included inoculation of seeds with Azospirillum brasilense and increasing levels of nitrogen application in top dressing (0, 30, 60, 90 and 120 kg ha-1. The experimental design was in randomized block, factorial 2 x 5 (inoculation x N levels, with four replications. The parameters evaluated were water activity, moisture, protein, and grain contamination by deoxynivalenol (DON. The data were subjected to analysis of variance, comparison of means by Tukey’s test (p<0.05 and regression for nitrogen levels. The inoculation of seeds with A. brasilense increased the protein content in grain in 2010 (+1.6%; 16.9 g 100g-1 and 2011 (+1.7%, 15.7 g 100g-1, independently of the nitrogen level (p<0.01. Levels of nitrogen in 2010 presented a positive linear response with protein content, increasing by 14.2% using non-inoculated seeds (p<0.01, R2=0.955 and 14.4% for those inoculated with A. brasilense (p<0.01, R2=0.906. However, in 2011 a quadratic response was observed between nitrogen levels and protein content (p<0.01, R2=0.99, with stabilization or reduction in protein content using high levels of nitrogen (?120 kg ha-1. The contamination by DON was greater using high levels of nitrogen (3574 ?g kg-1, 120 kg ha-1; non-inoculated seeds in 2011, with a quadratic response between nitrogen levels and contamination of grains (p<0.05, R2=0.772. Furthermore, 37.5% of the samples presented contamination by DON higher than the maximum tolerated limit established by Brazilian legislation (2000 ?g kg-1; whole-wheat grain. The data demonstrates that proper management of nitrogen enhances intrinsic effects arising from plant breeding.

  7. Toxicidade de herbicidas utilizados na cultura da cana-de-açúcar à bactéria diazotrófica Azospirillum brasilense Toxicity of herbicides applied on sugarcane to the diazotrophic bacterium Azospirillum brasilense

    OpenAIRE

    S.O. Procópio; M.F. Fernandes; D.A Teles; J.G Sena Filho; A. Cargnelutti Filho; L. Vargas; S.A.C Sant'Anna

    2011-01-01

    Objetivou-se neste trabalho identificar herbicidas utilizados na cultura da cana-de-açúcar que não alteram o crescimento ou a capacidade de fixação biológica de nitrogênio (FBN) da bactéria diazotrófica Azospirillum brasi lense. Dezoito herbicidas - paraquat, ametryn, amicarbazone, diuron, metribuzin, [hexazinone + diuron], [hexazinone + clomazone], clomazone, isoxaflutole, sulfentrazone, oxyfluorfen, imazapic, imazapyr, [trifloxysulfuron-sodium + ametryn], S-metolachlor, glyphosate, MSMA e 2...

  8. Elemental composition of strawberry plants inoculated with the plant growth-promoting bacterium Azospirillum brasilense REC3, assessed with scanning electron microscopy and energy dispersive X-ray analysis.

    Science.gov (United States)

    Guerrero-Molina, M F; Lovaisa, N C; Salazar, S M; Díaz-Ricci, J C; Pedraza, R O

    2014-07-01

    The elemental composition of strawberry plants (Fragaria ananassa cv. Macarena) inoculated with the plant growth-promoting bacterium Azospirillum brasilense REC3, and non-inoculated controls, was studied using scanning electron microscopy (SEM) and energy dispersive X-ray (EDS) analysis. This allowed simultaneous semi-quantification of different elements in a small, solid sample. Plants were inoculated and grown hydroponically in 50% or 100% Hoagland solution, corresponding to limited or optimum nutrient medium, respectively. Bacteria-inoculated plants increased the growth index 45% and 80% compared to controls when grown in 100% and 50% Hoagland solution, respectively. Thus, inoculation with A. brasilense REC3 in a nutrient-limited medium had the strongest effect in terms of increasing both shoot and root biomass and growth index, as already described for Azospirillum inoculated into nutrient-poor soils. SEM-EDS spectra and maps showed the elemental composition and relative distribution of nutrients in strawberry tissues. Leaves contained C, O, N, Na, P, K, Ca and Cu, while roots also had Si and Cl. The organic fraction (C, O and N) accounted for over 96.3% of the total chemical composition; of the mineral fraction, Na had higher accumulation in both leaves and roots. Azospirillum-inoculated and control plants had similar elemental quantities; however, in bacteria-inoculated roots, P was significantly increased (34.33%), which constitutes a major benefit for plant nutrition, while Cu content decreased (35.16%). PMID:24148195

  9. Fourier transform infrared spectroscopic characterisation of heavy metal-induced metabolic changes in the plant-associated soil bacterium Azospirillum brasilense Sp7

    Science.gov (United States)

    Kamnev, A. A.; Antonyuk, L. P.; Tugarova, A. V.; Tarantilis, P. A.; Polissiou, M. G.; Gardiner, P. H. E.

    2002-06-01

    Structural and compositional features of whole cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense Sp7 under standard and heavy metal-stressed conditions are analysed using Fourier transform infrared (FTIR) spectroscopy and compared with the FT-Raman spectroscopic data obtained previously [J. Mol. Struct. 563-564 (2001) 199]. The structural spectroscopic information is considered together with inductively coupled plasma-mass spectrometric (ICP-MS) analytical data on the content of the heavy metal cations (Co 2+, Cu 2+ and Zn 2+) in the bacterial cells. As a bacterial response to heavy metal stress, all the three metals, being taken up by bacterial cells from the culture medium (0.2 mM) in significant amounts (ca. 0.12, 0.48 and 4.2 mg per gram of dry biomass for Co, Cu and Zn, respectively), are shown to induce essential metabolic changes in the bacterium revealed in the spectra, including the accumulation of polyester compounds in bacterial cells and their enhanced hydration affecting certain IR vibrational modes of functional groups involved.

  10. Positive effect of reduced aeration rate on growth and stereospecificity of DL-malic acid consumption by Azospirillum brasilense: improving the shelf life of a liquid inoculant formulation.

    Science.gov (United States)

    Carrasco-Espinosa, Karen; García-Cabrera, Ramsés I; Bedoya-López, Andrea; Trujillo-Roldán, Mauricio A; Valdez-Cruz, Norma A

    2015-02-10

    Azospirillum brasilense has significance as a growth promoter in plants of commercial interest. Two industrial native strains (Start and Calf), used as a part of an inoculant formulation in Mexico during the last 15 years, were incubated in laboratory-scale pneumatic bioreactors at different aeration rates. In both strains, the positive effect of decreased aeration was observed. At the lowest (0.1 vvm, air volume/liquid volume×minute), the highest biomass were obtained for Calf (7.8 × 10(10)CFU/ml), and Start (2.9 × 10(9)CFU/ml). These were higher in one magnitude order compared to cultures carried out at 0.5 vvm, and two compared to those at 1.0 vvm. At lower aeration, both stereoisomeric forms of malic acid were consumed, but at higher aeration, just L-malate was consumed. A reduction in aeration allows an increase of the shelf life and the microorganism saved higher concentrations of polyhydroxybutyrate. The selected fermentation conditions are closely related to those prevalent in large-scale bioreactors and offer the possibility of achieving high biomass titles with high shelf life at a reduced costs, due to the complete use of a carbon source at low aeration of a low cost raw material as DL-malic acid mixture in comparison with the L-malic acid stereoisomer. PMID:25556026

  11. Coberturas vegetais, doses de nitrogênio e inoculação de sementes com Azospirillum brasilense em arroz de terras altas no sistema plantio direto

    Directory of Open Access Journals (Sweden)

    Douglas de Castilho Gitti

    2012-01-01

    Full Text Available O arroz é importante fonte de energia e proteínas para a população mundial, principalmente na Ásia e Oceania. No Brasil, juntamente com o feijão, constitui a base da alimentação. Tecnologias sustentáveis que reduzam custos da produção e aumentem a produtividade do arroz podem garantir seu suprimento em períodos de alta demanda. O objetivo deste trabalho foi avaliar diferentes coberturas vegetais antecessoras (milheto [Pennisetum americanum], crotalária [Crotalaria juncea], guandu [Cajanus cajan], braquiária [Brachiaria ruziziensis], milheto + crotalária e milheto + guandu, doses de nitrogênio (N em cobertura (0, 40, 80 e 120 kg ha-1 e o efeito da inoculação de sementes com Azospirillum brasilense no arroz de terras altas em sistema plantio direto no desenvolvimento e na produtividade. Utilizou-se o delineamento experimental em blocos casualizados em esquema fatorial 6x4x2 com quatro repetições. O estudo foi desenvolvido em um Latossolo Vermelho, em Selvíria, Estado do Mato Grosso do Sul, Brasil, em 2011/2012. O cultivo do guandu antecedendo o arroz proporcionou maior produtividade do arroz somente em comparação a B. ruziziensi. A produtividade do arroz em função das doses de N em cobertura se ajustou a uma função quadrática. Não houve influência da inoculação de sementes com A. brasilense sobre a produtividade do arroz, porém houve interação entre a inoculação e as coberturas vegetais sobre o teor de N foliar, número de panículas por m², matéria seca de plantas de arroz e a massa de cem grãos.

  12. Coberturas vegetais, doses de nitrogênio e inoculação de sementes com Azospirillum brasilense em arroz de terras altas no sistema plantio direto Cover crops, nitrogen rates and seeds inoculation with Azospirillum brasilense in upland rice under no-tillage

    Directory of Open Access Journals (Sweden)

    Douglas de Castilho Gitti

    2013-01-01

    Full Text Available O arroz é importante fonte de energia e proteínas para a população mundial, principalmente na Ásia e Oceania. No Brasil, juntamente com o feijão, constitui a base da alimentação. Tecnologias sustentáveis que reduzam custos da produção e aumentem a produtividade do arroz podem garantir seu suprimento em períodos de alta demanda. O objetivo deste trabalho foi avaliar diferentes coberturas vegetais antecessoras (milheto [Pennisetum americanum], crotalária [Crotalaria juncea], guandu [Cajanus cajan], braquiária [Brachiaria ruziziensis], milheto + crotalária e milheto + guandu, doses de nitrogênio (N em cobertura (0, 40, 80 e 120 kg ha-1 e o efeito da inoculação de sementes com Azospirillum brasilense no arroz de terras altas em sistema plantio direto no desenvolvimento e na produtividade. Utilizou-se o delineamento experimental em blocos casualizados em esquema fatorial 6x4x2 com quatro repetições. O estudo foi desenvolvido em um Latossolo Vermelho, em Selvíria, Estado do Mato Grosso do Sul, Brasil, em 2011/2012. O cultivo do guandu antecedendo o arroz proporcionou maior produtividade do arroz somente em comparação a B. ruziziensi. A produtividade do arroz em função das doses de N em cobertura se ajustou a uma função quadrática. Não houve influência da inoculação de sementes com A. brasilense sobre a produtividade do arroz, porém houve interação entre a inoculação e as coberturas vegetais sobre o teor de N foliar, número de panículas por m², matéria seca de plantas de arroz e a massa de cem grãos.Rice is an important source of energy and protein for the world population, mainly in Asia and Oceania. In Brazil, together with common beans, it is the population's basic food. Sustainable technologies that reduce rice production costs and increase productivity can warrant its supply on period of high demand. The objective of this study was to evaluate different preceding cover crops (millet [Pennisetum americanum

  13. Coberturas vegetais, doses de nitrogênio e inoculação de sementes com Azospirillum brasilense em arroz de terras altas no sistema plantio direto Cover crops, nitrogen rates and seeds inoculation with Azospirillum brasilense in upland rice under no-tillage

    Directory of Open Access Journals (Sweden)

    Douglas de Castilho Gitti

    2012-01-01

    Full Text Available O arroz é importante fonte de energia e proteínas para a população mundial, principalmente na Ásia e Oceania. No Brasil, juntamente com o feijão, constitui a base da alimentação. Tecnologias sustentáveis que reduzam custos da produção e aumentem a produtividade do arroz podem garantir seu suprimento em períodos de alta demanda. O objetivo deste trabalho foi avaliar diferentes coberturas vegetais antecessoras (milheto [Pennisetum americanum], crotalária [Crotalaria juncea], guandu [Cajanus cajan], braquiária [Brachiaria ruziziensis], milheto + crotalária e milheto + guandu, doses de nitrogênio (N em cobertura (0, 40, 80 e 120 kg ha-1 e o efeito da inoculação de sementes com Azospirillum brasilense no arroz de terras altas em sistema plantio direto no desenvolvimento e na produtividade. Utilizou-se o delineamento experimental em blocos casualizados em esquema fatorial 6x4x2 com quatro repetições. O estudo foi desenvolvido em um Latossolo Vermelho, em Selvíria, Estado do Mato Grosso do Sul, Brasil, em 2011/2012. O cultivo do guandu antecedendo o arroz proporcionou maior produtividade do arroz somente em comparação a B. ruziziensi. A produtividade do arroz em função das doses de N em cobertura se ajustou a uma função quadrática. Não houve influência da inoculação de sementes com A. brasilense sobre a produtividade do arroz, porém houve interação entre a inoculação e as coberturas vegetais sobre o teor de N foliar, número de panículas por m², matéria seca de plantas de arroz e a massa de cem grãos.Rice is an important source of energy and protein for the world population, mainly in Asia and Oceania. In Brazil, together with common beans, it is the population's basic food. Sustainable technologies that reduce rice production costs and increase productivity can warrant its supply on period of high demand. The objective of this study was to evaluate different preceding cover crops (millet [Pennisetum americanum

  14. Growth of Quailbush in Acidic, Metalliferous Desert Mine Tailings: Effect of Azospirillum brasilense Sp6 on Biomass Production and Rhizosphere Community Structure

    Science.gov (United States)

    de-Bashan, Luz E.; Hernandez, Juan-Pablo; Nelson, Karis N.; Bashan, Yoav

    2010-01-01

    Mine tailing deposits in semiarid and arid environments frequently remain devoid of vegetation due to the toxicity of the substrate and the absence of a diverse soil microbial community capable of supporting seed germination and plant growth. The contribution of the plant growth promoting bacterium (PGPB) Azospirillum brasilense Sp6 to the growth of quailbush in compost-amended, moderately acidic, high-metal content mine tailings using an irrigation-based reclamation strategy was examined along with its influence on the rhizosphere bacterial community. Sp6 inoculation resulted in a significant (2.2-fold) increase in plant biomass production. The data suggest that the inoculum successfully colonized the root surface and persisted throughout the 60-day experiment in both the rhizosphere, as demonstrated by excision and sequencing of the appropriate denaturing gradient gel electrophoresis (DGGE) band, and the rhizoplane, as indicated by fluorescent in situ hybridization of root surfaces. Changes in rhizosphere community structure in response to Sp6 inoculation were evaluated after 15, 30, and 60 days using DGGE analysis of 16S rRNA polymerase chain reaction amplicons. A comparison of DGGE profiles using canonical correspondence analysis revealed a significant treatment effect (Sp6-inoculated vs. uninoculated plants vs. unplanted) on bacterial community structure at 15, 30, and 60 days (p<0.05). These data indicate that in an extremely stressed environment such as acid mine tailings, an inoculated plant growth promoting bacterium not only can persist and stimulate plant growth but also can directly or indirectly influence rhizobacterial community development. PMID:20632001

  15. [Insertional mutation in the AZOBR_p60120 gene is accompanied by defects in the synthesis of lipopolysaccharide and calcofluor-binding polysaccharides in the bacterium Azospirillum brasilense Sp245].

    Science.gov (United States)

    Katsy, E I; Prilipov, A G

    2015-03-01

    In the bacterium Azospirillum brasilense Sp245, extracellular calcofluor-binding polysaccharides (Cal+ phenotype) and two types of lipopolysaccharides, LPSI and LPSII, were previously identified. These lipopolysaccharides share the same repeating O-polysaccharide unit but have different antigenic structures and different charges of their O-polysaccharides and/or core oligosaccharides. Several dozens of predicted genes involved in the biosynthesis of polysaccharides have been localized in the AZOBR_p6 plasmid of strain Sp245 (GenBank accession no. HE577333). In the present work, it was demonstrated that an artificial transposon Omegon-Km had inserted into the central region of the AZOBR_p60120 gene in the A. brasilense Sp245 LPSI- Cal- KM252 mutant. In A. brasilense strain Sp245, this plasmid gene encodes a putative glycosyltransferase containing conserved domains characteristic of the enzymes participating in the synthesis of O-polysaccharides and capsular polysaccharides (accession no. YP004987664). In mutant KM252, a respective predicted protein is expected to be completely inactivated. As a result of the analysis of the EcoRI fragment of the AZOBR_p6 plasmid, encompassing the AZOBR_p60120 gene and a number of other loci, novel data on the structure of AZOBR_p6 were obtained: an approximately 5-kb gap (GenBank accession no. KM189439) was closed in the nucleotide sequence of this plasmid. PMID:26027369

  16. Physiological and molecular basis of Azospirillum-Arabidopsis Interaction

    OpenAIRE

    Nazeer, Ahmed

    2012-01-01

    The present study was aimed at revealing the early signalling events during the interaction of the diazotrophic soil bacterium Azospirillum brasilense with its host plant Arabidopsis thaliana. Furthermore, taking advantage of the micro array technique, a comprehensive overview of Arabidopsis genes has been undertaken which are affected upon association with A. brasilense The characterization of the early responses of Arabidopsis plants upon inoculation with Azospirillum brasilense strain Sp7 ...

  17. CHANGES IN THE MORPHOLOGY OF THE ROOT SYSTEM OF WHEAT INOCULATED WITH Azospirillum brasilense Sp7 AND BACTERIOPHAGE FAb-Sp7

    OpenAIRE

    O.I. GULII; M.K. SOKOLOVA; O.I. SOKOLOV; O.V. IGNATOV

    2015-01-01

    The Azospirillum is one of the most common objects to study associative interactions between bacteria and plants. In the rhizosphere of cereals the Azospirillum cells form effective association and demonstrate a stimulating effect on plant growth and development, in particular in wheat. However, the details of these positive effects are still unknown. For example, there is no evidence of whether the Azospirillum cells are infected with bacteriophages, and little is known about the role that t...

  18. Montagem e anotação parcial da sequência genômica da Bactéria Diazotrófica Azospirillum Brasilense FP2

    OpenAIRE

    Silveira, Leviston da

    2012-01-01

    Resumo: Bactérias fixadoras de nitrogênio ou diazotróficas são organismos capazes de reduzir o dinitrogênio atmosférico em amônia, um processo chamado fixação biológica de nitrogênio que é catalisado pela enzima nitrogenase. Azospirillum brasilense é uma bactéria fixadora capaz de se associar a raízes de gramíneas como trigo e arroz, e promover o crescimento do vegetal e aumento de produtividade. Neste trabalho utilizamos 5.768.466 milhões de seqüência de nucleotídeos obtidas em seqüenciador ...

  19. Chemotaxis of Azospirillum Species to Aromatic Compounds

    OpenAIRE

    Lopez-de-Victoria, Geralyne; Lovell, Charles R.

    1993-01-01

    Chemotaxis of Azospirillum lipoferum Sp 59b and Azospirillum brasilense Sp 7 and Sp CD to malate and to the aromatic substrates benzoate, protocatechuate, 4-hydroxybenzoate, and catechol was assayed by the capillary method and direct cell counts. A. lipoferum required induction by growth on 4-hydroxybenzoate for positive chemotaxis to this compound. Chemotaxis of Azospirillum spp. to all other substrates did not require induction. Maximum chemotactic responses for most aromatic compounds occu...

  20. Características agronômicas do trigo em função de Azospirillum brasilense, ácidos húmicos e nitrogênio em casa de vegetação

    Directory of Open Access Journals (Sweden)

    Luan F. O. S. Rodrigues

    2014-01-01

    Full Text Available Objetivou-se, neste estudo, verificar o efeito do uso combinado de Azospirillum brasilense, ácidos húmicos e diferentes doses de nitrogênio nas características agronômicas do trigo. Os experimentos foram instalados no dia 21 de maio de 2011 e a colheita foi procedida no dia 13 de setembro de 2011. O delineamento experimental adotado foi o de blocos casualizados em esquema fatorial 4 x 4, com quatro repetições. O primeiro fator se refere à combinação da estirpe Ab-V5 de A. brasilense com os ácidos húmicos, sendo utilizados os seguintes tratamentos: controle; Ab-V5; ácido húmico e Ab-V5+ácido húmico e o segundo fator se refere às doses de nitrogênio (0, 30, 60 e 90 kg ha-1 N. A maioria das variáveis em análise apresentou efeito linear positivo dos tratamentos em função da adubação nitrogenada sendo que apenas para a variável massa de cem grãos este efeito foi linear negativo. Não houve diferença significativa entre as variâncias, na produção de grãos. Pôde-se concluir que o uso combinado de Ab-V5 + ácido húmico promove principalmente a produção de matéria seca de folhas e não é responsivo à adubação nitrogenada para os demais componentes produtivos em estudo nem para a produtividade dos grãos.

  1. Aspectos morfofisiológicos de plantas de milho e bioquímico do solo em resposta à adubação nitrogenada e à inoculação com Azospirillum brasilense

    Directory of Open Access Journals (Sweden)

    Tâmara Prado de Morais

    2015-12-01

    Full Text Available RESUMO O nitrogênio (N é um macronutriente que aumenta a produção de grãos na cultura do milho e o seu manejo adequado torna-se indispensável como proposta de uma agricultura sustentável, incluindo o uso de fontes alternativas como bactérias fixadoras de N2. Os objetivos deste trabalho foram avaliar a resposta morfofisiológica de plantas de milho e a atividade de enzimas no solo (urease e fosfatase decorrente da adubação N mineral e da inoculação com Azospirillum brasilense. Dois ensaios foram realizados em condições de casa de vegetação com solo de cerrado. O delineamento estatístico adotado foi o de blocos ao acaso com os tratamentos distribuídos em esquema fatorial 3 x 3, sendo o primeiro fator correspondente a doses de N (0; 100 e 200 kg ha-1 e o segundo, a doses de um inoculante líquido à base de A. brasilense aplicado via sementes (0; 100 e 200 mL ha-1. Ao final desse experimento, outro ensaio foi realizado para verificar o possível efeito residual da inoculação e da adubação nitrogenada. A adição de fertilizantes nitrogenados promoveu maior desenvolvimento das plantas de milho, elevou os teores de clorofila e de nutrientes. Houve aumento da atividade das enzimas relacionadas à disponibilização de amônio e fósforo inorgânico na rizosfera. Além disso, o nitrogênio apresentou efeito residual no desenvolvimento das plantas na semeadura subsequente. A dose de 200 mL ha-1 de A. brasilense associada à dose de 200 kg ha-1 de N aumentou a resposta fisiológica da cultura.

  2. ESTUDIO DEL EFECTO QUIMIOTÁCTICO DE LOS EXUDADOS RADICALES DEL ARROZ SOBRE Azospirillum brasilense Sp7 Y A. brasilense R5(15). PRODUCCIÓN DE AUXINAS POR AMBAS CEPAS

    OpenAIRE

    Mabel Pazos; Digna Hernández; Annia Hernández

    2003-01-01

    El género Azospirillum agrupa bacterias diazotróficas de vida libre, ampliamente encontradas en suelos tropicales y subtropicales, en asociación con raíces de cultivos de importancia económica como arroz, trigo y diversas especies vegetales. La gran mayoría de los estudios realizados con este género han demostrado su distribución prácticamente universal y sus numerosos efectos sobre el crecimiento de las plantas que coloniza. En este trabajo se demuestra el efecto quimiotáctico que ejercen lo...

  3. Estudio sobre la influencia de la inoculación de las rizobacterias Azospirillum brasilense y Pseudomonas fluorescens sobre el desarrollo morfológico y el contenido de aceites esenciales en las especies aromáticas Ocimum basilicum var. genovesse, Ocimum basilicum var. minimum, Petroselinum sativum var. lisa y Salvia officinalis.

    OpenAIRE

    Martos Trenado, Pilar

    2012-01-01

    En el presente estudio se analiza la influencia de la inoculación con Azospirillum brasilense, con Pseudomonas fluorescens y la inoculación conjunta con ambas rizobacterias en las especies de plantas aromáticas Ocimum basilicum var. genovesse, Ocimum basilicum var. minimum, Petroselinum sativum var. lisa y Salvia officinalis. Se evaluará su desarrollo morfológico, atendiendo a tres parámetros: la longitud del tallo, el peso fresco y la superficie foliar. Así como el posible incremento en el c...

  4. Assessment of N2 fixing efficiency of Beijerinckia indica and Azospirillum brasilense in Sorghum (Sorghum bicolor (L.) moench) using 15N tracer

    International Nuclear Information System (INIS)

    For studying the benefits of inoculation of N2 fixing diazotrophs in the root zone of sorghum crop, a pot culture was conducted on neutral red sandy loam soil with sorghum cv. CO26, using 15N tracer. At the end of 45 days duration after sowing, Beijerinckia indica inoculation contributed 56.9 per cent N derived from N2 fixation, out of total N concentration in whole drymatter of sorghum plant. It proved to be the efficient N2 fixer by contributing N from N2 fixation to the tune of 17.6 Kg-1. Accumulation of N derived from N2 fixation from B. indica was primarily in leaf blade (50.0%) followed by stem (31.8%), leaf sheath (14.0%) and root (4.2%). Inoculation of Azospirillum brasllense accelerated uptake of N from soil and fertilizer N sources compared to B. indica and hence registered low N fixation. (author)

  5. Efecto de la coinmovilización de la microalga Chlorella sorokiniana con la bacteria promotora de crecimiento vegetal Azospirillum brasilense, en el crecimiento poblacional microalgal y capacidad de remoción de amonio como uso potencial en el tratamiento..

    Directory of Open Access Journals (Sweden)

    Guillot Monroy Gabriel

    2006-06-01

    Full Text Available Se desarrollaron dos experimentos de coinmovilización de la microalga Chlorella sorokiniana con la bacteria promotora
    de crecimiento vegetal (PGPB Azospirillum brasilense en esferas de alginato, para evaluar la influencia de la bacteria en el crecimiento poblacional y en la capacidad de remoción de amonio de la microalga; con el fin de establecer el potencial que pueda tener la coinmovilización de estos microorganismos en el tratamiento terciario de aguas residuales. Los resultados revelan un significativo incremento de la población cuando C.
    sorokiniana es coinmovilizada con A. brasilense, aunque no se observó un efecto significativo en la remoción de amonio. Los resultados obtenidos en el presente trabajo, reflejan la importancia de avanzar en el estudio de un sistema coinmovilizado altamente eficiente para ser utilizado en tratamiento de aguas residuales. La coinmovilización
    de C. sorokiniana con A. brasilense, muestra la habilidad de esta bacteria para influir de manera positiva en el crecimiento y fisiología de la microalga y por lo tanto la remoción de amonio puede ser incrementada.

  6. Azospirillum rugosum sp. nov., isolated from oil-contaminated soil.

    Science.gov (United States)

    Young, C C; Hupfer, H; Siering, C; Ho, M-J; Arun, A B; Lai, W-A; Rekha, P D; Shen, F-T; Hung, M-H; Chen, W-M; Yassin, A F

    2008-04-01

    The taxonomic status of a light-orange-coloured bacterial isolate from an oil-contaminated soil sample was characterized by using a polyphasic taxonomic approach. Comparative analysis of 16S rRNA gene sequences demonstrated that the isolate belonged phylogenetically to the genus Azospirillum, with Azospirillum canadense, Azospirillum brasilense and Azospirillum doebereinerae as its closest phylogenetic relatives (97.3, 97.0 and 97.0 % similarity, respectively). DNA-DNA pairing studies showed that the unidentified organism displayed 25.0, 17.0 and 19.0 % relatedness to the type strains of A. brasilense, A. canadense and A. doebereinerae, respectively. The generic assignment was confirmed by chemotaxonomic data, which revealed a fatty acid profile that was characteristic of the genus Azospirillum, consisting of straight-chain saturated and unsaturated fatty acids with C18 : 1 omega 7c as the major fatty acid, and ubiquinone with ten isoprene units (Q-10) as the predominant respiratory quinone. On the basis of both the phenotypic and molecular genetic evidence, it is proposed that the unknown isolate be classified as a representative of a novel species of the genus Azospirillum, for which the name Azospirillum rugosum sp. nov. is proposed. The type strain is IMMIB AFH-6T (=CCUG 53966T=DSM 19657T). PMID:18398202

  7. Biology of Azospirillum-Sugarcane Association: Enhancement of Nitrogenase Activity †

    OpenAIRE

    Berg, R. Howard; Tyler, Max E.; Novick, Norman J.; Vasil, Vimla; Vasil, Indra K.

    1980-01-01

    Azospirillum brasilense was reisolated from associations with callus tissue cultures of sugarcane and compared with stock cultures of the inoculated bacterium and related strains. Although the reisolate had a growth rate similar to stock cultures, it exhibited a severalfold increase in maximum specific activity of nitrogenase. The reisolate and the parent culture had similar ultrastructure. The general ultrastructure of Azospirillum is described. The bacterium was capsulated when grown on nit...

  8. Partial characterization of nif genes from the bacterium Azospirillum amazonense

    Directory of Open Access Journals (Sweden)

    D.P. Potrich

    2001-09-01

    Full Text Available Azospirillum amazonense revealed genomic organization patterns of the nitrogen fixation genes similar to those of the distantly related species A. brasilense. Our work suggests that A. brasilense nifHDK, nifENX, fixABC operons and nifA and glnB genes may be structurally homologous to the counterpart genes of A. amazonense. This is the first analysis revealing homology between A. brasilense nif genes and the A. amazonense genome. Sequence analysis of PCR amplification products revealed similarities between the amino acid sequences of the highly conserved nifD and glnB genes of A. amazonense and related genes of A. brasilense and other bacteria. However, the A. amazonense non-coding regions (the upstream activator sequence region and the region between the nifH and nifD genes differed from related regions of A. brasilense even in nitrogenase structural genes which are highly conserved among diazotrophic bacteria. The feasibility of the 16S ribosomal RNA gene-based PCR system for specific detection of A. amazonense was shown. Our results indicate that the PCR primers for 16S rDNA defined in this article are highly specific to A. amazonense and can distinguish this species from A. brasilense.

  9. Genome-wide survey of two-component signal transduction systems in the plant growth-promoting bacterium Azospirillum

    OpenAIRE

    Borland, Stéphanie; Oudart, Anne; Prigent-Combaret, Claire; Brochier-Armanet, Céline; Wisniewski-Dyé, Florence

    2015-01-01

    Background Two-component systems (TCS) play critical roles in sensing and responding to environmental cues. Azospirillum is a plant growth-promoting rhizobacterium living in the rhizosphere of many important crops. Despite numerous studies about its plant beneficial properties, little is known about how the bacterium senses and responds to its rhizospheric environment. The availability of complete genome sequenced from four Azospirillum strains (A. brasilense Sp245 and CBG 497, A. lipoferum 4...

  10. Applicability of the 16S-23S rDNA internal spacer for PCR detection of the phytostimulatory PGPR inoculant Azospirillum lipoferum CRT1 in field soil

    OpenAIRE

    Baudoin, Ezékiel; Couillerot, O.; Spaepen, S.; Moenne-Loccoz, Y.; Nazaret, S.

    2010-01-01

    Aims: To assess the applicability of the 16S-23S rDNA internal spacer regions (ISR) as targets for PCR detection of Azospirillum ssp. and the phytostimulatory plant growth-promoting rhizobacteria seed inoculant Azospirillum lipoferum CRT1 in soil. Methods and Results: Primer sets were designed after sequence analysis of the ISR of A. lipoferum CRT1 and Azospirillum brasilense Sp245. The primers fAZO/rAZO targeting the Azospirillum genus successfully yielded PCR amplicons (400-550 bp) from Azo...

  11. ХАРАКТЕРИСТИКА ЛИПОПОЛИСАХАРИДА ДИАЗОТРОФНЫХ РИЗОБАКТЕРИЙ AZOSPIRILLUM BRASILENSE SR55

    OpenAIRE

    Бойко, А.; Коннова, О.; Коннова, С.; Федоненко, Ю.; Игнатов, В.

    2007-01-01

    Исследованы липополисахариды грамотрицательных диазотрофных ризобактерий, стимулирующих рост растений, Azospirillum brasilense SR55, изолированных с корней пшеницы в Саратовской области. Из наружной мембраны фенольной экстракцией выделен липополисахарид и изучен его химический состав. Среди основных компонентов гидрофобной части идентифицированы 3-гидрокситетрадекановая, 3-гидроксигексадекановая, гексадекановая и октадеценовая кислоты, а в углеводной составляющей рамноза, галактоза, 3-О-метил...

  12. Cellulose decomposition and associated nitrogen fixation by mixed cultures of Cellulomonas gelida and Azospirillum species or Bacillus macerans

    Energy Technology Data Exchange (ETDEWEB)

    Halsall, D.M.; Gibson, A.H.

    1985-10-01

    Mixed cultures of Cellulomonas gelida plus Azospirillum lipoferum or Azospirillum brasilense and C. gelida plus Bacillus macerans were shown to degrade cellulose and straw and to utilize the energy-yielding products to fix atmospheric nitrogen. This cooperative process was followed over 30 days in sand-based cultures in which the breakdown of 20% of the cellulose and 28 to 30% of the straw resulted in the fixation of 12 to 14.6 mg of N per g of cellulose and 17 to 19 mg of N per g of straw consumed. Cellulomonas species have certain advantages over aerobic cellulose-degrading fungi in being able to degrade cellulose at oxygen concentrations as low as 1% O/sub 2/ (vol/vol) which would allow a close association between cellulose-degrading and microaerobic diazotrophic microorganisms. Cultures inoculated with initially different proportions of A. brasilense and C. gelida all reached a stable ratio of approximately 1 Azospirillum/3 Cellulomonas cells.

  13. ВЛИЯНИЕ БАКТЕРИЙ AZOSPIRILLUM BRASILENSE НА СОДЕРЖАНИЕ ПИГМЕНТОВ У ПШЕНИЦЫ ПРИ КАДМИЕВОМ СТРЕССЕ

    OpenAIRE

    Железкова, Мария; Плешакова, Екатерина; Любунь, Елена

    2014-01-01

    Важную роль при устранении токсического действия тяжелых металлов на растения играют почвенные микроорганизмы. Известно, что ризосферные ассоциативные микроорганизмы рода Azospirillum активно взаимодействуют с растениями и могут оказывать различные воздействия на их морфологические и биохимические параметры. Проведенными исследованиями установлено, что инокуляция растений пшеницы (Triticum aestivum L.) ассоциативными бактериями Azospirillum brasilense (штаммы Sp7, SpCd, Sp245, Sp245.5) нивели...

  14. [Effect of Azospirillum lectins on the Activity of Proteolytic Enzymes and Their Inhibitors in Wheat Seedling Roots].

    Science.gov (United States)

    Alen'kina, S A; Nikitina, V E

    2015-01-01

    The lectins of associative nitrogen-fixing strains Azospirillum brasilense Sp7 and Sp245 were shown to exerte a multidirectional effect on the activity of acidic (pH 3.5), neutral (6.8), and alkaline (pH 7.8) proteinases. The lectin of the epiphytic A. brasilense Sp7 decreased proteolytic activity at all pH values, whereas the lectin of the endophytic A. brasilense Sp245 activated neutral and alkaline proteinases, while not affecting the alkaline ones. Experiments with protease inhibitors made it possible to conclude that the lectins of the studied A. brasilense strains alter the ratio between the activities of different protease types in germinating seeds. The activity of trypsin inhibitors in wheat seedling roots was found to increase in the presence of the lectins. Our results indicate a broader spectrum of effects of azospirilla lectins on the host plant organism. PMID:27169244

  15. STUDY OF AZOSPIRILLUM LECTINS INFLUENCE ON HYDROGEN PEROXIDE PRODUCTION IN WHEAT-ROOTS

    Directory of Open Access Journals (Sweden)

    Alen’kina S.A.

    2009-12-01

    Full Text Available It was found that two cell-surface lectins isolated from the nitrogen-fixing soil bacterium Azospirillum brasilense Sp7 and from its mutant defective in lectin activity, A. brasilense Sp7.2.3 can stimulate rapid formation of hydrogen peroxide, associated with an increase in the activities of oxalate oxidase and peroxidase in the roots of wheat seedlings. The most advantageous and most rapidly induced pathway of hydrogen peroxide formation was the oxidation of oxalic acid by oxalate oxidase because in this case, a 10-min treatment of the roots with the lectins at 10 µg ml-1 was sufficient. The data from this study attest that the Azospirillum lectins can act as inducers of adaptation processes in the roots of wheat seedlings.

  16. [Characterization of the lipopolysaccharides of serogroup II Azospirillum].

    Science.gov (United States)

    Sigida, E N; Fedonenko, Iu P; Zdorovenko, É L; Butygin, G L; Konnova, S A; Ignatov, V V

    2014-01-01

    Lipopolysaccharides of six Azospirillum strains (A. brasilense SR50, SR80, SR88, SR109, SR111, SR115, and A. lipoferum SR 42) isolated from the rhizosphere of cereal plants of Saratov oblast, Russia and assigned to serogroup II by serological analysis were studied. In the lipid A fatty acid composition, the lipopolysaccharides under study were similar to those of other Azospirillum strains and were characterized by predominance of 3-hydroxytetradecanoic, 3-hydroxyhexadecanoic, and octadecenoic acids. Monosaccharide analysis of the O-specific polysaccharides (including determination of the absolute configurations, methylation analysis, and one- and two-dimensional NMR spectroscopy) revealed the presence of two types of repeating units in varying ratios. High degree of serological similarity between the strains under study was shown to result from the presence of repeating units with identical structure in their O antigens. PMID:25844452

  17. Polyhydroxyalcanoates of strains of Azospirillum spp. isolated of roots of Lycopersicon esculentum Mill. “tomato” and Oryza sativa L. “rice” in Lambayeque

    Directory of Open Access Journals (Sweden)

    Katty Baca

    2010-12-01

    Full Text Available In this work was determined the concentration of polyhydroxyalkanoates (PHAs of Azospirillum strains isolated from roots of Lycopersicon esculentum Mill "tomato" and Oryza sativa L. "rice" as an alternative to accumulation of petroleum-based plastics. Previously disinfected root were plated in Nfb semisolid medium where nitrogen-fixing bacteria were recognized by a whitish film on the surface and turn from green to blue. The genus Azospirillum was identified in Congo red agar medium, obtained 96 isolates of A. lipoferum and A. brasilense on tomato and rice. Batch fermentation was performed with broth Azotobacter modified feeding a saturated solution of malic acid every 12 hours and were stained with Sudan Black B. Strains were selected with the greatest number of PHAs granules (in tomato, 18 of A. lipoferum and 2 of A. brasilense; in rice, 10 of A. lipoferum and 10 of A. brasilense and quantified the biomass and PHAs. PHAs concentration reached 0.661 gL-1 in A. lipoferum KM(T-73 and 0.738 gL-1 in A. brasilense KM(T-19, both isolated from tomato. Strains of A. lipoferum and A. brasilense isolated from tomato reached a higher concentration of biomass and PHAs against the strains of rice.

  18. СРАВНИТЕЛЬНАЯ ХАРАКТЕРИСТИКА ЛИПОПОЛИСАХАРИДОВ БАКТЕРИЙ ШТАММА AZOSPIRILLUM BRASILENSE SP7 И ЕГО СПОНТАННОГО МУТАНТА SP7.K2

    OpenAIRE

    Сигида, Елена; Федоненко, Юлия; Смолькина, Ольга; Коннова, Светлана; Игнатов, Владимир

    2012-01-01

    Проведены сравнительные исследования липополисахаридов (ЛПС) азотфиксирующих ризобактерий штамма Azospirillum brasilense Sp7 и его спонтанного мутанта Sp7.K2, у которого в результате изменений плазмидного состава наблюдалось преобладание R-форм ЛПС. Выявлены различия в химическом составе и электрофоретическом профиле исследуемых препаратов ЛПС. Показано, что для получения ЛПС A. brasilense Sp7.K2 с целью проведения его дальнейших структурных исследований предпочтительнее использовать метод во...

  19. Enhanced Mineral Uptake by Zea mays and Sorghum bicolor Roots Inoculated with Azospirillum brasilense†

    OpenAIRE

    Lin, Willy; Okon, Yaacov; Hardy, Ralph W. F.

    1983-01-01

    Inoculation of corn (Zea mays) seeds with Azospirillum brasilense strain Cd or Sp 7 significantly enhanced (30 to 50% over controls) the uptake of NO3−, K+, and H2PO4− into 3- to 4-day- and 2-week-old root segments. No gross changes in root morphology were observed; altered cell arrangement in the outer four or five layers of the cortex was seen in photomicrographs of cross sections of inoculated corn roots. The surface activity involved in ion uptake probably increased, as shown by the darke...

  20. [Comparative assessment of inductive effects of Azospirillum lectins with different antigenic properties on the signal systems of wheat seedling roots].

    Science.gov (United States)

    Alen'kina, S A; Petrova, L P; Sokolova, M K; Chernyshova, M P; Trutneva, K A; Bogatyrev, V A; Nikitina, V E

    2014-01-01

    The lectins of associative nitrogen-fixing bacteria Azospirillum brasilense Sp7 and its mutant A. brasilense Sp7.2.3 were shown to have different effects on the components of the wheat seedling root signal system, namely to regulate the levels of cAMP, nitric oxide, diacylglycerol, and salicylic acid, as well as to induce the activities of superoxide dismutase and lipoxygenase. Our results make it possible to consider azospirilla lectins as inducers of the signal systems in wheat seedling roots, since they cause development of several flows of primary signals. These data are of general biological importance, since lectins are present in all living organisms and most ot the functions of lectins remain insufficiently understood. PMID:25844444

  1. Coexistence and survival of pathogenic leptospires by formation of biofilm with Azospirillum.

    Science.gov (United States)

    Kumar, K Vinod; Lall, Chandan; Raj, R Vimal; Vedhagiri, K; Vijayachari, P

    2015-06-01

    Pathogenic Leptospira spp. represent one cause of leptospirosis worldwide and have long been regarded as solitary organisms in soil and aquatic environments. However, in the present study, Leptospira interrogans was observed to be associated with environmental biofilms with 21 bacterial isolates belonging to 10 genera. All 21 isolates were examined for their coaggregation and biofilm-forming ability with leptospires in vitro. Among these, Azospirillum brasilense RMRCPB showed maximum interspecies coaggregation with leptospiral strains (>75%, visual score of +4). Other significant coaggregating isolates belonged to the genera Sphingomonas, Micrococcus, Brevundimonas, Acinetobacter and Paracoccus. Biofilms of leptospires in combination with A. brasilense RMRCPB showed high resistance to penicillin G, ampicillin and tetracycline (minimum bactericidal concentration ≥800 μg/mL) and tolerance to UV radiation and high temperature (up to 49°C). This study hypothesized that biofilm formation with A. brasilense protects the pathogenic Leptospira from adverse environmental conditions/stress. This coexistence of pathogenic Leptospira with other bacteria may be the key factor for its persistence and survival. However, the mechanism of biofilm formation by leptospires needs to be explored to help devise an appropriate control strategy and reduce transmission of leptospires. PMID:25962762

  2. AMPLIFICATION OF AZOSPIRILLUM SP. JG3 GLPD GENE FRAGMENT USING DEGENERATE PRIMERS GENERATED BY WEB-BASED TOOLS

    Directory of Open Access Journals (Sweden)

    Stalis Norma Ethica

    2013-12-01

    Full Text Available Primaclade and In Silico web-based tools were used as a strategy to obtain the correct-size PCR amplicon targeting a fragment of gene encoding glycerol-3-phosphate dehydrogenase (glpD of Azospirillum sp. JG3. The bacterial strains are soil, Gram-negative PGPR (Plant-Growth Promoting Rhizobacteria isolated from an agricultural land in Purwokerto, Central Java, Indonesia, which have ability to produce several commercial enzymes. The aim is to obtain a pair of reliable degenerate primers from a limited number of glpD sequences from other Azospirilla retrieved in GenBank using bioinformatics approach. We demonstrated degenerate primer design that led to successful PCR amplification corresponding to the targeted DNA fragment. Homology analysis showed that the obtained DNA fragment is 61% and 99% similar to sn-glycerol-3-phosphate dehydrogenase genes of Azospirillum brasilense and Stenotrophomonas maltophili respectively.

  3. Azospirillum, a free-living nitrogen-fixing bacterium closely associated with grasses: genetic, biochemical and ecological aspects.

    Science.gov (United States)

    Steenhoudt, O; Vanderleyden, J

    2000-10-01

    Azospirillum represents the best characterized genus of plant growth-promoting rhizobacteria. Other free-living diazotrophs repeatedly detected in association with plant roots, include Acetobacter diazotrophicus, Herbaspirillum seropedicae, Azoarcus spp. and Azotobacter. Four aspects of the Azospirillum-plant root interaction are highlighted: natural habitat, plant root interaction, nitrogen fixation and biosynthesis of plant growth hormones. Each of these aspects is dealt with in a comparative way. Azospirilla are predominantly surface-colonizing bacteria, whereas A. diazotrophicus, H. seropedicae and Azoarcus sp. are endophytic diazotrophs. The attachment of Azospirillum cells to plant roots occurs in two steps. The polar flagellum, of which the flagellin was shown to be a glycoprotein, mediates the adsorption step. An as yet unidentified surface polysaccharide is believed to be essential in the subsequent anchoring phase. In Azoarcus sp. the attachment process is mediated by type IV pili. Nitrogen fixation structural genes (nif) are highly conserved among all nitrogen-fixing bacteria, and in all diazotrophic species of the class of proteobacteria examined, the transcriptional activator NifA is required for expression of other nif genes in response to two major environmental signals (oxygen and fixed N). However, the mechanisms involved in this control can vary in different organisms. In Azospirillum brasilense and H. seropedicae (alpha- and beta-subgroup, respectively), NifA is inactive in conditions of excess nitrogen. Activation of NifA upon removal of fixed N seems to involve, either directly or indirectly, the signal transduction protein P(II). The presence of four conserved cysteine residues in the NifA protein might be an indication that NifA is directly sensitive to oxygen. In Azotobacter vinelandii (gamma-subgroup) nifA is cotranscribed with a second gene nifL. The nifL gene product inactivates NifA in response to high oxygen tension and cellular

  4. Chemotaxis of Azospirillum species to aromatic compounds

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-de-Victoria, G.; Lovell, C.R. (Univ. of South Carolina, Columbia, SC (United States))

    1993-09-01

    Azospirillum sspeciesare free-living nitrogen fixing bacteria commonly found in soils and in association with plant roots, including important agricultural crops. Rhizosphere colonization my Azospirillum species has been shown to stimulate growth of a variety of plant species. Chemotaxis is one of the properties which may contribute to survival, rhizosphere colonization and the initiation of mutualistic interactions by Azospirillum species. This study evaluates the chemotactic responses of three Azospirillum stains to a variety of aromatic compounds:benzoate, catechol, 4-HB, and PCA. Results indicate that the same aromatic substance can elicit different chemotactic responses from different Azospirillum species, and that Azospirillum can detect aromatic substrates at concentrations similar to those they encounter naturally. 36 refs., 1 fig., 6 tabs.

  5. Change in the Content of Salicylic Acid and in the Activities of Phenylalanine Ammonia-Lyase and Catalase in Wheat Seedling Roots Under the Effect of Azospirillum Lectins

    Directory of Open Access Journals (Sweden)

    Alen'kina S.A.

    2012-05-01

    Full Text Available We investigated the time course of changes in the endogenous content of salicylic acid, the ratio between the acid's free and bound forms, and changes in the activities of phenylalanine ammonia-lyase and catalase in wheat seedling roots under the effect of the lectins of two strains of the associative nitrogen-fixing bacterium Azospirillum: A. brasilense Sp7 and its mutant defective in lectin activity, A. brasilense Sp7.2.3. Differences in plant response to the action of the lectins from these two strains were established. On the basis of the obtained data, a model was proposed for lectin-assisted induction of resistance, according to which the lectin effect on the roots of seedlings results in accumulation of free salicylic acid, which inhibits catalase activity, ultimately leading to accumulation of hydrogen peroxide and to formation of induced resistance.

  6. EVALUACIÓN DE CEPAS NATIVAS DEL GÉNERO Azospirillum Y SU INTERACCIÓN CON EL CULTIVO DEL ARROZ

    OpenAIRE

    Mabel Pazos; Annia Hernández

    2001-01-01

    Catorce cepas nativas pertenecientes a la especie Azospirillum brasilense se caracterizaron en cuanto a su ca- pacidad de fijar el nitrógeno atmosférico. Se estudió su efecto en el cultivo del arroz (Oryza sativa), mediante el modelo Microcosmos, realizando determinaciones de la altura de las plantas inoculadas, masa fresca de la raíz y el contenido de fenoles libres y la cuantificación de proteínas en las hojas. Se observó en todos los casos un efecto positivo por la inocula- ción con e...

  7. Carbohydrate Catabolism in Azospirillum amazonense

    OpenAIRE

    Martínez-Drets, G.; Fabiano, E.; Cardona, A

    1985-01-01

    The nitrogen fixer Azospirillum amazonense grew on the various disaccharides, hexoses, and pentoses tested in this study but not on polyols and on some tricarboxylic acid cycle intermediates. An active transport system was detected for sucrose and glucose but not for mannitol and 2-ketoglutarate. Six A. amazonense strains were examined for 16 carbon-metabolizing enzymes, and the results indicate that these strains employ the Entner-Doudoroff pathway to catabolize sucrose, fructose, and glucos...

  8. Development of sequence-characterized amplified region (SCAR) markers as a quality standard of inoculants based on Azospirillum.

    Science.gov (United States)

    Reddy Priya, Pasupuleti; Selastin Antony, Raju; Gopalaswamy, Ganesan; Balachandar, Dananjeyan

    2016-04-01

    An attempt was made in this work to develop a strain-level molecular marker for unambiguous authentication of two Azospirillum inoculants, viz. A. lipoferum (strain Az204) and A. brasilense (strain Sp7). The sequence-characterized amplified region (SCAR) markers obtained from DNA fingerprints were designed for discrete detection of the strains. The SCAR primers could successfully amplify the target strain without cross-reaction with other Azospirillum strains, native isolates and other inoculants. The detection limit of SCAR primer for Az204 was 8.00 pg of DNA (approximately 10(5) cells per mL), and for Sp7, it was 0.49 pg of DNA (equal to 10(4) cells per mL). A simplified Sephadex G100-based crude DNA extraction protocol developed in this study was found suitable for SCAR marker-based strain authentication. Further, SCAR primers were assessed for simultaneous authentication as well as quantification of commercially prepared Azospirillum inoculants by quantitative real-time PCR (RT-PCR) and most-probable-number PCR (MPN-PCR). The RT-PCR assay can be able to quantify the commercial formulations as equal to culturable MPN method, while MPN-PCR failed for Az204. The SCAR marker-based strain authentication and presumptive quantification developed in the present work can contribute to improving the quality standard of commercial inoculants. PMID:26792777

  9. Improvement of Canola (Brassica napus L.) Inoculated with Rhizobium, Azospirillum and/or Mycorrhizal Fungi Under Salinity Stress

    International Nuclear Information System (INIS)

    Bio fertilization technology was applied for improving canola plant growth and nutrient acquisition in sandy saline soil ,as a biological mean used to develop plant growth and nutrient uptake under salinity stress. Canola was cultivated in pots packed at rate of 7 kg saline sandy soil pot-1, and inoculated with Rhizobium leguminosarum biovar viceae, Azospirillum brasilense strain no. 40 and arbuscular mycorrhizal fungi either solely or in combinations of them. Nitrogen fertilizer was added in form (15NH4)2SO4 with 5%15N atom excess at rate of 0.99 g N pot-1. Maximum dry matter accumulation induced by composite inoculation (Rh + Azo + AM). Na concentrations were frequently affected by Rhizobium and /or mycorrhizae while K was affected by Azospirillum and /or mycorrhizae. Azospirillum enhanced Ca uptake whereas Mg content was responded well to composite inoculants of Rh + Azo + AM. Dual inoculation with Rh + Azo resulted in the highest values of N uptake by plant. Similar effect was noticed with P uptake when dual inoculums of Azo + AM were applied. Data of 15N isotope showed that the highest portion and value of N2-fixed was recorded with composite inoculums followed by dual inoculations. On the other hand, the infection with AM fungi gave the highest proportion of N derived from fertilizer as compared to other inoculants or uninoculated control. In the same trend, the fertilizer use efficiency (FUE%) was enhanced by AM infection. Dual inoculums of Rh + Azo induced highest content of proline in leaves. (Authors)

  10. Nitrogen fixation associated with development and localization of mixed populations of Cellulomonas species and Azospirillium brasilense grown on cellulose or wheat straw

    Energy Technology Data Exchange (ETDEWEB)

    Halsall, D.M.; Goodchild, D.J.

    1986-04-01

    Mixed cultures of Cellulomonas sp. and Azospirillum brasilense were grown with straw or cellulose as the carbon source under conditions favoring the fixation of atmospheric nitrogen. Rapid increases in cell numbers, up to 10/sup 9/ cells per g of substrate, were evident after 4 and 5 days of incubation at 30 degrees C for cellulose and straw, respectively. Nitrogen fixation (detected by acetylene reduction measured on parallel cultures) commenced after 2 and 4 days of incubation for straw and cellulose, respectively, and continued for the duration of the experiment. Pure cultures of Cellulomonas sp. showed an increase in cell numbers, but CO/sub 2/ production was low, and acetylene reduction was not detected on either cellulose or straw. Pure cultures of A. brasilense on cellulose showed an inital increase in cell numbers (10/sup 7/ cells per g of substrate) over 4 days, followed by a decline presumably caused by the exhaustion of available carbon substrate. On straw, A. brasilense increased to 10/sup 9/ cells per g of substrate over 5 days and then declined slowly; this growth was accompanied by acetylene reduction. Scanning electron micrographs of straw incubated with a mixture under the above conditions for 8 days showed cells of both species in close proximity to each other. Evidence was furnished that the close spatial relatioship of cells from the two species facilitated the mutally beneficial association between them and thus increased the efficiency with which the products of straw breakdown were used for nitrogen fixation. 17 references.

  11. L-arabinose metabolism in Azospirillum brasiliense.

    OpenAIRE

    Novick, N J; Tyler, M.E.

    1982-01-01

    An oxidative pathway by which L-arabinose is converted to alpha-ketoglutarate in crude extracts of Azospirillum brasiliense is demonstrated. Specific activities of enzymes involved in the pathway were determined, and several pathway intermediates were identified.

  12. Genome Structure of the Genus Azospirillum

    OpenAIRE

    Martin-Didonet, Claudia C. G.; Chubatsu, Leda S; Emanuel M. Souza; Kleina, Margareth; Rego, Fabiane G. M.; Liu U Rigo; Yates, M. Geoffrey; Pedrosa, Fabio O.

    2000-01-01

    Azospirillum species are plant-associated diazotrophs of the alpha subclass of Proteobacteria. The genomes of five of the six Azospirillum species were analyzed by pulsed-field gel electrophoresis. All strains possessed several megareplicons, some probably linear, and 16S ribosomal DNA hybridization indicated multiple chromosomes in genomes ranging in size from 4.8 to 9.7 Mbp. The nifHDK operon was identified in the largest replicon.

  13. Combination of inoculation methods of Azospirilum brasilense with broadcasting of nitrogen fertilizer increases corn yield

    Directory of Open Access Journals (Sweden)

    Tânia Maria Müller

    2015-01-01

    Full Text Available Nitrogen (N is the most limiting nutrient for corn production. Thereby, the goal of the paper was to evaluate inoculation methods of Azospirillum brasilense in order to partially supply N required by the crop. The experiment was carried out in Guarapuava, PR, Brasil, in 2011/2012 growing season. Randomized blocks with factorial 3 inoculation methods (seed treatment, planting furrow and non-inoculated control x 5 doses of nitrogen (0, 75, 150, 225 and 300kg ha-1 x 8 replications was used as the experimental design. Leaf are index, foliar nitrogen content, total chlorophyll, grains per ear and yield were evaluated. There was significant interaction between inoculation methods and nitrogen fertilization to leaf area index, but not for yield. Inoculation with the diazotrophic bacteria provided yield increase of 702kg ha-1 for inoculation in seeding furrow and 432kg ha-1 for inoculation in seed treatment compared to the control, but both treatments did not differ between each other. Furthermore, total chlorophyll, grains per ear and yield were positively affected, with quadratic response, by the nitrogen fertilization in broadcasting

  14. ESTUDIO DE LA INTERACCIÓN PLANTA-Azospirillum EN EL CULTIVO CAÑA DE AZÚCAR (Saccharum sp.

    Directory of Open Access Journals (Sweden)

    Juana Pérez

    2005-01-01

    Full Text Available Se realizó el aislamiento y la caracterización de cepas nativas de Azospirillum en la rizosfera de las variedades comerciales de caña de azúcar Ja60-5 y C266-70 en los suelos Ferralítico Rojo y Ferralítico Amarillento de las provincias de La Habana y Ciego de Avila. A los aislamientos se les evaluó la actividad nitrogenasa mediante la técnica de reducción del acetileno y la actividad estimuladora del crecimiento en vitroplantas de caña de azúcar. Las cepas fueron caracterizadas mediante pruebas morfológicas y bioquímicas. Se encontraron concentraciones de bacterias del orden de 104 cel. g -1 de raíces, correspondiendo los mayores valores a la variedad Ja60-5 en ambos suelos. Se aislaron cuatro cepas con características propias del género Azospirillum, seleccionándose la cepa 8 INICA de Azospirillum brasilense para estudios posteriores, por sus elevados valores de reducción de acetileno y su mayor efecto sobre el crecimiento de vitroplantas de caña de azúcar.

  15. ХАРАКТЕРИСТИКА СТРУКТУРНЫХ ОСОБЕННОСТЕЙ ЛИПОПОЛИСАХАРИД-БЕЛКОВЫХ КОМПЛЕКСОВ КАПСУЛЫ БАКТЕРИЙ AZOSPIRILLUM BRASILENSE SR80 И SP245 ПРИ РОСТЕ НА АГАРИЗОВАННОЙ СРЕДЕ

    OpenAIRE

    Халэпа, Яна; Евстигнеева, Стелла; Сигида, Елена; Федоненко, Юлия; Коннова, Светлана; Игнатов, Владимир

    2014-01-01

    Проведено сравнительное исследование структурных особенностей липополисахарид-белковых комплексов (ЛПБК) из капсульного материала бактерий Azospirillum brasilense SR80 и Sp245, выращенных в жидкой и агаризованной питательных средах. Анализ данных ГЖХ и ЯМР-спектроскопии выявил отличия структуры липидной и полисахаридной составляющих ЛПБК исследуемых бактерий, в зависимости от условий их культивирования. Отличительной особенностью ЛПБК обоих штаммов, рост которых осуществлялся на плотной среде...

  16. Nitrogen translocation in wheat inoculated with Azospirillum and fertilized with nitrogen

    Directory of Open Access Journals (Sweden)

    RODRIGUES OSMAR

    2000-01-01

    Full Text Available The productivity and the translocation of assimilates and nitrogen (N were compared after inoculation of wheat (Triticum aestivum L., cv. BR-23 seeds with two strains of Azospirillum brasilense (strains 245 and JA 04 under field conditions. The inoculation of wheat seeds was done with a peat inoculant at sowing time. Plant material for evaluations were collected at anthesis and maturity. No differences in grain yield and in the translocation of assimilates resulting from inoculation were detected. Differences were observed in relation to N rates (0, 15, and 60 kg ha-1. N content in the grain increased significantly in the bacteria-inoculated treatments in which N was not added. This increase in N content in the grain with inoculation was probably due to higher N uptake after anthesis without any significant contribution on the grain yield. Such increment was of 8.4 kg ha-1 of N representing 66% more N than in no inoculated treatment. Regardless of the inoculation and the rate of N applied, it was observed that about 70% of the N accumulated at anthesis was translocated from vegetative parts to the grain.

  17. Plant yield and nitrogen content of a digitgrass in response to azospirillum inoculation

    Energy Technology Data Exchange (ETDEWEB)

    Schank, S.C.; Weier, K.L.; MacRae, I.C.

    1981-02-01

    Two Australian soils, a vertisol (pH 6.8, 0.299% N) and a sandy yellow podzol (pH 6.2, 0.042% N), were used with digitgrass, Digitaria sp. X46-2 (PI 421785), in a growth room experiment. Comparisons were made between plants inoculated with live and autoclaved bacterial suspensions of Australian and Brazilian isolates of Azospirillum brasilense. Seedlings were inoculated on days 10 and 35. Acetylene-reducing activity was measured five times during the experiment. Dry matter yields of the digitgrass on the podzol (low N) inoculated with liver bacteria were 23% higher than those of the controls. On the vertisol (high N), yield increases from inoculation with live bacteria were 8.5%. The higher-yielding plants had significantly lower precent nitrogen, but when total nitrogen of the tops was calculated, the inoculated plants had a higher total N than did the controls (P = 0.04). Acetylene-reducing activity was variable in the experiment, ranging from 0.5 to 11.9 mu mol of C2H2 core -1 day -1. Live bacterial treatment induced a proliferation of roots, possible earlier maturity, higher percent dry matter, and a higher total N in the tops. (Refs. 21).

  18. DEVELOPMENT AND CHARACTERISATION OF ABIOTIC STRESS TOLERANT AZOSPIRILLUM

    OpenAIRE

    Anitha Thomas* and Ramya Poshala

    2013-01-01

    Abiotic stress is one of the most important environmental constraints that limit survival and productivity of staple crops like wheat and maize particularly in arid and semi-arid regions. Plant growth promoting bacteria (Azospirillum) are beneficial bacteria present in soil and forming associations with roots of plants. This investigation deals with the isolation and characterization of Azospirillum from maize roots.  Azospirillum strain was identified by physiological, morphological and bioc...

  19. EVALUACIÓN DE CEPAS NATIVAS DEL GÉNERO Azospirillum Y SU INTERACCIÓN CON EL CULTIVO DEL ARROZ

    Directory of Open Access Journals (Sweden)

    Mabel Pazos

    2001-01-01

    Full Text Available Catorce cepas nativas pertenecientes a la especie Azospirillum brasilense se caracterizaron en cuanto a su ca- pacidad de fijar el nitrógeno atmosférico. Se estudió su efecto en el cultivo del arroz (Oryza sativa, mediante el modelo Microcosmos, realizando determinaciones de la altura de las plantas inoculadas, masa fresca de la raíz y el contenido de fenoles libres y la cuantificación de proteínas en las hojas. Se observó en todos los casos un efecto positivo por la inocula- ción con estas rizobacterias, donde se destaca la cepa R5(15 con los mayores incrementos en los indicadores estudiados.

  20. Computer simulation and experimental study of the polysaccharide-polysaccharide interaction in the bacteria Azospirillum brasilense Sp245

    Science.gov (United States)

    Arefeva, Oksana A.; Kuznetsov, Pavel E.; Tolmachev, Sergey A.; Kupadze, Machammad S.; Khlebtsov, Boris N.; Rogacheva, Svetlana M.

    2003-09-01

    We have studied the conformational properties and molecular dynamics of polysaccharides by using molecular modeling methods. Theoretical and experimental results of polysaccharide-polysaccharide interactions are described.

  1. ВЛИЯНИЕ УСЛОВИЙ КУЛЬТИВИРОВАНИЯ НА ЛИГНИН-ПЕРОКСИДАЗНУЮ АКТИВНОСТЬ ЭНДОФИТНОГО И ЭПИФИТНОГО ШТАММОВ AZOSPIRILLUM BRASILENSE

    OpenAIRE

    Петров, Сергей; Купряшина, Мария; Глинская, Елена; Никитина, Валентина

    2012-01-01

    Впервые установлена способность бактерий A. brasilense к росту на лигнинсодержащих субстратах, обнаружена лигнинолитическая активность, которая в большей степени выражена у эн-дофитного штамма. Впервые обнаружена способность бактерий A. brasilense к деградации лигнина. Впервые получен чистый препарат бактериальной внеклеточной лигнин-пероксидазы. Высказано предположение об участии данного фермента в лигниндеградирующей способности азоспирилл....

  2. Realocação de nitrogênio e de biomassa para os grãos, em trigo submetido a inoculação de Azospirillum Reallocation of nitrogen and biomass to the seeds in wheat inoculated with Azospirillum bacteria

    Directory of Open Access Journals (Sweden)

    AGOSTINHO DIRCEU DIDONET

    2000-02-01

    Full Text Available Estudou-se, em condições de campo, o efeito de inoculante turfoso em pó contendo bactérias do gênero Azospirillum no rendimento de grãos e na remobilização de N e de biomassa para os grãos de trigo (Triticum aestivum L., cultivar Embrapa 16. Usaram-se como inoculantes, a estirpe de Azospirillum brasilense 245 e o isolado 10 de Azospirillum lipoferum. Em cada tratamento de inoculação, e também sem inoculação, aplicaram-se diferentes doses de N em diferentes estádios de desenvolvimento das plantas, distribuídos em blocos ao acaso com parcelas subdivididas. Na antese e na maturação fisiológica, avaliaram-se o acúmulo de massa seca e N total nas diferentes partes da planta. Na colheita, além do rendimento de grãos, avaliaram-se também o índice de colheita para biomassa e para N, os principais componentes do rendimento e o teor de N total de grãos. Os resultados ainda preliminares evidenciaram que, mesmo não havendo efeito da inoculação no rendimento de grãos, houve um melhor alocamento de N e de biomassa para os grãos, resultando em maior massa de mil grãos e em menor quantidade de N restante na palha das plantas na maturação fisiológica. Esses efeitos resultaram de um menor número de espigas m-2, provavelmente devido à morte de afilhos, fator que determinou maior disponibilidade de N e de biomassa às espigas e grãos restantes.The effect of inoculating wheat (Triticum aestivum L. seeds, cultivar Embrapa 16, with powder peat inoculant containing Azospirillum bacteria on yield and remobilization of nitrogen and biomass was studied under field conditions. The strain of Azospirillum brasilense 245 and the isolate 10 of Azospirillum lipoferum were used as inoculants. Different rates of nitrogen were applied at varying stages of plant growth for each inoculated and non-inoculated treatment, distributed in blocks at random with split plots. The accumulation of dry matter and total nitrogen in plant parts was evaluated

  3. Influence of Azospirillum Strains on the Nodulation of Clovers by Rhizobium Strains

    OpenAIRE

    Plazinski, Jacek; Rolfe, Barry G.

    1985-01-01

    Mixed cultures of several Azospirillum and Rhizobium trifolii strains caused either an inhibition or stimulation of nodule formation on plant hosts as compared with nodulation of plants inoculated with R. trifolii alone. Azospirillum strains affected the nodulation process at a precise cell ratio (R. trifolii/Azospirillum cells) and time of inoculation. All Azospirillum strains used showed a variation in their ability to inhibit or enhance nodulation by R. trifolii strains. When nonviable cel...

  4. Desempenho agronômico a campo de híbridos de milho inoculados com Azospirillum

    Directory of Open Access Journals (Sweden)

    Patricia Dörr de Quadros

    2014-04-01

    Full Text Available O uso de inoculantes na cultura do milho tem sido cada vez mais valorizado, em vista dos benefícios que pode trazer à cultura, como a fixação biológica do nitrogênio e o aumento da quantidade de raízes. Isto pode melhorar a absorção de água e nutrientes pela planta, contribuindo para o desenvolvimento do milho, principalmente em períodos de seca. Este estudo foi desenvolvido com o objetivo de avaliar, em condições de campo, as características agronômicas e o rendimento de grãos de híbridos de milho, inoculados, ou não, com uma mistura de três espécies de Azospirillum (A. brasilense, A. lipoferum, A. oryzae. Foram avaliados o teor relativo de clorofila nas folhas, a altura de planta, a senescência foliar, os componentes de rendimento de grãos, o teor de N, a matéria seca da parte aérea das plantas e o número mais provável de bactérias diazotróficas na rizosfera das plantas. A inoculação manteve o teor de clorofila significativamente maior até o estádio R3 das plantas, para os três híbridos testados, aumentou o rendimento da matéria seca da parte aérea, dos híbridos AS 1575 e SHS 5050, o peso de 1000 grãos, para o híbrido P32R48 e altura, para o AS 1575. Houve interação entre os genótipos de milho e as bactérias inoculadas, visto que, cada híbrido testado respondeu de forma diferente à inoculação. A inoculação de Azospirillum em milho demonstrou estimular o desenvolvimento das plantas no período vegetativo, aumentando a probabilidade de obter-se um estande de plantas uniforme, maior resistência ao estresse e maior concentração de clorofila nas folhas.

  5. [Ligninolytic Activity of Bacteria of the Genera Azospirillum and Niveispirillum].

    Science.gov (United States)

    Kupryashina, M A; Petrov, S V; Ponomareva, E G; Nikitina, V E

    2015-01-01

    Capacity of associative soil bacteria of the genera Azospirillum and Niveispirillum for degradation of lignin model compounds was demonstrated. Lignin and Mn-peroxidases were detected in the culture liquid of the type strains of these genera. The data on involvement of nonspecific bacterial peroxidases in lignin degradation were obtained. PMID:26964358

  6. Plant Cell Wall Carbohydrates as Substrates for Azospirillum brasiliense†

    OpenAIRE

    Myers, Mary L.; Hubbell, David H.

    1987-01-01

    Carbohydrate components (simple sugars and polysaccharides) of cell walls of pearl millet (Pennisetum americanum L., cv. Gahi) were studied as potential substrates for the root-associated diazotroph Azospirillum brasiliense Sp. 7. Simple sugars were utilized, but no evidence was obtained to support the suggestion that the polysaccharide components tested might serve as substrates for growth following hydrolysis by the associated azospirilla.

  7. Interaction of Azospirillum and Rhizobium Strains Leading to Inhibition of Nodulation

    OpenAIRE

    Plazinski, Jacek; Rolfe, Barry G.

    1985-01-01

    Rhizobium-Azospirillum interactions during establishment of Rhizobium-clover symbiosis were studied. When mixed cultures of Azospirillum and Rhizobium trifolii strains were simultaneously inoculated onto clover plants, no nodulation by R. trifolii was observed. R. trifolii ANU1030, which nodulated clover plants without attacking root hairs, i.e., does not cause root hair curling (Hac−), did not show inhibition of nodulation when inoculated together with Azospirillum strains. Isolation of bact...

  8. Plasmid visualization and nif gene location in nitrogen-fixing Azospirillum strains.

    OpenAIRE

    Plazinski, J; Dart, P. J.; Rolfe, B G

    1983-01-01

    A modified gel electrophoresis technique provided a reproducible way of detecting and isolating plasmids with molecular weights ranging from 12 X 10(6) to 370 X 10(6) for Azospirillum species. Analysis with the nifHD region of Rhizobium trifolii showed that the Azospirillum nif genes were chromosomally located in all eight strains investigated and not on endogenous plasmids.

  9. Phenotypic and molecular characterization of native Azospirillum strains from rice fields to improve crop productivity.

    Science.gov (United States)

    Sahoo, Ranjan K; Ansari, Mohammad W; Pradhan, Madhusmita; Dangar, Tushar K; Mohanty, Santanu; Tuteja, Narendra

    2014-07-01

    Beneficial microorganisms have been considered as an important tool for crop improvement. Native isolates of Azospirillum spp. were obtained from the rhizospheres of different rice fields. Phenotypic, biochemical and molecular characterizations of these isolates led to the identification of six efficient strain of Azospirillum. PCR amplification of the nif genes (nifH, nifD and nifK) and protein profile of Azospirillum strains revealed inter-generic and inter-specific diversity among the strains. In vitro nitrogen fixation performance and the plant growth promotion activities, viz. siderophore, HCN, salicylic acid, IAA, GA, zeatin, ABA, NH3, phosphorus metabolism, ACC deaminase and iron tolerance were found to vary among the Azospirillum strains. The effect of Azospirillum formulations on growth of rice var. Khandagiri under field condition was evaluated, which revealed that the native formulation of Azospirillum of CRRI field (As6) was most effective to elevate endogenous nutrient content, and improved growth and better yield are the result. The 16S rRNA sequence revealed novelty of native Azospirillum lipoferum (As6) (JQ796078) in the NCBI database. PMID:24414168

  10. Screening on Gibberellic Acid Producing Activity of Azospirillum Isolates

    International Nuclear Information System (INIS)

    Six strains of Azopirillum spp were isolated from rice, sugarcane, corn, maize, sunflower and pepper roots and screened the gibberellic acid productivity. Only three strains of Azospirillum species showed the activity and were indentified by cultural, biochemical and drug sensitivity patterns. Among them,one strain isolated from rice root can produce microbial gibberellic acid. It showed greenish yellow colour in chromatogram under UV absorption. This screening method was studied from 1 to 14 days incubation. Qualitative measurement of GA productivity was determined by thin layer chromatography.

  11. Purification and properties of the nitrogenase of Azospirillum amazonense.

    OpenAIRE

    Song, S D; Hartmann, A; Burris, R H

    1985-01-01

    The nitrogenase of the free-living, microaerobic, N2-fixing bacterium Azospirillum amazonense (strain Y1) was purified by chromatography on DEAE-52 cellulose, by heat treatment, and by preparative polyacrylamide gel electrophoresis. The specific nitrogenase activities were 2,400 nmol of C2H4 formed per min per mg of protein for dinitrogenase (MoFe protein) and 1,800 nmol of C2H4 formed per min per mg of protein for dinitrogenase reductase (Fe protein). The MoFe protein was composed of a minim...

  12. 15N2 incorporation and acetylene reduction by azospirillum isolated from rice roots and soils

    International Nuclear Information System (INIS)

    Nitrogen fixation by strains of Azospirillum isolated from several rice soils and rice cultivars was investigated by 15N2 incorporation and C2H2 reduction. C2H2 reducing ability markedly varied among the strains obtained from soils differing widely in their physico-chemical properties. Large variations in 15N2 incorporation by Azospirillum isolated from the roots of several rice cultivars were also noticed. The present study reveals that rice cultivars harbour Azospirillum with differential N2-fixing ability and that plant genotype is of importance for optimal associations. (orig.)

  13. Azospirillum genomes reveal transition of bacteria from aquatic to terrestrial environments.

    Directory of Open Access Journals (Sweden)

    Florence Wisniewski-Dyé

    2011-12-01

    Full Text Available Fossil records indicate that life appeared in marine environments ∼3.5 billion years ago (Gyr and transitioned to terrestrial ecosystems nearly 2.5 Gyr. Sequence analysis suggests that "hydrobacteria" and "terrabacteria" might have diverged as early as 3 Gyr. Bacteria of the genus Azospirillum are associated with roots of terrestrial plants; however, virtually all their close relatives are aquatic. We obtained genome sequences of two Azospirillum species and analyzed their gene origins. While most Azospirillum house-keeping genes have orthologs in its close aquatic relatives, this lineage has obtained nearly half of its genome from terrestrial organisms. The majority of genes encoding functions critical for association with plants are among horizontally transferred genes. Our results show that transition of some aquatic bacteria to terrestrial habitats occurred much later than the suggested initial divergence of hydro- and terrabacterial clades. The birth of the genus Azospirillum approximately coincided with the emergence of vascular plants on land.

  14. Azospirillum genomes reveal transition of bacteria from aquatic to terrestrial environments.

    OpenAIRE

    Florence Wisniewski-Dyé; Kirill Borziak; Gurusahai Khalsa-Moyers; Gladys Alexandre; Sukharnikov, Leonid O.; Kristin Wuichet; Gregory B Hurst; W Hayes McDonald; Robertson, Jon S.; Valérie Barbe; Alexandra Calteau; Zoé Rouy; Sophie Mangenot; Claire Prigent-Combaret; Philippe Normand

    2011-01-01

    International audience Fossil records indicate that life appeared in marine environments ∼3.5 billion years ago (Gyr) and transitioned to terrestrial ecosystems nearly 2.5 Gyr. Sequence analysis suggests that "hydrobacteria" and "terrabacteria" might have diverged as early as 3 Gyr. Bacteria of the genus Azospirillum are associated with roots of terrestrial plants; however, virtually all their close relatives are aquatic. We obtained genome sequences of two Azospirillum species and analyze...

  15. Azospirillum Genomes Reveal Transition of Bacteria from Aquatic to Terrestrial Environments

    OpenAIRE

    Wisniewski-Dye, Florence; Borziak, Kirill; Khalsa-Moyers, Gurusahai; Alexandre, Gladys; O.Sukharnikov, Leonid; Wuichet, Kristin; B. Hurst, Gregory; Hayes Mcdonald, W.; S. Robertson, Jon; Barbe, Valerie; Calteau, Alexandra; Rouy, Zoe; Mangenot, Sophie; Prigent-Combaret, Claire; Normand, Philippe

    2011-01-01

    Fossil records indicate that life appeared in marine environments ∼3.5 billion years ago (Gyr) and transitioned to terrestrial ecosystems nearly 2.5 Gyr. Sequence analysis suggests that "hydrobacteria" and "terrabacteria" might have diverged as early as 3 Gyr. Bacteria of the genus Azospirillum are associated with roots of terrestrial plants; however, virtually all their close relatives are aquatic. We obtained genome sequences of two Azospirillum species and analyzed their gene origins. Whil...

  16. The Plant Growth-Promoting Bacteria Azospirillum amazonense: Genomic Versatility and Phytohormone Pathway

    OpenAIRE

    Ricardo Cecagno; Tiago Ebert Fritsch; Irene Silveira Schrank

    2015-01-01

    The rhizosphere bacterium Azospirillum amazonense associates with plant roots to promote plant growth. Variation in replicon numbers and rearrangements is common among Azospirillum strains, and characterization of these naturally occurring differences can improve our understanding of genome evolution. We performed an in silico comparative genomic analysis to understand the genomic plasticity of A. amazonense. The number of A. amazonense-specific coding sequences was similar when compared with...

  17. Population dynamics and identification of efficient strains of Azospirillum in maize ecosystems of Bihar (India)

    OpenAIRE

    Verma, Rinkee; Chourasia, S. K.; Jha, M. N.

    2011-01-01

    Information on inoculum load and diversity of native microbial community is an important prerequisite for crop management of microbial origin. Azospirillum has a proven role in benefiting the maize (Zea mays) crop in terms of nutrient (nitrogen) supply as well as plant growth enhancement. Bihar state has highest average national maize productivity although fertilizer consumption is minimum, indicating richness of Azospirillum both in terms of population and diversity in soils. An experiment w...

  18. Use of combined inoculum of Azospirillum and Rhizobium in winged bean Psophocarpus tetragonolobus (L) D.C

    OpenAIRE

    Iruthayathas, EE.; Vlassak, K.

    1985-01-01

    The potential of using the free living N -fixing Azospirillum in increasing the nodulation and N2-fixation by Rhizobium in winged bean was analysed. Various strains of winged bean Rhizobium and several strains of Azospirillum were tested in combined inoculations. Substantial increases in nodulation, N2-fixation, shoot dry matter production and N gain due to the mixed inoculation were obtained in one Rhizobium strain namely KUL-BH and most of the Azospirillum strains used. The influence of Rhi...

  19. Results in the application of biofertilizers using Azospirillum and Mycorrhiza, in associations of horticultural crops under semi-greenhouse conditions

    OpenAIRE

    Dania Bárbara Núñez Sosa; Ramón Liriano González; Jorge Luis Álvarez; Yilian Walker Bauza; Yannerys Candelario Angulo

    2013-01-01

    The current research was carried out in the greenhouse “La Condesa”, which belongs to the Empresa de Cultivos Varios “Lenin”, in Jovellanos, Matanzas province. Its main objective was to evaluate the effect of the application of biofertilizer (Azospirillum sp and Micorrizas) in combinations of crops (lettuce and radish, or beet and radish). The research included four different treatments: witness, Micorrizas, Azospirillum, Azospirillum +Micorrizas. We used an at random block design. Data were ...

  20. Inoculation with Azospirillum, associated with nitrogen fertilization in maize

    Directory of Open Access Journals (Sweden)

    Maria do Carmo Lana

    2012-06-01

    Full Text Available The biological nitrogen fixation is an alternative to supply the nitrogen needed for maize. The objective of this study was to evaluate the development and yield of maize in response to inoculation with Azospirillum associated with nitrogen fertilization. We conducted two field experiments in the summer harvest, the first in the 2000/2001 crop year in the region of Marechal Cândido Rondon, under conventional tillage, and second in the 2002/2003 agricultural year in the region of Cascavel, under no tillage. The experimental design in both experiments was a randomized complete block, with four replications, 2x2x2 factorial, with two levels of nitrogen at sowing (zero and 20 kg ha-1, two levels of inoculum (zero and 200 g ha-1 and two levels of nitrogen in topdressing (zero and 100 kg ha-1. There was evaluated the height of ear insertion, total plant height, leaf N content, shoot dry biomass and grain yield. The height of ear insertion and total plant height were not influenced by the factors under study. Nitrogen fertilization at sowing increased the leaf N content, causing the opposite effect when combined with inoculation. Inoculation with Azospirillum in the absence of nitrogen, provide productivity increases of 15.4% and 7.4% for 2000/2001 and 2002/2003 crops, respectively. The inoculation provided productivity similar to that obtained with 100 kg ha-1 in topdressing in crop 2000/2001, while in association with the topdressing, reduced productivity and shoot dry biomass in crop 2002/2003.

  1. Pengaruh pupuk kandang dan NPK terhadap populasi bakteri Azotobacter dan Azospirillum dalam tanah pada budidaya cabai (Capsicum annum)

    OpenAIRE

    MUJIYATI; SUPRIYADI

    2009-01-01

    Mujiyati, Supriyadi. 2009. Pengaruh pupuk kandang dan NPK terhadap populasibakteri Azotobacter dan Azospirillum dalam tanah pada budidaya cabai (Capsicumannum). Bioteknologi 6: 63-69. Tujuan penelitian ini adalah mengetahui peningkatan populasi bakteri Azotobacter dan Azospirillum akibat pemberian pupuk kandang. Percobaan menggunakan rancangan acak kelompok dengan perlakuan: (i) tanpa pupuk sebagai kontrol, (ii) dengan pupuk kandang, (iii) dengan pupuk NPK. Data dikumpulkan se...

  2. Plant root transcriptome profiling reveals a strain-dependent response during Azospirillum-rice cooperation

    Directory of Open Access Journals (Sweden)

    Benoît eDrogue

    2014-11-01

    Full Text Available Cooperation involving Plant Growth-Promoting Rhizobacteria results in improvements of plant growth and health. While pathogenic and symbiotic interactions are known to induce transcriptional changes for genes related to plant defence and development, little is known about the impact of phytostimulating rhizobacteria on plant gene expression. This study aims at identifying genes significantly regulated in rice roots upon Azospirillum inoculation, considering possible favored interaction between a strain and its original host cultivar. Genome-wide analyses of Oryza sativa japonica cultivars Cigalon and Nipponbare were performed, by using microarrays, seven days post inoculation with A. lipoferum 4B (isolated from Cigalon or Azospirillum sp. B510 (isolated from Nipponbare and compared to the respective non-inoculated condition. A total of 7,384 genes were significantly regulated, which represent about 16 % of total rice genes. A set of 34 genes is regulated by both Azospirillum strains in both cultivars, including a gene orthologous to PR10 of Brachypodium, and these could represent plant markers of Azospirillum-rice interactions. The results highlight a strain-dependent response of rice, with 83 % of the differentially expressed genes being classified as combination-specific. Whatever the combination, most of the differentially expressed genes are involved in primary metabolism, transport, regulation of transcription and protein fate. When considering genes involved in response to stress and plant defence, it appears that strain B510, a strain displaying endophytic properties, leads to the repression of a wider set of genes than strain 4B. Individual genotypic variations could be the most important driving force of rice roots gene expression upon Azospirillum inoculation. Strain-dependent transcriptional changes observed for genes related to auxin and ethylene signalling highlight the complexity of hormone signalling networks in the Azospirillum

  3. POTENCIALIDADES DE Azospirillum COMO INOCULANTE PARA LA AGRICULTURA

    Directory of Open Access Journals (Sweden)

    Yanet Parra

    2002-01-01

    Full Text Available La utilización de bacterias rizosféricas con la finalidad de aumentar el rendimiento de los cultivos, disminuir el uso desmedido de fertilizantes minerales y productos químicos y, por consiguiente, reducir la contaminación ambiental, es una práctica que ha tomado un gran auge en las últimas décadas. Dentro de las bacterias asociativas más estudiadas, se encuentran las pertenecientes al género Azospirillum, el cual se ha convertido en el grupo más promisorio de diazótrofos asociados con gramíneas y otras plantas no leguminosas. En el siguiente trabajo se resumen los resultados y consideraciones más actuales de diversos autores al respecto, demostrándose que esta bacteria es capaz de incrementar el rendimiento de cultivos agrícolas importantes en diferentes suelos y regiones climáticas, usando diferentes cepas y especies de plantas y que aunque complejo, este sistema tiene un potencial para la explotación agrícola.

  4. Results in the application of biofertilizers using Azospirillum and Mycorrhiza, in associations of horticultural crops under semi-greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Dania Bárbara Núñez Sosa

    2013-01-01

    Full Text Available The current research was carried out in the greenhouse “La Condesa”, which belongs to the Empresa de Cultivos Varios “Lenin”, in Jovellanos, Matanzas province. Its main objective was to evaluate the effect of the application of biofertilizer (Azospirillum sp and Micorrizas in combinations of crops (lettuce and radish, or beet and radish. The research included four different treatments: witness, Micorrizas, Azospirillum, Azospirillum +Micorrizas. We used an at random block design. Data were processed after evaluating yields components by using the statistical software called Statgraphics, version 5.0. The research showed a positive response to the application of biofertilizers, resulting in a considerable increase of profits.

  5. /sup 15/N/sub 2/ incorporation and acetylene reduction by azospirillum isolated from rice roots and soils

    Energy Technology Data Exchange (ETDEWEB)

    Nayak, D.N.; Charyulu, P.B.B.; Rajaramamohan Rao, V. (Central Rice Research Inst., Cuttack (India). Dept. of Soil Microbiology)

    1981-01-01

    Nitrogen fixation by strains of Azospirillum isolated from several rice soils and rice cultivars was investigated by /sup 15/N/sub 2/ incorporation and C/sub 2/H/sub 2/ reduction. C/sub 2/H/sub 2/ reducing ability markedly varied among the strains obtained from soils differing widely in their physico-chemical properties. Large variations in /sup 15/N/sub 2/ incorporation by Azospirillum isolated from the roots of several rice cultivars were also noticed. The present study reveals that rice cultivars harbour Azospirillum with differential N/sub 2/-fixing ability and that plant genotype is of importance for optimal associations.

  6. KARAKTERISASI SIFAT-SIFAT BIOKIMIA EKSTRAK KASAR LIPASE EKSTRASELULER BAKTERI Azospirillum sp.PRD1

    OpenAIRE

    Santi Nur Handayani; Puji Lestari; Oedjijono; Tri Joko Raharjo; Sabirin Matsjeh

    2011-01-01

    Enzim lipase mempunyai peranan penting dalam katalis berbagai reaksi industri satu diantaranya pembuatan flavor melalui reaksi esterifikasi. Lipase adalah biokatalis yang berperan besar dalam aplikasi bioteknologi, seperti dalam sintesis biopolimer, biodiesel, produksi obat, dan produksi flavor. Peningkatan penggunaan lipase untuk industri mendorong dilakukan penelitian untuk mendapatkan sumber-sumber lipase baru. Sumber lipase yang potensial salah satunya adalah bakteri Azospirillum sp.PRD1 ...

  7. Comparative Study of Substrates and Inhibitors of Azospirillum lipoferum and Pyricularia oryzae Laccases

    OpenAIRE

    Faure, D.; Bouillant, M.; Bally, R

    1995-01-01

    Azospirillum lipoferum and Pyricularia oryzae laccases were compared, using several substrates and inhibitors. Sixteen phenolic or nonphenolic compounds were found to be substrates of both fungal and bacterial laccases. In the presence of different phenol oxidase inhibitors, P. oryzae and A. lipoferum laccase activities had similar properties.

  8. Effect of Endosulfan on Azospirillum lipoferum Growth, Morphology, Nitrogenase Activity, and Protein Binding

    OpenAIRE

    Buff, Klaus; Mano, Denise M. S.; Langenbach, Tomaz

    1992-01-01

    The organochlorine Thiodan CE inhibited growth and nitrogenase activity of Azospirillum lipoferum. The active ingredient, Endosulfan, was nonspecifically bound to proteins and mainly adsorbed to the cell envelope with small amounts transported into cytosol. The involvement of the external membrane and cyst formation in protection against hazardous substances is discussed.

  9. Azospirillum agricola sp. nov., a nitrogen-fixing species isolated from cultivated soil.

    Science.gov (United States)

    Lin, Shih-Yao; Liu, You-Cheng; Hameed, Asif; Hsu, Yi-Han; Huang, Hsin-I; Lai, Wei-An; Young, Chiu-Chung

    2016-03-01

    A polyphasic approach was used to characterize a novel nitrogen-fixing bacterial strain, designated CC-HIH038T, isolated from cultivated soil in Taiwan. Cells of strain CC-HIH038T were Gram-stain-negative, facultatively aerobic and spiral-shaped, with motility provided by a single polar flagellum. The 16S rRNA gene sequence analysis of strain CC-HIH038T showed highest sequence similarity to Azospirillum doebereinerae (98.0 %), Azospirillum thiophilum (97.5 %), Azospirillum rugosum (97.4 %) and Azospirillum zeae (97.2 %) and lower sequence similarity ( Azospirillum. According to DNA-DNA association, the relatedness values of strain CC-HIH038T with A. doebereinerae, A. thiophilum, A. rugosum and A. zeae were 51.8 %, 41.2 %, 56.5 % and 37.5 %, respectively. Strain CC-HIH038T was able to grow at 20-37 °C and pH 7.0-8.0. Strain CC-HIH038T gave positive amplification for dinitrogen reductase (nifH gene); the activity was recorded as 8.4 nmol ethylene h- 1. The predominant quinone system was ubiquinone Q-10 and the DNA G+C content was 68.8 mol%. The major fatty acids found in strain CC-HIH038T were C16 : 0, iso-C18 : 0, C16 : 0 3-OH, C14 : 0 3-OH/iso-C16 : 1 and C18 : 1ω7c/C18 : 1ω6c. Based on the distinct phylogenetic, phenotypic and chemotaxonomic traits together with results of comparative 16S rRNA gene sequence analysis, strain CC-HIH038T is considered to represent a novel species in the genus Azospirillum, for which the name Azospirillum agricola sp. nov. is proposed. The type strain is CC-HIH038T ( = BCRC 80909T = JCM 30827T). PMID:26786719

  10. First Azospirillum genome from aquatic environments: Whole-genome sequence of Azospirillum thiophilum BV-S(T), a novel diazotroph harboring a capacity of sulfur-chemolithotrophy from a sulfide spring.

    Science.gov (United States)

    Kwak, Yunyoung; Shin, Jae-Ho

    2016-02-01

    Azospirillum thiophilum BV-S(T), isolated from a sulfide spring, is a novel nitrogen-fixing bacterium harboring sulfur-lithotrophy. In order to identify genetic characteristics with habitat- and metabolic features contrasting to those from terrestrial Azospirillum species, we present here the genome sequence of a novel species A. thiophilum BV-S(T), with a significance of first genome report in the aquatic Azospirillum species. The genome of strain BV-S(T) is comprised of 7.6Mb chromosome with a GC content of 68.2%. This information will contribute to expand understandings of sulfur-oxidizer microbes that preserve inherencies as a diazotroph, and further it will provide insights into genome plasticity of the genus Azospirillum for niche specific adaptations. PMID:26545806

  11. Gluconic acid production and phosphate solubilization by the plant growth-promoting bacterium Azospirillum spp.

    Science.gov (United States)

    Rodriguez, Hilda; Gonzalez, Tania; Goire, Isabel; Bashan, Yoav

    2004-11-01

    In vitro gluconic acid formation and phosphate solubilization from sparingly soluble phosphorus sources by two strains of the plant growth-promoting bacteria A. brasilense (Cd and 8-I) and one strain of A. lipoferum JA4 were studied. Strains of A. brasilense were capable of producing gluconic acid when grown in sparingly soluble calcium phosphate medium when their usual fructose carbon source is amended with glucose. At the same time, there is a reduction in pH of the medium and release of soluble phosphate. To a greater extent, gluconic acid production and pH reduction were observed for A. lipoferum JA4. For the three strains, clearing halos were detected on solid medium plates with calcium phosphate. This is the first report of in vitro gluconic acid production and direct phosphate solubilization by A. brasilense and the first report of P solubilization by A. lipoferum. This adds to the very broad spectrum of plant growth-promoting abilities of this genus.

  12. Plant root transcriptome profiling reveals a strain-dependent response during Azospirillum-rice cooperation

    OpenAIRE

    Drogue, Benoît; Sanguin, Hervé; Chamam, Amel; Mozar, Michael; Llauro, Christel; Panaud, Olivier; Prigent-Combaret, Claire; Picault, Nathalie; Wisniewski-Dyé, Florence

    2014-01-01

    Cooperation involving Plant Growth-Promoting Rhizobacteria results in improvements of plant growth and health. While pathogenic and symbiotic interactions are known to induce transcriptional changes for genes related to plant defense and development, little is known about the impact of phytostimulating rhizobacteria on plant gene expression. This study aims at identifying genes significantly regulated in rice roots upon Azospirillum inoculation, considering possible favored interaction betwee...

  13. Improving nutrient uptake in wheat through cultivar specific interaction with Azospirillum

    OpenAIRE

    Hoagland, Dr. Lori; Murphy, Dr. Kevin; Carpenter-Boggs, Dr. Lynne; Jones, Dr. Steve

    2008-01-01

    Obtaining sufficient plant available nitrogen in organic dryland wheat cropping systems is difficult. This study was conducted to determine whether inoculation with Azospirillum could improve nitrogen uptake and increase crop yield, and whether there are differences among wheat cultivars in the ability to benefit from inoculation of these diazotrophic bacteria. Seed from twenty historic and modern wheat cultivars were either left untreated, or treated with a commercial inoculant of Azospiri...

  14. SIFAT-SIFAT BIOKIMIAWI EKSTRAK KASAR LIPASE EKSTRASELULER DARI BAKTERI Azospirillum sp. JG3

    OpenAIRE

    Puji Lestari; Santi Nur Handayani; Oedjijono

    2009-01-01

    Lipases are valuable biocatalysts because they act under extremely mild conditions, are stable in organic solvents, show broad substrate specificity and exhibit high stereoselectivity. Lipases play important role in various industries such as detergent, cosmetics, flavor, pharmacy and synthesis of organic compounds. The increasing of lipases requirements in industries is goading research to get new lipases resources commited. One of potential lipase resource is Azospirillum sp.JG3 bacteria fr...

  15. The plant growth-promoting bacteria Azospirillum amazonense: genomic versatility and phytohormone pathway.

    Science.gov (United States)

    Cecagno, Ricardo; Fritsch, Tiago Ebert; Schrank, Irene Silveira

    2015-01-01

    The rhizosphere bacterium Azospirillum amazonense associates with plant roots to promote plant growth. Variation in replicon numbers and rearrangements is common among Azospirillum strains, and characterization of these naturally occurring differences can improve our understanding of genome evolution. We performed an in silico comparative genomic analysis to understand the genomic plasticity of A. amazonense. The number of A. amazonense-specific coding sequences was similar when compared with the six closely related bacteria regarding belonging or not to the Azospirillum genus. Our results suggest that the versatile gene repertoire found in A. amazonense genome could have been acquired from distantly related bacteria from horizontal transfer. Furthermore, the identification of coding sequence related to phytohormone production, such as flavin-monooxygenase and aldehyde oxidase, is likely to represent the tryptophan-dependent TAM pathway for auxin production in this bacterium. Moreover, the presence of the coding sequence for nitrilase indicates the presence of the alternative route that uses IAN as an intermediate for auxin synthesis, but it remains to be established whether the IAN pathway is the Trp-independent route. Future investigations are necessary to support the hypothesis that its genomic structure has evolved to meet the requirement for adaptation to the rhizosphere and interaction with host plants. PMID:25866821

  16. Genome wide profiling of Azospirillum lipoferum 4B gene expression during interaction with rice roots.

    Science.gov (United States)

    Drogue, Benoît; Sanguin, Hervé; Borland, Stéphanie; Prigent-Combaret, Claire; Wisniewski-Dyé, Florence

    2014-02-01

    Azospirillum-plant cooperation has been mainly studied from an agronomic point of view leading to a wide description of mechanisms implicated in plant growth-promoting effects. However, little is known about genetic determinants implicated in bacterial adaptation to the host plant during the transition from free-living to root-associated lifestyles. This study aims at characterizing global gene expression of Azospirillum lipoferum 4B following a 7-day-old interaction with two cultivars of Oryza sativa L. japonica (cv. Cigalon from which it was originally isolated, and cv. Nipponbare). The analysis was done on a whole genome expression array with RNA samples obtained from planktonic cells, sessile cells, and root-adhering cells. Root-associated Azospirillum cells grow in an active sessile-like state and gene expression is tightly adjusted to the host plant. Adaptation to rice seems to involve genes related to reactive oxygen species (ROS) detoxification and multidrug efflux, as well as complex regulatory networks. As revealed by the induction of genes encoding transposases, interaction with root may drive bacterial genome rearrangements. Several genes related to ABC transporters and ROS detoxification display cultivar-specific expression profiles, suggesting host specific adaptation and raising the question of A. lipoferum 4B/rice cv. Cigalon co-adaptation. PMID:24283406

  17. Relative efficiency of Azotobacter and Azospirillum on yield and P utilization by wheat (Triticum Aestivum) with various N levels

    International Nuclear Information System (INIS)

    Efficiency of 32P labelled single superphosphate along with N levels (0, 60, 80 and 120 kg/ha) and biofertilizers (Azotobacter and Azospirillum) was studied on wheat in Typic ustifluvent (saline phase) soil. Average grain and straw yield, total P uptake, per cent P derived by crop from applied phosphorus and its utilization in grain and straw increased either with Azospirillum or Azotobacter inoculation. However, the magnitude of increase in these attributes was of higher extent in presence of Azotobacter as compared to Azospirillum. The yield, uptake and utilization of P increased with increasing levels of N. Per cent Pdff was higher with all levels of N over control, whereas, it was at par with their successive levels. Interaction effect between levels of nitrogen and biofertilizers were also positive and significant at all levels of N with respect to yield and uptake of P, while per cent Pdff and its utilization by wheat was more pronounced at 60 and 80 kg N ha-1 in the presence of Azotobacter. Azospirillum was more effective at 60 kg of N than the other levels. Generally, Azotobacter performed better than the Azospirillum with respect to all parameters. (author)

  18. Proline and Abscisic Acid Content in Droughted Corn Plant Inoculated with Azospirillum sp. and Arbuscular Mycorrhizae Fungi

    Directory of Open Access Journals (Sweden)

    NOVRI YOULA KANDOWANGKO

    2009-03-01

    Full Text Available Plants that undergo drought stress perform a physiological response such as accumulation of proline in the leaves and increased content abscisic acid. A research was conducted to study proline and abscisic acid (ABA content on drought-stressed corn plant with Azospirillum sp. and arbuscular mycorrhizae fungi (AMF inoculated at inceptisol soil from Bogor, West Java. The experiments were carried out in a green house from June up to September 2003, using a factorial randomized block design. In pot experiments, two factors were assigned, i.e. inoculation with Azospirillum (0, 0.50, 1.00, 1.50 ml/pot and inoculation with AMF Glomus manihotis (0, 12.50, 25.00, 37.50 g/pot. The plants were observed during tasseling up to seed filling periods. Results of experiments showed that the interaction between Azospirillum sp. and AMF was synergistically increased proline, however it decreased ABA.

  19. Inoculación del trigo var. Pavón con Azospirillum spp. y Azotobacter beijerinckii

    OpenAIRE

    M.M. Garc\\u00EDa-Gonz\\u00E1lez; R. Far\\u00EDas-Rodr\\u00EDguez; J.J. Pe\\u00F1a-Cabriales; J.M. S\\u00E1nchez-Y\\u00E1\\u00F1ez

    2005-01-01

    La respuesta positiva del trigo (Triticum aestivum L.) a la inoculación con bacterias benéficas de raíz (BBR), como: Azospirillum y Azotobacter, se basa en que estas BBR transforman los exudados radicales (ER) del trigo en sustancias promotoras del crecimiento vegetal (SPCV). Los objetivos de este trabajo fueron: I) analizar la dinámica de colonización de Azospirillum spp. y Azotobacter beijerinckii en las raíces del trigo, y 2) determinar la respuesta del trigo a la inoculación con Azospiril...

  20. Improvement of endophytic Azospirillum colonization by co-inoculation with Cellulomonas Uda ATCC 491

    Directory of Open Access Journals (Sweden)

    Mohammad Javad Mehdipour Moghaddam

    2014-04-01

    Full Text Available Introduction: Most of the plant growth promoting rhizobacteria (PGPR such as Azopirillum if accompanied with strong cellulase producing bacteria such as Cellulomonas, their colonization may be increased and their host plants growth improved. Materials and methods: Six endophytic Azospirilla which isolated from three rice and three wheat cultivars and also one strain from commercial biofertilizer (Green Biotech Co., identified by biochemical tests and 16S rDNA analysis and were studied on the basis of cellulase, pectinase and auxin production and also their chemotaxis toward rice and wheat cultivars exudates was investigated. Two cellulase positive (A5 and A6 and two negative (A2 and A3 strains were selected and their interaction with C. uda ATCC 491 on auxin production and colonization on roots were compared. Results: This study showed that none of the strains had pectinase activity, but the strain isolated from rice had more Carboxy methyl cellulase (CMCase activity. Selected isolates and C. uda ATCC 491 showed chemotaxis toward roots exudates. In most of the isolates, rate of auxin production increased by coculture with C. uda ATCC 491. Also, it was determined that C. uda ATCC 491 promoted the colonization of Azospirillum without or with cellulase activity on rice and wheat roots, respectively. Discussion and conclusion: Co-inoculation Azospirillum with C. uda ATCC 491 improves plant root system due to stimulation or additive effect of auxin production and cellulase activity, followed by more uptakes of water and minerals by roots. Also, it raises the number of colonization niches for useful bacteria such as Azospirillum and finally quantitative and qualitative plant parameters.

  1. Penggunaan Azospirillum pada Tanah Masam dengan Aluminium Tinggi Terhadap Produksi dan Serapan Nitrogen Rumput Setaria splendida dan Chloris gayana

    Directory of Open Access Journals (Sweden)

    P.D.M.H. Karti

    2005-04-01

    Full Text Available High content of Al on the soil maybe harmful (toxic for plant. Red and yellow podzolic soil was marginal land that characterized by high Al content. Azospirillum is free living N fixing bacteria that can be associated with grass. This research was conducted to find the best yield of grass planted on the soil inoculated with Azospirillum. The research consisted of some steps; 1 soil sampling 2 laboratory research: bacterial isolation, isolate selection, standardized of population, content of IAA 3 pod experiment. Pod experiment in the glass house was designed in completely randomized design, that consisted of six treatments. The variables observed were dry mass production of shoot and root, nitrogen content of shoot and root, and nitrogen absorption. Four best isolates chosen were; SM Setaria, OBIS/BD, PO2 and PM2. Azospirillum isolates enhanced shoot and root production, nitrogen content and N total absorption of tolerance one (S. splendida. The susceptible (C. gayana, Azospirillum significantly enhanced shoot and root nitrogen content, but did not affect the growth, production and N total absorption. Root growth that was inhibited by Al toxicity, decreased the symbiotic capability of nitrogen fixing bacteria. PM2 isolate showed the best effect on production and quality of S. splendida as well as on C. gayana. This isolate will be used for future research. PM2 produces 6.4 ppm Indole Acetic Acid that promoted root growth.

  2. Pengaruh pupuk kandang dan NPK terhadap populasi bakteri Azotobacter dan Azospirillum dalam tanah pada budidaya cabai (Capsicum annum

    Directory of Open Access Journals (Sweden)

    MUJIYATI

    2009-11-01

    Full Text Available Mujiyati, Supriyadi. 2009. Pengaruh pupuk kandang dan NPK terhadap populasibakteri Azotobacter dan Azospirillum dalam tanah pada budidaya cabai (Capsicumannum. Bioteknologi 6: 63-69. Tujuan penelitian ini adalah mengetahui peningkatan populasi bakteri Azotobacter dan Azospirillum akibat pemberian pupuk kandang. Percobaan menggunakan rancangan acak kelompok dengan perlakuan: (i tanpa pupuk sebagai kontrol, (ii dengan pupuk kandang, (iii dengan pupuk NPK. Data dikumpulkan secara eksperimen dengan menanam cabai pada beberapa petak percobaan dengan perlakuan penggunaan pupuk sebanyak tiga kali ulangan. Data yang dikumpulkan terdiri atas jumlah populasi Azotobacter dan Azospirillum, kandungan nitrogen dalam tanah dan hasil cabai. Percobaan lapangan dilakukan di Desa Gathak, Kecamatan Karangnongko, Kabupaten Klaten, Jawa Tengah. Data primer dari hasil penelitian di analisis dengan uji ANAVA dan dilanjutkan dengan uji BNT dengan tingkat kepercayaan 95%. Hasil penelitian menunjukkan bahwa menggunakan pupuk kandang dapat meningkatkan populasi bakteri Azotobacter (0,02% dan Azospirillum (0,46% apabila dibandingkan kontrol, sehingga dapat meningkatkan kesuburan tanah dalam waktu yang cukup lama yaitu dengan meningkatkan ketersediaan hara dalam tanah. Kandungan nitrogen total tanah setelah diberi pupuk kandang juga meningkat dan sangat bermanfaat untuk bahan penyusun tubuh tumbuhan.

  3. Characterization of native strains of Azospirillum spp. and its effect on growth of Oryza sativa L. “rice” in Lambayeque

    OpenAIRE

    Franklin García; Harold Muñoz; Carmen Carreño; Gilmar Mendoza

    2010-01-01

    This research was conducted to characterize and determine the effect of native strains of Azospirillum spp. on growth of Oryza sativa L. "rice" as an alternative for the reduction of chemical fertilizers. The bacteria were isolated from roots of rice in Lambayeque. Fragments of previously disinfected roots were planted in Nfb semisolid medium, were nitrogen-fixing bacteria were recognized by a whitish film on the surface and turn from green to blue. The genus Azospirillum was identified in Co...

  4. Growth Promotion and Enhanced Nutrient Uptake of Maize (Zea maysL.) by Application of Plant Growth Promoting Rhizobacteria in Arid Region of Iran

    OpenAIRE

    A. Biari; A. Gholami; H.A. Rahmani

    2008-01-01

    The effect of plant growth-promoting rhizobacteria (PGPR) belonging to the genera Azospirillum and Azotobacter on the growth and nutrient uptake of maize (Zea mays) was investigated in the field as factorial experiment. Azospirillum strains were: Z0 = no inoculation, Z1 = Azospirillum sp. Strain 21, Z2 = Azospirillum lipoferum DSM 1691, Z3 = Azospirillum brasilense DSM 1690 and Azotobacter strains were: A0 = no inoculation, A1 = Azotobacter sp. Strain 5, A2 = Azotobacter chroococcum ...

  5. Afinidad y efecto de Azospirillum sp. en maíz

    OpenAIRE

    José Antonio Rangel-Lucio; María de las Nieves Rodríguez-Mendoza; Ronald Ferrera-Cerrato; Javier Zaragoza Castellanos-Ramos; Rosa María Ramírez-Gama; Estéfana Alvarado-Bárcenas

    2011-01-01

    El objetivo del presente trabajo fue determinar la afi nidad y efecto de cepas de Azospirillum en maíz. Este bioensayo se desarrolló en el estado de México, México, durante el ciclo primavera - verano del 2009. Para ello se colectó la raíz de maíz Palomero Toluqueño, Cacahuacintle, Cónico, Chalqueño y H-20, y de Teocintle, y después de aislar y purifi car las cepas sobresalientes por actividad nitrogenasa (N¿asa), se re-inocularon ascépticamente en las mismas variedades en estadío de plántula...

  6. [Effect of flavonoids on the composition of surface glycopolymers in Azospirillum lipoferum Sp59b].

    Science.gov (United States)

    2014-01-01

    Cultivation of the type strain Azospirillum lipoferum Sp59b in the presence of the flavonoid quercetin induced modification of the structure of the bacterial lipopolysaccharide. Cultivation in the presence of the flavonoid was shown to result in altered serological characteristics of the bacteria, increased heterogeneity of the outer membrane lipopolysaccharide pool, as well as in modified composition and fatty acid ratio of lipid A. The flavonoid was shown to induce the synthesis of the O-specific polysaccharide with the repeating structure represented by a tetrasaccharide consisting of a linear trisaccharide fragment of α-L-Rhap residues in the main chain and the terminal β-D-Glcp residue. The structure of this O-specific polysaccharide was identical to the previously determined structure of the capsular polysaccharide of these bacteria grown without quercetin. Modifications in the structural composition of the capsular polysaccharide induced by cultivation in the presence of quercetin were revealed. PMID:25507441

  7. Efecto de la inoculación en maíz con cepas nativas de Azospirillum sp

    OpenAIRE

    L. Villa-Castro; N Mayek-Pérez; J. G. García-Olivares; J. L. Hernández-Mendoza

    2014-01-01

    En condiciones de invernadero se evaluó el efecto de tres cepas de Azospirillum sp (Patrón 9, IPN-33, IPN-35) aisladas de suelos cultivados con sorgo, en el norte de Tamaulipas; en el crecimiento de híbridos de maíz (30P49® y 30F52®). Las cepas de Azospirillum mostraron efectos diferentes en la producción de biomasa, así como también el testigo. La cepa Patrón 9 incrementó significativamente el peso seco de la planta. Dicha cepa, Patrón 9, muestra potencial para utilizarse como inoculante en ...

  8. Response of Sunflower Yield and Phytohormonal Changes to Azotobacter,Azospirillum,Pseudomonas and Animal Manure in a Chemical Free Agroecosystem

    OpenAIRE

    Maziyar, Mehran; M. Reza, Ardakani; Hamid, Madani; Mohammad , Zahedi; Mohsen, Amirabadi; Saeed, Mafakheri

    2011-01-01

    There are new trends in agriculture to move toward the low input systems with the lower application of chemical fertilizers. To reach this goal, different methods, such as the application of biofertilizers, may be used. So this experiment was conducted in 2010 at a research farm in Arak, Iran, in factorial in the form of a randomized complete block design with three replications and four factors: animal manure (M), Pseudomonas putida (P), Azotobacter chroococcum (A)and Azospirillum lipoferum ...

  9. Protein Quantity and Quality of Safflower Seed Improved by NP Fertilizer and Rhizobacteria (Azospirillum and Azotobacter spp.)

    Science.gov (United States)

    Nosheen, Asia; Bano, Asghari; Yasmin, Humaira; Keyani, Rumana; Habib, Rabia; Shah, Syed T. A.; Naz, Rabia

    2016-01-01

    HIGHLIGHTS Rhizobacteria (Azotobacter spp.) have improved the quality and quantity of safflower seed protein.Protein quality was confirmed by SDS-PAGE and new bands were found in response to different combinations of rhizobacteria and lower doses of fertilizers.The PGPR application has reduced the use of fertilizers upto 50%. Protein is an essential part of the human diet. The aim of this present study was to improve the protein quality of safflower seed by the application of plant growth promoting rhizobacteria (PGPR) in combination with conventional nitrogen and phosphate (NP) fertilizers. The seeds of two safflower cultivars Thori and Saif-32, were inoculated with Azospirillum and Azotobacter and grown under field conditions. Protein content and quality was assessed by crude protein, amino acid analysis, and SDS-PAGE. Seed crude protein and amino acids (methionine, phenylalanine, and glutamic acid) showed significant improvements (55–1250%) by Azotobacter supplemented with a quarter dose of fertilizers (BTQ) at P ≤ 0.05. Additional protein bands were induced in Thori and Saif-32 by BTQ and BTH (Azotobacter supplemented with a half dose of fertilizer) respectively. The Azospirillum in combination with half dose of fertilizer (SPH) and BTQ enhanced both indole acetic acid (IAA) (90%) and gibberellic acid (GA) (23–27%) content in safflower leaf. Taken together, these data suggest that Azospirillum and Azotobacter along with significantly reduced (up to 75%) use of NP fertilizers could improve the quality and quantity of safflower seed protein. PMID:26941744

  10. Protein quantity and quality of safflower seed improved by NP fertilizer and rhizobacteria (Azospirillum and Azotobacter spp.

    Directory of Open Access Journals (Sweden)

    Asia eNosheen

    2016-02-01

    Full Text Available Protein is an essential part of human diet. The aim of present study was to improve the protein quality of safflower seed by the application of plant growth promoting rhizobacteria (PGPR in combination with conventional nitrogen and phosphate (NP fertilizers. The seeds of two safflower cultivar Thori and Saif-32, were inoculated with Azospirillum and Azotobacter and grown under field conditions. Protein content and quality was assessed by crude protein, amino acid analysis and SDS-PAGE. Seed crude protein and amino acids (metheonine, phenylanine and glutamic acid showed significant improvement (55%–1250% by Azotobacter supplemented with quarter dose of fertilizers (BTQ at P≤0.05. Additional protein bands were induced in Thori and Saif-32 by BTQ and BTH (Azotobacter supplemented with half dose of fertilizers respectively. The Azospirillum in combination with half dose of fertilizers (SPH and BTQ enhanced the indole acetic acid (90% and gibberellic acid (23%–27% contents in safflower leaf. Taken together, these data suggest that Azospirillum and Azotobacter along with significantly reduced (up to 75% use of NP fertilizers improved the quality and quantity of safflower seed protein.

  11. Protein Quantity and Quality of Safflower Seed Improved by NP Fertilizer and Rhizobacteria (Azospirillum and Azotobacter spp.).

    Science.gov (United States)

    Nosheen, Asia; Bano, Asghari; Yasmin, Humaira; Keyani, Rumana; Habib, Rabia; Shah, Syed T A; Naz, Rabia

    2016-01-01

    HIGHLIGHTS Rhizobacteria (Azotobacter spp.) have improved the quality and quantity of safflower seed protein.Protein quality was confirmed by SDS-PAGE and new bands were found in response to different combinations of rhizobacteria and lower doses of fertilizers.The PGPR application has reduced the use of fertilizers upto 50%. Protein is an essential part of the human diet. The aim of this present study was to improve the protein quality of safflower seed by the application of plant growth promoting rhizobacteria (PGPR) in combination with conventional nitrogen and phosphate (NP) fertilizers. The seeds of two safflower cultivars Thori and Saif-32, were inoculated with Azospirillum and Azotobacter and grown under field conditions. Protein content and quality was assessed by crude protein, amino acid analysis, and SDS-PAGE. Seed crude protein and amino acids (methionine, phenylalanine, and glutamic acid) showed significant improvements (55-1250%) by Azotobacter supplemented with a quarter dose of fertilizers (BTQ) at P ≤ 0.05. Additional protein bands were induced in Thori and Saif-32 by BTQ and BTH (Azotobacter supplemented with a half dose of fertilizer) respectively. The Azospirillum in combination with half dose of fertilizer (SPH) and BTQ enhanced both indole acetic acid (IAA) (90%) and gibberellic acid (GA) (23-27%) content in safflower leaf. Taken together, these data suggest that Azospirillum and Azotobacter along with significantly reduced (up to 75%) use of NP fertilizers could improve the quality and quantity of safflower seed protein. PMID:26941744

  12. Characterization of native strains of Azospirillum spp. and its effect on growth of Oryza sativa L. “rice” in Lambayeque

    Directory of Open Access Journals (Sweden)

    Franklin García

    2010-06-01

    Full Text Available This research was conducted to characterize and determine the effect of native strains of Azospirillum spp. on growth of Oryza sativa L. "rice" as an alternative for the reduction of chemical fertilizers. The bacteria were isolated from roots of rice in Lambayeque. Fragments of previously disinfected roots were planted in Nfb semisolid medium, were nitrogen-fixing bacteria were recognized by a whitish film on the surface and turn from green to blue. The genus Azospirillum was identified in Congo red agar medium, obtained 96 isolates with production of 2.69 to 38.02 ppm indoleacetic acid and 7.95 to 29.09 ppm of fixed nitrogen. The four strains with the highest values were inoculated independently and in combination with 50 and 100 % urea in Tinajones INIA508 rice. It used a completely randomized design and including witnesses’ 50 and 100 % urea and absolute control. All native strains increased height and dry matter of shoot and roots, with effectiveness index of up to 21.77, 102.06 and 126.11 % compared to untreated control. Azospirillum sp. GM-86 selected by the highest value of indoleacetic acid, reached the highest level of effectiveness in height and root dry biomass. The application of 50 % úrea with Azospirillum spp. increased rates of effectiveness. It demonstrated the potential of native strains of Azospirillum spp. to increase the growth of rice as well as the possibility to use associate with low doses of urea.

  13. Inoculación con Azospirillum spp y Enterobacter aglomerans en Pasto Guinea (Panicum maximum Jacq. en el Departamento de Cesar (Colombia / Inoculation with Azospirillum spp and Enterobacter aglomerans in Guinea Grass (Panicum maximum Jacq. in the Cesar

    Directory of Open Access Journals (Sweden)

    Diana María Cárdenas Caro

    2014-06-01

    Full Text Available Resumen. Se evaluó el efecto de los aislados SRGM2, SRGM3 y SRGM4 de Azospirillum spp. en el crecimiento y desarrollo de plantas de pasto Guinea (Panicum maximum Jacq cv. Tanzania en la Estación Experimental Motilonia de Corpoica, del municipio Agustín Codazzi (Cesar, Colombia. Se realizó inoculación por imbibición de las semillas, y en el momento de la siembra, en las macetas en condiciones de casa malla. Se utilizó inoculación simple de los aislados de Azospirillum sp y co-inoculación con una cepa fosfato solubilizadora de Enterobacter aglomerans (UV1, aislada de suelos cultivados con algodón en el departamento de Cesar. Lasvariables estudiadas en las plantas fueron: germinación, peso foliar fresco y seco, peso radical fresco y seco, fósforo y proteína foliar. Los resultados mostraron que la inoculación simple y combinada promovió la germinación de semillas del pasto guinea (P≤0,05 con respecto al tratamiento sin inoculación (testigo absoluto; y aunque no se presentaron diferencias significativas (P≤0,05 en las demásvariables estudiadas, se encontraron aumentos de hasta 26,80% en proteína cruda, y 45,67% en materia seca foliar comparada con las plantas tratadas con 100% de fertilización nitrogenada. Se observó que el aislado de Azospirillum SRGM2 co-inoculado con Enterobacter aglomerans UV1 registró los mayores valores en el crecimiento vegetal del pasto guinea, por lo que se consideró como una rizobacteria promisoria para la biofertilización de esta gramínea utilizada en la alimentación bovina en la costa caribe colombiana. / Abstract. The effect of the isolates SRGM2, SRGM3 and SRGM of Azospirillum spp. on the growth and development of Guinea grass plants (Panicum maximum Jacq cv. Tanzania was evaluated in the Experimental Station Motilonia of Corpoica, municipality Agustin Codazzi (Cesar, Colombia. The inoculation was performed by imbibition of seeds and at planting time in pots under

  14. PEMBUATAN DEKSTRIN DARI PATI UBI KAYU MENGGUNAKAN KATALIS AMILASE HASIL FRAKSINASI DARI Azospirillum sp. JG3

    Directory of Open Access Journals (Sweden)

    Zusfahair

    2012-05-01

    Full Text Available Amilase merupakan salah satu enzim potensial dalam proses industri. Amilase dapat diperoleh dari bakteri Azopsirillum sp. JG3. Amilase ini dapat dimanfaatkan untuk hidrolisis pati ubi kayu pada pembuatan dekstrin. Dekstrin memiliki peran yang cukup penting dalam industri seperti pembuatan roti, makanan bayi dan bahan penyalut lapis tipis tablet. Penelitian ini bertujuan untuk mengetahui karakterisasi biokimiawi amilase hasil fraksinasi dari Azospirillum sp. JG3 serta potensinya dalam pembuatan dekstrin. Tahap penelitian ini dimulai dengan memproduksi enzim yang dilakukan dengan cara menumbuhkan inokulum ke dalam medium produksi selama 30 jam kemudian diekstraksi dengan sentrifugasi sehingga diperoleh ekstrak kasar. Ekstrak kasar amilase kemudian difraksinasi secara bertahap (15%, 30%, 45% dan 60% dengan menggunakan ammonium sulfat dan didialisis. Fraksi yang diperoleh diukur aktivitas, volume dan kadar proteinnya. Fraksi dengan aktivitas spesifik tertinggi dikarakterisasi dan digunakan untuk membuat dekstrin dari pati ubi kayu. Dekstrin pati ubi kayu yang diperoleh dikarakterisasi berupa rendemen, kadar air, kadar abu dan dextrose equivalen. Hasil penelitian menunjukkan bahwa fraksi hasil dialisis 45% (FHD 45% menghasilkan aktivitas dan aktivitas spesifik tertinggi berturut-turut sebesar 11,659 U/mL dan 7,319 U/mg. Aktivitas amilase optimum pada suhu 30°C, pH 7 dan konsentrasi substrat 4%. Dekstrin yang diperoleh memiliki rendemen 95,14, kadar air 3,411%, kadar abu 0,209% dan dextrose equivalen 13,4.

  15. Tools for genetic manipulation of the plant growth-promoting bacterium Azospirillum amazonense

    Directory of Open Access Journals (Sweden)

    Schrank Irene S

    2011-05-01

    Full Text Available Abstract Background Azospirillum amazonense has potential to be used as agricultural inoculant since it promotes plant growth without causing pollution, unlike industrial fertilizers. Owing to this fact, the study of this species has gained interest. However, a detailed understanding of its genetics and physiology is limited by the absence of appropriate genetic tools for the study of this species. Results Conjugation and electrotransformation methods were established utilizing vectors with broad host-replication origins (pVS1 and pBBR1. Two genes of interest - glnK and glnB, encoding PII regulatory proteins - were isolated. Furthermore, glnK-specific A. amazonense mutants were generated utilizing the pK19MOBSACB vector system. Finally, a promoter analysis protocol based on fluorescent protein expression was optimized to aid genetic regulation studies on this bacterium. Conclusion In this work, genetic tools that can support the study of A. amazonense were described. These methods could provide a better understanding of the genetic mechanisms of this species that underlie its plant growth promotion.

  16. Kandungan Nitrogen dan Bobot Biji Kentang yang Diberi Pupuk Organik Difermentasi, Azospirillum sp., dan Pupuk Nitrogen di Cisarua, Lembang, Jawa Barat

    OpenAIRE

    Nurmayulis; Maryati,

    2008-01-01

    A research was conducted to study response of potato (Solanum tuberosum L.) plant to the application of fermented organic matter (‘porasi’) (0, 7.5, 15.0, and 22.5 t ha-1), without or with inoculation of Azospirillum sp., and N fertilizer (0, 86, 172, and 258 kg ha-1 N) and also to determine optimal rate of application of ‘porasi’ and N fertilizer without or with inoculant Azospirillum sp. Field experiments were carried out in Cisarua, Lembang West Java, from June to November 2003. The...

  17. EFECTO PROMOTOR DEL CRECIMIENTO VEGETAL DE CEPAS DE Azospirillum sp. EN EL CULTIVO DEL ARROZ

    Directory of Open Access Journals (Sweden)

    Yanelis Acebo

    2007-01-01

    Full Text Available El arroz es fuente de alimento y empleo para una gran parte de la población mundial. Como parte de la estrategia de agricultura sostenible para aumentar el rendimiento y sustituir los fertilizantes químicos, son utilizados actualmente inoculantes microbianos elaborados a partir de rizobacterias. En particular, el género Azospirillum ha sido utilizado como agente promotor del crecimiento vegetal, debido a su capacidad para fijar nitrógeno atmosférico y producir auxinas del tipo ácido indolacético. Se emplearon cepas nativas aisladas y de referencia, a las que se les determinó su capacidad de producir compuestos indólicos mediante la técnica colorimétrica derivada de Salkowski y la capacidad de fijación de nitrógeno, mediante el ensayo de reducción de acetileno. Se obtuvieron resultados positivos para todas las cepas, que resultaron productoras de compuestos indólicos en un rango de 2,75-8.6 ¿g.mL-1 y con una capacidad de fijar nitrógeno de 164.17-384.9 nmol.h-1·5 mL-1. Se llevó a cabo además un bioensayo destinado a evaluar la aplicación de estas cepas, como agentes promotores del crecimiento vegetal en el cultivo del arroz (variedad J-104. Se obtuvo un incremento notable en los parámetros de crecimiento de la planta con respecto al control.

  18. Description of Niveispirillum fermenti gen. nov., sp. nov., isolated from a fermentor in Taiwan, transfer of Azospirillum irakense (1989) as Niveispirillum irakense comb. nov., and reclassification of Azospirillum amazonense (1983) as Nitrospirillum amazonense gen. nov.

    Science.gov (United States)

    Lin, Shih-Yao; Hameed, Asif; Shen, Fo-Ting; Liu, You-Cheng; Hsu, Yi-Han; Shahina, Mariyam; Lai, Wei-An; Young, Chiu-Chung

    2014-06-01

    A taxonomic study was carried out on a novel aerobic bacterial strain (designated CC-LY736(T)) isolated from a fermentor in Taiwan. Cells of strain CC-LY736(T) were Gram-stain negative, spiral-shaped and motile by means of a monopolar flagellum. Strain CC-LY736(T) shared the greatest degree of 16S rRNA gene sequence similarity to Azospirillum irakense DSM 11586(T) (97.2 %), Rhodocista centenaria JCM 21060(T) (96.3 %) and Rhodocista pekingensis JCM 11669(T) (96.1 %). The major fatty acids were C16:0, C16:1 ω5c, C19:0 cyclo ω8c, C18:1 ω7c/C18:1 ω6c, C16:0 3-OH and C18:1 2-OH. The predominant polar lipids included phosphatidylcholine, phosphatidylglycerol, diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylmethylethanolamine, phosphatidyldimethylethanolamine and two unidentified glycolipids. The common major respiratory quinone was ubiquinone Q-10 and predominant polyamines were sym-homospermidine and putrescine. The DNA G+C content of strain CC-LY736(T) was 67.6 ± 0.1 mol %. During phylogenetic analysis, strain CC-LY736(T) formed a unique phyletic lineage associated with Rhodocista species. However, the combination of genetic, chemotaxonomic and physiological data clearly indicated that strain CC-LY736(T) was a novel representative of the family Rhodospirillaceae. Based on the polyphasic comparison, the name Niveispirillum fermenti gen. nov., sp. nov. is proposed; the type strain of the type species is CC-LY736(T) (= BCRC 80504(T) = LMG 27263(T)). In addition, the reclassifications of Azospirillum irakense as Niveispirillum irakense comb. nov. (type strain KBC1(T) = ATCC 51182(T) = BCRC 15764(T) = CIP 103311(T)), and Azospirillum amazonense as Nitrospirillum amazonense gen. nov., sp. nov. (type strain Am14(T) = ATCC 35119(T) = BCRC 14279(T) = DSM 3787(T)) are proposed based on the polyphasic taxonomic data obtained in this study. PMID:24771126

  19. Survival of endophytic diazotrophic bacteria in soil under different moisture levels Sobrevivência de bactérias diazotróficas endofíticas no solo sob diferentes teores de umidade

    OpenAIRE

    André L.M. Oliveira; Erineudo L. Canuto; Edmilson E. Silva; Veronica M. Reis; José I. Baldani

    2004-01-01

    The effects of soil moisture on the survival of three diazotrophic bacteria species (Azospirillum amazonense, Gluconacetobacter diazotrophicus and Azospirillum brasilense) were tested. Soil moisture had little influence on the survival of A. brasilense, which is considered a free-living species. On the other hand, increased soil moisture extended the survival of the endophytes A. amazonense and G. diazotrophicus. These results indicate that nitrogen-fixing endophytic species are more affected...

  20. AcEST: DK961439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0010_C02 673 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_C02. 5' end seq ... D1|GLND_AZOBR [Protein-PII] uridylyltransferase OS=Azospirillum ... brasilense Align length 78 Score (bit) 55.1 E-valu ... D1|GLND_AZOBR [Protein-PII] uridylyltransferase OS=Azospirillum ... brasilense GN=glnD PE=3 SV=1 Length = 933 Score = ...

  1. AcEST: DK955630 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0023_J22 592 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_J22. 5' end seq ... TB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum ... brasilense Align length 83 Score (bit) 32.0 E-valu ... TB_AZOBR Glutamate synthase [NADPH] large chain OS=Azospirillum ... brasilense GN=gltB PE=1 SV=1 Length = 1515 Score = ...

  2. Nodulation of legumes, nitrogenase activity of roots and occurrence of nitrogen-fixing Azospirillum spp. In representative soils of central Amazonia

    Energy Technology Data Exchange (ETDEWEB)

    Sylvester-Bradley, R.; De Oliverira, L.A.; De Podesta Filho, J.A.; St. John, T.V.

    1980-12-01

    Leguminosae do not predominate in the Brazilian Amazon rain forest, although they are among the five best represented families. Plant roots from various soils were examined for the presence of nodules, acetylene-reducing activity and N/sub 2/-fixing Azospirillum spp. Abundant nodulation was found in black earth (''terra preta dos indios'') and in one case on sandy soil under campinarana vegetation along a tributary of the upper Rio Negro. In sandy latosol some nodules occurred in secondary forest and fewer in primary forest. Legumes in disturbed clayey or sandy latosol showed more frequent nodulation. Primary forest on alluvial (''varzea'') soil, and in Bahia coastal rain forest on sandy latosol and Erythrina glauca used for shading cacao plantations were abundantly nodulated. Acetylene reduction assays showed no, or very little, nitrogenase activity of roots from primary or secondary forest on clayey latosol near Manaus. Nodulated roots from secondary forest on sandy latosol showed acetylene-reducing activity. High rates of acetylene reduction were observed in nodulated roots of primary forest on alluvial ''varzea'' soil. Root samples showed ethylene absorption in controls without acetylene which might interfere with the results of acetylene reduction tests. The incidence of Azospirillum was also higher in black earth than the other soils examined, and in soils with higher pH. The hypothesis that Azospirillum is associated with Trema micantha roots was refuted. Roots and soils collected under cultivated grasses showed a higher incidence of Azospirillum when fertilized with phosphorus and lime. Results indicate that nitrogen fixation did occur in association with roots in some soils, but not with roots of primary or secondary forest on clayey latosol in the vicinity of Manaus, which is the most common soil in Central Amazonia. The possible reasons for this are discussed.

  3. Evaluación de la zeolita como soporte sólido para la formulación del biofertilizante Azospirillum

    OpenAIRE

    Dayamí Borges-Rodríguez; Ana Nelis San Juan-Rodríguez; Angela O. Díaz-LLanes; Eulalia Gómez-Santiesteban; Raúl Hernández-Sanchez

    2012-01-01

    Se realizó una caracterización física de la zeolita proveniente de los yacimientos de San Juan de la Yeras, con el objetivo de evaluar sus posibilidades para ser usada como soporte sólido en la formulación del biofertilizante Azospirillum. Se evaluaron fracciones de tres tamaños de partícula, de las que la fracción Zoac (

  4. Uso del biofertilizante Azospirillum como fuente alternativa para la fertilización nitrogenada de la caña de azúcar

    Directory of Open Access Journals (Sweden)

    Everaldo Becerra-De Armas

    2014-01-01

    Full Text Available El presente trabajo se desarrolló sobre un suelo Pardo Sialítico Típico con el objetivo de validar la efectividad del biofertilizante Azospirillum, Cepa 8 INICA, con una concentración 109 UFC/mL en áreas cañeras de producción. Se utilizaron dos métodos de aplicación: asperjado con arrope y enterrado. Se empleó la variedad C86-12, cepa R1. Los parámetros altura, diámetro, conteo de tallos y hojas activas fueron evaluados a los 3 meses de edad. Los datos de rendimiento se obtuvieron a partir del pesaje real de la caña en el momento de la cosecha. En las evaluaciones realizadas se pudo observar que existe una mayor altura, diámetro y número de hojas activas en los tratamientos donde se utilizó el método asperjado. Para la variable conteo de tallos los mejores resultados se alcanzaron al enterrar el biofertilizante. En el caso del rendimiento agrícola, los valores siempre fueron mayores en los tratamientos donde se aplicó Azospirillum respecto al testigo (NPK SERFE, con resultados satisfactorios cuando se utilizó el método enterrado, y una dosis 75 l/ha de Azospirillum + el 40% de Nitrógeno, según dosis del SERFE.

  5. fRNAdb Summary: FR199526 [

    Lifescience Database Archive (English)

    Full Text Available FR199526 AY685923,AY685924,AY685926,AY685927 transfer RNA (tRNA), TGC (Ala/A) Alanine tRNA Azospirillum ... irillum brasilense,Azospirillum ... lipoferum RF00005 Rfam v8.1 FR199526.jpg FR199526. ...

  6. fRNAdb Summary: FR076235 [

    Lifescience Database Archive (English)

    Full Text Available FR076235 AY685923,AY685924,AY685926,AY685927 transfer RNA (tRNA), GAT (Ile/I) Isoleucine tRNA Azospirillum ... ospirillum brasilense,Azospirillum ... lipoferum RF00005 Rfam v8.1 FR076235.jpg FR076235. ...

  7. Desenvolvimento vegetativo do arroz irrigado afetado pela inoculação com Azospirillum e aplicação de nitrogênio mineral

    OpenAIRE

    Bianchet, Paula; Sangoi, Luis; Souza, Clovis Arruda de; Klauberg Filho, Osmar; Panison, Fernanda

    2015-01-01

    O nitrogênio é o nutriente absorvido em maior quantidade pelo arroz. A associação com bactérias diazototróficas pode contribuir com o suprimento de N da cultura. O objetivo deste trabalho foi avaliar o efeito da inoculação de isolados de bactérias diazotróficas do gênero Azospirillum e da aplicação de doses crescentes de N mineral sobre o desenvolvimento vegetativo de cultivares de arroz irrigado cultivadas no sistema pré-germinado. O experimento foi implantado em casa de vegetação, num delin...

  8. Actividad nitrogenasa, producción de fitohormonas, sideróforos y antibiosis en cepas de Azospirillum y Klebsiella aisladas de maíz y teocintle

    OpenAIRE

    Moisés Graciano Carcaño-Montiel; Ronald Ferrera-Cerrato; Jesús Pérez-Moreno; José D. Molina-Galán; Yoav Bashan

    2006-01-01

    Las bacterias de los géneros Azospirillum y Klebsiella, conocidas como rizobacterias promotoras del crecimiento vegetal, son fijadoras de nitrógeno y productoras de sustancias reguladoras del crecimiento, por lo que ejercen un efecto benéfico en las plantas con las cuales interaccionan. Esta asociación microorganismo-planta puede mejorar el crecimiento de los cultivos a través de la combinación de fijación biológica de nitrógeno, producción de sustancias hormonales, incremento de la disponi...

  9. Detecção de Azospirillum amazonense em raízes e rizosfera de orchidaceae e de outras famílias vegetais

    OpenAIRE

    Lange, A.; F. M. S. Moreira

    2002-01-01

    Azospirillum amazonense é uma bactéria fixadora de N2 atmosférico de ampla ocorrência, principalmente em associações radiculares com gramíneas e palmeiras. Para verificar sua presença em outras espécies vegetais, ainda não estudadas, e a eficiência de meios para sua detecção, foram testados os meios Fam e LGI para contagens em solo rizosférico ou em culturas de enriquecimento com solo rizosférico, ecto e endorrizosfera. A. amazonense foi detectada no solo rizosférico, ecto e endorrizosfera de...

  10. Produtividade do milho em resposta à aplicação de nitrogênio e inoculação das sementes com Azospirillum spp Corn produntivity in response to nitrogen application and seed inoculation with Azospirillum spp

    Directory of Open Access Journals (Sweden)

    Luiz Ermindo Cavallet

    2000-04-01

    Full Text Available Em experimento de campo, nas condições de plantio direto em Latossolo Vermelho eutroférrico de fertilidade média a alta, foram testados para o milho (Zea mays, cv. G-159 S da Ciba Sementes no período de outubro/1997 a março/1998, o aumento de produtividade de grãos, o comprimento de espiga, a altura de plantas e o número de linhas de grão por espiga, por conseqüência da inoculação das sementes com o produto biotecnológico comercial denominado "Graminante", à base de Azospirillum spp. Os tratamentos consistiram em ausência e presença de inoculação de "Graminante", com e sem aplicação de nitrogênio tanto, da semeadura (70 kg ha-1 como em cobertura (70 kg ha-1 consistindo, deste modo, numa distribuição fatorial 2 x 2 x 2, em quatro repetições. A inoculação do "Graminante" aumentou significativamente a produtividade média de grãos, de 5211 para 6067 kg ha-1, ou seja, aumento de 17%, e aumentou o comprimento médio das espigas, de 13,6 para 14,4 cm; a inoculação do "Graminante" não teve efeito sobre o número de linhas de grão por espiga e altura de plantas. A aplicação de nitrogênio na semeadura e/ou em cobertura, não causou efeito sobre a produtividade do milho.An evaluation of corn productivity, cob length, plant height and number of corn lines on the cob as a result of nitrogen application and seed inoculation with Azospirillum spp. ("Graminante" was conducted from October 1997 to March 1998. The experiment was carried out on a high fertility Oxisol using Zea mays L. cv. G-1595 (Ciba under no-tillage in a 2 x 2 x 2 factorial design representing application and non-application of nitrogen at planting (70 kg ha-1, application and non-application of broadcast nitrogen (70 kg ha-1 and presence or absence of seed inoculation with four replications. Results showed that with seed inoculation the corn productivity increased by 17% (from 5211 to 6067 kg ha-1 while corn cob length increased from 13.6 to 14.4 cm. On the

  11. ИММУНОХИМИЧЕСКОЕ ИССЛЕДОВАНИЕ АНТИГЕННЫХ СВОЙСТВ ПОЧВЕННЫХ РОСТСТИМУЛИРУЮЩИХ БАКТЕРИЙ РОДА AZOSPIRILLUM

    OpenAIRE

    Филипьечева, Юлия; Беляков, Алексей; Бурыгин, Геннадий; Коннова, Светлана

    2010-01-01

    В статье представлены результаты иммунохимического анализа 63 штаммов ассоциативных ризобактерий рода Azospirillum. Показаны значительная гетерогенность О-антигенов штаммов видов A. lipoferum и A. brasilense, а также высокое сходство антигенных свойств ЛПС штаммов A. irakense. Серологически обособленным оказался штамм A. amazonense. Продемонстрирована высокая консервативность мажорных белковых антигенов данных бактерий....

  12. Identificação de isolados de Azospirillum amazonense associados a Brachiaria spp., em diferentes épocas e condições de cultivo e produção de fitormônio pela bactéria Identification of Azospirillum amazonense isolates associated to Brachiaria spp. at different stages and growth conditions, and bacterial plant hormone production

    OpenAIRE

    F. B. Reis Junior; Silva, M.F.; K. R. S. Teixeira; Urquiaga, S; V. M. Reis

    2004-01-01

    Existem evidências de que pastagens formadas por algumas espécies do gênero Brachiaria poderiam beneficiar-se com o processo de fixação biológica do nitrogênio atmosférico (FBN), garantindo a estas pastagens maior longevidade. Dentre as bactérias diazotróficas encontradas em associação com estas gramíneas forrageiras, destaca-se a espécie Azospirillum amazonense. Neste trabalho, objetivou-se verificar a influência da espécie de Brachiaria, manejo da pastagem e sazonalidade sobre as populações...

  13. TECNOLOGÍA DE PRODUCCIÓN DE INOCULANTES DE Azospirillum Y FACTIBILIDAD ECONÓMICA DE SU APLICACIÓN AGRÍCOLA EN CULTIVOS SELECCIONADOS

    Directory of Open Access Journals (Sweden)

    J. Villar

    2005-01-01

    Full Text Available El desarrollo de inoculantes bacterianos de uso agrícola puede contribuir a la disminución del empleo de fertilizantes químicos y favorecer el medio ambiente. Sin embargo, su aplicación debe resultar económica para los productores, sin detrimento de los rendimientos agrícolas tradicionales. En el presente trabajo se estiman los indicadores económicos de una planta industrial, a partir de una nueva tecnología que emplea turba y cachaza como soporte, para la obtención de dos tipos de inoculantes sólidos de Azospirillum: polvo húmedo para impregnación de semillas y polvo humedecible para aspersión en campo, y se analiza la factibilidad económica de la aplicación de estos inoculantes en los cultivos de caña de azúcar y arroz.

  14. Uso del biofertilizante Azospirillum como fuente alternativa para la fertilización nitrogenada de la caña de azúcar

    OpenAIRE

    Everaldo Becerra-De Armas; Ilia Lugo-Ruiz; Rafael Más-Martínez; Emma Pineda-Ruiz; Yudith Viñas-Quintero

    2014-01-01

    El presente trabajo se desarrolló sobre un suelo Pardo Sialítico Típico con el objetivo de validar la efectividad del biofertilizante Azospirillum, Cepa 8 INICA, con una concentración 109 UFC/mL en áreas cañeras de producción. Se utilizaron dos métodos de aplicación: asperjado con arrope y enterrado. Se empleó la variedad C86-12, cepa R1. Los parámetros altura, diámetro, conteo de tallos y hojas activas fueron evaluados a los 3 meses de edad. Los datos de rendimiento se obtuvieron a partir de...

  15. Detecção de Azospirillum amazonense em raízes e rizosfera de orchidaceae e de outras famílias vegetais

    Directory of Open Access Journals (Sweden)

    A. Lange

    2002-06-01

    Full Text Available Azospirillum amazonense é uma bactéria fixadora de N2 atmosférico de ampla ocorrência, principalmente em associações radiculares com gramíneas e palmeiras. Para verificar sua presença em outras espécies vegetais, ainda não estudadas, e a eficiência de meios para sua detecção, foram testados os meios Fam e LGI para contagens em solo rizosférico ou em culturas de enriquecimento com solo rizosférico, ecto e endorrizosfera. A. amazonense foi detectada no solo rizosférico, ecto e endorrizosfera de várias espécies de monocotiledôneas, incluindo Orchidaceae e dicotiledôneas, sendo o meio Fam mais eficiente para sua detecção

  16. Rôle du quorum-sensing et prévalence des bactériophages chez la bactérie phytostimulatrice Azospirillum

    OpenAIRE

    Boyer, Mickaël

    2008-01-01

    Le but de ce travail était d'identifier les fonctions régulées par quorum-sensing (QS) chez la bactérie phytostimulatrice Azospirillum. Les effets phytobénéfiques in vitro des souches B518 et TVV3 (isolées du riz) ne sont pas altérées par l'inactivation des molécules signal impliquées dans le QS. La combinaison d'une approche ciblée et d'une approche globale par protéomique montre que le QS régule des fonctions liées à l'adaptation à la plante, notamment à la colonisation racinaire chez B518....

  17. Response of rice to inoculation with plant growth promoting rhizobacteria in control lab environment and field experiment

    International Nuclear Information System (INIS)

    The present study was conducted to evaluate the effects of bacterial inoculation on different growth parameters of rice variety JP-5. Three bacterial strains (Azospirillum brasilense R1, Azospirillum lipoferum RSWT1 and Pseudomonas Ky1) were used to inoculate rice varietyJP-5 at control lab environment and field. Plant growth promotion was observed in all inoculated treatments over non-inoculated, which was evident from increase in root area, root length, number of tillers, straw and grain yields and total weight of plant. Azospirillum brasilense R1 was more effective in plant growth promotion than other strains and showed 19% increase in the straw weight and 39.5% increase in grain weight. Inoculation with Azospirillum lipoferum RSWT1 and Pseudomonas Ky1 increased grain weight by 18.5% and 13.8% respectively. The study revealed that beneficial strains of PGPR can be used as biofertilizer for rice. (author)

  18. Search for endophytic diazotrophs in barley seeds

    Directory of Open Access Journals (Sweden)

    Myriam S. Zawoznik

    2014-06-01

    Full Text Available Eight endophytic isolates assigned to Pseudomonas, Azospirillum, and Bacillus genera according to pheno-genotypic features were retrieved from barley seeds under selective pressure for nitrogen-fixers. Genetic relationships among related isolates were investigated through RAPD. Six isolates displayed nitrogen-fixing ability, while all could biosynthesize indolacetic acid in vitro and showed no antibiosis effects against Azospirillum brasilense Az39, a recognized PGPR.

  19. Isolation and identification by 16s rrna sequence analysis of achromobacter, azospirillum and rhodococcus strains from the rhizosphere of maize and screening for the beneficial effect on plant growth

    International Nuclear Information System (INIS)

    The aim of the present study was to isolate and characterize plant growth promoting rhizobacteria from the rhizosphere of field-grown maize. Among the five bacterial isolates obtained in the present study, the isolates M1, M7 and ZN1 showed typical Azospirillum-like cell morphology, motility and high sequence similarity of 16S rDNA to the genus Azospirillum. The isolates M25 and M28 were identified on the bases of 16S rRNA sequence analysis as Achromobacter and Rhodococcus, respectively. All the five isolates obtained in the present study produced phytohormone IAA in pure culture but phosphate-solubilization activity was detected only in pure cultures of Achromobacter strain M25 and Rhodococcus strain M28. The isolates were tested as inoculants for maize seedlings grown in sterilized sand from which cotyledons were removed at an early growth stage to deprive the seedlings of internal nutrient source and harvested after 5 weeks. For comparison, seedlings with intact cotyledons were used as control. In addition inoculated plants were grown in non-sterilized soil in earthen pots and harvested at maturity. In both the short-term inoculation experiments carried out in sterilized sand as well as in long-term inoculation experiment in earthen pots all the inoculated strains improved plant growth compared to respective non-inoculated controls. However, unlike the seedlings with intact cotyledons, the pattern regarding the efficiency of growth promotion by inoculated strains (Azospirillum strains ZN1>M7>M1>Achromobacter strain M25>Rhodococcus strain M28) was the same in plants with detached cotyledons and the plants grown to maturity in non-sterilized soil. It can be concluded from the short-term experiments under controlled conditions that removal of cotyledons helps effective screening of bacterial inocula compared to seedlings with intact cotyledons. (author)

  20. Enzymology of biological nitrogen fixation. Annual report

    Energy Technology Data Exchange (ETDEWEB)

    Burris, R.H.

    1992-05-01

    Two genes involved in the regulation of nitrogenase activity, draT and draG, were cloned and found to be contiguous on the Azospirillum brasilense chromosome. The nifH gene, encoding dinitrogenase reductase, is near to draT with an intervening gap of 1.9 kb. The organization of these genes in Azospirillum lipoferum and Rhodosprillum rubrum is similar, but nifH and draT are separated by only 400 bp in the organisms. A. brasilense draTG is very similar to draTG in R. rubrum with 91.8% similarity and 85.3% identity at the amino acid level. Apparently A. brasilense uses the normal ATG initiation codon for draT, and draG. The genes for A. brasilense were able to restore function to appropriate mutants of R. rubrum. The heterologous expression of A. brasilense draTG in R. rubrum was not fully normal, as it responded more slowly to darkness and more quickly to ammonia than wild type cells. Our mutational analysis of the draTG region of A. brasilense confirms the function of these genes in the regulation of nitrogenase activity, but it also revealed minor but demonstrable differences in the control systems of R. rubrum and A. brasilense.

  1. Enzymology of biological nitrogen fixation

    Energy Technology Data Exchange (ETDEWEB)

    Burris, R.H.

    1992-01-01

    Two genes involved in the regulation of nitrogenase activity, draT and draG, were cloned and found to be contiguous on the Azospirillum brasilense chromosome. The nifH gene, encoding dinitrogenase reductase, is near to draT with an intervening gap of 1.9 kb. The organization of these genes in Azospirillum lipoferum and Rhodosprillum rubrum is similar, but nifH and draT are separated by only 400 bp in the organisms. A. brasilense draTG is very similar to draTG in R. rubrum with 91.8% similarity and 85.3% identity at the amino acid level. Apparently A. brasilense uses the normal ATG initiation codon for draT, and draG. The genes for A. brasilense were able to restore function to appropriate mutants of R. rubrum. The heterologous expression of A. brasilense draTG in R. rubrum was not fully normal, as it responded more slowly to darkness and more quickly to ammonia than wild type cells. Our mutational analysis of the draTG region of A. brasilense confirms the function of these genes in the regulation of nitrogenase activity, but it also revealed minor but demonstrable differences in the control systems of R. rubrum and A. brasilense.

  2. Inoculación con Azospirillum spp. en la Región Semiárida-Central de Argentina: factores que afectan la colonización rizosférica Inoculation with Azospirillum spp. in the semiarid-central region of Argentina: factors involved in rhizosphere colonization

    Directory of Open Access Journals (Sweden)

    Adriana Abril

    2006-07-01

    Full Text Available La efectividad de la inoculación con Azospirillum spp. en condiciones de campo a menudo es poco consistente. La colonización de la rizosfera por las bacterias del inoculante es un prerrequisito para el éxito de la inoculación. El objetivo de este trabajo fue evaluar el grado de colonización de raíces en 11 ensayos de campo con diferentes tratamientos (localidades, cepas, cultivos, cultivares, etc. en la Región semiárida central de la Argentina. Todos los ensayos se realizaron con similar diseño experimental y metodología de análisis para permitir su comparación. El grado de colonización mostró alta variabilidad entre los casos analizados (CV 173%, rango: -18 a >100%. Sólo 11 de los 32 casos analizados presentaron diferencias significativas entre el tratamiento inoculado y el control. No se detectó un patrón definido que permita explicar la alta heterogeneidad de los resultados, sin embargo, se podría especular, que los principales factores que pueden haber afectado el grado de colonización son: el estrés hídrico y el origen de las cepas del inoculante. Bajo condiciones de estrés puede existir una fuerte competencia entre las poblaciones rizosféricas, situación en la cual, las cepas nativas tienen ventaja por su mayor adaptación al medio.The effectivity of inoculation with Azospirillum spp. often lacks consistency under field conditions. Microbial colonization of the rhizosphere is considered a prerequisite for successful inoculation. The objective of this study was to determine the degree of rhizosphere colonization in 11 field inoculation assays under different treatments (sites, crops, strains, cultivars, etc. performed in the semiarid central region of Argentina in the last 15 years, conforming a total of 32 study cases. For comparative purposes, all the assays were performed following the same experimental design and inoculation and analytic methods. Variation results relative to control treatment were clustered

  3. Transformation of the water soluble fraction from "alpeorujo" by Coriolopsis rigida: the role of laccase in the process and its impact on Azospirillum brasiliense survival.

    Science.gov (United States)

    Saparrat, Mario C N; Jurado, Miguel; Díaz, Rosario; Romera, Inmaculada Garcia; Martínez, María Jesús

    2010-01-01

    The objective of this work was to evaluate the ability of the white rot basidiomycete Coriolopsis rigida to detoxify the water soluble fraction from "alpeorujo" (WSFA), a solid by-product produced by the olive oil extraction industry and characterized by a high concentration of phenols which limits its use as fertilizer and/or amendment. C. rigida reduced the phenol content in the liquid media supplemented with WSFA at 10 and 20% (v/v) after 15d of incubation. The analysis of WSFA toxicity after fungal treatment showed that C. rigida was responsible for a significant increase in the survival rate of Azospirillum brasiliense, a N(2) fixing soil rhizobacterium which promotes plant growth. Supplementation of culture medium with CuSO(4) (300 microM) resulted in strong laccase induction thus facilitating higher phenol reduction and detoxification of WSFA. In vitro reactions using a crude extracellular preparation from laccase-active C. rigida showed phenol removal as well as detoxification of the WSFA at 20%. These results suggest that C. rigida reduces the phenol content of the WSFA through the effect of laccase on free phenolic compounds consequently decreasing the toxic effect on A. brasiliense, which suggests that the enzyme plays an important role in the process. These findings have implications in the management and revalorization of olive-mill residues treated with laccase-producing fungi and their potential impact on integrative agricultural systems including organic residues and the co-inoculation with microorganisms which can facilitate the growth of plants of agricultural interest. PMID:19875147

  4. Identification and characterization of trans-3-hydroxy-l-proline dehydratase and Δ1-pyrroline-2-carboxylate reductase involved in trans-3-hydroxy-l-proline metabolism of bacteria

    OpenAIRE

    Watanabe, Seiya; Tanimoto, Yoshiaki; Yamauchi, Seiji; Tozawa, Yuzuru; Sawayama, Shigeki; Watanabe, Yasuo

    2014-01-01

    Highlights • The bacterial metabolic pathway of trans-3-hydroxy-l-proline (T3LHyp) has been identified. • Azospirillum brasilense can grow on T3LHyp as a sole carbon source. • The T3LHyp pathway comprises T3LHyp dehydratase and Δ1-pyrroline-2-carboxylate reductase. • This pathway is similar to one found in mammals.

  5. Survival of endophytic diazotrophic bacteria in soil under different moisture levels Sobrevivência de bactérias diazotróficas endofíticas no solo sob diferentes teores de umidade

    Directory of Open Access Journals (Sweden)

    André L.M. Oliveira

    2004-12-01

    Full Text Available The effects of soil moisture on the survival of three diazotrophic bacteria species (Azospirillum amazonense, Gluconacetobacter diazotrophicus and Azospirillum brasilense were tested. Soil moisture had little influence on the survival of A. brasilense, which is considered a free-living species. On the other hand, increased soil moisture extended the survival of the endophytes A. amazonense and G. diazotrophicus. These results indicate that nitrogen-fixing endophytic species are more affected by soil moisture than associative nitrogen-fixing species.Neste trabalho foi avaliado o efeito da umidade do solo na sobrevivência de três espécies de bactérias diazotróficas (Azospirillum amazonense, Gluconacetobacter diazotrophicus e Azospirillum brasilense. O teor de umidade apresentou pouca influência na sobrevivência de A. brasilense, considerada uma espécie cosmopolita, enquanto A. amazonense e G. diazotrophicus, consideradas endofíticas, aumentaram o período de culturabilidade na presença de umidade no solo. Os resultados demonstram que o teor de umidade do solo possui maior influência nas espécies endofíticas, em comparação às espécies associativas.

  6. Dicty_cDB: VHN643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHN643 (Link to dictyBase) - - - Contig-U15036-1 VHN643P (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 198 3e-49 CP000699_3106( ...

  7. Dicty_cDB: VHQ389 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHQ389 (Link to dictyBase) - G20672 DDB0230088 Contig-U15036-1 VHQ389P (Lin ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 196 2e-48 CP000699_3106( ...

  8. Arabidopsis CDS blastp result: AK065162 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK065162 J013002C05 At5g23140.1 ATP-dependent Clp protease proteolytic subunit, putative nClpP2/ ... c subunit (EC 3.4.21.92) (Endopeptidase Clp) from [Azospirillum ... brasilense] 2e-66 ...

  9. AcEST: BP919917 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000130_F08 438 Adiantum capillus-veneris mRNA. clone: YMU001_000130_F08. BP919917 - Show ... R_AZOBR HTH-type transcriptional regulator gbpR OS=Azospirillum ... brasilense GN=gbpR PE=1 SV=1 Length = 342 Score = ...

  10. Dicty_cDB: VFO656 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFO656 (Link to dictyBase) - - - Contig-U15036-1 VFO656P (Link to Original ... oulou... 166 1e-39 AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 164 7e-39 CP000943_2544( ...

  11. Arabidopsis CDS blastp result: AK073070 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK073070 J033013H23 At3g63510.1 nitrogen regulation family protein contains Pfam domain PF01207: ... lar to (SP:P45672) NIFR3-like protein (SP:P45672) [Azospirillum ... brasilense] 1e-148 ...

  12. Dicty_cDB: VHH651 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH651 (Link to dictyBase) - - - Contig-U15036-1 VHH651P (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 179 2e-43 CP000943_2544( ...

  13. Dicty_cDB: SSK605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK605 (Link to dictyBase) - - - Contig-U15036-1 SSK605E (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 205 2e-51 CU234118_1139( ...

  14. Dicty_cDB: VHB561 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB561 (Link to dictyBase) - - - Contig-U15036-1 VHB561P (Link to Original ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 201 4e-50 CP000699_3106( ...

  15. Arabidopsis CDS blastp result: AK121934 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121934 J033107A05 At5g23140.1 ATP-dependent Clp protease proteolytic subunit, putative nClpP2/ ... c subunit (EC 3.4.21.92) (Endopeptidase Clp) from [Azospirillum ... brasilense] 2e-76 ...

  16. Dicty_cDB: VHE871 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE871 (Link to dictyBase) - - - Contig-U11753-1 | Contig-U13627-1 VHE871P ... 157592.... 33 7.5 EU864034_12( EU864034 |pid:none) Azospirillum ... brasilense histone a... 33 9.7 AF167159_1( AF16715 ...

  17. Dicty_cDB: CHS229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHS229 (Link to dictyBase) - - - Contig-U15036-1 - (Link to Original site) ... ents: (bits) Value AM050060_1( AM050060 |pid:none) Azospirillum ... brasilense partial pu... 153 5e-38 CP000943_2544( ...

  18. Sequence Classification: 896752 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|19112778|ref|NP_595986.1| protein with weak ... similarity to Azospirillum ... brasilense nifR3 protein; yeast YML080W homolog; U ...

  19. Arabidopsis CDS blastp result: AK108886 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108886 002-152-D12 At3g63510.1 nitrogen regulation family protein contains Pfam domain PF01207 ... lar to (SP:P45672) NIFR3-like protein (SP:P45672) [Azospirillum ... brasilense] 2e-87 ...

  20. PHYSIOLOGICAL QUALITY OF CORN SEEDS REINOCULATED WITH DIAZOTROPHIC BACTERIA

    Directory of Open Access Journals (Sweden)

    Ricardo Felipe Braga de Sousa

    2015-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade fisiológica de sementes de milho provenientes do cultivo associado com Azospirillum brasilense e Herbaspirillum seropedicae e reinoculadas com A. brasilense. As sementes utilizadas foram provenientes de cultivo em condições de campo, sendo os tratamentos: T1 - testemunha; T2 - 60 kg hectare-1 de N; T3 – inoculação (Azospirillum brasilense - AbV5; T4 - inoculação (Azospirillum brasilense + 60 kg hectare-1 de N; T5 - inoculação (Herbaspirillum seropedicae - SmR1 e T6 - inoculação (Herbaspirillum seropedicae + 60 kg hectare-1 de N. Foram separados dois lotes dos tratamentos, sendo um reinoculado com A. brasilense (AbV5. O delineamento foi inteiramente ao acaso com esquema fatorial (6x2, sendo seis tratamentos; com inoculação e reinoculadas. As sementes reinoculadas apresentaram maiores comprimentos, volumes e matéria seca de raízes e parte aérea, concluindo que a reinoculação com sementes promove um incremento no desenvolvimento inicial das plântulas.

  1. Identificação de isolados de Azospirillum amazonense associados a Brachiaria spp., em diferentes épocas e condições de cultivo e produção de fitormônio pela bactéria Identification of Azospirillum amazonense isolates associated to Brachiaria spp. at different stages and growth conditions, and bacterial plant hormone production

    Directory of Open Access Journals (Sweden)

    F. B. Reis Junior

    2004-02-01

    Full Text Available Existem evidências de que pastagens formadas por algumas espécies do gênero Brachiaria poderiam beneficiar-se com o processo de fixação biológica do nitrogênio atmosférico (FBN, garantindo a estas pastagens maior longevidade. Dentre as bactérias diazotróficas encontradas em associação com estas gramíneas forrageiras, destaca-se a espécie Azospirillum amazonense. Neste trabalho, objetivou-se verificar a influência da espécie de Brachiaria, manejo da pastagem e sazonalidade sobre as populações de A. amazonense associadas às raízes destas plantas. Diferentes pastagens (B. humidicola, B. decumbens e B. brizantha foram introduzidas em regiões do ecossistema Cerrado e de Mata Atlântica. Foram avaliados dois sistemas de manejo com diferentes taxas de lotação, e as coletas foram realizadas em diferentes épocas do ano. As populações de A. amazonense foram quantificadas e a identidade dos isolados confirmada, assim como sua capacidade de produção de fitormônios tipo AIA (ácido 3-indol acético em meio de cultivo. Isolados de A. amazonense foram obtidos a partir de amostras de raízes das três espécies de Brachiaria avaliadas. Estimativas das populações desta bactéria variaram de 10³-10(7 células g-1 de raízes. Em amostras do ecossistema Cerrado, a época de coleta apresentou efeito significativo sobre a população destas bactérias. Os dados da região de Mata Atlântica mostraram que plantas de Brachiaria de diferentes espécies e pastagens sob diferentes taxas de lotação podem apresentar números populacionais distintos associados às suas raízes. A técnica de análise de restrição do DNA ribossomal amplificado (ARDRA confirmou a identidade de todos os isolados avaliados. Estes isolados foram capazes de produzir fitormônios tipo AIA.There is evidence that pastures formed by some species of the genus Brachiaria could be benefited by the biological nitrogen fixation process (BNF, which would give these

  2. Caracterización de cepas del género Azospirillum aisladas de dos tipos de suelos de la localidad de San Nicolás de Bari

    OpenAIRE

    Mabel Pazos; Annia Hernández; Paneque, M.; J. L. Santander

    2000-01-01

    Un total de 40 cepas bacterianas fueron aisladas empleando el modelo Microcosmos, a partir de dos tipos de suelos de la localidad de San Nicolás de Bari, La Habana, siendo doce de estas identificadas como pertenecientes al género Azospirillum, por combinación de métodos tradicionales y serológicos de aglutinación en portaobjetos e inmunodifusión doble. Se realizó la caracterización de las cepas en cuanto a capacidad de reducción del acetileno y producción de ácido indol acético (AIA). Las doc...

  3. Isolation and identification of an endophytic bacteria Azospirillum melinis against Rhizoctonia solani%水稻纹枯病生防内生菌糖蜜草固氮螺菌的分离与鉴定

    Institute of Scientific and Technical Information of China (English)

    王兰英; 谢颖; 廖凤仙; 王琼; 骆焱平

    2012-01-01

    Twenty-seven endophytic bacterial strains isolated from Fructus amomi were tested for in vitro antagonistic activity, pot experiment and field trial against the rice sheath blight pathogen, Rhizoctonia solani. The results revealed that 4 of the 27 isolates showed good anti-fungal activity against Rhizoctonia solani, of which SRJ2-4 exhibited the best effect with an inhibition zone up to 18 mm in diameter. The control efficacy of SRJ2-4 strain in pot experiment and field trial were 80. 7% and 79. 4% respectively, significantly higher than those of other isolates. The yield of the field treated with SRJ2-4 was also found to be the highest, up to 488.79 kg · 667 m-2. According to the morphological analysis, physiological and biochemical determination and 16S rDNA sequence comparison, the strain SRJ24 was identified as Azospirillum melinis.%本文首先对砂仁内生细菌进行分离,以水稻纹枯病菌(Rhizoctonia solani)为靶标菌对获得菌株进行离体拮抗活性、盆栽及田间试验测定.结果表明:获得的27株内生细菌中有4株具有较好的离体抑菌活性,其中SRJ2-4抑菌效果最好,抑菌带达到18 mm;SRJ2-4的盆栽防效及田间防效分别为80.7%与79.4%,与其它菌株相比达极显著水平.SRJ2-4处理的亩产量为488.79kg,高于其他药剂处理.对该菌株形态、生理生化及16S rDNA序列进行分析,将该内生菌鉴定为糖蜜草固氮螺菌(Azospirillum melinis.

  4. Producción y propiedades de alginato de Sargassum sinicola (Setchell y gardner) y su aplicación en inmovilización celular

    OpenAIRE

    Yabur Pacheco, Ricardo

    2005-01-01

    Se llevó a cabo la producción de alginato de sodio del alga café S. sinicola como material para la inmovilización de la microalga Chlorella sorokiniana y co-inmovilización con la bacteria promotora de crecimiento de plantas, Azospirillum brasilense, para el tratamiento de aguas residuales. El alginato también se empleó para la formulación de microesferas de A. brasilense, para la inoculación de semillas de tomate, como promotores de crecimiento de plantas. Durante la producción se analizaron ...

  5. AcEST: DK950816 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0009_L09 635 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0009_L09. 5' end seq ... tion sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum ... brasilense Align length 54 Score (bit) 32.7 E-valu ... alue sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum ... brasi... 33 1.6 sp|Q86WI1|PKHL1_HUMAN Fibrocystin- ...

  6. AcEST: DK948521 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_I14 690 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I14. 5' end seq ... 1 5.3 sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum ... brasil... 31 6.9 sp|P0C6P5|RGNEF_RAT Rho-guanine n ... 121 >sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum ... brasilense GN=nodG PE=3 SV=2 Length = 246 Score = ...

  7. AcEST: BP919119 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000121_D11 308 Adiantum capillus-veneris mRNA. clone: YMU001_000121_D11. BP919119 - Show ... 6 sp|P28604|NODQ_AZOBR Bifunctional enzyme nodQ OS=Azospirillum ... br... 31 2.2 sp|Q6AEW2|SYL_LEIXX Leucyl-tRNA synth ... >sp|P28604|NODQ_AZOBR Bifunctional enzyme nodQ OS=Azospirillum ... brasilense GN=nodQ PE=3 SV=2 Length = 620 Score = ...

  8. Studies on phosphorus utilization as influenced by bacterial seed inoculation and phosphorus fertilization in summer mung (Vigna radiata L. Wilczek)

    International Nuclear Information System (INIS)

    A greenhouse experiment was conducted with four types of bacterial inoculation (Rhizobium alone; Rhizobium along with Azotobacter chroococcum; Rhizobium along with Azospirillum brasilense and no inoculation) and three levels of phosphorus (32P labelled SSP) application (O, 6.5 ppm and 13.0 ppm P). Inoculation with Rhizobium along with Azotobacter chroococcum was found to be better than Rhizobium alone or Rhizobium along with Azospirillum brasilense in respect of leaf, stem, root and nodule dry weight, phosphorus uptake and utilization efficiency. P application upto 6.5 ppm significantly increased leaf, stem, root and nodule dry weight and phosphorus uptake. Per cent phosphorus derived from fertilizer (per cent pdff) and fertilizer P uptake significantly increased while P utilization efficiency significantly decreased with increasing levels of P application. (author). 12 refs., 2 tables

  9. Modificacion del Valor Nutrimental de Acidos Grasos en Semilla de la Halofita Salicornia bigelovii Torr. con la Interaccion de Bacterias Promotoras del Crecimiento de Plantas (Azospirillum halopraeferens y Klebsiella pneumoniae

    Directory of Open Access Journals (Sweden)

    Edgar Omar Rueda Puente

    2005-01-01

    Full Text Available Una especie vegetal a gran escala se presenta como una alternativa para la producción de ácidos grasos esenciales en nutrición humana por lo que su composición de ácidos grasos cobra especial importancia. Salicornia bigelovii una halófita que se desarrolla en ambientes áridos y costeros como las del estado de Sonora y de la península de Baja California Sur, México, presenta ser una especie alternativa en la producción de aceites comestibles. La fijación de N2 por bacterias asociadas con raíces de Salicornia bigelovii y halófitas similares son una fuente importante de nitrógeno disponible en ecosistemas costeros. La inoculación de Klebsiella pneumoniae y Azospirillum halopraeferens fue evaluada durante el desarrollo vegetativo de Salicornia bigelovii bajo condiciones de campo en dos genotipos (genotipo silvestre y cv. SOS-10, afectando positivamente variables como peso, longitud de plantas, rendimientos de producción y características bioquímicas como proteína total, ceniza, y contenido de lípidos totales en semilla producida. Nuestros resultados sugieren que ambos genotipos de S. bigelovii, bajo las condiciones de campo empleadas, pueden ser mejorados con la aplicación de K. pneumoniae y A. halopraeferens, mostrando una utilidad potencial para productores agrícolas de zonas semiáridas costeras.

  10. CO-INOCULAÇÃO NO DESENVOLVIMENTO VEGETATIVO E NODULAÇÃO DE PLÂNTULAS DE SOJA SUBMETIDAS À CALAGEM, FERTILIZAÇÃO NITROGENADA E APLICAÇÃO DE MICRONUTRIENTES

    OpenAIRE

    LIBÓRIO, Paloma Helena da Silva; Bárbaro, Ivana Marino; NOBILE, Fábio Olivieri de

    2015-01-01

    In order to evaluate the co-inoculation of soybeans, or mixed inoculation with bacteria of the genus Bradyrhizobium and Azospirillum brasilense, at the expense of traditional inoculation with Bradyrhizobium, two experiments were installed in october 2014, in a greenhouse. The experimental design was completely randomized with eight treatments and eight replications in pots rotation system. Treatments involving different combinations as commercial fertilizer formulations, with or without inocu...

  11. Effect of plant growth-promoting bacteria on the growth and fructan production of Agave americana L.

    OpenAIRE

    De La Torre-Ruiz, Neyser; Ruiz-Valdiviezo, Víctor Manuel; Rincón-Molina, Clara Ivette; Rodríguez-Mendiola, Martha; Arias-Castro, Carlos; Gutiérrez-Miceli, Federico Antonio; Palomeque-Dominguez, Héctor; Rincón-Rosales, Reiner

    2016-01-01

    The effect of plant growth-promoting bacteria inoculation on plant growth and the sugar content in Agave americana was assessed. The bacterial strains ACO-34A, ACO-40, and ACO-140, isolated from the A. americana rhizosphere, were selected for this study to evaluate their phenotypic and genotypic characteristics. The three bacterial strains were evaluated via plant inoculation assays, and Azospirillum brasilense Cd served as a control strain. Phylogenetic analysis based on the 16S rRNA gene sh...

  12. THE SCIENTIFIC BASIS FOR THE CREATION OF NEW FORMS OF MICROBIAL BIOCHEMICALS

    OpenAIRE

    A.P. KOZHEMYAKOV; Yu.V. LAKTIONOV; T.A. POPOVA; A.G. ORLOVA; A.L. KOKORINA; Vaishlya, O. B.; E.V. AGAFONOV; S.A. GUZHVIN; A.A. CHURAKOV; M.T. YAKOVLEVA

    2015-01-01

    Herein we summarize the results of a comprehensive study aimed on the creation of liquid form of biological products for symbiotic and associative rhizobacteria. The objects of study were nodule bacteria from the rhizosphere of galegae (Rhizobium galegae), soybean (Bradyrhizobium japonicum) and associative rhizobacteria (Arthrobacter mysorens, Azospirillum brasilense, Agrobacterium radiobacter), as well as plants of soybean (Glycine max L.), barley (Hordeum L.), alfalfa (Medicago L.), etc. As...

  13. History on the biological nitrogen fixation research in graminaceous plants: special emphasis on the Brazilian experience

    OpenAIRE

    José I. Baldani; Vera L.D. Baldani

    2005-01-01

    This review covers the history on Biological Nitrogen Fixation (BNF) in Graminaceous plants grown in Brazil, and describes research progress made over the last 40 years, most of whichwas coordinated by Johanna Döbereiner. One notable accomplishment during this period was the discovery of several nitrogen-fixing bacteria such as the rhizospheric (Beijerinckia fluminensis and Azotobacter paspali), associative (Azospirillum lipoferum, A. brasilense, A. amazonense) and the endophytic (Herbaspiril...

  14. Optical methods for creating delivery systems of chemical compounds to plant roots

    Science.gov (United States)

    Kuznetsov, Pavel E.; Rogacheva, Svetlana M.; Arefeva, Oksana A.; Minin, Dmitryi V.; Tolmachev, Sergey A.; Kupadze, Machammad S.

    2004-08-01

    Spectrophotometric and fluorescence methods have been used for creation and investigation of various systems of target delivery of chemical compounds to roots of plants. The possibility of using liposomes, incrusted by polysaccharides of the external surface of nitrogen-fixing rizospheric bacteria Azospirillum brasilense SP 245, and nanoparticles incrusted by polysaccharides of wheat roots, as the named systems has been shown. The important role of polysaccharide-polysaccharide interaction in the adsorption processes of bacteria on wheat roots has been demonstrated.

  15. Use of Bio-Organic Fertilizers to Develop N Uptake Using 15N Technique

    International Nuclear Information System (INIS)

    Experimental work either in field scale or in green house conditions were conducted using 15N technique to evaluate the role of different bio fertilizers and different plant residues as organic amendments on enhancement of plant N nutrition. Nitrogen fixation by a symbiotic bacteria has been observed in greenhouse and field experiments under dry land cropping systems. Biological N2 fixation associated with crop residues (legumes or cereals) was investigated in pot experiments with wheat and chickpea cultivars. In these experiments, labelled wheat and rice straw were used as organic N sources in comparison with either 15N-labelled ammonium sulfate or ammonium nitrate as chemical nitrogen fertilizers. Rhizobium inoculation extended to be used with wheat gave the best results of N uptake and N2 fixation when combined with Azospirillum brasilense as heterotrophic diazotrophs. The nitrogen uptake by wheat plants was significantly increased by application of soybean residues and inoculation with Azospirillum brasilense. From the field trial we can conclude that soybean residue as enriched N material, and Azospirillum brasilense inoculation enhanced N yields of wheat cultivars grown in poor fertile sandy soil

  16. Microorganisms associated to tomato seedlings growing in saline culture act as osmoprotectant

    Directory of Open Access Journals (Sweden)

    Daniel Cortés-Jiménez

    2014-06-01

    Full Text Available Less than 0.5% of total water in the world is available for human consumption and agriculture. The major part of the world's water is saline and salinity in soils interferes in germination of seeds and the posterior development of the plant. In order to increase the osmotolerance of tomato, seedlings were associated with Azospirillum brasilense Cd, Azospirillum brasilense Cd transformed bacteria with a plasmid harboring a trehalose biosynthesis gene-fusion or Chlorella vulgaris. Two plant culture media: Hydroponic and Murashige and Skoog were tested. In the first set of studies seedlings were associated to single free cells meanwhile in a second set single and combined free cells were studied. A positive interaction between transformed Azospirillum and Chlorella vulagris and tomato plants was observed. Seedlings showed a salt concentration tolerance, as sodium chloride, up to 200 mM. According to our results, the association of plants with A. brasilense Cd-BIF and C. vulgaris is a viable approach to increase their salt tolerance and biomass, as consequence the possible use of sea water to irrigate horticultural plants.

  17. PRODUTIVIDADE DA SOJA EM RESPOSTA Á INOCULAÇÃO PADRÃO E COINOCULAÇÃO

    Directory of Open Access Journals (Sweden)

    Ivana Marino Bárbaro

    2009-06-01

    Full Text Available The objectives of this research were to evaluate the response to a standard inoculation with Bradyrhizobium, as well as the co-inoculation with Azospirillum brasilense and Bradyrhizobium in soybean sown area already established with the culture. The rehearsal was installed in Colina-SP, in november of 2007, with the use of the soybean cultivar MG BR 46 (Conquista. The treatments were: 1 - control without N and without inoculation of Bradyrhizobium, 2-control with 200 kg N / ha split, 3-inoculation with Bradyrhizobium, 4-coinoculation with Bradyrhizobium and Azospirillum brasilense peat and 5 - co-inoculation with Bradyrhizobium and Azospirillum brasilense liquid. The experimental design was randomized blocks, with four replications. The experimental plots were constituted by six rows of four meters of length, with spacing of 0,50 m. In V6, were evaluated the nodulation, root dry mass and shoot dry mass. The crop was accomplished manually, in the useful area of the plot, being dear the yield of grains in kg/ha, after obtaining of the mass of grains for portion, being determined the text of water, calculated in 13% of humid base. Besides, the mass of the thousand seeds/plot was evaluated, in grams. In general, it was found that inoculation as well as the coinoculation did not cause an increase in most parameters assessed and soybean yield when grown in area already established with the culture, in Colina-SP.

  18. LA BIOFERTILIZACIÓN CON RIZOBACTERIAS Y HONGOS MICORRÍZICOS ARBUSCULARES EN LA PRODUCCIÓN DE POSTURAS DE TOMATE (Lycopersicon esculentum Mill. Y CEBOLLA (Allium cepa L.. I. CRECIMIENTO VEGETATIVO

    Directory of Open Access Journals (Sweden)

    L. E. Pulido

    2003-01-01

    Full Text Available En áreas experimentales de la Universidad de Ciego de Ávila, sobre un suelo Ferralítico Rojo compactado eútrico y durante dos campañas hortícolas sucesivas, se estudió el efecto de la inoculación, simple y combinada, mediante recubrimiento de las semillas y prescindiendo de la fertilización mineral, con cuatro y cinco especies, respectivamente, de rizobacterias promotoras del crecimiento vegetal -RPCV- (Azospirillum brasilense, Azotobacter chroococcum, Burkholderia cepacia y Pseudomonas fluorescens y de hongos micorrízicos arbusculares -HMA- (Glomus clarum, G. fasciculatum, G. mosseae, G. agregatum y G. versiculiferum, sobre algunos indicadores del crecimiento de posturas de tomate y cebolla, tomando como criterio de evaluación la altura y la longitud radical de las plántulas. Los resultados mostraron que, para el tomate, la inoculación con Azospirillum brasilense, Azotobacter chroococcum y Burkholderia cepacia permitió obtener posturas de calidad equivalente a la alcanzada con la fertilización mineral, mientras que para la cebolla, solo Azospirillum brasilense y Azotobacter chroococcum lograron que las posturas tuvieran dicha calidad. En relación con la inoculación con HMA, las especies Glomus clarum, G. fasciculatum y G. mosseae, para ambos cultivos, produjeron posturas con valores de altura y longitud radical considerados óptimos. Con las coinoculaciones de RPCV + HMA se lograron posturas de calidad superior a la alcanzada con las mejores variantes de inoculación simple, destacándose las combinaciones de G. clarum y G. fasciculatum con A. brasilense para el tomate y de G. clarum y G. fasciculatum con A. chroococcum para la cebolla.

  19. Isolation and identification by 16S rRNA sequence analysis of plant growth-promoting azospirilla from the rhizosphere of wheat.

    Science.gov (United States)

    Ayyaz, Khadija; Zaheer, Ahmad; Rasul, Ghulam; Mirza, Muhammad Sajjad

    2016-01-01

    The main objective of the present study was to isolate phytohormone-producing, phosphate-solubilizing strains of Azospirillum from wheat to be used as inoculants for plant growth promotion. Five Azospirillum strains were isolated from the rhizosphere of field-grown wheat (Triticum aestivum L.), and it was confirmed by BOX-polymerase chain reaction (PCR) that the isolates were different and not re-isolates of the same strain. Sequence analysis of the PCR-amplified 16S rRNA gene indicated that four isolates showed maximum similarity to Azospirillum brasilense and one isolate showed maximum similarity to Azospirillum zeae. This is the first report indicating the presence of an A. zeae like isolate in the wheat rhizosphere in Pakistan. The bacterial isolates were characterized for their plant growth-promoting traits, phosphate solubilization, and indole-3-acetic acid (IAA) production. None of the isolates showed phosphate solubilization activity in the commonly used Pikovskaya medium. However, all strains (except AzoK4) exhibited ability to solubilize tricalcium phosphate (TCP) in modified Pikovskaya medium in which sucrose was replaced by Na-malate, as well as in TCP-supplemented Luria-Bertani (LB) medium. Organic acids, such as acetic, citric, lactic, malic, and succinic acids, were detected in culture supernatants of the tested Azospirillum strains. All strains exhibited ability to produce IAA in the growth medium, except Azospirillum sp. AzoK1. Among the strains tested, the maximum IAA production (30.49±1.04mgL(-1)) and phosphate solubilization (105.50±4.93mgL(-1)) were shown by a pure culture of Azospirillum sp. AzoK2. In pot experiments, single-strain inocula of Azospirillum sp. AzoK1 and AzoK2 improved wheat plant growth. PMID:27133558

  20. Effect of arsenic on tolerance mechanisms of two plant growth-promoting bacteria used as biological inoculants.

    Science.gov (United States)

    Armendariz, Ana L; Talano, Melina A; Wevar Oller, Ana L; Medina, María I; Agostini, Elizabeth

    2015-07-01

    Bacterial ability to colonize the rhizosphere of plants in arsenic (As) contaminated soils is highly important for symbiotic and free-living plant growth-promoting rhizobacteria (PGPR) used as inoculants, since they can contribute to enhance plant As tolerance and limit metalloid uptake by plants. The aim of this work was to study the effect of As on growth, exopolysaccharide (EPS) production, biofilm formation and motility of two strains used as soybean inoculants, Bradyrhizobium japonicum E109 and Azospirillum brasilense Az39. The metabolism of arsenate (As(V)) and arsenite (As(III)) and their removal and/or possible accumulation were also evaluated. The behavior of both bacteria under As treatment was compared and discussed in relation to their potential for colonizing plant rhizosphere with high content of the metalloid. B. japonicum E109 growth was reduced with As(III) concentration from 10 μM while A. brasilense Az39 showed a reduction of growth with As(III) from 500 μM. EPS and biofilm production increased significantly under 25 μM As(III) for both strains. Moreover, this was more notorious for Azospirillum under 500 μM As(III), where motility was seriously affected. Both bacterial strains showed a similar ability to reduce As(V). However, Azospirillum was able to oxidize more As(III) (around 53%) than Bradyrhizobium (17%). In addition, both strains accumulated As in cell biomass. The behavior of Azospirillum under As treatments suggests that this strain would be able to colonize efficiently As contaminated soils. In this way, inoculation with A. brasilense Az39 would positively contribute to promoting growth of different plant species under As treatment. PMID:26141894

  1. EFECTO DE LA BIOFERTILIZACIÓN SOBRE EL CRECIMIENTO EN MACETA DE PLANTAS DE CAÑA DE AZÚCAR (Saccharum officinarum EFEITO DA BIOFERTILIZAÇÃO NO CRESCIMENTO DE PLANTAS EM VASOS açúcar de cana (Saccharum officinarum EFFECT OF BIOFERTILIZATION ON THE GROWTH OF POTTED SUGARCANE PLANTS (Saccharum officinarum

    Directory of Open Access Journals (Sweden)

    LILIANA SERNA-COCK

    2011-12-01

    Full Text Available El uso de microorganismos como fertilizante, ha demostrado tener efectos benéficos sobre el crecimiento de plantas y son una alternativa al uso de fertilizantes guímicos, sin embargo, cada microorganismo difiere en sus efectos benéficos. En este trabajo se evaluó el efecto de la aplicación de microorganismos fertilizantes, Azospirillum brasilense, Azotobacter chroccocum y Trichoderma lignorum sobre el crecimiento en maceta de plantas de caña de azúcar variedad CC 934418. El crecimiento de las plantas se midió en términos de diámetro del tallo, longitud de tallo y raíces, y número de hojas y raíces a los 15, 30 y 45 días de la siembra. El crecimiento de las plantas mostró diferencias estadísticamente significativas entre los tratamientos. Los microorganismos fertilizantes mostraron efecto positivo sobre el crecimiento de plantas de caña de azúcar, siendo Azospirillum brasilense y Trichoderma lignorum los microorganismos gue ejercieron mayor efecto sobre el diámetro del tallo y los sistemas radical y foliar de la planta. Se observaron los efectos beneficiosos de Trichoderma lignorum sobre el crecimiento de la hoja. Este es un nuevo aporte científico, ya que esta especie no ha sido reportada como promotora de crecimiento vegetal.0 uso de microrganismos como fertilizante, tem sido demonstrado gue têm efeitos benéficos no crescimento das plantas e são considerados uma alternativa ao uso de fertilizantes guímicos, no entanto, cada microrganismo possui diferentes efeitos benéficos. Neste estudo foi avaliado o efeito da aplicação de microorganismos fertilizantes, Azospirillum brasilense, Azotobacter chroccocum e Trichoderma lignorum no crescimento de cana-de-açucar da variedade CC 934418 plantadas em vasos. 0 crescimento das plantas foi medido em termos do diâmetro do caule, comprimento de caule e da raiz e número de folhas e raízes nos dias 15, 30 e 45 após a semeadura. 0 crescimento da planta mostrou diferen

  2. Efecto de la biofertilización y los biorreguladores en la germinación y el crecimiento de Carica papaya L.

    Directory of Open Access Journals (Sweden)

    Maricela Constantino

    2011-01-01

    Full Text Available Título en inglés: Effect of biofertilization and bioregulators on germination and growth of Carica papaya L. Resumen Con el objetivo de incrementar y acelerar el proceso de germinación de las semillas y obtener una alta producción y homogeneidad de plántulas de Carica papaya variedad Maradol en vivero, se evaluó el efecto de tres biofertilizantes aplicados solos o en combinación (Azotobacter chroococcum, Azospirillum brasilense y Glomus intraradices, y un biorregulador del crecimiento vegetal, el ácido giberélico (AG3, en la germinación y el crecimiento vegetal. Se realizó un experimento bajo un diseño completamente al azar con ocho tratamientos y tres repeticiones. A las semillas se les aplicó un pretratamiento germinativo con alternancia de temperatura para superar la dormancia. Los tratamientos simples con A. chroococcum y A. brasilense, incrementaron el porcentaje de germinación a 90,28 y 88,89% respectivamente. Además, con la aplicación de los biofertilizantes y el AG3, la velocidad de germinación se incrementó y el tiempo medio de germinación se redujo. La doble aplicación en semillas y foliar de los biofertilizantes y el AG3 en plántulas mejoró el crecimiento vegetal. La población de A. chroococcum fue mayor cuando se inoculó en combinación con G. intraradices. La prevalencia de colonización de las plántulas inoculadas con G. intraradices varió de 18,53 a 26,67%, con el mayor valor registrado para el tratamiento combinado con A. brasilense. Finalmente, aplicando esta metodología se logró acelerar la germinación, obteniéndose una mayor homogeneidad en la emergencia de las plántulas, disminuyendo así el tiempo de permanencia en el vivero. Palabras clave: Azospirillum brasilense; Azotobacter chroococcum; Glomus intraradices; ácido giberélico; dormancia. Abstract In order to increase and accelerate the process of seed germination and obtain a high yield and homogeneity of papaya seedlings cv. Maradol in

  3. LAS MICORRIZAS ARBUSCULARES Y LAS BACTERIAS RIZOSFÉRICAS COMO ALTERNATIVA A LA NUTRICIÓN MINERAL DEL TOMATE

    Directory of Open Access Journals (Sweden)

    María I. Hernández

    2004-01-01

    Full Text Available El presente estudio se desarrolló en el Instituto de Investigaciones Hortícolas "Liliana Dimitrova" durante los años 1996-2000 con la variedad de tomate HC 38-80 sembrada en período tardío. En la fase de semillero se realizó un screening, con el objetivo de seleccionar las cepas de micorrizas arbusculares y rizobacterias más eficientes para el cultivo del tomate, así como las mejores combinaciones. Para ello se determinaron la altura de la planta, el diámetro del tallo, la longitud radical y la masa seca total. Posteriormente, se evaluó el efecto de los biofertilizantes seleccionados y la fertilización mineral en el rendimiento del cultivo, sus componentes y el estado nutricional de la planta. El mejor comportamiento en la fase de semillero se obtuvo con la inoculación de las cepas Glomus mosseae, Glomus fasciculatum, Azospirillum brasilense, Azotobacter chroococcum, Glomus mosseae + Pseudomonas fluorescens y Glomus mosseae + Azospirillum brasilense. En la fase de campo se observó que el rendimiento y sus componentes se beneficiaron con la aplicación de niveles óptimos de fertilizantes, mientras que para los tratamientos inoculados los mayores valores correspondieron a Glomus mosseae, Glomus mosseae + Pseudomonas flourescens y Glomus mosseae + Azospirillum brasilense combinadas con el 50 % de la fertilización nitrogenada. Los HFMA y su coinoculación con bacterias rizosféricas influyeron de manera positiva en la absorción de nitrógeno y fósforo.

  4. AcEST: DK961024 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ia with plantlets Developmental stage gametophytes with sporophytes...36 Definition Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0008_P24. 5' end sequence. Accession DK961024 Tissue type prothall...04F76|Y987_OENOB Putative metalloprotease OEOE_0987 OS=Oenoc... 30 8.0 sp|P0C6P5|RGNEF_RAT Rho-guanine nucleotide excha... A ++ Q Sbjct: 61 DVSDFESCKAMVAKIEADLGPVDILVNNAGITRDKFFAKMDKAQ 104 >sp|Q04F76|Y987_OENOB Putative metalloprote...p|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense Align length 44 Score (bit) 30.8 E-value

  5. Estudio de algunos géneros bacterianos asociados a la rizosfera de los cultivos de gerbera (Gerbera jamesonii) y clavel (Dianthus barbatus, Dianthus caryophyllus)

    OpenAIRE

    Annia Hernández; Damarys García; María R. Soroa; Hernández, Ana N.

    2000-01-01

    En este trabajo se realizó la caracterización de algunos géneros bacterianos presentes en la rizosfera de los cultivos de gerbera (Gerbera jamesonii) y clavel (Dianthus barbatus y Dianthus caryophyllus), en un suelo Ferralítico Rojo compactado de San José de las Lajas. También se estudió la quimioatracción de los exudados radicales de estos cultivos hacia diferentes rizobacterias (Pseudomonas (Burkholderia) cepacia, P. fluorescens y Azospirillum brasilense). En ambos casos se utilizó el Model...

  6. Increased root exudation of 14C-compounds by sorghum seedlings inoculated with nitrogen-fixing bacteria

    International Nuclear Information System (INIS)

    Organic components leaked from Sorghum bicolor seedlings ('root exudates') were examined by recovering 14C labelled compounds from root solutions of seedlings inoculated with Azospirillum brasilense, Azotobacter vinelandii or Klebsiella pneumoniae nif-. Up to 3.5% of the total 14C recovered from shoots, roots, and nutrient solutions was found in the root solutions. Inoculation with Azospirillum and Azotobacter increased the amounts of 14C and decreased the amounts of carbohydrates in the root solutions. When sucrose was added as a carbon source for the bacteria, the increase of 14C in the solutions did not occur. Quantities of 14C found in the root solutions were proportional to amounts of mineral nitrogen supplied to the plants. Bacterial growth also was proportional to nitrogen levels. When sorghum plants were grown in soil and labelled with 14CO2, about 15% of the total 14C recovered within 48 hours exposure was found in soil leachates. (orig.)

  7. [Immunochemical Detection of Azospirilla in Soil with Genus-Specific Antibodies].

    Science.gov (United States)

    Shirokov, A A; Krasov, A I; Selivanov, N Yu; Burygin, G L; Shchegolev, S Yu; Matora, L Yu

    2015-01-01

    Immunoelectrophoresis and immunodiffusion analysis with antibodies to whole intact cells of the type strain of nitrogen-fixing soil bacteria Azospirillum brasilense Sp7 revealed at least three conservative surface immunogenic proteins of azospirilla. Cross-reactions with these proteins made it possible to use the above antibodies for detection of azospirilla as a genus-specific probe conjugated with horseradish peroxidase as an enzymatic label. Direct immune-enzyme analysis of soil suspensions (typical chernozem, Saratov oblast) confirmed applicability of the conjugates based on genus-specific antibodies to the surface proteins of azospirilla for direct detection of this bacterial genus in environmental samples. These results provide a basis for broad application of this method for analysis of Azospirillum occurrence in soil. PMID:26263631

  8. Molecular responses in root-associative rhizospheric bacteria to variations in plant exudates

    Science.gov (United States)

    Abdoun, Hamid; McMillan, Mary; Pereg, Lily

    2015-04-01

    Plant exudates are a major factor in the interface of plant-soil-microbe interactions and it is well documented that the microbial community structure in the rhizosphere is largely influenced by the particular exudates excreted by various plants. Azospirillum brasilense is a plant growth promoting rhizobacterium that is known to interact with a large number of plants, including important food crops. The regulatory gene flcA has an important role in this interaction as it controls morphological differentiation of the bacterium that is essential for attachment to root surfaces. Being a response regulatory gene, flcA mediates the response of the bacterial cell to signals from the surrounding rhizosphere. This makes this regulatory gene a good candidate for analysis of the response of bacteria to rhizospheric alterations, in this case, variations in root exudates. We will report on our studies on the response of Azospirillum, an ecologically, scientifically and agriculturally important bacterial genus, to variations in the rhizosphere.

  9. Bioinoculants: A sustainable approach to maximize the yield of Ethiopian mustard (Brassica carinata L.) under low input of chemical fertilizers.

    Science.gov (United States)

    Nosheen, Asia; Bano, Asghari; Ullah, Faizan

    2016-02-01

    This study aimed to find out the effect of plant growth-promoting rhizobacteria (PGPR; Azospirillum brasilense and Azotobacter vinelandii) either alone or in combination with different doses of nitrogen and phosphate fertilizers on growth, seed yield, and oil quality of Brassica carinata (L.) cv. Peela Raya. PGPR were applied as seed inoculation at 10(6) cells/mL(-1) so that the number of bacterial cells per seed was 2.6 × 10(5) cells/seed. The chemical fertilizers, namely, urea and diammonium phosphate (DAP) were applied in different doses (full dose (urea 160 kg ha(-1) + DAP 180 kg ha(-1)), half dose (urea 80 kg ha(-1) + DAP 90 kg ha(-1)), and quarter dose (urea 40 kg ha(-1) + DAP 45 kg ha(-1)). The chemical fertilizers at full and half dose significantly increased the chlorophyll, carotenoids, and protein content of leaves and the seed yield (in kilogram per hectare) but had no effect on the oil content of seed. The erucic acid (C22:1) content present in the seed was increased. Azospirillum performed better than Azotobacter and its effect was at par with full dose of chemical fertilizers (CFF) for pigments and protein content of leaves when inoculated in the presence of half dose of chemical fertilizers (SPH). The seed yield and seed size were greater. Supplementing Azospirillum with SPH assisted Azospirillum to augment the growth and yield, reduced the erucic acid (C22:1) and glucosinolates contents, and increased the unsaturation in seed oil. It is inferred that A. brasilense could be applied as an efficient bioinoculant for enhancing the growth, seed yield, and oil quality of Ethiopian mustard at low fertilizer costs and sustainable ways. PMID:24097367

  10. ВЛИЯНИЕ ПОЧВЕННОГО САПРОФИТНОГО ГРИБА CHAETOMIUM COCHLIODES НА АССОЦИАТИВНУЮ СИСТЕМУ « TRITICUM AESTIVUM – AZOSPIRILLUM BRASILENSE»

    OpenAIRE

    Копылов, Е.; Жиденко, А.

    2009-01-01

    В условиях лабораторных и вегетационных опытов показана способность почвенного сумчатого гриба C. cochliodes 3250 способствовать проникновению азотфиксирующих бактерий рода Azospirillum во внутренние ткани корней. При этом формируется эндофитная ассоциация: яровая пшеница – диазотрофы рода Azospirillum – почвенный сапрофитный гриб C. cochliodes 3250, что позволяет активизировать азотфиксацию в корневой зоне яровой пшеницы и биосинтетические процессы в растениях: повысить глутаминсинтетазную а...

  11. Aeração e adição de sais na produção de ácido indol acético por bactérias diazotróficas Aeration and salt effects on indol acetic production by diazotrophic bacteria

    Directory of Open Access Journals (Sweden)

    Tharwat El-Sayed El-Desouk Radwan

    2005-10-01

    Full Text Available Foi analisada a produção de compostos indólicos por Azospirillum brasilense Cd, A. lipoferum Br 17, Herbaspirillum seropedicae Z 67, H. rubrisubalbicans M4 e a estirpe 34 isolada de arroz, que não se enquadra em nenhuma das espécies de Herbaspirillum já descritas, em relação a diferentes condições de aeração e concentrações de sais. A maior aeração do meio propiciou aumento na produção de compostos indólicos pelas bactérias testadas. Foi verificado aumento desses compostos, em culturas estáticas, em meio sem nitrogênio no caso de Azospirillum, e na presença de N para as estirpes de Herbaspirillum. O aumento da concentração de sais no meio de cultivo inibiu a produção de compostos indólicos, embora tenha sido observado um pequeno aumento quando a concentração de CaCl2 foi de 1 g L-1. O efeito mais deletério da salinidade foi observado com a presença de NaHCO3, seguido de NaCl e Na2SO4. Azospirillum produziu mais compostos indólicos em meio semi-sólido e Herbaspirillum em meio líquido, mas em menor nível.The production of indolic compounds by Azospirillum brasilense Cd, A. lipoferum Br 17, Herbaspirillum seropedicae Z 67, H. rubrisubalbicans M4, and strain 34 isolated from rice, which does not fit into the described Herbaspirillum species, was measured under aeration ratio and salt concentrations. Aeration of the medium increased growth and production of indole compounds by these bacteria. Under static condition, the production was higher both in nitrogen-free medium for Azospirillum, and in amended N medium for the Herbaspirillum strains. Increasing salt concentration into the medium inhibited the production of indole compounds, although a small increase in production was observed, when CaCl2 concentration was raised above 1 g L-1. Deleterious effect of salinity was more pronounced in the presence of NaHCO3, followed by NaCl and Na2SO4. Azospirillum produced more indolic compounds in semi-solid cultures, and

  12. GERMINATION OF GRASSES DUE TO INOCULATION DIAZOTROPHIC BACTERIA

    Directory of Open Access Journals (Sweden)

    C. D. A. Moreira

    2014-07-01

    Full Text Available The germination of forage grasses suffers from numbness and a natural tendency to low quality. The use of microorganisms inoculated in seeds with the purpose of increasing and meet the demand of some nutrient has been shown to be efficient, but the role of the microorganism in germination and rate of force is still unknown. Therefore the goal as study was to evaluate the germination rate of seeds of three cultivars of Brachiaria brizantha CV. Marandu, b., b. brizantha CV. Xaraés and b. humidícola cv Tupi and a cultivar of millet, P. hybrid cv Massai depending on the bacterium Azospirillum brasilense diazotrofic inoculation (nitrogen-fixing. Germination test was used in seed dispersal to assess the effect of first count (VPC in the treatments with and without inoculation. It was done also conducted further tests of electrical conductivity, weight of thousand seeds and water content. The delineation used was randomized entirely (DIC and the statistical analysis carried out through the analysis of variance and comparison of means using the Tukey test, the 5% probability. Massai grass seeds have the highest rate of force of first count in both treatments. Inoculation of bacterium Azospirillum brasilense did not affect the values of force of first count on seeds of the cultivars Marandu, Xaraés, Tupi and Massai. The seeds of the massai have higher germination speed relative the other cultivars evaluated when inoculated.

  13. A novel interaction between plant-beneficial rhizobacteria and roots: colonization induces corn resistance against the root herbivore Diabrotica speciosa.

    Directory of Open Access Journals (Sweden)

    Franciele Santos

    Full Text Available A number of soil-borne microorganisms, such as mycorrhizal fungi and rhizobacteria, establish mutualistic interactions with plants, which can indirectly affect other organisms. Knowledge of the plant-mediated effects of mutualistic microorganisms is limited to aboveground insects, whereas there is little understanding of what role beneficial soil bacteria may play in plant defense against root herbivory. Here, we establish that colonization by the beneficial rhizobacterium Azospirillum brasilense affects the host selection and performance of the insect Diabrotica speciosa. Root larvae preferentially orient toward the roots of non-inoculated plants versus inoculated roots and gain less weight when feeding on inoculated plants. As inoculation by A. brasilense induces higher emissions of (E-β-caryophyllene compared with non-inoculated plants, it is plausible that the non-preference of D. speciosa for inoculated plants is related to this sesquiterpene, which is well known to mediate belowground insect-plant interactions. To the best of our knowledge, this is the first study showing that a beneficial rhizobacterium inoculant indirectly alters belowground plant-insect interactions. The role of A. brasilense as part of an integrative pest management (IPM program for the protection of corn against the South American corn rootworm, D. speciosa, is considered.

  14. Nitrogen fixed by wheat plants as affected by nitrogen fertilizer levels and Non-symbiotic bacteria

    International Nuclear Information System (INIS)

    Inorganic nitrogen is required for all egyptian soils for wheat. Free living and N 2-fixing microorganisms are able associate closely related with the roots of geraminacae. Pot experiment studies were carried out to examine the response of wheat plants to inoculation with Azospirillum Brasilense and Azotobacter Chroococcum, single or in combination, under various levels of ammonium sulfate interaction between both the inoculants increased straw or grain yield as well as N-uptake by wheat plants with increasing N levels. Results showed that grains of wheat plants derived over 19,24 and 15% of its N content from the atmospheric - N 2 (Ndfa) with application of 25,50 and 75 mg N kg-1 soil in the presence of + Azospirillum + azotobacter. The final amount of N 2-fixers. The highest values of N 2-fixed were observed with mixed inoculants followed by inoculation with Azospirillum and then azotobacter. The recovery of applied ammonium sulfate-N was markedly increased by inoculation with combined inoculants, but less in uninoculated treatments. Seeds inoculated with non-symbiotic fixing bacteria could be saved about 25 kg N without much affecting the grain yield. i fig., 4 tabs

  15. Characterization of diazotrophic bacteria non-symbiotic associated with eucalyptus (eucalyptus sp.) in Codazzi, Cesar (Colombia)

    International Nuclear Information System (INIS)

    The effect of climatic seasons (rainy and dry) and the stratum sample (rhizospheric soil, roots and leaves) the population of the genera Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter and Burkholderia in soil rhizosphere, roots and leaves of eucalyptus (eucalyptus sp.). It also assesses their ability to produce indoles compounds as plant growth promoters and their acetylene reduction activity as an indicator of biological fixation of nitrogen. The results showed no statistically significant differences in the Duncan test (p ≤ 0.05) in the population with respect to the climate epoch, suggesting that these bacteria are able to tolerate stress conditions by different physiological mechanisms. With respect to the stratum sample isolates attempts of Herbaspirillum sp. and Azospirillum sp. significant differences in rhizospheric soil and roots. we obtained 44 isolates of which were grouped by phenotypic characterization as 14 suspected of Beijerinckia sp., 12 Azotobacter sp., 8 Derxia sp., 4 Herbaspirillum sp., 5 Azospirillum sp., 1 Gluconacetobacter sp. and 1 Burkholderia sp. due to their high potential were selected isolates C27, C26 and C25. These four strains present the best values of efficiency in vitro, exceeding production values of the reference strains used (A. chroococcum (AC1) and a. brasilense (SP7)).

  16. HONGO ENDOMICORRÍZICO Y BACTERIA FIJADORA DE NITRÓGENO INOCULADAS A Coffea arabica EN VIVERO

    Directory of Open Access Journals (Sweden)

    Juan Francisco Aguirre-Medina

    2011-01-01

    Full Text Available Con el objetivo de determinar el efecto de la inoculación con Azospirillum brasilense y Glomus intraradice en café, se estableció la presente investigación en un vivero en el Campo Experimental Rosario Izapa, Chiapas, México de septiembre de 2005 a abril de 2006. Se utilizó un suelo Andosol¿mólico típico de la región cafetalera del Soconusco Chiapas, México. El A. brasilense tuvo una concentración de 100 x 106 bacterias por gramo de turba y el hongo micorrízico, cuarenta esporas por gramo de suelo con infección de 95% en el sistema radical de cebolla. Los tratamientos utilizados fueron los microorganismos solos, la combinación de ambos y el testigo sin inocular que se distribuyeron en un diseño de bloques completos al azar. Se evaluaron variables morfológicas y fisiológicas del rendimiento cada treinta días a partir del segundo mes de siembra durante siete meses y se determinó el contenido de N, P y Ca en el tejido vegetal. Los resultados se analizaron estadísticamente y las diferencias entre tratamientos se compararon de acuerdo a Tukey 5%. Los resultados indican una respuesta diferencial entre los microorganismos. A. brasilense indujo mayor desarrollo radical y la simbiosis doble G. intraradices + A. brasilense mejoró el desarrollo del tallo y lámina foliar. El contenido de N, P y Ca se presentó de forma consistente con G. intraradices.

  17. Plant-microorganism-soil interactions influence the Fe availability in the rhizosphere of cucumber plants.

    Science.gov (United States)

    Pii, Youry; Penn, Alexander; Terzano, Roberto; Crecchio, Carmine; Mimmo, Tanja; Cesco, Stefano

    2015-02-01

    Iron (Fe) is a very important element for plants, since it is involved in many biochemical processes and, often, for the low solubility of the natural Fe sources in soil, plants suffer from Fe - deficiency, especially when grown on calcareous soils. Among the numerous plant growth-promoting rhizobacteria (PGPR) that colonize the rhizosphere of agronomically important crops, Azospirillum brasilense has been shown to exert strong stimulating activities on plants, by inducing alterations of the root architecture and an improvement of mineral nutrition, which could result from an enhancement of ion uptake mechanisms as well as by increased bioavailability of nutrients. Some studies have also established that A. brasilense can act as biocontrol agent, by preventing the growth and/or virulence of phytopathogens, most likely through the production of microbial siderophores that sequester Fe from the soil. Despite microbial siderophores complexed with Fe could be an easily accessible Fe source for plants, the possible involvement of A. brasilense in improving Fe nutrition in plants suffering from the micronutrient deficiency has not been investigated yet. Within the present research, the characterization of the physiological and biochemical effects induced by Fe starvation and PGPR inoculation in cucumber plants (Cucumis sativus L. cv. Chinese Long) was carried out. The analyses of root exudates released by hydroponically grown plants highlighted that cucumber plants respond differently depending on the nutritional status. In addition, following the cultivation period on calcareous soil, also the root exudates found in the extracts suggested a peculiar behaviour of plants as a function of the treatment. Interestingly, the presence of the inoculum in soil allowed a faster recovery of cucumber plants from Fe-deficiency symptoms, i.e. increase in the chlorophyll content, in the biomass and in the Fe content of leaves. These observations might suggest a feasible application of

  18. Identification and characterization of trans-3-hydroxy-l-proline dehydratase and Δ1-pyrroline-2-carboxylate reductase involved in trans-3-hydroxy-l-proline metabolism of bacteria

    Directory of Open Access Journals (Sweden)

    Seiya Watanabe

    2014-01-01

    Full Text Available trans-4-Hydroxy-l-proline (T4LHyp and trans-3-hydroxy-l-proline (T3LHyp occur mainly in collagen. A few bacteria can convert T4LHyp to α-ketoglutarate, and we previously revealed a hypothetical pathway consisting of four enzymes at the molecular level (J Biol Chem (2007 282, 6685–6695; J Biol Chem (2012 287, 32674–32688. Here, we first found that Azospirillum brasilense has the ability to grow not only on T4LHyp but also T3LHyp as a sole carbon source. In A. brasilense cells, T3LHyp dehydratase and NAD(PH-dependent Δ1-pyrroline-2-carboxylate (Pyr2C reductase activities were induced by T3LHyp (and d-proline and d-lysine but not T4LHyp, and no effect of T3LHyp was observed on the expression of T4LHyp metabolizing enzymes: a hypothetical pathway of T3LHyp → Pyr2C → l-proline was proposed. Bacterial T3LHyp dehydratase, encoded to LhpH gene, was homologous with the mammalian enzyme. On the other hand, Pyr2C reductase encoded to LhpI gene was a novel member of ornithine cyclodeaminase/μ-crystallin superfamily, differing from known bacterial protein. Furthermore, the LhpI enzymes of A. brasilense and another bacterium showed several different properties, including substrate and coenzyme specificities. T3LHyp was converted to proline by the purified LhpH and LhpI proteins. Furthermore, disruption of LhpI gene from A. brasilense led to loss of growth on T3LHyp, d-proline and d-lysine, indicating that this gene has dual metabolic functions as a reductase for Pyr2C and Δ1-piperidine-2-carboxylate in these pathways, and that the T3LHyp pathway is not linked to T4LHyp and l-proline metabolism.

  19. ХАРАКТЕРИСТИКА СОСТАВА ЖИРНЫХ КИСЛОТ ЛИПИДОВ А ЛИПОПОЛИСАХАРИДОВ БАКТЕРИЙ РОДА AZOSPIRILLUM

    OpenAIRE

    Игнатов, В.; Коннова, О.; Бойко, А.; Фомина, А.; Федоненко, Ю.; Коннова, С.

    2009-01-01

    На основании анализа липополисахаридов восьми штаммов бактерий рода Azospirillum показано, что доминирующими являются: 3-гидрокситетрадекановая, гексадекановая, 3-гидроксигексадекановая и октадеценовая жирные кислоты, что подтверждает отнесение этих микроорганизмов к α-субклассу Proteobacteria. Исключение составил профиль жирных кислот ЛПС типового штамма A. lipoferum Sp59b, в котором доминировали по содержанию дидекановая, 2-гидроксидидекановая, 3-гидроксидидекановая, 3-гидрокситетрадеканова...

  20. Molecular characterization of nitrogen-fixing bacteria isolated from brazilian agricultural plants at São Paulo state Caracterização molecular de bactérias fixadoras de nitrogênio isoladas de plantas brasileiras no estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Érica. L. Reinhardt

    2008-09-01

    Full Text Available Fourteen strains of nitrogen-fixing bacteria were isolated from different agricultural plant species, including cassava, maize and sugarcane, using nitrogen-deprived selective isolation conditions. Ability to fix nitrogen was verified by the acetylene reduction assay. All potentially nitrogen-fixing strains tested showed positive hybridization signals with a nifH probe derived from Azospirillum brasilense. The strains were characterized by RAPD, ARDRA and 16S rDNA sequence analysis. RAPD analyses revealed 8 unique genotypes, the remaining 6 strains clustered into 3 RAPD groups, suggesting a clonal origin. ARDRA and 16S rDNA sequence analyses allowed the assignment of 13 strains to known groups of nitrogen-fixing bacteria, including organisms from the genera Azospirillum, Herbaspirillum, Pseudomonas and Enterobacteriaceae. Two strains were classified as Stenotrophomonas ssp. Molecular identification results from 16S rDNA analyses were also corroborated by morphological and biochemical data.Quatorze linhagens de bactérias fixadoras de nitrogênio foram isoladas de diferentes espécies de plantas, incluindo cassava, milho e cana-de-açúcar, usando condições seletivas desprovidas de nitrogênio. A capacidade de fixar nitrogênio foi verificada por ensaio de redução de acetileno. Todas as linhagens fixadoras de nitrogênio testadas apresentaram hibridização positiva com sonda de gene nifH derivada de Azospirillum brasilense. As linhagens foram caracterizadas por RAPD, ARDRA e sequenciamento do gene 16S rDNA. As análises de RAPD revelaram 8 genótipos, as 6 linhagens restantes foram agrupadas em 3 grupos de RAPD, sugerindo uma origem clonal. ARDRA e seqüências de 16S rDNA foram alocadas em 13 grupos conhecidos de bactérias fixadoras de nitrogênio, incluindo organismos dos gêneros Azospirillum, Herbaspirillum, Pseudomonas e Enterobacteriaceae. Duas linhagens foram classificadas como Stenotrophomonas ssp. Os resultados da identifica

  1. Ocorrência e diversidade de bactérias diazotróficas associadas a gramíneas forrageiras do Pantanal Sul Matogrossense Occurrence and diversity of diazotrophic bacteria associated to forage grasses of the Pantanal in the state of Mato Grosso do Sul

    Directory of Open Access Journals (Sweden)

    Marivaine da Silva Brasil

    2005-04-01

    Full Text Available Este trabalho teve por objetivo avaliar a ocorrência e a diversidade genética de bactérias fixadoras de N2 associadas às gramíneas nativas Elyonurus muticus (capim carona e Axonopus purpusii (capim mimoso e à gramínea exótica Brachiaria humidicola (braquiária que formam as pastagens na região da Nhecolândia. As coletas das plantas e solo foram feitas nos períodos de seca e de cheia para determinar a população de bactérias diazotróficas. Identificaram-se Azospirillum brasilense, A. lipoferum, A. amazonense, Herbaspirillum spp., Burkholderia spp. em amostras de solo, raízes e folhas das três espécies forrageiras. As populações dessas bactérias foram menores na época da cheia em comparação com a época da seca. A diversidade genética das bactérias isoladas foi avaliada por meio da técnica de análise de restrição do DNA ribossomal amplificado (ARDRA. Os isolados foram divididos em cinco grupos genotípicos distintos. Os isolados de A. brasilense e A. lipoferum apresentaram cerca de 50 % de similaridade, enquanto A. amazonense formou um grupo a parte, com apenas 25 % de similaridade em relação ao grupo das espécies do gênero. As bactérias do gênero Herbaspirillum formaram um grupo isolado com apenas 25 % de similaridade em relação ao gênero Azospirillum. O quinto grupo foi formado por apenas um isolado com 25 % de similaridade em relação aos demais.This study was carried out to verify the occurrence and genetic diversity of diazotrophic bacteria associated to the native graminaceus plants Elyonurus muticus (Carona grass and Axonopus purpusii (Mimoso grass and the exotic Brachiaria humidicola (Brachiaria that form the pastures in the Nhecolândia region of the Pantanal in the state of Mato Grosso do Sul, Brazil. The plants were harvested in the dry and rainy seasons and the diazotrophic bacteria populations in the soil and on roots and leaves of the three grasses were determined. Strains belonging to the

  2. Effect of plant growth-promoting bacteria on the growth and fructan production of Agave americana L.

    Science.gov (United States)

    De La Torre-Ruiz, Neyser; Ruiz-Valdiviezo, Víctor Manuel; Rincón-Molina, Clara Ivette; Rodríguez-Mendiola, Martha; Arias-Castro, Carlos; Gutiérrez-Miceli, Federico Antonio; Palomeque-Dominguez, Héctor; Rincón-Rosales, Reiner

    2016-01-01

    The effect of plant growth-promoting bacteria inoculation on plant growth and the sugar content in Agave americana was assessed. The bacterial strains ACO-34A, ACO-40, and ACO-140, isolated from the A. americana rhizosphere, were selected for this study to evaluate their phenotypic and genotypic characteristics. The three bacterial strains were evaluated via plant inoculation assays, and Azospirillum brasilense Cd served as a control strain. Phylogenetic analysis based on the 16S rRNA gene showed that strains ACO-34A, ACO-40 and ACO-140 were Rhizobium daejeonense, Acinetobacter calcoaceticus and Pseudomonas mosselii, respectively. All of the strains were able to synthesize indole-3-acetic acid (IAA), solubilize phosphate, and had nitrogenase activity. Inoculation using the plant growth-promoting bacteria strains had a significant effect (pagave plants with proper biological characteristics for agroindustrial and biotechnological use and to increase the sugar content in this agave species. PMID:27268113

  3. Dicty_cDB: Contig-U11623-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000272_337( CP000272 |pid:none) Burkholderia xenovorans LB400 ch... 108 5e-22 (Q9CTY5) RecName: Full=EF-hand domain-containing fam... 51908, c... 94 1e-17 CP000480_6168( CP000480 |pid:none) Mycobacterium smegmatis str. MC... 94 1e-17 CP00094...as syringae pv. tomato... 92 4e-17 CP000480_3868( CP000480 |pid:none) Mycobacterium smegmatis...e) Azospirillum brasilense AraR, AraC... 71 9e-11 CP000248_515( CP000248 |pid:none) Novosphingobium aromati...e) Novosphingobium aromaticivorans... 60 2e-07 CP001029_1248( CP001029 |pid:none) Me

  4. Efecto de diferentes concentraciones de ácido antranílico en el crecimiento del maíz

    Directory of Open Access Journals (Sweden)

    José Luis Hernández-Mendoza

    2010-08-01

    Palabras clave: auxinas, fitohormonas, rizobacterias promotoras del crecimiento vegetal, Zea mays L. Abstract: The plant growth-promoting ability of rhizo-bacterium Azospirillum brasilense is based on production of auxins and other hormones, among them outstanding antranilic acid (AA. In this work we determined the antranilic acid (0, 500, 1000, 3000, and 5000 ppm effects on maize growth and dry biomass accumulation under greenhouse conditions using the hybrid 83G66. From 500 to 3000 ppm of AA significantly increased plant growth (leaf area and plant height while 1000 and 3000 ppm of AA significantly increased dry biomass accumulation in maize compared with control (0 ppm. The 90 % of AA in maize plants was assimilated during the early 10 days after treatment. Key words: Auxins, phyto-hormones, plant growth promoting rhizobacteria, Zea mays L.

  5. Quantification of root associated nitrogen fixation in kallar grass as estimated by sup/15/nitrogen isotope dilution

    International Nuclear Information System (INIS)

    Present investigations were made by using sup/15/N isotope dilution technique to quantitatively estimate BNF in Kallar grass when grown under controlled conditions in nutrient solution and inoculated with N sub/2/-fixing bacteria. Azospirillum brasilense and two isolates from the rhizosphere of kallar grass were used as inoculant. After harvest acetylen reduction of roots, total yield, total N and sup/15/ N analysis were made. Total-N in inoculated treatments was 2-3 times higher than in control and so were the fresh and dry weight yields. The estimates based on isotopic dilution indicated that 50-70 percent N in the plant was derived from BNF in case of inoculated treatment. The results based on N balance gave relatively lower values of 40-60 percent of total N derived from fixation. The data revealed that in Kallar grass a substantial amount of plant N is derived from BNF. (orig./A.B.)

  6. Robust biological nitrogen fixation in a model grass-bacterial association.

    Science.gov (United States)

    Pankievicz, Vânia C S; do Amaral, Fernanda P; Santos, Karina F D N; Agtuca, Beverly; Xu, Youwen; Schueller, Michael J; Arisi, Ana Carolina M; Steffens, Maria B R; de Souza, Emanuel M; Pedrosa, Fábio O; Stacey, Gary; Ferrieri, Richard A

    2015-03-01

    Nitrogen-fixing rhizobacteria can promote plant growth; however, it is controversial whether biological nitrogen fixation (BNF) from associative interaction contributes to growth promotion. The roots of Setaria viridis, a model C4 grass, were effectively colonized by bacterial inoculants resulting in a significant enhancement of growth. Nitrogen-13 tracer studies provided direct evidence for tracer uptake by the host plant and incorporation into protein. Indeed, plants showed robust growth under nitrogen-limiting conditions when inoculated with an ammonium-excreting strain of Azospirillum brasilense. (11)C-labeling experiments showed that patterns in central carbon metabolism and resource allocation exhibited by nitrogen-starved plants were largely reversed by bacterial inoculation, such that they resembled plants grown under nitrogen-sufficient conditions. Adoption of S. viridis as a model should promote research into the mechanisms of associative nitrogen fixation with the ultimate goal of greater adoption of BNF for sustainable crop production. PMID:25645593

  7. ИССЛЕДОВАНИЕ АНТИГЕННЫХ СВОЙСТВ ПОЧВЕННЫХ РОСТ-СТИМУЛИРУЮЩИХ БАКТЕРИЙ РОДА AZOSPIRILLUM

    OpenAIRE

    Чернова, Ю.; Бурыгин, Г.

    2008-01-01

    Азоспириллы способны непосредственно или косвенно стимулировать рост растений и повышать урожайность ряда видов растений. Антигенное разнообразие видов рода Azospirillum обусловлено структурными различиями ЛПС О-антигена. Серологический скрининг 38 штаммов азоспирилл позволил выделить три серотипа, включающие восемь серовариантов, по наличию антигенных перекрёстов с модельными штаммами. В отдельную группу были отнесены 7 штаммов, так как взаимодействовали только с родоспецифичными антителами....

  8. PAS domain of the deduced Org35 protein mediates the interaction with NifA

    Institute of Scientific and Technical Information of China (English)

    TU Ran; CUI Yanhua; CHEN Sanfeng; LI Jilun

    2006-01-01

    NifA in Azospirillum brasilense plays a key role in regulating the synthesis of nitrogenase in response to ammonia and oxygen available. Recently,our laboratory has identified four clones, whose gene prodcuts interact with NifA, from A. brasilense Sp7genomic libraries by using the yeast two-hybrid system with NifA as bait. We are interested in clone S35,one of the four clones, because it contains a PAS-domain coding region. The entire open reading frame (ORF) for the PAS domain-containing protein was isolated and designated as org35 here. org35gene is 2211-bp long and encodes a protein of 736aa with a predicted molecular weight of about 78.4 kD.The predicted amino acid sequence of org35 has similarity to some two-component sensor kinase/response regulator hybrids of bacteria. Structural analyses showed that Org35 comprises at least three discrete conserved domains: the N-terminal PAS, the central histidine protein kinase (HPK) and the C-terminal response regulator (RR). The PAS domain of the deduced Org35 protein was found to interact directly with NifA, but the central HPK and the C-terminal RR domains of Org35 were not. These results indicated that interaction between NifA and Org35 was mediated by PAS domain.

  9. Swimming motility plays a key role in the stochastic dynamics of cell clumping

    International Nuclear Information System (INIS)

    Dynamic cell-to-cell interactions are a prerequisite to many biological processes, including development and biofilm formation. Flagellum induced motility has been shown to modulate the initial cell–cell or cell–surface interaction and to contribute to the emergence of macroscopic patterns. While the role of swimming motility in surface colonization has been analyzed in some detail, a quantitative physical analysis of transient interactions between motile cells is lacking. We examined the Brownian dynamics of swimming cells in a crowded environment using a model of motorized adhesive tandem particles. Focusing on the motility and geometry of an exemplary motile bacterium Azospirillum brasilense, which is capable of transient cell–cell association (clumping), we constructed a physical model with proper parameters for the computer simulation of the clumping dynamics. By modulating mechanical interaction (‘stickiness’) between cells and swimming speed, we investigated how equilibrium and active features affect the clumping dynamics. We found that the modulation of active motion is required for the initial aggregation of cells to occur at a realistic time scale. Slowing down the rotation of flagellar motors (and thus swimming speeds) is correlated to the degree of clumping, which is consistent with the experimental results obtained for A. brasilense. (paper)

  10. Construction of expression vector containing glnA gene and detection of NPT II activity in the transgenic rice calli using 32P-labelled compound

    International Nuclear Information System (INIS)

    The glnA gene encoding glutamine synthetase (GS) was amplified from Azospirillum brasilense Sp7 by PCR technique. the amplified 1.4 kb DNA fragment was cloned at the EcoRV site of Bluescript-SK. Both sequencing and restriction digestion data showed that the 1.4 kb DNA fragment flanked with BamHI site at each end was really the glnA gene of A. brasilense Sp7. The glnA gene was ligated with Bg1 II site of pCo24. As a result, an expression vector pGSC35 with CaMV35S promoter was obtained. Using colony in situ hybridization with α-32P-dATP labelled probes to screen the positive clones, another glnA gene expression vector pAGNB92 with rice actin 1 promoter was constructed after three rounds of ligation and transformation. Protoplasts isolated from rice cell suspension line cv. T986 were transformed with glnA expression vectors pGSC35 and pAGNB92 containing neomycin phosphotransferase II (NPTII) gene by using PEG fusion and electroporation. Transformed microcalli were selected on media containing G418 disulfate salt. NPT II activity was detected in 37% of G418 resistant calli by using dot blot hybridization with γ-32P-ATP and kanamycin as substrate

  11. Swimming motility plays a key role in the stochastic dynamics of cell clumping

    Science.gov (United States)

    Qi, Xianghong; Nellas, Ricky B.; Byrn, Matthew W.; Russell, Matthew H.; Bible, Amber N.; Alexandre, Gladys; Shen, Tongye

    2013-04-01

    Dynamic cell-to-cell interactions are a prerequisite to many biological processes, including development and biofilm formation. Flagellum induced motility has been shown to modulate the initial cell-cell or cell-surface interaction and to contribute to the emergence of macroscopic patterns. While the role of swimming motility in surface colonization has been analyzed in some detail, a quantitative physical analysis of transient interactions between motile cells is lacking. We examined the Brownian dynamics of swimming cells in a crowded environment using a model of motorized adhesive tandem particles. Focusing on the motility and geometry of an exemplary motile bacterium Azospirillum brasilense, which is capable of transient cell-cell association (clumping), we constructed a physical model with proper parameters for the computer simulation of the clumping dynamics. By modulating mechanical interaction (‘stickiness’) between cells and swimming speed, we investigated how equilibrium and active features affect the clumping dynamics. We found that the modulation of active motion is required for the initial aggregation of cells to occur at a realistic time scale. Slowing down the rotation of flagellar motors (and thus swimming speeds) is correlated to the degree of clumping, which is consistent with the experimental results obtained for A. brasilense.

  12. Plant growth-promoting bacteria associated with nitrogen fertilization at topdressing in popcorn agronomic performance

    Directory of Open Access Journals (Sweden)

    Leandro Teodoski Spolaor

    2016-03-01

    Full Text Available ABSTRACT The use of plant growth-promoting bacteria is a promising alternative with low environmental impact to increase the efficiency of use of chemical fertilizers, ensuring high yield with better cost-effective ratio. In maize crops, several studies have demonstrated an increased yield when Azospirillum-based inoculants are used. In the case of popcorn, there are no available studies related to use of inoculation and its response on yield parameters. Thus, the aim of this study was to evaluate the field performance of popcorn when inoculated with the commercial product Masterfix L (A. brasilense Ab-V5 and A. brasilense Ab-V6 and the non-commercial inoculant UEL (A. brasilense Ab-V5 + Rhizobium sp. 53GRM1 associated with nitrogen fertilization. The trials were conducted in Londrina and Maringá, Paraná State, Brazil, in a randomized block design with four replications, in a split plot design with the inoculation treatments located in the plots (uninoculated, Masterfix L, and UEL and the different N rates located in the subplots where ammonium sulphate was applied in the topdressing at the V6 stage (0, 50, 100, and 150 kg∙ha–1. The variance analysis showed significant effects (p < 0.05 of inoculation (Londrina environment and N rates (both environments only for grain yield. There was no inoculation effect in the grain yield when inoculants were applied together with N-fertilization at topdressing. In the absence of N-fertilization at topdressing, the inoculants Masterfix L. and UEL promoted higher grain yield as compared to the uninoculated plants, with resulting increases of 13.21 and 26.61% in yield, respectively.

  13. Increased root exudation of /sup 14/C-compounds by sorghum seedlings inoculated with nitrogen-fixing bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Lee, K.J. (Institute of Forest Genetics, Suweon (Republic of Korea)); Gaskins, M.H. (Florida Univ., Gainesville (USA). Dept. of Agriculture)

    1982-01-01

    Organic components leaked from Sorghum bicolor seedlings ('root exudates') were examined by recovering /sup 14/C labelled compounds from root solutions of seedlings inoculated with Azospirillum brasilense, Azotobacter vinelandii or Klebsiella pneumoniae nif-. Up to 3.5% of the total /sup 14/C recovered from shoots, roots, and nutrient solutions was found in the root solutions. Inoculation with Azospirillum and Azotobacter increased the amounts of /sup 14/C and decreased the amounts of carbohydrates in the root solutions. When sucrose was added as a carbon source for the bacteria, the increase of /sup 14/C in the solutions did not occur. Quantities of /sup 14/C found in the root solutions were proportional to amounts of mineral nitrogen supplied to the plants. Bacterial growth also was proportional to nitrogen levels. When sorghum plants were grown in soil and labelled with /sup 14/CO/sub 2/, about 15% of the total /sup 14/C recovered within 48 hours exposure was found in soil leachates.

  14. CARACTERIZACIÓN DE BACTERIAS DIAZOTRÓFICAS ASIMBIÓTICAS ASOCIADAS AL EUCALIPTO (Eucalyptussp. EN CODAZZI, CESAR (COLOMBIA Characterization of Diazotrophic Bacteria Non-Symbiotic Associated with Eucalyptus (Eucalyptussp. in Codazzi, Cesar (Colombia

    Directory of Open Access Journals (Sweden)

    DOLLY MELISSA OBANDO CASTELLANOS

    Full Text Available Se evaluó el efecto de las épocas climáticas (lluvia y sequía y del estrato de la muestra (suelo rizosférico, raíces y hojas sobre la población de los géneros Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter y Burkholderia en el Eucalipto (Eucalyptus sp.. Así mismo, se evalúo su capacidad en la producción de compuestos indólicos como promotores del crecimiento vegetal y su actividad de reducción de acetileno como indicador de la fijación biológica de nitrógeno. Los resultados no registraron diferencias estadísticas significativas en el test de Tukey (P ≤ 0.05 en la población con respecto a la época climática. Con respecto al estrato de muestra, los aislamientos tentativos de Herbaspirillum sp. y Azospirillum sp. presentaron diferencias significativas en suelo rizosférico y raíces. Se obtuvieron 44 aislamientos de los cuales se agruparon por caracterización fenotípica como: 14 presuntivos de Beijerinckia sp., 12 de Azotobacter sp., ocho de Derxia sp., cuatro de Herbarpirillum sp., cinco de Azospirillum sp., uno de Gluconacetobacter sp. y uno de Burkholderia sp. Por su alto potencial fueron seleccionados y criopreservados los aislamientos C27, C26 y C25, las cuales presentaron los mejores valores de eficiencia in vitro, superando valores de producción de las cepas de referencia utilizadas (A. chroococcum (AC1 y A. brasilense (SP7.The effect of climatic seasons (rainy and dry and the stratum sample (rhizospheric soil, roots and leaves the population of the genera Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter and Burkholderia in soil rhizosphere, roots and leaves of Eucalyptus (Eucalyptus sp.. It also assesses their ability to produce indoles compounds as plant growth promoters and their acetylene reduction activity as an indicator of biological fixation of nitrogen. The results showed no statistically significant differences in the Duncan test (P ≤ 0

  15. Evaluation of the association nitrogen fixing bacterias interspecific – rice lines – nitrogen, in typic haplustalf. Ibagué, Colombia Evaluación de la asociación bacterias fijadoras de nitrógeno – líneas interespecíficas de arroz–nitrógeno, en Typic haplustalf. Ibagué, Colombia

    Directory of Open Access Journals (Sweden)

    Bonilla Correa Carmen Rosa

    2008-03-01

    Full Text Available The study was carried out at the Cauchitos farm, Ibague municipality department of Tolima, with bounds: North 4°23'51"; and west 75°9'7";, 979 ansm, the average temperature is 24,3°C, tropical dry forest (bs–t in the Holdridge classification. The purpose of this study was to evaluate the association between the nitrogen fixation bacteries with and without inoculo in 10 interespecific rice lines with three nitrogen dosis (0, 50 and 100% de 250 kg/ ha–1 and three repetitions. The inoculation was realized with 108 former units of colonies per millimeter. 2.260 bacteries of the generums Azotobacter spp y Azospirrillum spp., and identification the species: Azospirillum brasilense, Azospirillum lipoferum, Azospirillum amazonense, were identified and from the genus Azotobacter were identified the species: A. choroococcum, A. vinelandii, A. paspali and A. veijerinckii. Weren't found none significative differences after the inoculation. Azotobacter spp and Azospirillum spp. were typical generums of the bacterian flora in the rice plantation and in field conditions were effect of the treatment effects in the bacterian . The Azotobacter spp was the predominant in generum in each one of the treatments.El estudio se llevó a cabo en la hacienda Cauchitos, municipio de Ibagué, departamento del Tolima (Norte 4° 23' 51"; y Oeste 75° 9' 7";, 979 msnm, 24.3°C, bosque seco tropical (bs–T, con el objetivo de evaluar las asociaciones entre bacterias fijadoras de nitrógeno con inóculo y sin él en diez líneas interespecíficas de arroz, con tres dosis de nitrógeno (0%, 50% y 100% de 250 kg/ha–1 y tres repeticiones por tratamiento. La inoculación se

  16. ИСПОЛЬЗОВАНИЕ МЕТОДА ЭЛЕКТРООПТИЧЕСКОГО АНАЛИЗА МИКРОБНЫХ СУСПЕНЗИЙ ДЛЯ ОПРЕДЕЛЕНИЯ СПЕЦИФИЧНОСТИ БАКТЕРИОФАГА

    OpenAIRE

    Караваева, Ольга; Гулий, Ольга; Павлий, Сергей; Володин, Дмитрий; Игнатов, Олег

    2011-01-01

    Изучена возможность использования метода электрооптического анализа клеточных суспензий для определения специфичности бактериофага, выделенного из клеток Azospirillum brasilense Sp7, в отношении клеток хозяина и близкородственных штаммов. Для определения селективности также был использован стандартный метод стекающей капли. Эксперименты проводились с клетками бактериальных штаммов Azospirillum brazilense Sp7, Azospirillum brazilense Sr75, Azospirillum brazilense Cd, Azospirillum brazilense Sp...

  17. CARACTERIZACIÓN DE BACTERIAS DIAZOTRÓFICAS ASIMBIÓTICAS ASOCIADAS AL EUCALIPTO (Eucalyptus sp. EN CODAZZI, CESAR.

    Directory of Open Access Journals (Sweden)

    Divan Baldani Vera Lúcia

    2010-12-01

    Full Text Available Se evaluó el efecto de las épocas climáticas (lluvia y sequía y del estrato de la muestra (Suelo rizosférico, raíces y hojas sobre la población de los géneros Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter y Burkholderia en el Eucalipto (Eucalyptus sp.. Así mismo, se evalúo su capacidad en la producción de compuestos indólicos como promotores del crecimiento vegetal y su actividad de reducción de acetileno como indicador de la fijación biológica de nitrógeno. Los resultados no registraron diferencias estadísticas significativas en el test de Tukey (P ≤ 0.05 en la población con respecto a la época climática. Con respecto al estrato de muestra, los aislamientos tentativos a Herbaspirillum sp. y Azospirillum sp. presentaron diferencias significativas en suelo rizosférico y raíces. Se obtuvieron 44 aislamientos de los cuales se agruparon por caracterización fenotípica como: 14 presuntivos del género Beijerinckia sp., 12 de Azotobacter sp., 8 de Derxia sp., 4 de Herbarpirillum sp., 5 de Azospirillum sp., 1 de Gluconacetobacter sp. y 1 de Burkholderia sp. Por su alto potencial fueron seleccionados y criopreservados los aislamientos C27, C26, C25 y C45, las cuales presentaron los mejores valores de eficiencia in vitro, superando valores de producción de las cepas de referencia utilizadas (A. chroococcum (AC-01 y A. brasilense (SP7.

  18. Potential of plant growth promoting rhizobacteria and chemical fertilizers on soil enzymes and plant growth

    International Nuclear Information System (INIS)

    The present investigation deals with the role of Plant Growth Promoting Rhizobacteria and chemical fertilizers alone or in combination on urease, invertase and phosphatase activities of rhizospheric soil and also on general impact on growth of safflower cvv. Thori and Saif-32. The PGPR (Azospirillum brasilense and Azotobacter vinelandii) were applied at 10/sup 6/ cells/mL as seed inoculation prior to sowing. Chemical fertilizers were applied at full (Urea 60 Kg ha/sup -1/ and Diammonium phosphate (DAP) 30 Kg ha/sup -1/), half (Urea 30 Kg ha/sup -1/ and DAP 15 Kg ha/sup -1/) and quarter doses (Urea 15 Kg ha-1 and DAP 7.5 Kg ha/sup -1/) during sowing. The chemical fertilizers and PGPR enhanced urease and invertase activities of soil. Presence of PGPR in combination with quarter and half doses of chemical fertilizers further augmented their effect on soil enzymes activities. The soil phosphatase activity was greater in Azospirillum and Azotobacter in combination with half dose of chemical fertilizers. Maximum increase in leaf melondialdehyde content was recorded in full dose of chemical fertilizers whereas coinoculation treatment exhibited significant reduction in cv. Thori. Half and quarter dose of chemical fertilizers increased the shoot length of safflower whereas maximum increase in leaf protein was recorded in Azotobacter in combination with full dose of chemical fertilizers. Root length was improved by Azospirillum and Azotobacter in combination with quarter dose of chemical fertilizers. Leaf area and chlorophyll contents were significantly improved by Azotobacter in combination with half dose of chemical fertilizers. It is inferred that PGPR can supplement 50 % chemical fertilizers for better plant growth and soil health. (author)

  19. BIOFERTILIZATION USING RHIZOBACTERIA AND AMF IN THE PRODUCTION OF TOMATO (Lycopersicon esculentum Mill. AND ONION (Allium cepa L. SEEDLINGS. II. ROOT COLONIZATION AND NUTRITIONAL STATUS

    Directory of Open Access Journals (Sweden)

    L. E. Pulido

    2003-01-01

    Full Text Available Como complemento a estudios precedentes de la biofertilización en posturas de plantas hortícolas sobre suelos Ferralíticos Rojos compactados, eútricos y en áreas experimentales de la Universidad de Ciego de Ávila, se evaluaron los efectos de la inoculación simple y la coinoculación, mediante el recubrimiento de semillas y sin aplicar fertilizantes minerales, con rizobacterias promotoras del crecimiento vegetal -RPCV- (Azospirillum brasilense, Azotobacter chroococcum y Burkholderia cepacia y hongos micorrízicos arbusculares - HMA- (Glomus clarum y G. fasciculatum en algunos indicadores de la colonización radical por los microorganismos y el estado nutricional de plántulas de tomate y cebolla. A partir de los resultados, se evidenció que, para ambos cultivos, las poblaciones de A. chroococcum, B. cepacia y A. brasilense se incrementaron significativamente en aquellos tratamientos inoculados con estas rizobacterias, encontrando, en general, los mayores valores en los tratamientos que fueron coinoculados. Respecto a la micorrización, los mayores porcentajes de colonización micorrízica y masa del endófito en tomate se obtuvieron mediante la coinoculación de A. brasilense con ambas especies de HMA y, para la cebolla, la máxima colonización la realizó G. fasciculatum aplicada de forma independiente, mientras que la masa del endófito fue mayor en la coinoculación de G. clarum + A. chroococcum. En relación con el estado nutricional de las plantas, en tomate, los tratamientos con presencia conjunta de A. brasilense y ambas especies de HMA fueron los que hicieron mayores extracciones de N y estuvieron entre los que realizaron mayores extracciones de P y K. En cebolla, todos los tratamientos inoculados con ambos tipos de microorganismos fueron capaces de extraer mayores cantidades de N, P y K. Todos estos resultados permiten explicar las causas de la obtención de posturas de adecuada calidad mediante la biofertilización sin el uso

  20. Alternative rooting induction of semi-hardwood olive cuttings by several auxin-producing bacteria for organic agriculture systems

    Directory of Open Access Journals (Sweden)

    M. C. Montero-Calasanz

    2013-01-01

    Full Text Available Southern Spain is the largest olive oil producer region in the world. In recent years organic agriculture systems have grown exponentially so that new alternative systems to produce organic olive cuttings are needed. Several bacterial isolates, namely Pantoea sp. AG9, Chryseobacterium sp. AG13, Chryseobacterium sp. CT348, Pseudomonas sp. CT364 and Azospirillum brasilense Cd (ATCC 29729, have been used to induce rooting in olive semi-hardwood cuttings of Arbequina, Hojiblanca and Picual cultivars of olive (Olea europea L. The first four strains were previously selected as auxin-producing bacteria and by their ability to promote rooting in model plants. They have been classified on the basis of their 16S rDNA gene sequence. The known auxin producer A. brasilense Cd strain has been used as a reference. The inoculation of olive cuttings was performed in two different ways: (i by dipping cuttings in a liquid bacterial culture or (ii by immersing them in a paste made of solid bacterial inoculant and sterile water. Under nursery conditions all of the tested bacterial strains were able to induce the rooting of olive cuttings to a similar or greater extent than the control cuttings treated with indole-3-butyric acid (IBA. The olive cultivars responded differently depending on the bacterial strain and the inoculation method. The strain that consistently gave the best results was Pantoea sp. AG9, the only one of the tested bacterial strains to express the enzyme 1-aminocyclopropane-1-carboxylate (ACC deaminase. The results are also discussed in terms of potential commercial interest and nursery feasibility performance of these strains.

  1. Effect of immobilized rhizobacteria and organic amendment in bulk and rhizospheric soil of Cistus albidus L.

    Science.gov (United States)

    Mengual, Carmen Maria; del Mar Alguacil, Maria; Roldan, Antonio; Schoebitz, Mauricio

    2013-04-01

    A field experiment was carried out to assess the effectiveness of the immobilized microbial inoculant and the addition of organic olive residue. The microbial inoculant contained two rhizobacterial species identified as Azospirillum brasilense and Pantoea dispersa immobilized in a natural inert support. Bacterial population densities were 3.5×109 and 4.1×109 CFU g-1 of A. brasilense M3 and P. dispersa C3, respectively. The amendment used was the organic fraction extracted with KOH from composted "alperujo". The raw material was collected from an olive-mill and mixed with fresh cow bedding as bulking agent for composting. The inoculation of rhizobacteria and the addition of organic residue were employed for plant growth promotion of Cistus albidus L. and enhancement of soil physicochemical, biochemical and biological properties in a degraded semiarid Mediterranean area. One year after planting, the available phosphorus and potassium content in the amended soils was about 100 and 70% respectively higher than in the non-amended soil. Microbial inoculant and their interaction with organic residue increased the aggregate stability of the rhizosphere soil of C. albidus (by 12% with respect to control soil) while the organic residue alone not increased the aggregate stability of the rhizosphere of C. albidus. Microbial biomass C content and enzyme activities (dehydrogenase, urease, protease-BAA and alkaline phosphatase) of the rhizosphere of C. albidus were increased by microbial inoculant and organic residue interaction but not by microbial inoculation alone. The microbial inoculant and organic residue interaction were the most effective treatment for stimulating the roots dry weight of C. albidus (by 133% with respect to control plants) and microbial inoculant was the most effective treatment for increase the shoot dry weigh of plants (by 106% with respect to control plants). The combined treatment, involving microbial inoculant and addition of the organic residue

  2. ИЗУЧЕНИЕ ВЛИЯНИЯ ЛЕКТИНОВ АЗОСПИРИЛЛ НА ОБРАЗОВАНИЕ ПЕРЕКИСИ ВОДОРОДА В КОРНЯХ ПРОРОСТКОВ ПШЕНИЦЫ

    OpenAIRE

    Аленькина, Светлана; Трутнева, Ксения; Великов, Владимир; Никитина, Валентина

    2012-01-01

    Показана способность лектинов, выделенных с поверхности почвенных азотфиксирующих бактерий штамма Azospirillum brasilense Sp7 и его мутанта по лектиновой активности Azospirillum brasilense Sp7.2.3, регулировать продукцию перекиси водорода в корнях проростков пшеницы, связанную с активацией супероксиддисмутазы, пероксидазы, оксалатоксидазы и ингибированием активности каталазы. Было показано, что в корнях проростков пшеницы при воздействии лектинов наиболее быстро индуцируемым путем образования...

  3. Use of Phosphate Solubilizing Bacteria to Leach Rare Earth Elements from Monazite-Bearing Ore

    Directory of Open Access Journals (Sweden)

    Doyun Shin

    2015-04-01

    Full Text Available In the present study, the feasibility to use phosphate solubilizing bacteria (PSB to develop a biological leaching process of rare earth elements (REE from monazite-bearing ore was determined. To predict the REE leaching capacity of bacteria, the phosphate solubilizing abilities of 10 species of PSB were determined by halo zone formation on Reyes minimal agar media supplemented with bromo cresol green together with a phosphate solubilization test in Reyes minimal liquid media as the screening studies. Calcium phosphate was used as a model mineral phosphate. Among the test PSB strains, Pseudomonas fluorescens, P. putida, P. rhizosphaerae, Mesorhizobium ciceri, Bacillus megaterium, and Acetobacter aceti formed halo zones, with the zone of A. aceti being the widest. In the phosphate solubilization test in liquid media, Azospirillum lipoferum, P. rhizosphaerae, B. megaterium, and A. aceti caused the leaching of 6.4%, 6.9%, 7.5%, and 32.5% of calcium, respectively. When PSB were used to leach REE from monazite-bearing ore, ~5.7 mg/L of cerium (0.13% of leaching efficiency and ~2.8 mg/L of lanthanum (0.11% were leached by A. aceti, and Azospirillum brasilense, A. lipoferum, P. rhizosphaerae and M. ciceri leached 0.5–1 mg/L of both cerium and lanthanum (0.005%–0.01%, as measured by concentrations in the leaching liquor. These results indicate that determination of halo zone formation was found as a useful method to select high-capacity bacteria in REE leaching. However, as the leaching efficiency determined in our experiments was low, even in the presence of A. aceti, further studies are now underway to enhance leaching efficiency by selecting other microorganisms based on halo zone formation.

  4. The crude plant juices of desert plants as appropriate culture media for the cultivation of rhizospheric microorganisms

    Directory of Open Access Journals (Sweden)

    Eman H. Nour

    2012-01-01

    Full Text Available The exclusive use of plant juices, not as a mere supplement to synthetic culture media, for culturing rhizospheric microorganisms (RMO is introduced here. Juices were prepared from desert (Mesembryanthemum crystallinum L., Zygophyllum album L., Carpobrotus edulis L. as well as cultivated (Trifolium alexandrinum L., Beta vulgaris L. plants. Colonies of RMO (Azospirillum brasilense, Enterobacter agglomerans and Klebsiella pneumoniae nicely developed on surface-inoculated agar plates prepared from crude and diluted juice of M. crystallinum (ice plant. Furthermore, hundreds of RMO colonies developed on various standard culture media were replicated (>90% on agar plates of different plant juices. RMO cells grew nicely in liquid ice plant juice, with doubling times comparable to those grown in the reference culture medium. RMO populations resident in various host plants were able to develop on culture media prepared from homologous and heterologous juices. The application of a thin semi-solid overlay agar on the surfaces of inoculated agar plates significantly increased the recovery of micro-colonies on agar plates, particularly those prepared from plant juices.

  5. Identification, sequencing and structural analysis of a nifA-like gene of Acetobacter diazotrophicus.

    Science.gov (United States)

    Teixeira, K R; Morgan, T; Meletzus, D; Galler, R; Baldani, J I; Kennedy, C

    1999-01-01

    A recombinant plasmid, pAD101, containing a DNA fragment of Acetobacter diazotrophicus strain PAL5 was isolated by its ability to restore Nif+ phenotype to a nifA- ntrC- double mutant of Azotobacter vinelandii. Hybridization with the nifA genes of Azospirillum brasilense located the nifA gene more precisely to specific fragments of pAD101. DNA sequencing of appropriate subclones of pAD101 revealed that the nifA gene was adjacent to the nifB gene in A. diazotrophicus, and the 5' end of the nifB gene was located downstream of the nitrogenase MoFe subunit gene, nifK. The deduced aminoacid sequence of A. diazotrophicus nifA and nifB gene were most similar to the NifA and NifB proteins of Azorhizobium caulinodans and Rhodobacter capsulatus, respectively. In addition, nucleotide sequences upstream of the A. diazotrophicus nifA-encoding region indicate features similar to those in the A. caulinodans nifA promoter region involved in O2 and fixed N regulation of nifA expression. PMID:10530336

  6. Differential growth responses of Brachypodium distachyon genotypes to inoculation with plant growth promoting rhizobacteria.

    Science.gov (United States)

    do Amaral, Fernanda P; Pankievicz, Vânia C S; Arisi, Ana Carolina M; de Souza, Emanuel M; Pedrosa, Fabio; Stacey, Gary

    2016-04-01

    Plant growth promoting rhizobacteria (PGPR) can associate and enhance the growth of important crop grasses. However, in most cases, the molecular mechanisms responsible for growth promotion are not known. Such research could benefit by the adoption of a grass model species that showed a positive response to bacterial inoculation and was amenable to genetic and molecular research methods. In this work we inoculated different genotypes of the model grass Brachypodium distachyon with two, well-characterized PGPR bacteria, Azospirillum brasilense and Herbaspirillum seropedicae, and evaluated the growth response. Plants were grown in soil under no nitrogen or with low nitrogen (i.e., 0.5 mM KNO3). A variety of growth parameters (e.g., shoot height, root length, number of lateral roots, fresh and dry weight) were measured 35 days after inoculation. The data indicate that plant genotype plays a very important role in determining the plant response to PGPR inoculation. A positive growth response was observed with only four genotypes grown under no nitrogen and three genotypes tested under low nitrogen. However, in contrast, relatively good root colonization was seen with most genotypes, as measured by drop plate counting and direct, microscopic examination of roots. In particular, the endophytic bacteria H. seropedicae showed strong epiphytic and endophytic colonization of roots. PMID:26873699

  7. Densidade e diversidade fenotípica de bactérias diazotróficas endofíticas em solos de mineração de bauxita, em reabilitação Density and phenotypic diversity of endophytic nitrogen fixing bacteria in soils under rehabilitation after bauxite mining

    Directory of Open Access Journals (Sweden)

    R. Melloni

    2004-02-01

    Full Text Available Bactérias diazotróficas endofíticas contribuem para o desenvolvimento das plantas por meio da fixação biológica do nitrogênio, produção e liberação de substâncias reguladoras do crescimento vegetal, podendo, assim, facilitar a revegetação de solos degradados por atividades antrópicas. No entanto, pouco se conhece sobre as populações destas bactérias em solos ou plantas de áreas de mineração. Objetivando avaliar o efeito de diferentes tipos de vegetação e tempo de reabilitação de áreas degradadas por mineração de bauxita na densidade e diversidade de algumas espécies de bactérias diazotróficas endofíticas, realizaram-se, em duas épocas, amostragens de solo, de dois ambientes distintos, submetidos a diferentes processos de reabilitação. A densidade, avaliada pelo número mais provável, utilizando os meios de cultura: NFb, JNFb e Fam, para Azospirillum brasilense e A. lipoferum, Herbaspirillum spp. e A. amazonense, respectivamente, variou de 0 a 2,0 x 10(4 bactérias por grama de solo e mostrou que o tipo de vegetação influiu nas populações destas bactérias. Foram encontradas densidades maiores em solos revegetados com gramíneas: braquiária (Brachiaria decumbens, capim-azevém (Lolium multiflorum e capim-gordura (Melinis minutiflora. Contudo, estas densidades podem ser consideradas baixas, se comparadas às de solos agrícolas, e não apresentaram relação com o tempo de reabilitação da área. Foram encontrados 36 fenótipos culturais em meio batata, entre os 72 isolados obtidos dos três meios de cultura utilizados. A partir destes, foram formados sete grandes grupos com similaridade superior ou igual a 63 %, dos quais cinco, representando 62,5 % do total de isolados obtidos, continham as estirpes-tipo de Burkholderia brasilensis, Herbaspirillum seropedicae e Azospirillum spp. (A. brasilense, A. amazonense, A. lipoferum, A. irakense. Apesar da baixa densidade, este grupo de bactérias apresentou alta

  8. USO COMBINADO DE MICROORGANISMOS BENÉFICOS Y PRODUCTOS BIOACTIVOS COMO ALTERNATIVA PARA LA PRODUCCIÓN DE TOMATE (Lycopersicon esculentum, Mill

    Directory of Open Access Journals (Sweden)

    Elein Terry

    2005-01-01

    Full Text Available Con el objetivo de conocer la efectividad agrobiológica de la combinación de microorganismos benéficos y productos bioactivos, sobre el desarrollo, rendimiento y la calidad interna en el cultivo del tomate (variedad 'Amalia', se llevó a cabo un experimento de campo en el 2000 y 2001, sobre un suelo Ferralítico Rojo lixiviado típico. Los tratamientos consistieron en plantas coinoculadas (Glomus clarum- Azospirillum brasilense y asperjadas foliarmente con el producto bioactivo Biostan en diferentes momentos del desarrollo de las plantas. Los resultados mostraron una relación armónica y ecológicamente compatible entre ambos productos, permitiendo un adecuado estado nutricional de las plantas, así como posibilitó un rendimiento de 35 t.ha-1, siendo superior en un 17 % al testigo de producción; por otra parte, los frutos obtenidos con estos tratamientos tuvieron una mejor calidad bromatológica.

  9. Bioremediation of hydrocarbons contaminating sewage effluent using man-made biofilms: effects of some variables.

    Science.gov (United States)

    Al-Mailem, D M; Kansour, M K; Radwan, S S

    2014-11-01

    Biofilm samples were established on glass slides by submerging them in oil-free and oil-containing sewage effluent for a month. In batch cultures, such biofilms were effective in removing crude oil, pure n-hexadecane, and pure phenanthrene contaminating sewage effluent. The amounts of the removed hydrocarbons increased with increasing biofilm surface area exposed to the effluent. On the other hand, addition of the reducing agent thioglycollate dramatically inhibited the hydrocarbon bioremediation potential of the biofilms. The same biofilm samples removed contaminating hydrocarbons effectively in three successive batch bioremediation cycles but started to become less effective in the cycles thereafter, apparently due to mechanical biofilm loss during successive transfers. As major hydrocarbonoclastic bacteria, the biofilms harbored species belonging to the genera Pseudomonas, Microvirga, Zavarzinia, Mycobacterium, Microbacterium, Stenotrophomonas, Gordonia, Bosea, Sphingobium, Brachybacterium, and others. The nitrogen fixer Azospirillum brasilense and the microalga Ochromonas distigma were also present; they seemed to enrich the biofilms, with nitrogenous compounds and molecular oxygen, respectively, which are known to enhance microbiological hydrocarbon degradation. It was concluded that man-made biofilms based upon sewage microflora are promising tools for bioremediation of hydrocarbons contaminating sewage effluent. PMID:25146193

  10. Trace cobalt speciation in bacteria and at enzymic active sites using emission Moessbauer spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Kamnev, A.A.; Antonyuk, L.P.; Smirnova, V.E.; Serebrennikova, O.B. [Laboratory of Biochemistry, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, Saratov (Russian Federation); Kulikov, L.A.; Perfiliev, Yu.D. [Laboratory of Nuclear Chemistry Techniques, Department of Radiochemistry, Faculty of Chemistry, Moscow State University (Russian Federation)

    2002-02-01

    {sup 57}Co emission Moessbauer spectroscopy (EMS) allows the chemical state of cobalt, as influenced by its coordination environment, to be monitored in biological samples at its physiological (trace) concentrations. To draw attention to EMS as a valuable tool for speciation of cobalt in biocomplexes, the process of cobalt(II) metabolism in cells of the plant growth-promoting rhizobacterium Azospirillum brasilense Sp245 was investigated using EMS of {sup 57}Co{sup II}-doped bacterial cells. EMS measurements also showed {sup 57}Co{sup II}-activated glutamine synthetase (GS, a key enzyme of nitrogen metabolism, isolated from this bacterium) to have two different cobalt(II) forms at its active sites, in agreement with data available on other bacterial GSs. Chemical after-effects following electron capture by the nucleus of the parent {sup 57}Co{sup II} during the {sup 57}Co{yields}{sup 57}Fe transition, which contribute to the formation of a stabilised daughter {sup 57}Fe{sup III} component along with the nucleogenic {sup 57}Fe{sup II} forms, are also briefly considered. (orig.)

  11. The effect of ectomycorrhizal fungi and bacteria on pine seedlings

    Directory of Open Access Journals (Sweden)

    Hanna Dahm

    2014-08-01

    Full Text Available The effect of ecomycorrhizal fungi (Hebelon crustuliniforme(Bull.: Fr. Quél. 5392 and Pisolithus tinctorius (Pers. Coker et Couch 5335 and bacteria (Bacillus polymyxa and Azospirillum brasilense. associated with mycorrhizas on the growth of pine seedligs was investigated. In addition the influence of bacteria on fungal biomass production and the relationship between ectomycorrhizal fungi and fungi pathogenic to root of pine seedlings were determined. In general, the shoot/root ratio was higher in plants inoculated with Hebeloma crustuliniforme and bacteria than in the control seedlings (grown only under sterile conditions. In non-sterile substrate the root/shoot ratio of the mycorrhizal seedlings was lower as compared to the control. Similar phenomenon was noted in plants inoculated with the mycorrhizal fungus Pisolithus tinetorius. The bacteria used as well as the time of introduction of these organisms into the cultures of mycorrhiza fungi affected the production of fungal biomass. Hebeloma crustuliniforme and Pisolithus tinctorius inhibited the growth of Rizoctonia solani and Fusarium oxysporum fungi pathogenic to pine seedlings.

  12. Oviposition Attractancy of Bacterial Culture Filtrates: response of Culex quinquefasciatus

    Directory of Open Access Journals (Sweden)

    S Poonam

    2002-04-01

    Full Text Available Oviposition attractants could be used for monitoring as well as controlling mosquitoes by attracting them to lay eggs at chosen sites. In the present study, culture filtrates of seven bacterial species were tested for their attractancy against gravid females of Culex quinquefasciatus. When their oviposition active indices (OAI were studied, the culture filtrates of Bacillus cereus and Pseudomonas fluorescens exhibited oviposition attractancy (OAI = >0.3 at 100 ppm and the OAI were respectively 0.70 and 0.47. Culture filtrates of B. thuringiensis var. israelensis (wild type, B. t. var. israelensis (mutant and B. sphaericus showed attractancy at 2000 ppm with OAI of respectively 0.71, 0.59 and 0.68. However, the OAI of B. megaterium as well as Azospirillum brasilense was 0.13 (at 2000 ppm, which was less than 0.3 required to be considered them as attractants. When the oviposition attractancy of the bacterial culture filtrates were compared with that of a known oviposition attractant, p-cresol (at 10 ppm, the culture filtrates of B. t. var. israelensis (wild type and B. cereus were found to be more active than p-cresol, respectively with 64.2 and 54.3% oviposition.

  13. BIOFERTILIZANTES Y PRODUCTOS BIOACTIVOS, ALTERNATIVAS PARA LA ASOCIACIÓN MAÍZ-TOMATE EN EL PERÍODO TEMPRANO DE SIEMBRA

    Directory of Open Access Journals (Sweden)

    Elein Terry

    2006-01-01

    Full Text Available Con el objetivo de conocer el efecto agronómico de la utilización combinada de biofertilizantes y productos bioactivos, sobre el desarrollo, rendimiento y la calidad interna del tomate (variedad ´Amalia´, cultivado fuera del período óptimo bajo un sistema de asociación de cultivos, se llevó a cabo un experimento de campo en el 2000 y 2001, sobre un suelo Ferralítico Rojo lixiviado típico. Los tratamientos consistieron en plantas coinoculadas (Glomus clarum + Azospirillum brasilense y asperjadas foliarmente con los productos bioactivos Biostan y Biobras-16, aplicados al inicio de la floracióndel cultivo. Los resultados mostraron una relación compatibleentre microorganismos y productos bioactivos, permitieron un adecuado balance nutricional de las plantas, así como un rendimiento entre 26 y 29 t.ha-1, siendo superior en un rango del 12-19 % con respecto al testigo de producción; por otra parte, los frutos obtenidos con estos tratamientos presentaron una calidad bromatológica superior.

  14. Effects of head pruning and different nutritional systems (chemical, biological and integrated on seed yield and oil content in medicinal pumpkin (Cucurbita pepo L.

    Directory of Open Access Journals (Sweden)

    Zarei Dariush

    2016-01-01

    Full Text Available To evaluate the effect of head pruning and different nutritional systems (chemical, biological and integrated on yield and seed oil content in medicinal pumpkin (Cucurbita pepo L., an experiment was conducted in Kermanshah/Iran during the 2013 growing season. The experimental treatments consisted of two levels - no head pruning, control (Co and head pruning (C1 allocated to the main plots. Four levels of different fertilizing systems - control (without fertilizer (T0, chemical (T1, biological (a combination of nitrogen fixing bacteria, Azospirillum brasilense and Glomus mosseae (T2, and integrated fertilizing system (biological fertilizer + 50% chemical fertilizer (T3 were assigned to the sub-plots. The experimental treatments were arranged as a split plot based on a randomized complete block design with three replications. The results showed that the highest percentage of seed oil was obtained (37% in the integrated nutritional system along with the head pruning treatment. The highest grain yields of 53 and 50 g per square meter were obtained in integrated and chemical fertilizing systems, respectively while no pruning was applied. The highest fruit yields of 3,710 and 3,668 kg per hectare were produced by chemical and integrated fertilizing systems, respectively. The biological nutrition system required more time to demonstrate its positive effect on the growth and yield of medicinal pumpkin.

  15. Growth promoting characteristics of rhizobacteria and AM Fungi for biomass amelioration of Zea mays

    Directory of Open Access Journals (Sweden)

    Kumar Manoj

    2015-01-01

    Full Text Available Plant growth promoting rhizobacteria (PGPR and mycorrhiza were evaluated on the growth (biomass and yield of Zea mays. In the present study, selective rhizospheric PGPR (Azotobacter chroococcum, Pseudomonas aeruginosa, Azospirillum brasilense and Streptomyces sp. and a combination of six strains of arbuscular mycorrhizal fungi (AMF (Acaulospora morrowae, Gigaspora margarita, Glomus constrictum, Glomus mossae, Glomus aggregatum and Scutellospora calospora were isolated and identified with standard methods and 16S rRNA sequence analysis. PGPR and AMF were checked for their growth-promoting behavior under specific treatment conditions. The 30-48-day-old treated plants in all combinations showed a significantly higher mass value. The average dry weight from the shoot was in a range from 41-52% as compared to the control. This increase also translated into a higher mass value of the roots. Overall, an 82% growth rate was observed in terms of height as the consequence of biomass production, specifically in the case of AMF + rhizobacteria combination. We report an efficient, sustainable and cost-effective biofertilizer for enhanced biomass of Z. mays, one of the staple food crops worldwide.

  16. Bacillus pumilus ES4: candidate plant growth-promoting bacterium to enhance establishment of plants in mine tailings

    Science.gov (United States)

    de-Bashan, Luz E.; Hernandez, Juan-Pablo; Bashan, Yoav; Maier, Raina

    2014-01-01

    Three plant growth-promoting bacteria (PGPB; Bacillus pumilus ES4, B. pumilus RIZO1, and Azospirillum brasilense Cd) were tested for their ability to enhance plant growth and development of the native Sonoran Desert shrub quailbush (Atriplex lentiformis) and for their effect on the native bacterial community in moderately acidic, high-metal content (AHMT) and in neutral, low metal content natural tailings (NLMT) in controlled greenhouse experiments. Inoculation of quailbush with all three PGPB significantly enhanced plant growth parameters, such as germination, root length, dry weight of shoots and roots, and root/shoot ratio in both types of tailings. The effect of inoculation on the indigenous bacterial community by the most successful PGPB Bacillus pumilus ES4 was evaluated by denaturating gradient gel electrophoresis (PCR-DGGE) fingerprinting and root colonization was followed by specific fluorescent in situ hybridization (FISH). Inoculation with this strain significantly changed the bacterial community over a period of 60 days. FISH analysis showed that the preferred site of colonization was the root tips and root elongation area. This study shows that inoculation of native perennial plants with PGPB can be used for developing technologies for phytostabilizing mine tailings. PMID:25009362

  17. Search for novel targets of the PII signal transduction protein in Bacteria identifies the BCCP component of acetyl-CoA carboxylase as a PII binding partner.

    Science.gov (United States)

    Rodrigues, Thiago E; Gerhardt, Edileusa C M; Oliveira, Marco A; Chubatsu, Leda S; Pedrosa, Fabio O; Souza, Emanuel M; Souza, Gustavo A; Müller-Santos, Marcelo; Huergo, Luciano F

    2014-02-01

    The PII family comprises a group of widely distributed signal transduction proteins. The archetypal function of PII is to regulate nitrogen metabolism in bacteria. As PII can sense a range of metabolic signals, it has been suggested that the number of metabolic pathways regulated by PII may be much greater than described in the literature. In order to provide experimental evidence for this hypothesis a PII protein affinity column was used to identify PII targets in Azospirillum brasilense. One of the PII partners identified was the biotin carboxyl carrier protein (BCCP), a component of the acetyl-CoA carboxylase which catalyses the committed step in fatty acid biosynthesis. As BCCP had been previously identified as a PII target in Arabidopsis thaliana we hypothesized that the PII -BCCP interaction would be conserved throughout Bacteria. In vitro experiments using purified proteins confirmed that the PII -BCCP interaction is conserved in Escherichia coli. The BCCP-PII interaction required MgATP and was dissociated by increasing 2-oxoglutarate. The interaction was modestly affected by the post-translational uridylylation status of PII ; however, it was completely dependent on the post-translational biotinylation of BCCP. PMID:24329683

  18. Structure of insoluble immune complexes as studied by spectroturbidimetry and dynamic light scattering

    Science.gov (United States)

    Khlebtsov, Boris N.; Burygin, Gennadii L.; Matora, Larisa Y.; Shchyogolev, Sergei Y.; Khlebtsov, Nikolai G.

    2004-07-01

    We describe two variants of a method for determining the average composition of insoluble immune complex particles (IICP). The first variant is based on measuring the specific turbidity (the turbidity per unit mass concentration of the dispersed substance) and the average size of IICP determined from dynamic light scattering (DLS). In the second variant, the wavelength exponent (i.e., the slope of the logarithmic turbidity spectrum) is used in combination with specific turbidity measurements. Both variants allow the average biopolymer volume fraction to be determined in terms of the average refractive index of IICP. The method is exemplified by two experimental antigen+antibody systems: (i) lipopolysaccharide-protein complex (LPPC) of Azospirillum brasilense Sp245+rabbit anti-LPPC; and (ii) human IgG (hIgG)+sheep anti-hIgG. Our measurements by the two methods for both types of systems gave, on the average, the same result: the volume fraction of the IICP biopolymers is about 30%; accordingly, the volume fraction of buffer solvent is 70%.

  19. L-arabonate and D-galactonate production by expressing a versatile sugar dehydrogenase in metabolically engineered Escherichia coli.

    Science.gov (United States)

    Liu, Huaiwei; Valdehuesa, Kris Niño G; Ramos, Kristine Rose M; Nisola, Grace M; Lee, Won-Keun; Chung, Wook-Jin

    2014-05-01

    The production of L-arabonate and D-galactonate employing a versatile l-arabinose dehydrogenase (AraDH) from Azospirillum brasilense is presented. The promiscuity of AraDH is manifested by its appreciable activity towards L-arabinose and D-galactose as substrates, and NAD(+) and NADP(+) as cofactors. The AraDH was introduced into an engineered Escherichia coli with inactive L-arabinose or D-galactose metabolism, resulting in strains EMA2 and EWG4, respectively. EMA2 produced 43.9 g L(-1)L-arabonate with a productivity of 1.22 g L(-1)h(-1) and 99.1% (mol/mol) yield. After methanol precipitation, 92.6% of L-arabonate potassium salt was recovered with a purity of 88.8%. Meanwhile, EWG4 produced 24.0 g L(-1)D-galactonate, which is 36% higher than that of the strain carrying the specific d-galactose dehydrogenase. Overall results reveal that the versatility of AraDH to efficiently catalyze the formation of L-arabonate and D-galactonate could be a useful tool in advancing industrial viability for sugar acids production. PMID:24713235

  20. Bionota: Bacterias promotoras de crecimiento de microalgas: una nueva aproximación en el tratamiento de aguas residuales Microalgae growth-promoting bacteria: A novel approach in wastewater treatment

    Directory of Open Access Journals (Sweden)

    Bashan Yoav

    2003-12-01

    Full Text Available Las bacterias promotoras de crecimiento en plantas (PGPB del género Azospirillum son conocidas porque mejo­ran el crecimiento de numerosas cosechas agrícolas; sin embargo, el presente trabajo pretende extender el uso de estas bacterias a "bacterias promotoras de crecimiento de microalgas" (MPGB para aumentar la capacidad de las microalgas de eliminar nutrientes de aguas residuales. La inoculación deliberada de las microalgas Chlorella spp. con PGPB de origen terrestre no ha sido reportada con anterioridad, tal vez debido al origen diferente de estos dos microorganismos. Al inmovilizar de manera conjunta Chlorella vulgaris y Azospirillum brasilense Cd en esferas de alginato, se obtuvo como resultado un aumento significativo en varios parámetros de crecimiento de la microalga, como el peso fresco y seco, el número total de células, el tamaño de las colonias de microalgas dentro de la esfera, el número de organismos por colonia y la concentración de pigmentos. Además, aumenta­ron los lípidos y la variedad de ácidos grasos. La microalga combinada con la MGPB tiene una mayor capacidad de eliminar amonio y fósforo tanto en agua residual sintética como en agua residual doméstica. Actualmente se ha estado experimentando con otras PGPB (Flavobacterium sp. Azospirillum sp. y Azotobacter sp. para propósitos acuícolas; por ejemplo aumentar el crecimiento de fitoplancton utilizado en el cultivo de carpas y estabilizar cultivos masivos de microalgas marinas utilizadas como alimento para organismos marinos, todo esto con resul­tados promisorios. Si bien el efecto de las PGPB en microorganismos acuáticos aún no ha sido suficientemente explorado, proponemos que la co-inmovilización de microalgas y bacterias promotoras de crecimiento es un medio efectivo para aumentar la población microalgal y también su capacidad de limpiar aguas residuales. Palabras clave: PGPB; microalgas; biotratamiento de aguas residuales; co

  1. Produção, caracterização e aplicação de anticorpo policlonal contra Azospirillum amazonense estirpe Am15 Production, characterization and application of polyclonal antibodies against Azospirillum amazonense strain Am15

    OpenAIRE

    Marinete Flores da Silva; Veronica Massena Reis

    2009-01-01

    O uso de ferramentas moleculares e imunológicas permite a detecção e o monitoramento específico de microrganismos usados como inoculantes agrícolas. O maior exemplo de sucesso com uso de bactérias diazotróficas na agricultura é o caso da inoculação de soja no Brasil. Entretanto, a inoculação de bactérias diferentes de rizóbio não permite a localização de um sítio específico onde ocorra A redução do nitrogênio atmosférico, pois não há a formação de estruturas nodulares. Este trabalho foi reali...

  2. Protein Quantity and Quality of Safflower Seed Improved by NP Fertilizer and Rhizobacteria (Azospirillum and Azotobacter spp.)

    OpenAIRE

    Nosheen, Asia; Bano, Asghari; Yasmin, Humaira; Keyani, Rumana; Habib, Rabia; Shah, Syed T. A.; Naz, Rabia

    2016-01-01

    HIGHLIGHTS Rhizobacteria (Azotobacter spp.) have improved the quality and quantity of safflower seed protein. Protein quality was confirmed by SDS-PAGE and new bands were found in response to different combinations of rhizobacteria and lower doses of fertilizers. The PGPR application has reduced the use of fertilizers upto 50%. Protein is an essential part of the human diet. The aim of this present study was to improve the protein quality of safflower seed by the application of ...

  3. Identificação e avaliação de rizobactérias isoladas de raízes de milho

    Directory of Open Access Journals (Sweden)

    Eliamar Aparecida Nascimbém Pedrinho

    2010-12-01

    Full Text Available Estudos sobre a atividade microbiológica que ocorre na rizosfera de diversos vegetais levaram ao descobrimento de grupos de microrganismos importantes para o desenvolvimento vegetal. Dentre eles estão as rizobactérias que são capazes de colonizar as raízes, estimulando-a diretamente ou beneficiando o crescimento e o desenvolvimento de diversas plantas. Estas bactérias são chamadas Rizobactérias Promotoras de Crescimento em Plantas (RPCP. Este trabalho teve o objetivo de isolar, identificar, testar a capacidade da solubilização de fosfato e a produção de ácido indol acético (AIA de bactérias que habitam a rizosfera de plantas de milho. A análise parcial do gene 16S rRNA dos 58 isolados possibilitou a identificação dos gêneros, Bacillus, Burkholderia e Azospirillum, sendo os mais frequentes totalizando 68% dos isolados, seguidos de Sphingomonas, Pseudomonas, Herbaspirillum, Pantoea , Bosea. Desses, 27 apresentaram a capacidade de solubilização do fosfato e 18 foram positivos no teste colorimétrico para detecção de produção do AIA. A partir destes resultados, selecionou-se um organismo pertencente ao gênero Sphingomonas para ser testado em casa de vegetação como promotor de crescimento com as estirpes de Azospirillum brasilense (AbV5 e AbV6. As plantas foram avaliadas quanto à altura aos vinte e setenta dias após a germinação e a massa seca da parte aérea (MSPAe parte radicular (MSPR foi quantificada após setenta dias no encerramento do experimento. Os resultados das análises do isolado pertencente ao gênero Sphingomonas foram estatisticamente semelhantes às estirpes AbV5 e AbV6 na planta de milho indicando que este microrganismo possui potencial para ser utilizado como RPCP

  4. Ecology of nitrogen fixation in soils and rhizospheres. Pt. 5

    Energy Technology Data Exchange (ETDEWEB)

    Werner, D.; Stripf, R.; Abramowski, R.; Fiedler, U.

    1980-12-01

    The effects of reduced oxygen concentration on root growth and activities of enzymes of N-metabolism of wheat (Triticum aestivum var. Kolibri) have been studied, for low O/sub 2/ tensions are required for N/sub 2/ fixation by microaerophilic bacteria (e.g. Azospirillum) associated with root systems of grasses. In hydrocultures with oxygen concentrations in the range of 0.2 to 1 mg O/sub 2/ x 1/sup -1/ compared to aerated cultures (8-9 mg O/sub 2/ x 1/sup -1/) root growth was reduced from 10 mg fresh weight x day/sup -1/ x plant/sup -1/ to one tenth 15 to 30 d after sowing. Specific activity of NADH and NADPH dependent glutamate dehydrogenase (E.C. 1.4.1.2 and 1.4.1.4) is reduced by 50% in the cultures with low oxygen concentrations 20 to 30 days after sowing, whereas specific activity of aspartate aminotransferase (E.C. 2.6.1.1) and alanine amino transferase (E.C. 2.6.1.2) is enhanced by a factor of two to three. Specific activity of glutamine synthetase is almost unaffected. Specific activity of glutamate dehydrogenase is lowest in the root tips, medium in young root hair zone and highest in the old root hair zone, glutamine synthetase activity is reverse in the three zones with differences by a factor of 3-5; aspartate aminotransferase is similarly active in the three zones. Nitrate concentration used (100 ..mu..M) for cultivation of the wheat plants was tested with Azospirillum brasilense in pure culture on agar surfaces exposed to air at the same pH (5.8), used for cultivation of the wheat plants. Activiy after a 14 day period (peak activity 70 mmol C/sub 2/H/sub 4/ x mg protein/sup -1/ x h/sup -1/) was not affected, however 1 mM and 5 mM nitrate added reduced the total activity to 50% and 10% respectively.

  5. Densidade e diversidade fenotípica de bactérias diazotróficas não simbióticas em solos da Reserva Biológica Serra dos Toledos, Itajubá (MG

    Directory of Open Access Journals (Sweden)

    Talita Filomena Silva

    2011-04-01

    Full Text Available Bactérias diazotróficas não simbióticas (BDNS atuam no desenvolvimento das plantas por meio da fixação biológica de nitrogênio e também pela produção e liberação de substâncias reguladoras do crescimento vegetal. Este estudo objetivou avaliar a densidade e diversidade fenotípica desse grupo de bactérias em fragmentos de solo da Reserva Biológica Serra dos Toledos e entorno, em Itajubá/MG. Essa reserva localiza-se na Área de Proteção Ambiental da Mantiqueira, constituindo-se em uma importante área de recarga e de abrigo à flora e fauna endêmicas. Amostras de solo superficial foram coletadas em áreas com diferentes declividades na reserva, em épocas representativas das estações de inverno (setembro/2006 e verão (abril/2007. A densidade, avaliada pelo número mais provável, utilizando os meios de cultura NFb, JNFb e Fam, para Azospirillum spp., Herbaspirillum spp. e A. amazonense, respectivamente, variou de 0,12 a 75,60 (NMP x 10(5 bactérias g-1 solo seco. Foram obtidos 172 e 174 isolados, respectivamente para as amostras de inverno e verão, dos quais 30 e 55 % apresentaram similaridade igual ou superior a 70 % com as estirpes-tipo Azospirillum brasilense, A. amazonense, A. lipoferum, Herbaspirillum seropedicae e Burkholderia brasilensis. O resultado do comportamento dos isolados com base na tolerância à salinidade nem sempre foi semelhante ao obtido pelas características fenotípicas culturais a 70 % de similaridade, sendo indicado para estudos complementares de diversidade desses organismos. As BDNS apresentam potencial de utilização em estudos de avaliação da qualidade e sustentabilidade de ecossistemas. No entanto, apesar da alta densidade e diversidade fenotípica em solos da reserva, maiores valores foram obtidos no entorno, evidenciando o efeito positivo da cobertura vegetal do tipo gramíneas sobre elas, independentemente da variação climática.

  6. Especificidade de anti-soro policlonal à Leifsonia xyli subsp. xyli Policlonal antiserum specifity against Leifsonia xyli subsp. xyli

    Directory of Open Access Journals (Sweden)

    Josil B. Carneiro Jr

    2004-12-01

    Full Text Available Detectar a presença da bactéria Leifsonia xyli subsp. xyli em material de propagação da cana-de-açúcar (Saccharum sp. é importante para direcionar o controle do raquitismo-da-soqueira. Neste trabalho, objetivou-se produzir anticorpo policlonal específico contra Leifsonia xyli subsp. xyli (Lxx, visando utilizá-lo em método sorológico para detecção do patógeno. Para isso, o antígeno foi preparado a partir de células intactas, após lavagem por centrifugação de cultura-pura em tampão fosfato salino 0,01 M (PBS e diálise em glutaraldeido 2% em PBS. O plano de imunização em coelho consistiu de duas injeções intramusculares da mistura 1:1 do antígeno com adjuvante Freund (completo e incompleto, a intervalos de 21 dias e duas injeções subcutâneas do antígeno puro, a intervalos de dez dias. O anti-soro foi testado pelo método de Dot Blot com revelação por peroxidase para se determinar: (i título do anticorpo e (ii reação contra Lxx, Xanthomonas axonopodis pv. vesicatoria e bactérias endofíticas de cana-de-açúcar (Azospirillum brasilense, A. lipoferum, Herbaspirillum rubrisubalbicans, H. seropedicae e Gluconacetobacter diazotrophicus. A maior diluição analisada do anti-soro 1:20.000 mostrou reação fortemente positiva e específica contra Lxx e ausência de reação contra as demais bactérias. A purificação da fração IgG (Imunoglobulina G não resultou em melhoria na reatividade e especificidade do anti-soro. Estimou-se o nível de detecção do método a partir de suspensão bacteriana em 2x10(6 células/ml.To detect the presence of the bacterium Leifsonia xyli subsp. xyli (Lxx in propagation material is important for the control of the ratoon stunting disease. The objective of this work was to improve a serological method for detection of the pathogen and to evaluate the policlonal antiserum specificity produced against Lxx. The antigen was prepared by resuspending pure culture in PBS and dialyzing it in

  7. CO-INOCULAÇÃO NO DESENVOLVIMENTO VEGETATIVO E NODULAÇÃO DE PLÂNTULAS DE SOJA SUBMETIDAS À CALAGEM, FERTILIZAÇÃO NITROGENADA E APLICAÇÃO DE MICRONUTRIENTES

    Directory of Open Access Journals (Sweden)

    LIBÓRIO, Paloma Helena da Silva

    2015-11-01

    Full Text Available In order to evaluate the co-inoculation of soybeans, or mixed inoculation with bacteria of the genus Bradyrhizobium and Azospirillum brasilense, at the expense of traditional inoculation with Bradyrhizobium, two experiments were installed in october 2014, in a greenhouse. The experimental design was completely randomized with eight treatments and eight replications in pots rotation system. Treatments involving different combinations as commercial fertilizer formulations, with or without inoculant application (s and micronutrients cobalt and molybdenum (Co-Mo in the seeds, being: 0-20-20; 4-20-20; 0-20-20 + inoculant (s; 4-20-20 + inoculant (s; 0-20-20 + inoculant (s + Co-Mo; 4-20-20 + inoculant (s + Co-Mo; 0-20-20 + Co-Mo and 4-20-20 + Co-Mo. Evaluations constituted the% of normal seedlings, number and dry weight of nodules / plant, dry weight of shoot and root / plant. In liming performed with only 30 days before sowing, limestone has not had sufficient time to react with soil, which showed deficiency in calcium, in addition to aluminum and manganese toxicity, reducing the % normal seedlings in the pots, which batch seed was already low in certain physiological quality of germination and emergence tests. Nevertheless, the practice of co-inoculation combined with the formulation (0-20-20 and without Co-Mo in the seeds stood out in relation to the evaluated parameters. Com o objetivo de avaliar a co-inoculação de soja, ou seja, inoculação mista com bactérias do gênero Bradyrhizobium e Azospirillum brasilense, em detrimento da inoculação tradicional com Bradyrhizobium foram instalados dois experimentos em outubro de 2014, em casa de vegetação. O delineamento experimental utilizado foi o inteiramente casualizado com oito tratamentos e oito repetições sob rodízio diário dos vasos. Os tratamentos envolveram diferentes combinações quanto a formulações comerciais de adubo, com ou sem aplicação de inoculante (s e micronutrientes

  8. History on the biological nitrogen fixation research in graminaceous plants: special emphasis on the Brazilian experience

    Directory of Open Access Journals (Sweden)

    José I. Baldani

    2005-09-01

    Full Text Available This review covers the history on Biological Nitrogen Fixation (BNF in Graminaceous plants grown in Brazil, and describes research progress made over the last 40 years, most of whichwas coordinated by Johanna Döbereiner. One notable accomplishment during this period was the discovery of several nitrogen-fixing bacteria such as the rhizospheric (Beijerinckia fluminensis and Azotobacter paspali, associative (Azospirillum lipoferum, A. brasilense, A. amazonense and the endophytic (Herbaspirillum seropedicae, H. rubrisubalbicans, Gluconacetobacter diazotrophicus, Burkholderia brasilensis and B. tropica. The role of these diazotrophs in association with grasses, mainly with cereal plants, has been studied and a lot of progress has been achieved in the ecological, physiological, biochemical, and genetic aspects. The mechanisms of colonization and infection of the plant tissues are better understood, and the BNF contribution to the soil/plant system has been determined. Inoculation studies with diazotrophs showed that endophytic bacteria have a much higher BNF contribution potential than associative diazotrophs. In addition, it was found that the plant genotype influences the plant/bacteria association. Recent data suggest that more studies should be conducted on the endophytic association to strengthen the BNF potential. The ongoing genome sequencing programs: RIOGENE (Gluconacetobacter diazotrophicus and GENOPAR (Herbaspirillum seropedicae reflect the commitment to the BNF study in Brazil and should allow the country to continue in the forefront of research related to the BNF process in Graminaceous plants.A presente revisão aborda a história da Fixação Biológica de Nitrogênio (FBN em Gramíneas no Brasil, procurando mostrar a evolução da pesquisa na área iniciada a mais de 40 anos sob a liderança da pesquisadora Johanna Döbereiner. Um aspecto marcante deste período foi a descoberta de diversas bactérias fixadoras de nitrogênio atmosf

  9. Ocorrência de bactérias diazotróficas em diferentes genótipos de cana-de-açúcar Occurrence of diazotrophic bacteria in different sugar cane genotypes

    Directory of Open Access Journals (Sweden)

    FÁBIO BUENO DOS REIS JUNIOR

    2000-05-01

    Full Text Available O objetivo deste trabalho foi avaliar a localização e o número de bactérias endofíticas em quatro genótipos de cana-de-açúcar e investigar sobre a possível existência de correlação com os resultados apresentados em trabalhos de quantificação da fixação biológica de nitrogênio (FBN. Fez-se um levantamento das bactérias diazotróficas presentes, e quantificou-se a população de Herbaspirillum spp. e Acetobacter diazotrophicus, em genótipos de cana-de-açúcar contrastantes quanto à capacidade de obter N da FBN. De acordo com o levantamento realizado neste trabalho, as bactérias estudadas (Azospirillum lipoferum, A. brasilense, A. amazonense, Herbaspirillum spp. e Acetobacter diazotrophicus estavam presentes nos quatro genótipos avaliados e em todas as partes da planta, exceto A. amazonense, que não foi isolado de amostras de folhas. A quantificação das bactérias Herbaspirillum spp. e A. diazotrophicus mostrou não haver diferenças significativas entre os genótipos, e que, geralmente, elas estão presentes em maior número nas raízes. Enquanto Herbaspirillum spp. mantém-se mais estável ao longo do ciclo da cultura, a população de A. diazotrophicus decresce com a aproximação do final do ciclo comercial. Pode-se sugerir que as diferenças entre as taxas de FBN encontradas nos diversos genótipos não é causada por diferenças na presença ou no número das bactérias aqui estudadas.The objective of this work was to find out the localization and number of endophytic bacteria in four sugar cane genotypes and investigate upon the possible existence of correlation to the results obtained in some studies about quantification of biological nitrogen fixation (BNF. A survey of the diazotrophic bacteria present in sugar cane genotypes differing in their capacity to obtain nitrogen through BNF was performed, and population of Herbaspirillum spp. and Acetobacter diazotrophicus was quantified. The bacteria tested in the

  10. Influencia de lo abono nitrogenado en la calidad de ensilaje de maíz Influência da adubação nitrogenada sobre a qualidade da silagem de milho

    Directory of Open Access Journals (Sweden)

    Simone Basi

    2012-06-01

    Full Text Available

    La calidad final de ensilaje de maíz está directamente relacionada con el estado nutricional de las plantas. De los nutrientes requeridos por el cultivo, el nitrógeno (N es considerado el más importante. Esta revisión tiene como objetivo discutir temas relacionados con la dinámica de este nutriente en la planta de maíz, con énfasis en su influencia en los diversos eventos fisiológicos en los que participa. La producción de materia seca depende de la fuente y forma de suministro de este elemento a la planta. El uso de Azospirillum brasilense ha tenido prominencia a través de la fijación biológica de nitrógeno mediante la reducción de los costes de producción para la economía en el uso de N mineral, así como con el incremento de producción debido al uso más regular de lo nutriente en relación con los fertilizantes minerales, asegurando así una mayor productividad y calidad del material. Con un entendimiento de las funciones de este importante nutriente a la planta, el suministro alternativo y técnicas de gestión puede obtener un mayor valor nutritivo del ensilaje, debido al aumento de la concentración de proteína en la planta. Además con el aumento de la producción de materia seca por unidad de área, aumento de la producción de grano, mayor valor energético, influye en la concentración de fibras del material ensilado y posiblemente en el rendimiento de los animales.

    A qualidade final da silagem de milho está diretamente relacionada ao estado nutricional das plantas. Dos nutrientes exigidos pela cultura, o nitrogênio (N é considerado o de maior importância. A presente revisão tem como objetivo discutir aspectos relacionados à dinâmica deste nutriente na planta de milho, dando ênfase em sua influência nos diversos eventos fisiológicos dos quais participa. A produção de matéria seca depende da fonte e da forma de fornecimento deste elemento à planta. O uso

  11. Biological deterioration of alginate beads containing immobilized microalgae and bacteria during tertiary wastewater treatment.

    Science.gov (United States)

    Cruz, Ivonne; Bashan, Yoav; Hernàndez-Carmona, Gustavo; de-Bashan, Luz E

    2013-11-01

    Secondary treatment of municipal wastewater affects the mechanical stability of polymer Ca-alginate beads containing the microalgae Chlorella vulgaris that are jointly immobilized with Azospirillum brasilense as treating agents whose presence do not affect bead stability. Nine strains of potential alginate-degrading bacteria were isolated from wastewater and identified, based on their nearly complete 16S rDNA sequence. Still, their population was relatively low. Attempts to enhance the strength of the beads, using different concentrations of alginate and CaCl2 or addition of either of three polymers (polyvinylpyrrolidone, polyvinyl alcohol, carboxymethylcellulose), CaCO3, or SrCl2, failed. Beads lost their mechanical strength after 24 h of incubation but not the integrity of their shape for at least 96 h, a fact that sustained successful tertiary wastewater treatment for 48 h. In small bioreactors, removal of phosphorus was low under sterile conditions but high in unsterile wastewater. Alginate beads did not absorb PO4 (-3) in sterile wastewater, but in natural wastewater, they contained PO4 (-3). Consequently, PO4 (-3) content declined in the wastewater. A supplement of 10 % beads (w/v) was significantly more efficient in removing nutrients than 4 %, especially in a jointly immobilized treatment where >90 % of PO4 (-3) and >50 % ammonium were removed. Tertiary wastewater treatment in 25-L triangular, airlift, autotrophic bioreactors showed, as in small bioreactors, very similar nutrient removal patterns, decline in bead strength phenomena, and increase in total bacteria during the wastewater treatment only in the presence of the immobilized treatment agents. This study demonstrates that partial biological degradation of alginate beads occurred during tertiary wastewater treatment, but the beads survive long enough to permit efficient nutrient removal. PMID:23354446

  12. Manejo agronómico integral de sustratos, métodos de siembra y biofertilización en la producción sostenible de tubérculos-semilla de papa por semilla sexual

    Directory of Open Access Journals (Sweden)

    A. Hernández

    2001-01-01

    Full Text Available Con el objetivo de producir tubérculos-semilla de papa a partir de semilla sexual (SSP de forma ecológica y sostenible, se llevaron a cabo entre los años 1994-1998 tres experimentos en el Instituto Nacional de Ciencias Agrícolas (INCA, en el municipio de San José de las Lajas, La Habana, sobre un suelo Ferrálitico Rojo compactado, donde se estudiaron dos métodos de siembra (directa y transplante, el uso de dos fuentes de materia orgánica; dosis de aplicación de la materia orgánica en la composición del sustrato y la combinación de losmejores resultados de estos experimentos, con la inoculación de las semillas con biofertilizantes (bacterias nitrofijadoras, fosfosolubilizadoras y hongos micorrizógenos, utilizando pulso de nitrógeno a razón de 60 kg de N. ha-1, combinando todos estos en un experimento. Las bacterias empleadas fueron Azospirillum brasilense, Pseudomonas cepacia, Pseudomonas fluorescens y la micorriza empleada fue Glomus fasciculatum.Los resultados finales arrojaron que las plantas donde se había utilizado la coinoculación micorriza + Pseudomonascepacia, tuvieron una mayor producción de tubérculos semilla así como el tratamiento inoculado con Pseudomonas fluorescens, siendo los resultados superiores a los del testigo con fertilización química, consiguiéndose con ello una tecnologíade producción más económica y ecológica en este cultivo.

  13. COMO FAZER UMA AGRICULTURA VERDE USANDO O MAIS ANTIGO PROCESSO DE OBTENÇÃO DE NITROGÊNIO EM PLANTAS

    Directory of Open Access Journals (Sweden)

    Veronica Massena Reis

    2013-06-01

    Full Text Available Around 78% of the air is composed by nitrogen and this element is the third most important to the maintenance of life on the planet, after the carbon (C and oxygen (O. The greatparadox is life in earth it that this gas (N2 is inert and can only be reduced to a form assimilated by plants by different genus of bacteria called diazotrophs. These bacteria interact with other organisms including agricultural crops as the most famous one, the rhizobia of soybean. Another example recently incorporated to the cereal production routine is the application of another bacterium called Azospirillum brasilense described by the research group of Johanna Döberenier in the 80’s. The association of diazotrophs and grasses has been studied for about 60 years and revealed that in addition to providing nitrogen to the crops (contributing with up to 58% of its necessity, can also produce phyto-hormones, act as a biocontrol agents, solubilize phosphates and some other features; helping plants in the response of environmental stresses and refl ecting in crop productivity using reduced doses of N-fertilizer. With the objective of develop a cropmanagement based on biological nitrogen fi xation and a recommendation of inoculant application in order to improve the utilization of N-fertilizers, also preconized by the green revolution, made this research recognized worldwide for its innovation that advocates the use of a conservative practice, keeping the man in the fi eld, producing more without harming the environment.

  14. utilization of bio fertilizers and organic sources in arable soils under saline conditions using tracer technique

    International Nuclear Information System (INIS)

    Recently, more attention has been paid to conserve and save surrounding environment via minimizing the excessive use of chemical fertilizers and, in general, the agrochemicals applied in heavy quantities in agricultural agroecosystems. Therefore, the attention of most of agronomists was turned towards the use of so called clean agriculture or organic farming. Many of organic systems was pointed out such as the recycling of farm wastes i.e. crop residues, animal manure, organic conditioners for reclamation of soil and in the same time enhancement of plant growth and improving yield quality. The application of organic wastes combined with or without microbial inoculants to plant media are considered as a good management practice in any agricultural production system because it improves, plant quality and soil fertility. Therefore, we have the opportunity to conduct some experiments for achieving the clean agriculture approach, combating the adverse effects of salinity and avoiding the environmental pollution. Series of laboratory and greenhouse experiments were carried out to evaluate the impact of (1) potent isolated fungi (Aspergillus oryzae and Aspergillus terreus) on degrading plant residues (Leucaena and Acacia green parts), and (2) biofertilizers (Sinorhizobium meliloti, Azospirillum brasilense, and Pseudomonas aeruginosa) in assessing barley and spinach plants to combat salinity of soil and irrigation water.15N-tracer technique that considered unique and more reliable technique may benefits in clarifying the responsible mechanisms related to plant growth and gave us the opportunity to quantify the exact amounts of N derived from the different sources of nitrogen available to spinach and barley plants grown on sandy saline soil and irrigated with saline water.

  15. Microbial consortium role in processing liquid waste of vegetables in Keputran Market Surabaya as organic liquid fertilizer ferti-plus

    Science.gov (United States)

    Rizqi, Fauziah; Supriyanto, Agus; Lestari, Intan; Lita Indri D., L.; Elmi Irmayanti, A.; Rahmaniyah, Fadilatur

    2016-03-01

    Many activities in this market is directly proportional to increase production of vegetables waste, especially surabaya. Therefore, in this study aims to utilize liquid waste of vegetables into liquid organic fertilizer by mixing microbial consorsium. The microbial consorsium consist of Azotobacter chrococcum, Azospirillum brasilense, Rhizobium leguminosarum, Bacillus subtilis, Bacillus megaterium, Pseudomonas putida, and Pseudomonas fluorescens. Ttreatment of microbial concentrations (5%, 10%, 15%) and the length of the incubation period (7 days, 14 days, 21 days) used in this research. The parameters used are: C/N ratio, levels of CNP, and BOD value. This study uses a standard organic fertilizer value according SNI19-7030-2004, The results show the value of C/N ratio comply with the ISO standards. C levels showed an increase during the incubation period but not compare with standards. N levels that compare with standards are microbial treatment in all group concentration except control group with an incubation period of 21 days is > 7. P levels compare with the existing standards in the group of microbe concentration of 10% and 15% during the incubation period. The value of the initial BOD liquid waste of vegetable is 790.25 mg / L, this value indicates that the waste should not go into the water body. Accordingly, the results of this study can not be used as a liquid organic fertilizer, but potentially if it is used as a natural career or build natural soil. The Building natural soil is defined as the natural ingredients that can be used to improve soil properties.

  16. Instrumental analysis of bacterial cells using vibrational and emission Moessbauer spectroscopic techniques

    International Nuclear Information System (INIS)

    In biosciences and biotechnology, the expanding application of physicochemical approaches using modern instrumental techniques is an efficient strategy to obtain valuable and often unique information at the molecular level. In this work, we applied a combination of vibrational (Fourier transform infrared (FTIR), FT-Raman) spectroscopic techniques, useful in overall structural and compositional analysis of bacterial cells of the rhizobacterium Azospirillum brasilense, with 57Co emission Moessbauer spectroscopy (EMS) used for sensitive monitoring of metal binding and further transformations in live bacterial cells. The information obtained, together with ICP-MS analyses for metals taken up by the bacteria, is useful in analysing the impact of the environmental conditions (heavy metal stress) on the bacterial metabolism and some differences in the heavy metal stress-induced behaviour of non-endophytic (Sp7) and facultatively endophytic (Sp245) strains. The results show that, while both strains Sp7 and Sp245 take up noticeable and comparable amounts of heavy metals from the medium (0.12 and 0.13 mg Co, 0.48 and 0.44 mg Cu or 4.2 and 2.1 mg Zn per gram of dry biomass, respectively, at a metal concentration of 0.2 mM in the medium), their metabolic responses differ essentially. Whereas for strain Sp7 the FTIR measurements showed significant accumulation of polyhydroxyalkanoates as storage materials involved in stress endurance, strain Sp245 did not show any major changes in cellular composition. Nevertheless, EMS measurements showed rapid binding of cobalt(II) by live bacterial cells (chemically similar to metal binding by dead bacteria) and its further transformation in the live cells within an hour

  17. Instrumental analysis of bacterial cells using vibrational and emission Moessbauer spectroscopic techniques

    Energy Technology Data Exchange (ETDEWEB)

    Kamnev, Alexander A. [Laboratory of Biochemistry of Plant-Bacterial Symbioses, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, 410049 Saratov (Russian Federation)]. E-mail: aakamnev@ibppm.sgu.ru; Tugarova, Anna V. [Laboratory of Biochemistry of Plant-Bacterial Symbioses, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, 410049 Saratov (Russian Federation); Antonyuk, Lyudmila P. [Laboratory of Biochemistry of Plant-Bacterial Symbioses, Institute of Biochemistry and Physiology of Plants and Microorganisms, Russian Academy of Sciences, 410049 Saratov (Russian Federation); Tarantilis, Petros A. [Laboratory of Chemistry, Department of Science, Agricultural University of Athens, 11855 Athens (Greece); Kulikov, Leonid A. [Laboratory of Nuclear Chemistry Techniques, Department of Radiochemistry, Faculty of Chemistry, M.V. Lomonosov Moscow State University, 119992 Moscow (Russian Federation); Perfiliev, Yurii D. [Laboratory of Nuclear Chemistry Techniques, Department of Radiochemistry, Faculty of Chemistry, M.V. Lomonosov Moscow State University, 119992 Moscow (Russian Federation); Polissiou, Moschos G. [Laboratory of Chemistry, Department of Science, Agricultural University of Athens, 11855 Athens (Greece); Gardiner, Philip H.E. [Division of Chemistry, School of Science and Mathematics, Sheffield Hallam University, Sheffield S1 1WB (United Kingdom)

    2006-07-28

    In biosciences and biotechnology, the expanding application of physicochemical approaches using modern instrumental techniques is an efficient strategy to obtain valuable and often unique information at the molecular level. In this work, we applied a combination of vibrational (Fourier transform infrared (FTIR), FT-Raman) spectroscopic techniques, useful in overall structural and compositional analysis of bacterial cells of the rhizobacterium Azospirillum brasilense, with {sup 57}Co emission Moessbauer spectroscopy (EMS) used for sensitive monitoring of metal binding and further transformations in live bacterial cells. The information obtained, together with ICP-MS analyses for metals taken up by the bacteria, is useful in analysing the impact of the environmental conditions (heavy metal stress) on the bacterial metabolism and some differences in the heavy metal stress-induced behaviour of non-endophytic (Sp7) and facultatively endophytic (Sp245) strains. The results show that, while both strains Sp7 and Sp245 take up noticeable and comparable amounts of heavy metals from the medium (0.12 and 0.13 mg Co, 0.48 and 0.44 mg Cu or 4.2 and 2.1 mg Zn per gram of dry biomass, respectively, at a metal concentration of 0.2 mM in the medium), their metabolic responses differ essentially. Whereas for strain Sp7 the FTIR measurements showed significant accumulation of polyhydroxyalkanoates as storage materials involved in stress endurance, strain Sp245 did not show any major changes in cellular composition. Nevertheless, EMS measurements showed rapid binding of cobalt(II) by live bacterial cells (chemically similar to metal binding by dead bacteria) and its further transformation in the live cells within an hour.

  18. DUAL EFFECT OF AZOSPIRILLUM EXOPOLYSACCHARIDES (EPS) ON THE ENHANCEMENT OF PLANT GROWTH AND BIOCONTROL OF BLAST (PYRICULARIA ORYZAE) DISEASE IN UPLAND RICE (VAR. ASD-19)

    OpenAIRE

    A. Arul Selvi; S. Kalai Arasu

    2014-01-01

    The dual effect of exopolysaccharides of pseudomonas isolates viz, A17, A-18, A-26 and A-37 and certain ISR inducing chemicals viz, Salicylic acid, Jasmonic acid and Azibenzolar on the enhancement of plant growth and bio-control against blast disease in upland rice crop was studied under in-vitro condition. It was observed that the application of EPS, collected from pseudomonas isolates, augmented the height of rice plant and reduced the blast disease incidence in upland r...

  19. TECNOLOGÍA DE PRODUCCIÓN DE INOCULANTES DE Azospirillum Y FACTIBILIDAD ECONÓMICA DE SU APLICACIÓN AGRÍCOLA EN CULTIVOS SELECCIONADOS

    OpenAIRE

    Villar, J; Mabel Viñals; Xiomara Álvarez; M. Dorta

    2005-01-01

    El desarrollo de inoculantes bacterianos de uso agrícola puede contribuir a la disminución del empleo de fertilizantes químicos y favorecer el medio ambiente. Sin embargo, su aplicación debe resultar económica para los productores, sin detrimento de los rendimientos agrícolas tradicionales. En el presente trabajo se estiman los indicadores económicos de una planta industrial, a partir de una nueva tecnología que emplea turba y cachaza como soporte, para la obtención de dos tipos de inoculante...

  20. Compatibilité des bactéries phytobénéfiques Azospirillum et Pseudomonas dans la rhizosphère

    OpenAIRE

    Couillerot, Olivier

    2009-01-01

    Les bactéries rhizosphériques qualifiées de PGPR (Plant Growth-Promoting Rhizobacteria) forment des symbioses associatives avec les plantes, stimulant la croissance de ces dernières. Les PGPR présentent différents mécanismes phytobénéfiques (production de phytohormones, fixation non symbiotique de l'azote, etc.). Plusieurs PGPR sont susceptibles d'interagir avec la même plante hôte, et il est possible que leurs effets phytobénéfiques soient influencés par les interactions qu'elles auront les ...

  1. Speciation and transformations of cobalt(II) in bacterial cells using emission (57Co) Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Complete text of publication follows. The 57Co emission variant of Moessbauer spectroscopy (EMS), despite its solitary applications in biology owing to intrinsic methodological difficulties (Yu.D. Perfiliev, A.A. Kamnev, Moessbauer Effect Ref. and Data J., 30 (2007) 121-122; A.A. Kamnev, J. Mol. Struct., 744-747 (2005) 161-167), is highly sensitive and informative. The parameters of 57Co emission spectra provide chemical speciation data for the 57Co cation (chemical state, coordination environment and symmetry, etc.), as well as quantitative information on its distribution between different cation-binding sites in complicated biosystems (A.A. Kamnev, in 'Metal Ions in Biology and Medicine', Vol. 10, John Libbey Eurotext, Paris (2008), pp. 522-527). 57Co EMS can be successfully applied for monitoring 57Co2+ interactions with microbial cells, including its metabolic transformations (A.A. Kamnev et al., Anal. Chim. Acta, 573-574 (2006) 445-452). Comparative studies in rapidly frozen aqueous suspensions of live and dead cells of the ubiquitous phytostimulating soil bacterium Azospirillum brasilense have shown similarities in the chemical species formed upon purely chemical interaction of 57Co2+ traces with dead cell biomass and those formed upon primary rapid steps (2 min) of 57Co2+ sorption by the surface of live cells. For live cells, however, the parameters of 57Co emission spectra were found to change within an hour, which reflected ongoing metabolic transformations of the cation. The data obtained are in good agreement with the recently discovered involvement of Co2+ in reactions with labile [Fe-S] clusters during their de novo biosynthesis or repair in E. coli (C. Ranquet et al., J. Biol. Chem., 282 (2007) 30442-30451), presenting the molecular basis for Co2+ toxicity, besides Co2+-induced oxidative stress. The results obtained show that 57Co EMS can provide unique information both for speciation bioanalysis and for the monitoring of radionuclide bioleaching and

  2. A disposable laser print-cut-laminate polyester microchip for multiplexed PCR via infra-red-mediated thermal control.

    Science.gov (United States)

    Ouyang, Yiwen; Duarte, Gabriela R M; Poe, Brian L; Riehl, Paul S; dos Santos, Fernando M; Martin-Didonet, Claudia C G; Carrilho, Emanuel; Landers, James P

    2015-12-11

    Infrared (IR)-mediated thermal cycling system, a method proven to be a effective for sub-μL scale polymerase chain reaction (PCR) on microchips, has been integrated with DNA extraction and separation on a glass microchip in a fully integrated micro Total Analysis System by Easley et al., in 2006. IR-PCR has been demonstrated on both glass and PMMA microdevices where the fabrication (bonding) is not trivial. Polyester-toner (PeT) microfluidic devices have significant potential as cost-effective, disposable microdevices as a result of the ease of fabrication (∼$0.25 USD and <10 min per device) and availability of commercial substrates. For the first time, we demonstrate here the thermal cycling in PeT microchips on the IR-PCR system. Undesirable IR absorption by the black-toner bonding layer was eliminated with a spatial filter in the form of an aluminum foil mask. The solution heating rate for a black PeT microchip using a tungsten lamp was 10.1 ± 0.7 °C s(-1) with a cooling rate of roughly -12 ± 0.9 °C s(-1) assisted by forced air cooling. Dynamic surface passivation strategies allowed the successful amplification of a 520 bp fragment of the λ-phage genome (in 11 min) and a 1500 bp region of Azospirillum brasilense. Using a centrosymmetric chamber configuration in a multichamber PeT microchip, homogenous temperature distribution over all chambers was achieved with inter-chamber temperature differences at annealing, extension and denaturing steps of less than ±2 °C. The effectiveness of the multichamber system was demonstrated with the simultaneous amplification of a 390 bp amplicon of human β-globin gene in five PeT PCR microchambers. The relative PCR amplification efficiency with a human β-globin DNA fragment ranged from 70% to 90%, in comparison to conventional thermal cyclers, with an inter-chamber standard deviation of ∼10%. Development of PeT microchips for IR-PCR has the potential to provide rapid, low-volume amplification while

  3. АГРОТЕХНОЛОГИЧЕСКИЕ ОСНОВЫ СОЗДАНИЯ УСОВЕРШЕНСТВОВАННЫХ ФОРМ МИКРОБНЫХ БИОПРЕПАРАТОВ ДЛЯ ЗЕМЛЕДЕЛИЯ

    OpenAIRE

    Кожемяков, А.; Лактионов, Ю.; Попова, Т.; Орлова, А.; Кокорина, А.; Вайшля, О.; Агафонов, Е.; Гужвин, С.; Чураков, А.; Яковлева, М.

    2015-01-01

    Выполнены комплексные исследования по созданию жидкой формы биопрепаратов для симбиотических и ассоциативных ризобактерий. Объектами изучения служили клубеньковые бактерии, обитающие в ризосфере козлятника (Rhizobium galegae), сои (Bradyrhizobium japonicum), и ассоциативные ризобактерии (Arthrobacter mysorens, Azospirillum brasilense, Ag-robacterium radiobacter), а также растения сои (Glycine max), кукурузы (Zea L.) и пшеницы (Triticum L.). В качестве носителей бактерий использовали гамма-сте...

  4. Modificacion del Valor Nutrimental de Acidos Grasos en Semilla de la Halofita Salicornia bigelovii Torr. con la Interaccion de Bacterias Promotoras del Crecimiento de Plantas (Azospirillum halopraeferens y Klebsiella pneumoniae)

    OpenAIRE

    Edgar Omar Rueda Puente; Enrique Troyo Dieguez; Thelma Castellanos Cervantes; Bernardo Murillo-Amador; Bertha Olivia Arredondo Vega; Jose Luis Díaz de Leon Alvarez; Mario Antonio Tarazon Herrera

    2005-01-01

    Una especie vegetal a gran escala se presenta como una alternativa para la producción de ácidos grasos esenciales en nutrición humana por lo que su composición de ácidos grasos cobra especial importancia. Salicornia bigelovii una halófita que se desarrolla en ambientes áridos y costeros como las del estado de Sonora y de la península de Baja California Sur, México, presenta ser una especie alternativa en la producción de aceites comestibles. La fijación de N2 por bacterias asociadas con raíce...

  5. Estimation of the efficiency of hydrocarbon mineralization in soil by measuring CO2-emission and variations in the isotope composition of carbon dioxide

    Science.gov (United States)

    Dubrovskaya, Ekaterina; Turkovskaya, Olga

    2010-05-01

    Estimation of the efficiency of hydrocarbon mineralization in soil by measuring CO2-emission and variations in the isotope composition of carbon dioxide E. Dubrovskaya1, O. Turkovskaya1, A. Tiunov2, N. Pozdnyakova1, A. Muratova1 1 - Institute of Biochemistry and Physiology of Plants and Microorganisms, RAS, Saratov, 2 - A.N. Severtsov Institute of Ecology and Evolution, RAS, Moscow, Russian Federation Hydrocarbon mineralization in soil undergoing phytoremediation was investigated in a laboratory experiment by estimating the variation in the 13С/12С ratio in the respired СО2. Hexadecane (HD) was used as a model hydrocarbon pollutant. The polluted soil was planted with winter rye (Secale cereale) inoculated with Azospirillum brasilense strain SR80, which combines the abilities to promote plant growth and to degrade oil hydrocarbon. Each vegetated treatment was accompanied with a corresponding nonvegetated one, and uncontaminated treatments were used as controls. Emission of carbon dioxide, its isotopic composition, and the residual concentration of HD in the soil were examined after two and four weeks. At the beginning of the experiment, the CO2-emission level was higher in the uncontaminated than in the contaminated soil. After two weeks, the quantity of emitted carbon dioxide decreased by about three times and did not change significantly in all uncontaminated treatments. The presence of HD in the soil initially increased CO2 emission, but later the respiration was reduced. During the first two weeks, nonvegetated soil had the highest CO2-emission level. Subsequently, the maximum increase in respiration was recorded in the vegetated contaminated treatments. The isotope composition of plant material determines the isotope composition of soil. The soil used in our experiment had an isotopic signature typical of soils formed by C3 plants (δ13C,-22.4‰). Generally, there was no significant fractionation of the carbon isotopes of the substrates metabolized by the

  6. Response of Sunflower (Helianthus annuus L.) to N-application and Bio fertilization with Assessment of Fertilizer N Recovery by 15N Versus Subtraction Methods

    International Nuclear Information System (INIS)

    A factorial field experiment was conducted on sunflower (Helianthus annuus L.) grown on a sand soil (98% sand) supplied the different combinations of 4 N rates of 0, 105, 140 and 175 kg N ha-1 i.e. N0, N1, N2, and N3 respectively - as (NH4)2SO4 and 4 bio fertilization inoculation (B) of none, Azotobacter chroococcum, Azospirillum brasilense and Bacillus megaterium. i.e. B0,B1,B2, and B3 respectively. Labeled ammonium sulphate with 2% 15N atom excess was used for 15N assessment. All plots were supplied with 21 Mg compost +24 kg P +80 kg K ha-'1. Non-treated plants gave 0.534 Mg seeds ha-1 while the treated ones - especially those of N or N + bio fertilizers - gave increases of up to 403% (N2B). Main effect response patterns were: N: N3>N2>N1, for B: B1≥B3≥B2. Seed oil content in the N0B0 treatment was 222 gkg-1 increased reaching as high as 445 gkg-1by N2B3; with N main effect of N2>N3>N1and B main effect of B2>B3>B1. Seed oil yield was 113 kg ha-1 by N0B0 increased to as high as 1105 kg ha-1 by N2B1 with main effects of N2>N3>N1and B3≥B2>B1.Uptake of N (in total plant parts of roots + stems + leaves + discs + seeds) increased by N application; averages for non-N were 18.1 kg ha-118.5,14.7,17.4 by N0B0, N0B1, N0B2, and N0B3 respectively; increased considerably by up to 667% (N3B3) upon N application. Plants recovered a portion of fertilizer N of 19.6 to 40.9% by N1B1and N2B1 respectively as determined by 15N technique, but 27.7 to 59.6% respectively as calculated by subtraction of non-N from N treatments. The subtraction estimation considerably exceeded the 15N determined ones by + 39.5% to as high as + 194.6% indicating a non-real estimation of recovered fertilizer-N in crops. Thus, in studies using non-tracer techniques, estimation of uptake of fertilizer N could be erroneous. The reason in the current study could most certainly be a greater volume of root system expansion of N-treated plants, causing more uptake of non-fertilizer-N than in the no

  7. IMPACT OF BIOFERTILIZER SEED TREATMENT ON SEED AND SEEDLING PARAMETERS OF MAIZE (ZEA MAYS L.)

    OpenAIRE

    ANIMESH PATHAK; S. K. CHAKRABORTI

    2014-01-01

    To study influence of inorganic nitrogen and seed treatment with Azospirillum on different seed quality parameters, four local cultivars of maize seed were treated with full inorganic nitrogen (T1), half inorganic nitrogen with Azospirillum (T2) and Azospirillum (T3). Germination percentage for T2 exhibited significant increase than T1 and T3. The fresh and dry weight of root and shoot was significantly high for T2 followed by T1 and than T3. The vigour index was also found to...

  8. IMPACT OF BIOFERTILIZER SEED TREATMENT ON SEED AND SEEDLING PARAMETERS OF MAIZE (ZEA MAYS L.

    Directory of Open Access Journals (Sweden)

    ANIMESH PATHAK

    2014-03-01

    Full Text Available To study influence of inorganic nitrogen and seed treatment with Azospirillum on different seed quality parameters, four local cultivars of maize seed were treated with full inorganic nitrogen (T1, half inorganic nitrogen with Azospirillum (T2 and Azospirillum (T3. Germination percentage for T2 exhibited significant increase than T1 and T3. The fresh and dry weight of root and shoot was significantly high for T2 followed by T1 and than T3. The vigour index was also found to be significantly high in T2. When varieties were taken into account with regard to their response towards different treatments, V3 responded best followed by V2 and V1 for the character germination percentage. Increased germination percentage, vigour index by treatment T2 for different varieties of maize encourage use of low cost, ecofriendly Azospirillum seed treatment.

  9. ClEST cluster :Cl_singleton0883 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_singleton0883 dehydrogenase domain protein Cimex lectularius nuclear gene 257 TCGATTACAACTGAA ... AAAAGGCTACTGACG fs14067 1 unnamed protein product [Azospirillum ... lipoferum 4B] YP_005037771 4.11457E-19 GO:0016616 ...

  10. http://aygrt.isrj.net/UploadedData/3464.pdf

    OpenAIRE

    S. Kalaiarasu; Vivekanandhan, S.

    2014-01-01

    The effect of exopolysaccharides of Azospirillum isolates viz., Azo-16, Azo-19, PS-24 and PS- 28 and certain ISR inducing chemicals viz., Salicylic acid, Jasmonic acid and Azibenzolar on the enhancement of plant growth and bio-control against blast disease in lowland rice crop was studied under in-vitro condition. It was observed that the application of EPS, collected from Azospirillum isolates and Pseudomonas isolates, augmented the height of rice plant and reduced the blast ...

  11. Effect of manure and NPK to increase soil bacterial population of Azotobacter and Azospirillus in chili (Capsicum annum) cultivation

    OpenAIRE

    SUPRIYADI; MUJIYATI

    2009-01-01

    Mujiyati, Supriyadi. 2009. Effect of manure and NPK to increase soil bacterial population of Azotobacter and Azospirillum in chili (Capsicum annum) cultivation. Nusantara Bioscience 1: 59-64. The objectives of this research were to find out the increase number of two bacterials populations, Azotobacter and Azospirillum, due to the use of manure fertilizer. The exsperiment was conducted using group randomly designed with two treatments. The plant populations were treated (i) whithout fertilize...

  12. Effect of Biofertilizers on Agronomic Criteria of Hyssop (Hyssopus officinalis)

    OpenAIRE

    Tabrizi, Leila; Alireza KOOCHEKI; Ghorbani, Reza

    2008-01-01

    An experiment was conducted under field conditions to evaluate the effects of pure or combinations of biofertilizers on agronomic and quality criteria of Hyssop (Hyssopus officinalis), a medicinal and aromatic plant from Labiateae family at the Research Station of the Faculty of Agriculture, Ferdowsi University of Mashhad, during 2006 and 2007. A complete randomized block design with three replications was used. Treatments containing Azospirillum/Azotobacter(Nitroxin), Azospirillum/Bacillus s...

  13. Biomass and nutrient distribution and their return of Casuarina equisetifolia inoculated with biofertilizers in farm land

    Energy Technology Data Exchange (ETDEWEB)

    Rajendran, K.; Devaraj, P. [Institute of Forest Genetics and Tree Breeding, Coimbatore (India)

    2004-03-01

    An experiment was conducted to study the productivity, nutrient distribution and nutrient cycling of Casuarina equisetifolia Forst in farm forestry. Seedlings inoculated with different biofertilizers such as Azospirillum, Phosphobacterium, AM fungi and Frankia along with their combinations were planted in farmland. Growth, biomass, nutrient distribution, nutrient uptake and nutrient-return through litter were estimated 24 months after planting by harvesting the plant. The height of the tree is ranged from 9.87 to 11.90 m and the girth at breast height (gbh) is ranged from 16.8 to 23.2 cm. The maximum height, gbh and total biomass were obtained in the combined application of Azospirillum, Phosphobacterium, AM and Frankia. The combination of AM + Frankia among double inoculation, and in combination of Azospirillum, AM and Frankia in triple inoculation also proved to be the best treatment in promoting the significant total height, gbh and total biomass production. Better nutrient uptake was estimated in combined inoculation of Azospirillum + Phosphobacterium + AM + Frankia followed by Azospirillum + AM + Frankia in respect of the nutrients such as N, P, K, Ca and Mg. The nutrient concentration was distributed in the order of needle > branch > root nodule > twig > stem > root. Nutrient return in field condition showed the maximum nutrient-return through litter in combination with Azospirillum + Phosphobacterium + AM + Frankia inoculated trees. (author)

  14. Molecular and physiological responses of sunflower (helianthus annuus l.) to pgpr and sa under salt stress

    International Nuclear Information System (INIS)

    This paper presents the efficacy of PGPR (Azospirillum and Pseudomonas) and its modulation by salicylic acid. Two hybrids of sunflower (Hysun and Parsun) were inoculated with Azospirillum spp. and Pseudomonas spp. prior to sowing. Salt stress (20 dSm-1) was applied 28 d after sowing followed by foliar spray of salicylic acid (100 micro M) after 4 h of salt treatment. Azospirillum and Pseudomonas inoculation alone and in combination with salicylic acid alleviated the effects of salt stress on both the sunflower hybrids. The salt tolerance in these treatments was mediated by an increase in relative water content, carotenoids, proline, ABA, induction of new polypeptide bands and yield of sunflower hybrids. In response to salt stress four new polypeptide bands were synthesized in both Hysun, whereas, a group of six polypeptide bands were observed in Parsun. Application of salicylic acid alone and in combination with Azospirillum found to induce four new polypeptide bands in Hysun and Parsun. It is inferred that synthesis of new proteins in response to the combined application of salicylic acid and Azospirillum under salt stress, may play an important role as stress proteins in tolerance of sunflower hybrids to salt stress. (author)

  15. Comparative study of the fungicide Benomyl toxicity on some plant growth promoting bacteria and some fungi in pure cultures

    Directory of Open Access Journals (Sweden)

    Elslahi Randa H.

    2014-03-01

    Full Text Available Six laboratory experiments were carried out to investigate the effect of the fungicide Benomyl on pure cultures of some plant growth promoting bacteria (PGPB and some fungi. The highest LD50 was recorded for Bacillus circulans and proved to be the most resistant to the fungicide, followed by Azospirillum braziliense, while Penicillium sp. was the most affected microorganism. LD50 values for the affected microorganisms were in 21-240 orders of magnitude lower in comparison with the LD50 value for Azospirillum braziliense. The results indicate a strong selectivity for Benomyl against Rhizobium meliloti and Penicillium sp. when compared to other microorganisms tested. The highest safety coefficient was recorded for Bacillus circulans followed by Azospirillum braziliense, while Rhizobium meliloti, showed the lowest safety coefficient value compared to other bacteria. The lowest toxicity index was recorded for Bacillus circulans and Azospirillum braziliense. The slope of the curves for Bacillus sp. and Rhizobium meliloti was steeper than that of the other curves, suggesting that even a slight increase of the dose of the fungicide can cause a very strong negative effect. In conclusion, Benomyl could be applied without restriction when using inocula based on growth promoting bacteria such as symbiotic nitrogen fixers (Rhizobium meliloti, non-symbiotic nitrogen fixers (Azospirillum braziliense or potassium solibilizers (Bacillus circulans, given that the fungicide is applied within the range of the recommended field dose.

  16. Comparative study of the fungicide Benomyl toxicity on some plant growth promoting bacteria and some fungi in pure cultures.

    Science.gov (United States)

    Elslahi, Randa H; Osman, Awad G; Sherif, Ashraf M; Elhussein, Adil A

    2014-03-01

    Six laboratory experiments were carried out to investigate the effect of the fungicide Benomyl on pure cultures of some plant growth promoting bacteria (PGPB) and some fungi. The highest LD50 was recorded for Bacillus circulans and proved to be the most resistant to the fungicide, followed by Azospirillum braziliense, while Penicillium sp. was the most affected microorganism. LD50 values for the affected microorganisms were in 21-240 orders of magnitude lower in comparison with the LD50 value for Azospirillum braziliense. The results indicate a strong selectivity for Benomyl against Rhizobium meliloti and Penicillium sp. when compared to other microorganisms tested. The highest safety coefficient was recorded for Bacillus circulans followed by Azospirillum braziliense, while Rhizobium meliloti, showed the lowest safety coefficient value compared to other bacteria. The lowest toxicity index was recorded for Bacillus circulans and Azospirillum braziliense. The slope of the curves for Bacillus sp. and Rhizobium meliloti was steeper than that of the other curves, suggesting that even a slight increase of the dose of the fungicide can cause a very strong negative effect. In conclusion, Benomyl could be applied without restriction when using inocula based on growth promoting bacteria such as symbiotic nitrogen fixers (Rhizobium meliloti), non-symbiotic nitrogen fixers (Azospirillum braziliense) or potassium solibilizers (Bacillus circulans), given that the fungicide is applied within the range of the recommended field dose. PMID:26038670

  17. Effects of Vermi-compost and Two Bacterial Bio-fertilizers on some Quality Parameters of Petunia

    Directory of Open Access Journals (Sweden)

    Mina Zarghami MOGHADAM

    2013-05-01

    Full Text Available The present research was conducted to study the effect of vermi-compost and two bio-fertilizer applications on growth, yield and quality of petunia (Petunia hybrida. The experiment laid out in randomized block design with 3 replications and 9 treatment combinations composing of vermi-compost, bio-fertilizers and NPK fertilizer. The treatment receiving Azospirillum sp. + Phosphate solubilizing bacterium + Vermicompost + NPK (25% of recommended dose recorded the highest plant height, number of branches, plant spread, leaf area index, dry matter accumulation and yield attributes such as number of flowers per plant, number of flowers per plot, flower yield/plant, flower yield/plot. The early flower bud initiation, 50 percent flowering and more flowering duration was achieved in the treatment receiving Azospirillum sp. + Phosphate solubilizing bacterium + Vermicompost + NPK (25% of recommended dose. Application of Azospirillum sp. + Phosphate solubilizing bacterium + Vermicompost + NPK (25% of recommended dose registered significantly higher quality parameters such as flower diameter.

  18. Alterations in seedling vigour and antioxidant enzyme activities in Catharanthus roseus under seed priming with native diazotrophs

    Institute of Scientific and Technical Information of China (English)

    KARTHIKEYAN B.; JALEEL C.A.; GOPI R.; DEIVEEKASUNDARAM M.

    2007-01-01

    An experiment was conducted on Catharanthus roseus to study the effect of seed treatments with native diazotrophs on its seedling growth and antioxidant enzyme activities. The treatments had significant influence on various seedling parameters.There is no significant influence on dry matter production with the diazotrophs, Azospirillum and Azotobacter. However, the vital seedling parameters such as germination percentage and vigour index were improved. Azotobacter treatment influenced maximum of 50% germination, whereas Azospirillum and Azotobacter were on par with C. roseus with respect to their vigour index. There was significant difference in the population of total diazotrophs. Azospirillum and Azotobacter between rhizosphere and non-rhizosphere soils of C. roseus had the same trend and were observed at various locations of the study. The activities of antioxidant enzymes such as superoxide dismutase (SOD), peroxidase (POX) and catalase (CAT) were increased to a significant extent due to the treatment with diazotrophs.

  19. Alterations in seedling vigour and antioxidant enzyme activities in Catharanthus roseus under seed priming with native diazotrophs

    Science.gov (United States)

    Karthikeyan, B.; Jaleel, C.A.; Gopi, R.; Deiveekasundaram, M.

    2007-01-01

    An experiment was conducted on Catharanthus roseus to study the effect of seed treatments with native diazotrophs on its seedling growth and antioxidant enzyme activities. The treatments had significant influence on various seedling parameters. There is no significant influence on dry matter production with the diazotrophs, Azospirillum and Azotobacter. However, the vital seedling parameters such as germination percentage and vigour index were improved. Azotobacter treatment influenced maximum of 50% germination, whereas Azospirillum and Azotobacter were on par with C. roseus with respect to their vigour index. There was significant difference in the population of total diazotrophs. Azospirillum and Azotobacter between rhizosphere and non-rhizosphere soils of C. roseus had the same trend and were observed at various locations of the study. The activities of antioxidant enzymes such as superoxide dismutase (SOD), peroxidase (POX) and catalase (CAT) were increased to a significant extent due to the treatment with diazotrophs. PMID:17610323

  20. Differential Response of Potato Toward Inoculation with Taxonomically Diverse Plant Growth Promoting Rhizobacteria

    Science.gov (United States)

    Naqqash, Tahir; Hameed, Sohail; Imran, Asma; Hanif, Muhammad Kashif; Majeed, Afshan; van Elsas, Jan Dirk

    2016-01-01

    Rhizosphere engineering with beneficial plant growth promoting bacteria offers great promise for sustainable crop yield. Potato is an important food commodity that needs large inputs of nitrogen and phosphorus fertilizers. To overcome high fertilizer demand (especially nitrogen), five bacteria, i.e., Azospirillum sp. TN10, Agrobacterium sp. TN14, Pseudomonas sp. TN36, Enterobacter sp. TN38 and Rhizobium sp. TN42 were isolated from the potato rhizosphere on nitrogen-free malate medium and identified based on their 16S rRNA gene sequences. Three strains, i.e., TN10, TN38, and TN42 showed nitrogen fixation (92.67–134.54 nmol h-1mg-1 protein), while all showed the production of indole-3-acetic acid (IAA), which was significantly increased by the addition of L-tryptophan. Azospirillum sp. TN10 produced the highest amount of IAA, as measured by spectrophotometry (312.14 μg mL-1) and HPLC (18.3 μg mL-1). Inoculation with these bacteria under axenic conditions resulted in differential growth responses of potato. Azospirillum sp. TN10 incited the highest increase in potato fresh and dry weight over control plants, along with increased N contents of shoot and roots. All strains were able to colonize and maintain their population densities in the potato rhizosphere for up to 60 days, with Azospirillum sp. and Rhizobium sp. showing the highest survival. Plant root colonization potential was analyzed by transmission electron microscopy of root sections inoculated with Azospirillum sp. TN10. Of the five test strains, Azospirillum sp. TN10 has the greatest potential to increase the growth and nitrogen uptake of potato. Hence, it is suggested as a good candidate for the production of potato biofertilizer for integrated nutrient management. PMID:26925072

  1. Differential Response of Potato Toward Inoculation with Taxonomically Diverse Plant Growth Promoting Rhizobacteria.

    Science.gov (United States)

    Naqqash, Tahir; Hameed, Sohail; Imran, Asma; Hanif, Muhammad Kashif; Majeed, Afshan; van Elsas, Jan Dirk

    2016-01-01

    Rhizosphere engineering with beneficial plant growth promoting bacteria offers great promise for sustainable crop yield. Potato is an important food commodity that needs large inputs of nitrogen and phosphorus fertilizers. To overcome high fertilizer demand (especially nitrogen), five bacteria, i.e., Azospirillum sp. TN10, Agrobacterium sp. TN14, Pseudomonas sp. TN36, Enterobacter sp. TN38 and Rhizobium sp. TN42 were isolated from the potato rhizosphere on nitrogen-free malate medium and identified based on their 16S rRNA gene sequences. Three strains, i.e., TN10, TN38, and TN42 showed nitrogen fixation (92.67-134.54 nmol h(-1)mg(-1) protein), while all showed the production of indole-3-acetic acid (IAA), which was significantly increased by the addition of L-tryptophan. Azospirillum sp. TN10 produced the highest amount of IAA, as measured by spectrophotometry (312.14 μg mL(-1)) and HPLC (18.3 μg mL(-1)). Inoculation with these bacteria under axenic conditions resulted in differential growth responses of potato. Azospirillum sp. TN10 incited the highest increase in potato fresh and dry weight over control plants, along with increased N contents of shoot and roots. All strains were able to colonize and maintain their population densities in the potato rhizosphere for up to 60 days, with Azospirillum sp. and Rhizobium sp. showing the highest survival. Plant root colonization potential was analyzed by transmission electron microscopy of root sections inoculated with Azospirillum sp. TN10. Of the five test strains, Azospirillum sp. TN10 has the greatest potential to increase the growth and nitrogen uptake of potato. Hence, it is suggested as a good candidate for the production of potato biofertilizer for integrated nutrient management. PMID:26925072

  2. Differential growth stimulation response of potato towards inoculation with taxonomically diverse plant growth promoting rhizobacteria

    Directory of Open Access Journals (Sweden)

    Tahir eNaqqash

    2016-02-01

    Full Text Available Rhizosphere engineering with beneficial plant growth promoting bacteria offers great promise for sustainable crop yield. Potato is an important food commodity that needs large inputs of nitrogen and phosphorus fertilizers. To overcome high fertilizer demand (especially nitrogen, five bacteria, i.e. Azospirillum sp.TN10, Agrobacterium sp.TN14, Pseudomonas sp.TN36, Enterobactersp. TN38 and Rhizobium sp. TN42 were isolated from the potato rhizosphere on nitrogen-free malate medium and identified based on their 16S rRNA gene sequences. Three strains, i.e. TN10, TN38 and TN42, showed nitrogen fixation (92.67-134.54 nmol h-1mg-1protein, while all showed the production of indole acetic acid in the presence and/or absence of L-tryptophan. Azospirillum sp. TN10 produced the highest amount of IAA, as measured by spectrophotometry (312.14 µg mL-1 and HPLC (18.3 µg mL-1. Inoculation with these bacteria under axenic conditions resulted in differential growth responses of potato. Azospirillum sp. TN10 incited the highest increase in potato fresh and dry weight over control plants, along with increased N contents of shoot and roots. All strains were able to colonize and maintain their population densities in the potato rhizosphere for upto 60 days, with Azospirillum sp. and Rhizobium sp. showing the highest survival. Plant root colonization potential was analyzed by transmission electron microscopy of root sections inoculated with Azospirillum sp. TN10. Of the five test strains, Azospirillum sp. TN10 has the greatest potential to increase the growth and nitrogen uptake of potato. Hence, it is suggested as a good candidate for the production of potato biofertilizer for integrated nutrient management with potato.

  3. Isolation and identification by 16S rRNA sequence analysis of plant growth-promoting azospirilla from the rhizosphere of wheat

    OpenAIRE

    Ayyaz, Khadija; Zaheer, Ahmad; Rasul, Ghulam; Mirza, Muhammad Sajjad

    2016-01-01

    The main objective of the present study was to isolate phytohormone-producing, phosphate-solubilizing strains of Azospirillum from wheat to be used as inoculants for plant growth promotion. Five Azospirillum strains were isolated from the rhizosphere of field-grown wheat (Triticum aestivum L.), and it was confirmed by BOX-polymerase chain reaction (PCR) that the isolates were different and not re-isolates of the same strain. Sequence analysis of the PCR-amplified 16S rRNA gene indicated that ...

  4. Characterization of N/sub 2/-fixing bacteria and their role in plant growth under humic acid treatment

    International Nuclear Information System (INIS)

    Diazo trophic bacteria isolated from rice belonged to the six genera i.e. Pseudomonas, Azospirillum, Azotobacter, Xanthobacter, Flavobacterium and Zoogloea. During reinoculation studies it was observed that the rice roots grow well under humic acid treatment. The maximum root length 49.5 cm, was recorded at 10 ppm in plants inoculated with Azospirillum strain K-1. The total plant dry weight increase was also observed with the same organism at the similar humic acid concentration. In wheat the bacterial inoculation or humic acid treatment separately increased the dry weight of plant, however the humic acid treatment followed by inoculation of bacteria always cause decrease in total dry weight of plants. (author)

  5. Effect of manure and NPK to increase soil bacterial population of Azotobacter and Azospirillus in chili (Capsicum annum cultivation

    Directory of Open Access Journals (Sweden)

    SUPRIYADI

    2009-07-01

    Full Text Available Mujiyati, Supriyadi. 2009. Effect of manure and NPK to increase soil bacterial population of Azotobacter and Azospirillum in chili (Capsicum annum cultivation. Nusantara Bioscience 1: 59-64. The objectives of this research were to find out the increase number of two bacterials populations, Azotobacter and Azospirillum, due to the use of manure fertilizer. The exsperiment was conducted using group randomly designed with two treatments. The plant populations were treated (i whithout fertilizer as the control, (ii with manure fertilizer, and (iii with NPK fertilizer. Data was experimentally collected by planting chili in several plots treated by manure, with three replications. The field experiment was conducted in Gathak Village, Karangnongko Sub-district, Klaten District, Central Java. The data collected consist of the total population of Azotobacter and Azospirillum, nitrogen content in soil and the chili yield. The primary data of research were analyzed using ANOVA test and followed by LSD test, with the degree of significance by 95% .The results showed that the manure fertilizer can increase the population of bacteria as many as 0.02% (Azotobacter and 0.46% (Azospirillum when they were compared to the control one. So that it can increase the soil fertility when they were used in long time. Therefore increasing the nutrient availability in the soil was occurred. Application of manure fertilizer could increase the total nitrogen content in the soil and it is very useful for the fertilizing of plants.

  6. INTEGRATED NUTRIENT MANAGEMENT IN SUNFLOWER +APIARY FARMING SYSTEM FOR SUSTAINABLE PRODUCTIVITY

    Directory of Open Access Journals (Sweden)

    G .SUMALATHA AND T. GEETHA JEBARATHNAM

    2014-10-01

    Full Text Available ABSTRACT: Two sets of field experiments were conducted during  June-August months of 2012-2013 at Annamalai University of Cuddalore district under irrigated conditions to formulate site –specific nutrient management and to assess the yield  performance of sunflower +apiary farming system.The experiment consists of two main treatments; i.e, sunflower alone (M1 ,sunflower  with apiary (M2 and nine sub treatments i.e, control (S1, 100%RDF (S2, 100%RDF + Azospirillum (S3,100% RDF+phosphobacteria (S4,100%RDF+vermicompost (S5, 100%RDF+ Azospirillum+ phosphobacteria (S6, 100% RDF + Vermicompost +Azospirillum (S7, 100%RDF+ vermicompost+phosphobacteria (S8,100%RDF + Vermicompost + Azospirillum+phosphobacteria(S9 and it was laid out in split plot design with three replications .Highest values for seed yield and NPK uptake were observed for the combined application of all three nutrient sources in the plots of the experiment where beehive was installed. Perhaps to ensure better outcome. The apiary should be provided with better feeding for a longer period of time, beside  the natural feeding resources .feed consists of 500ml sugar syrup two times a week. Infact the bee foraging activites, improved seed yield, apart from the income through honey production, thus sustaining the crop + apiary system.

  7. Cultivation-based and molecular assessment of bacterial diversity in the rhizosheath of wheat under different crop rotations

    NARCIS (Netherlands)

    Tahir, Muhammad; Mirza, M.S.; Hameed, Sohail; Rocha Dimitrov, Mauricio; Smidt, Hauke

    2015-01-01

    A field study was conducted to compare the formationand bacterial communities of rhizosheaths of wheat grown under wheat-cotton and wheat-rice rotation and to study the effects of bacterial inoculation on plant growth. Inoculation of Azospirillum sp. WS-1 and Bacillus sp. T-34 to wheat plants inc

  8. Lack of nifH gene in some endophytic bacteria isolated on RC solid medium.

    Science.gov (United States)

    Pisarska, K; Adamski, M; Pietr, S J

    2011-01-01

    Presence of endophytic bacteria was reported in many crops including maize (Zea mays L.). Endophytes play a significant role in plant nutrient and pesticide uptake. Application of endophytic bacteria is a goal of sustainable agriculture. Occurrence of Azospirillum strains is often reported as tissue inhabiting bacteria of maize. The biological N2-fixation is one of most important processes assigned to this bacteria. The objective of this study was to examine the biodiversity of Azospirillum spp. isolated from the leaves of 6 cultivars of Zea mays L.. They were cultivated on two experimental fields at Smolice and Kobierzyce, (Poland). Strains of Azospirillum spp. were isolated on the solid RC medium. Forty four isolates grown as a small intensive red colonies were selected. To verify ability to N2-fixation isolates were analyzed based on nifH gene presence. Presence of nifH gene was tested using PCR method with PolF and PolR universal degenerate primers. The presence of nifH gene was found in 6 tested strains isolated from leaves of 3 cultivars (Cyrkon, Kosmo230, KB2704) from Smolice location, only. Our results suggest that selection of Azospirillum-like strains on RC solid medium based on appearance of colony is not correlated with theirs ability to nitrogen fixation or used degenerated primers (PolF, PolR) are not universal enough. PMID:22702189

  9. Elimination of Pathogenic Bacterium (Micrococcus sp.) by the Use of Probiotics

    OpenAIRE

    , Tejpal Dahiya; , S. K. Gahlawat; R.C. Sihag

    2012-01-01

    Probiotics 1 (Lactobacillus sporogenes), 2 (Saccharomyces boulardii) and 3 (Nitromonas, Rhodococcus, Bacilus megaterium, Lecheni formis, Desulphovibrio sulphuricum, Psuedomonas, Chromatium, Chlorobium, Thiobacillus, Thioxidants, Thiobacilus ferroxidant, Methylomonas methyanica, Glucon acetobactor, Azospirillum, Trichoderma, Shizophyllum commune and Sclertium gluconicum) were tested against the pathogenic Micrococcus sp. oxt in vitro as well a...

  10. Isolation And Purification Of Plant Growth Promoting Rhizobacteria (Pgpr From The Rhizosphere Of Acorus Calamus Grown Soil

    Directory of Open Access Journals (Sweden)

    P. Prakash

    2013-08-01

    Full Text Available Among the 10 bacterial isolates were obtained from Acorus calamus rhizospheric soil of Melaiyar and Nagapattinam districts in Tamil Nadu. All the isolates were identified as Azospirillum spp., Bacillus spp., Pseudomonas spp., and Azotobacter spp. These bacterial strains were tested on morphological, biochemical and screened for their direct growth promoting activities (IAA production, production of Ammonia and Phosphate solubilization and indirect growth promoting activities (HCN production, Siderophore production. The results obtained showed that among the 10 isolates of Melaiyar and Nagapattinam districts (M-M15 of ranged from (4.10 - 5.66 and 4.40 - 7.80 of Azospirillum spp., (3.00 – 6.00 and 3.20 – 6,.30 of Bacillus spp., (5.00 – 8.40 and 5.10 - 8.20 of Pseudomonas spp., and (3.00 - 6.00 and 3.30 - 6.30 of Azotobacter spp. The IAA production of Pseudomonas spp. (94%, Azospirillum spp (80%, Azotobacter spp. (65% and Bacillus spp. (40%. Ammonium production of the isolates, Bacillus spp. (96%, Pseudomonas spp. (92%, Azospirillum spp. (65% and Azotobacter spp. (55%. Thesiderophore and HCN production produced by all the isolates make it suitable for further investigation of pot and field trials by Acorus calamus cultivation

  11. http://aygrt.isrj.net/UploadedData/3464.pdf

    Directory of Open Access Journals (Sweden)

    S. Kalaiarasu

    2014-04-01

    Full Text Available The effect of exopolysaccharides of Azospirillum isolates viz., Azo-16, Azo-19, PS-24 and PS- 28 and certain ISR inducing chemicals viz., Salicylic acid, Jasmonic acid and Azibenzolar on the enhancement of plant growth and bio-control against blast disease in lowland rice crop was studied under in-vitro condition. It was observed that the application of EPS, collected from Azospirillum isolates and Pseudomonas isolates, augmented the height of rice plant and reduced the blast disease incidence in lowland rice to a higher level when compared to the application of ISR inducing chemicals alone. Eventhough, the application of ISR inducing chemicals was found to reduce the blast disease incidence, as in the case of purified EPS application of Azospirillum isolates and Pseudomonas isolates, but did not augment the growth of rice plant and clearly revealed the absence of phytostimulatory activities of ISR inducing chemicals.The study on the optimization of different concentrations of purified EPS viz., 100, 200, 300 ppm on the blast disease incidence of rice revealed that the application of the same at 200 ppm concentration could effectively controlled the disease incidence to a higher level when compared to other concentration. The results of the present study clearly revealed the effect of Azospirillum and Pseudomonas EPS on the enhancement of host plant growth as well as the bio-control against Pyricularia oryzae whereas the application of ISR inducing chemicals confined with reduction in blast disease incidence alone. Moreover, the Azospirillum and Pseudomonas EPS at a concentration of 200 ppm level could be optimized as effective one for the control of blast disease in lowland rice.

  12. Growth enhancement of black pepper (Piper nigrum) by a newly isolated Bacillus tequilensis NII-0943

    Digital Repository Service at National Institute of Oceanography (India)

    Dastager, S.G.; Deepa, C.K.; Pandey, A.

    like to thank CSIR for providing the financial support. References Ahmad F., Ahmad I. & Khan M.S. 2008. Screening of free-living rhizospheric bacteria for their multiple plant growth-promoting activities. Microbiol. Res. 163:173–181. Altschul S...: Azospirillum, Azotobacter, Bacillus, Pseudomonas, Serratia and Streptomyces (Baudoin et al. 2009, Biari et al. 2008, Ahmad et al.2008). In the present study we reporting on a potential isolate of bacillus sp isolated from Western ghat dense forest...

  13. Microorganismos rizosféricos, potenciales antagonistas de Fusarium sp. causante de la pudrición radicular de maracuyá (Passiflora edulis Sims)

    OpenAIRE

    Luisa Fernanda Quiroga-Rojas; Nataly Ruiz-Quiñones; Guerly Muñoz-Motta; María Denis Lozano-Tovar

    2012-01-01

    El cultivo de maracuyá (Passiflora edulis), de gran importancia económica para Colombia, actualmente es afectado por la enfermedad del marchitamiento vascular causado por Fusarium sp. lo que hace necesario la búsqueda de alternativas que permitan un control eficiente de esta enfermedad. Aislados de las bacterias Azotobacter spp., Azospirillum spp. y el hongo Trichoderma spp., fueron evaluados como potenciales biocontroladores de Fusarium sp. en pruebas in vitro e in vivo. Las pruebas de “test...

  14. INFLUENCE OF ORGANIC MANURES AND AMENDMENTS IN SOIL PHYSIOCHEMICAL PROPERTIES AND THEIR IMPACT ON GROWTH, YIELD AND NUTRIENT UPTAKE OF BANANA

    OpenAIRE

    K VANILARASU; G. BALAKRISHNAMURTHY

    2014-01-01

    An investigation was carried out during 2010-2011, to study the effect of organic manures (Farmyard manure, Vermicompost, Neem cake and Wood ash), organic amendments (Arbuscular mycorrhizae, Azospirillum, Phosphate Solubilising Bacteria and Trichoderma harzianum) and green manures (Sunhemp and Cowpea) in comparison with inorganic fertilizers on leaf nutrient and soil physiochemical properties of banana cv. Grand Naine. The treatment T10 with the combined application of organic man...

  15. Cultivation-based and molecular assessment of bacterial diversity in the rhizosheath of wheat under different crop rotations

    OpenAIRE

    Muhammad Tahir; M Sajjad Mirza; Sohail Hameed; Dimitrov, Mauricio R.; Hauke Smidt

    2015-01-01

    A field study was conducted to compare the formationand bacterial communities of rhizosheaths of wheat grown under wheat-cotton and wheat-rice rotation and to study the effects of bacterial inoculation on plant growth. Inoculation of Azospirillum sp. WS-1 and Bacillus sp. T-34 to wheat plants increased root length, root and shoot dry weight and dry weight of rhizosheathsoil when compared to non-inoculated control plants, and under both crop rotations. Comparing both crop rotations, root lengt...

  16. Effect of mineral vs. biofertilizer on growth, yield, and essential oil content of fennel (Foeniculum vulgare Mill.)

    OpenAIRE

    M.A. Sharaf-Eldin; S.A. Mahfouz

    2007-01-01

    In field experiments during two successive seasons (2003-2004 and 2004-2005), the effects of biofertilization on growth, fruit yield, and oil composition of fennel plants were investigated. Application of biofertilizer, which was a mixture of Azotobacter chroococcum, Azospirillum liboferum, and Bacillus megatherium applied with chemical fertilizers (only 50% of the recommended dosage of NPK) increased vegetative growth (plant height, number of branches, and herb fresh and dry weight per plant...

  17. A Metagenomic Study Highlights Phylogenetic Proximity of Quorum-Quenching and Xenobiotic-Degrading Amidases of the AS-Family

    OpenAIRE

    Mélanie Tannières; Amélie Beury-Cirou; Armelle Vigouroux; Samuel Mondy; Franck Pellissier; Yves Dessaux; Denis Faure

    2013-01-01

    Quorum-sensing (QS) signals of the N-acylhomoserine lactone (NAHL) class are cleaved by quorum-quenching enzymes, collectively named NAHLases. Here, functional metagenomics allowed the discovery of a novel bacterial NAHLase in a rhizosphere that was treated with γ-caprolactone. As revealed by rrs-DGGE and rrs-pyrosequencing, this treatment increased the percentage of the NAHL-degrading bacteria and strongly biased the structure of the bacterial community, among which Azospirillum dominated. A...

  18. Cellular and molecular-genetic mechanisms of symbiosis and associative interaction of microorganisms with plants in rhizosphere

    Directory of Open Access Journals (Sweden)

    Lioshina L. G.

    2009-02-01

    Full Text Available The review contains the results of research on symbiotic and associative interaction of microorganisms and plants in rhizosphere. A special attention is given to the process of contact association of microorganisms and plants tissues including the concrete molecular structures and dominant role pertaining to protein-carbohydrate interaction. There are common features and distinctions at formation of arbuscular mycorhiza, rhizobia– legume symbiosis and association of non-leguminous plants with Azospirillum

  19. Alterations in seedling vigour and antioxidant enzyme activities in Catharanthus roseus under seed priming with native diazotrophs

    OpenAIRE

    B.Karthikeyan; Jaleel, C.A.; Gopi, R.; Deiveekasundaram, M.

    2007-01-01

    An experiment was conducted on Catharanthus roseus to study the effect of seed treatments with native diazotrophs on its seedling growth and antioxidant enzyme activities. The treatments had significant influence on various seedling parameters. There is no significant influence on dry matter production with the diazotrophs, Azospirillum and Azotobacter. However, the vital seedling parameters such as germination percentage and vigour index were improved. Azotobacter treatment influenced maximu...

  20. Field Level Studies On The Association Of Plant Growth Promoting Rhizobacteria (pgpr) In Gloriosa Superba L. Rhizosphere

    OpenAIRE

    Elango. R; R. Parthasarathi; MEGALA. S

    2013-01-01

    The rhizobacteria, saprophytic bacteria that live in the plant rhizosphere and colonize the root system, have been studied as plant growth promoters for increasing agricultural production and as biocontrol agents against plant diseases. The variety of microbes present in rhizosphere soil. The plant growth promoting rhizobacteria presence is being observed from rhizosphere soil in Gloriosa superba. The field level studies revealed predominance of four PGPR microbes viz., Azospirillum, Azotobac...

  1. Plant growth-promoting bacteria associated with nitrogen fertilization at topdressing in popcorn agronomic performance

    OpenAIRE

    Leandro Teodoski Spolaor; Leandro Simões Azeredo Gonçalves; Odair José Andrade Pais dos Santos; André Luiz Martinez de Oliveira; Carlos Alberto Scapim; Filipe Augusto Bengosi Bertagna; Mauricio Carlos Kuki

    2016-01-01

    ABSTRACT The use of plant growth-promoting bacteria is a promising alternative with low environmental impact to increase the efficiency of use of chemical fertilizers, ensuring high yield with better cost-effective ratio. In maize crops, several studies have demonstrated an increased yield when Azospirillum-based inoculants are used. In the case of popcorn, there are no available studies related to use of inoculation and its response on yield parameters. Thus, the aim of this study was to eva...

  2. Influence of Organic Manures (Biofertilizers) on Soil Microbial Population in the Rhizosphere of Mulberry (Morus Indica L.)

    OpenAIRE

    L. Christilda Louis Mary; Sujatha, R.; A. J. Chozhaa; P. Mohideen Askar Navas

    2015-01-01

    The effect of different kinds of organic manures on soil microbial population and mulberry production was assessed. A field experiment wascarried out at Periyar EVR College, Tamil Nadu, India in basic soil to study the influence of organic manures on soil bacterial population andmulberry production. The 4 groups of mulberry plants of MR2 variety were biofertilized with FYM, Azospirillum, Phosphobacteria andVermicompost respectively. The biofertilizers lodged bacteria on the rhizosphere of mul...

  3. Influence of levels of nitrogen and management on seed cotton yield and 15N recovery by cotton

    International Nuclear Information System (INIS)

    Cotton var.MCU.5 showed varied response to N levels under different management practices. Higher yields were associated at 60-80 kg N ha-1 under combined application of urea, FYM and azospirillum. Whereas urea alone registered higher yield at 100-120 kg N ha-1, high 15N recovery (35.84%) was found to be associated with urea + FYM combination. (author)

  4. Identification of novel spp. of rice and wheat endophytic diazotrophs by 16S rDNA gene and FTIR analysis

    Directory of Open Access Journals (Sweden)

    Mohammad Javad Mehdipour Moghaddam

    2012-06-01

    Full Text Available In this research, six isolates, including three from three rice roots (PxR1, PxR2 and StR1 and three from three wheat roots (PxW1, PxW2 and PxW3 were isolated as endophytic bacteria and except for StR1, all the isolates were identified as Pseudoxanthomonas based on phenotypic analysis including FTIR and PCR amplification of 16S rDNA. The results showed that PxR1, PxR2, PxW1 and PxW2 were all similar and belonged to a novel species of Pseudoxanthomonas, but PxW3 was from different species. StR1 belonged to a novel species of Stenotrophomonas. Two strains including Azospirillum brasiliense Sp7 (S1 and Azospirillum lipoferum (S2 were selected as standard strains and compared with those isolates however, phenotypic and genotypic analysis verified that those isolates were not Azospirillum. For the first time, it was indicated that Pseudoxanthomonas existed as an endophytic bacterium in rice root.

  5. Microorganismos benéficos como biofertilizantes eficientes para el cultivo del tomate (Lycopersicon esculentum, Mill Beneficial microorganisms as efficient biofertilisers for tomato crops (Lycopersicon esculentum, Mill

    Directory of Open Access Journals (Sweden)

    Hernández Annia

    2005-12-01

    Full Text Available En el uso y manejo de biofertilizantes en la agricultura, uno de los principales problemas es el desconocimiento de las especies presentes en los agroecosistemas y en la rizosfera de los cultivos, para su posible utilización eficiente. Desde el punto de vista ecológico, es importante conocer los integrantes de la comunidad bacteriana que favorecen su aplicación como inoculantes y propician un efecto agrobiológico positivo en los cultivos agrícolas. Esta investigación se desarrolló con el objetivo de evaluar la efectividad agrobiológica de Azospirillum sp, en el crecimiento, desarrollo y rendimiento en el cultivo del tomate. Para ello, se partió de seleccionar el género microbiano predominante en la rizosfera del cultivo y posteriormente se evaluó el efecto de su inoculación a partir de la respuesta del cultivo. Los resultados demostraron que los géneros Pseudomonas, Azospirillum, Azotobacter, Bacillus y Streptomyces, forman parte de la comunidad microbiana de la rizosfera del tomate, en las condiciones estudiadas, y que Azospirillum es el género dominante. La inoculación artificial de esta rizobacteria causó un efecto positivo sobre el crecimiento de las plántulas, así como en el estado nutricional de las plantas, con un rendimiento agrícola superior a un 11 % con respecto a las plantas testigo. Se obtuvo un alto nivel poblacional en la rizosfera de las plantas inoculadas. Palabras clave: rizosfera, inoculante, crecimiento, rendimiento.One of the main problems regarding the efficient use and management of biofertilizers in agriculture lies in the unknown species present in agro-ecosystems and crop rhizospheres. From the ecological point of view, it is important to know the members of the bacterial population allowing them to be applied as inoculants and enable a positive agro-biological effect on agricultural crops. This investigation was aimed at evaluating the agro-biological effectiveness of Azospirillum sp. on tomato

  6. Biofertilización de café orgánico en etapa de vivero en Chiapas, México Biofertilizer of organic coffee in stage of seedlings in Chiapas, Mexico

    Directory of Open Access Journals (Sweden)

    María de Lourdes Adriano Anaya

    2011-06-01

    Full Text Available En Chiapas, la producción de plántulas de café, se realiza convencionalmente con la aplicación de fertilizantes químicos. La producción de café orgánico, requiere la nutrición de plántulas con biofertilizantes y por ello el objetivo fue evaluar el efecto de algunos de éstos en el desarrollo de plántulas de café (Coffe arábica variedad Bourbon en vivero. El experimento se realizó durante 2007 y 2008 en Cacahohatan,Chiapas. Los inoculantes fueron una cepa Glomus intraradices Schenck y Smith, cepas PACHAZ08 de Azotobacter y 11B de Azospirillum. Se utilizó el diseño factorial 2³ con ocho tratamientos y 100 repeticiones por tratamiento. En las platulas inoculadas, se efectuaron 4 muestreos con intervalos de 28 días, midiendóse la altura, longitud de hojas, longitud de raíz, peso seco de hojas y raíces, contenido de clorofila y nitrógeno, y colonizacion de raíz por los inoculantes. Los datos se sometieron al análisis de varianza y comparacion de medias por Tukey p≤ 0.05. Las mejores características morfológicas y bioquímicas de las plántulas, se obtuvieron con Azospirillum sóla o coinoculada con Glomus y Azotobacter y estadísticamente fueron los mejores tratamientos. Azospirillum modificó la arquitectura de la raíz y estimuló la micorrización. Los diazotrofos en conjunto fueron antagónicos pero esta fue inhibida por Glomus. La interacción de los tres microorganismos indujo en las plántulas un mejor aprovechamiento de nutrimentos, agua, capacidad fotosintética y mayor acumulación de biomasa carbonada.In Chiapas, c offee seedlings product ion is conventionally done with chemical fertilizers. Organic coffee production requires see dlings nutrition with biofertilizers and therefore the objective was to evaluate the effect of some of these in coffee seedlings development (Coffee arabica Bourbon variety in a nursery. The experiment was conducted during 2007 and 2008 in Cacahohatan, Chiapas. Inoculants were a strain

  7. Effect of arbuscular mycorrhizal fungi and multi-combination of bioinoculants on regenerated seedlings of cotton

    International Nuclear Information System (INIS)

    Effect of arbuscular mycorrhizal fungi and multi-combination of bioinoculants on regenerated seedlings of cotton Cotton, referred as 'The white gold' is an important commercial crop in India and stands third in the world by means of area of cultivation. Cotton plant regeneration from callus by somatic embryogenesis and its efficiency has been improved significantly in recent times. Our primary investigation was on regenerative studies and multiple shoot induction system focusing mainly on meristematic tissues like seedling cotyledonary nodal explants in RAH-9750 cotton cultivar. An attempt has been made to improve the rate of surveillance and growth of regenerated cotton seedlings by bio-inoculant (mainly AMF) treatment under greenhouse conditions. Out of a total seven pure cultures of AMF fungi, R1-R2 have shown maximum mycorrhizal colonization with RAH-9750 (R) and was identified as Glomus mosseae. This variety was also tested with three different bioinoculants i.e., Rhizobium sp. RHPU-7, Azospirillum sp. PPK-27, Bacillus sp. PU-1, apart from AMF R1-R2 in different combinations. The cotton seedlings have shown the best results in single, dual, triple and multiple combinations i.e R+R1-R2, R+R1-R2+Rhizobium, R+R1-R2+Rhizobium+Azospirillum and R+R1-R2+Rhizobium+Azospirillum+Bacillus respectively. The growth of cotton plants (RAH-9750) generated from meristematic tissue culture was found to be increasing significantly when compared with the normal seeds. Similar results were noticed when the same experiment was subjected to the different soil types of Mahabubnagar district. The investigation clearly infers that better yield of cotton RAH-9750 (R) could be achieved by treating the regenerated cotton seedlings with bioinoculants in different combination in various soil types of Mahabubnagar district. (author)

  8. Stable cesium uptake and accumulation capacities of five plant species as influenced by bacterial inoculation and cesium distribution in the soil.

    Science.gov (United States)

    Djedidi, Salem; Kojima, Katsuhiro; Yamaya, Hiroko; Ohkama-Ohtsu, Naoko; Bellingrath-Kimura, Sonoko Dorothea; Watanabe, Izumi; Yokoyama, Tadashi

    2014-09-01

    The effects of inoculation with Bacillus and Azospirillum strains on growth and cesium accumulation of five plant species, Komatsuna, Amaranth, sorghum, common millet and buckwheat, grown on cesium-spiked soil were assessed for potential use in cesium remediation. Pot experiments were performed using "artificially" Cs-contaminated soil. Three treatments were applied based on Cs location in the soil. For a soil height of 15 cm in the pots, Cs was added as follows: in the top five cm to imitate no ploughing condition; in the bottom five cm simulating inverted ploughing; and uniformly distributed Cs reproducing normal plowing. Generally, inoculation of Cs-exposed plants significantly enhanced growth and tolerance to this element. Transfer factor (ratio of Cs concentration in the plant tissues to that in surrounding soil) was strongly influenced by Cs distribution, with higher values in the top-Cs treatment. Within this treatment, inoculation of Komatsuna with Bacillus and Azospirillum strains resulted in the greatest transfer factors of 6.55 and 6.68, respectively. Cesium content in the shoots was high in the Azospirillum-inoculated Komatsuna, Amaranth, and buckwheat, i.e., 1,830, 1,220, and 1,030 µg per pot, respectively (five plants were grown in each pot). Therefore, inoculation of Komatsuna and Amaranth with the strains tested here could be effective in enhancing Cs accumulation. The decrease of Cs transfer under uniform- and bottom-Cs treatments would suggest that countermeasures aiming at decreasing the transfer of Cs could rely on ploughing practices. PMID:25002227

  9. SITUACIÓN ACTUAL Y PERSPECTIVA DE LAS RELACIONES ENDÓFITAS PLANTA-BACTERIA. ESTUDIO DE CASO Gluconacetobacter diazotrophicus-CULTIVOS DE IMPORTANCIA ECONÓMICA

    OpenAIRE

    B. Dibut; R. Martínez-Viera; Marisel Ortega; Yoania Ríos; Grisel Tejeda; Liuba Planas; Janet Rodríguez

    2009-01-01

    En los últimos años, ha ganado especial interés el estudio de las asociaciones endofíticas planta-microoganismos, con énfasis en la introducción en la práctica agrícola de los buenos resultados que se han obtenido en la agrobiología. En este trabajo se ofrece una panorámica de la situación actual y perspectiva de estas asociaciones ilustradas en gran medida por las interacciones Rhizobium-cereales, Azorhizobium-arroz, Azospirillum y Herbaspirillum, al igual que cereales y Gluconacetobacter di...

  10. Alternativas de control en la pudrición radical de cebolla para el Valle de la Trinidad, Baja California Control Alternatives for Onion root rot in the Trinity Valley, Baja California

    OpenAIRE

    Armando Pulido-Herrera; Emma Zavaleta-Mejía; Lourdes Cervantes-Díaz; Onécimo Grimaldo-Juárez

    2012-01-01

    La pudrición radical en cebolla es la enfermedad más importante en el Valle de la Trinidad, Baja California, México. Con el propósito de evaluar estrategias de control para la enfermedad se realizaron tres experimentos durante 2007, 2008 y 2009. En el experimento I (2007) los tratamientos fueron: 1) Tiofanato metílico; 2) Smicobac (Trichoderma + Bacillus sp. + Azospirillum sp. + Pseudomonas sp.); 3) estiércol de bovino (EB); 4) residuos de cebolla (RC); 5) solarización plástico transparente (...

  11. Role of biofertilizers in increasing tea productivity

    Institute of Scientific and Technical Information of China (English)

    P Nepolean; R Jayanthi; R Vidhya Pallavi; A Balamurugan; T Kuberan; T Beulah; R Premkumar

    2012-01-01

    Objective: To increase the tea productivity using biofertilizers like VAM fungi, phosphobacteria, Azosprillium. Methods: Nitrogen fixing Azospirillum, phosphate solubilising bacteria and VAM fungi were isolated from tea soils of southern India and region specific potential strains were selected based on laboratory, greenhouse, as well as field experiments. A technology for their mass multiplication has been developed. Results: Biofertilizers were showed higher yield at the rate of 5g/seedling and VAM fungi with 15 g of formulation/bush. Conclusions: Multifunctional biofertilizers were used to reduce the chemical fertilizers, diseases and to increase soil fertility in tea.

  12. DETECCIÓN DE BACTERIAS BENÉFICAS EN SUELO CON BANANO (Musa AAA Simmonds) cultivar 'Gran enano' Y SU POTENCIAL PARA INTEGRAR UN BIOFERTILIZANTE

    OpenAIRE

    Y Córdova-Bautista; MC Rivera-Cruz; R Ferrera-Cerrato; JJ Obrador-Olán; V Córdova-Ávalos

    2009-01-01

    Se determinaron las densidades de bacterias totales fijadoras de N de vida libre en suelo hasta 110 cm de profundidad y en suelo rizosférico de la planta de banano establecido en un Fluvisol éutrico. Se colectaron muestras de suelo en los seis horizontes del perfil y en 30 puntos de muestreo rizosférico (0-10 cm de profundidad) distribuidos en forma aleatoria en 10 000 m2. Las poblaciones de Azospirillum y Azotobacter se aislaron hasta profundidades de 59 y 110 cm, respectivamente. Los gremio...

  13. INOKULASI Azospirillium sp DARI LAHAN KERING MADURA TERHADAP PERTUMBUHAN TANAMAN JAGUNG

    Directory of Open Access Journals (Sweden)

    Ach. Khoirul Ikhwan

    2015-12-01

    Full Text Available Penelitian ini bertujuan untuk memperoleh isolat bakteri Azospirillium sp dari Madura, serta mengkaji kehandalannya dalam menggantikan pupuk N sintetik. Samel tanah diambil dari Kecamatan Galis, Geger dan Tanahmerah, isolasi dilakukan dengan menggunakan media semi solid Nfb, selanjutnya diuji kehandalannya berdasarkan pengaruhnya terhadap pertumbuhan tanaman jagung. Diperoleh 1 isolat yang terbaik yaitu isolat yang diisolasi dari rhizosper tanaman Graminae di Kecamatan Galis, namun demikian berdasarkan pertumbuhan tanaman jagung belum bisa menggantikan pupun N sintetik.Kata kunci : Azospirillum sp, jagung, nitrogen, isolat madura

  14. Radiotracer study on phosphorus utilization as influenced by bacterial seed inoculation, farmyard manure and nitrogen fertilization in Triticum aestivum grown on Typic ustifluvents (saline phase)

    International Nuclear Information System (INIS)

    A field experiment was carried out in micro-plots using 32P labelled superphosphate with varying levels of nitrogen (0, 60, 80 and 120 kg ha-1). farmyard manure (0 and 20 t ha-l) and bio fertilizers (Azospirillum, Azotobacter and no inoculation). Results revealed that the application of P either alone or with FYM in the presence of increasing levels of nitrogen as well as different sources of bio-fertilizers enhanced grain and straw yield as well as total P uptake. Seed inoculated with bio fertilizers or individual application of N also enhanced the yield, total P uptake and fertilizer P utilization. On the contrary, radiochemical analysis showed some depletion in per cent phosphorus derived from fertilizer (% Pdff) when FYM was applied in association with P. However, inoculation of seeds with bio fertilizers enhanced it. P utilization on the other hand, increased considerably in presence of N, P and FYM particularly when seeds were inoculated with both the inoculants. Moreover, yield and utilization of P was higher in favour of Azotobacter compared to Azospirillum. (author)

  15. Biodiversity of Soil Microbes from Rhizosphere at Wamena Biological Garden (WBiG, Jayawijaya, Papua

    Directory of Open Access Journals (Sweden)

    SRI WIDAWATI

    2005-01-01

    Full Text Available The isolation, identification and population of soil microbes from rizosphere at WBiG had been done in the Soil Laboratories Microbiology, Microbiology Division, Research Center of Biology, Indonesian Institute of Sciences (LIPI, Bogor. The soil was collected randomly from 16 sites in WBiG, and taken from 0-15 cm depth. Isolates of microbes were identified by Bergeys manual method for bacteria; Ellis method for fungi, and the morphology of isolate method for Actinomycetes. The population of microbes was estimated by plate count method. The result of isolation, identification and population soil microbes from 16 samples in WBiG showed that 20 isolates of bacteria (Azotobacter sp., Accinetobacter sp. , Bacillus sp., Citrobacter sp., Flavobacterium sp., Klebsiella sp., Nitrosomonas sp., Pseudomonas sp., Rhizobium sp., Thiobacillus sp., Azospirillum sp., Azotobacter chrococcum, Bacillus panthothenticus, Chromobacterium violaceum, C.lividum, Escherrrichia coli, Flavobacterium breve, Klebsiella aerogenes, Spaerotillus natans, and Staphylococcus epidermidis; nine isolates of fungi (Aspergillus niger, Bisporomyces, Monilia sp., Cephalospharium sp., Verticillum sp., Giocladium sp., Penicillium sp., Nelicocephalum sp., and Cuninghamella sp., and seven isolates of Actinomycetes (Streptomyces, Streptosporangium, Nocardia, Thermomonospora, Thermoactinomyces, Micromonospora, Mycobacterium. The population of Bacillus (108-109, Rhizobium (106-107, Azospirillum (106-107, and Thiobacillus (104 -109 were founded all of soil samples.

  16. INFLUENCE OF ORGANIC MANURES AND AMENDMENTS IN SOIL PHYSIOCHEMICAL PROPERTIES AND THEIR IMPACT ON GROWTH, YIELD AND NUTRIENT UPTAKE OF BANANA

    Directory of Open Access Journals (Sweden)

    K VANILARASU

    2014-06-01

    Full Text Available An investigation was carried out during 2010-2011, to study the effect of organic manures (Farmyard manure, Vermicompost, Neem cake and Wood ash, organic amendments (Arbuscular mycorrhizae, Azospirillum, Phosphate Solubilising Bacteria and Trichoderma harzianum and green manures (Sunhemp and Cowpea in comparison with inorganic fertilizers on leaf nutrient and soil physiochemical properties of banana cv. Grand Naine. The treatment T10 with the combined application of organic manures, amendments and green manures (Farmyard manure @ 10 kg + Neem cake @ 1.25 kg + Vermicompost @ 5 kg and Wood ash @ 1.75 kg /plant + Triple green manuring with Sunhemp + Double intercropping of Cow pea + biofertilizers viz., Arbuscular Mycorrhizae @ 25 g , Azospirillum @ 50 g, Phosphate Solubilizing Bacteria @ 50 g and Trichoderma harzianum @ 50 g/plant registered the maximum growth, yield and yield attributes, leaf nutrient status of N, P and K at 5th and 7th month after planting and soil physiochemical properties at harvesting stage because the role of organic manures and amendments to make the soil has healthy as well as possible and also, the unavailable form of soil nutrients to available form by enhancing mineralization and solubilization process in soil by adding organic manures and microbial agents make easy uptake of nutrients when crop required comparing to chemical fertilizers.

  17. Selección y caracterización de rizobacterias promotoras de crecimiento vegetal (RPCV asociadas al cultivo de algodón (Gossypium hirsutum

    Directory of Open Access Journals (Sweden)

    Andrés Guzmán

    2012-04-01

    Full Text Available Normal 0 21 false false false ES-CO X-NONE X-NONE MicrosoftInternetExplorer4 Título en ingles: Selection and characterization of plant growth promoting rhizobacteria (PGPR’s associated with cotton crop (Gossypium hirsutum Resumen: Como parte de las estrategias de una agricultura sostenible, se hace necesario disminuir el uso de fertilizantes nitrogenados de síntesis, mediante la utilización de los biofertilizantes. En particular, los géneros Azotobacter y Azospirillum son utilizados como agentes promotores de crecimiento vegetal debido a su capacidad para fijar nitrógeno atmosférico y producir hormonas de tipo indólico. Por tal razón, en este estudio se aislaron bacterias diazotróficas de los géneros Azotobacter y Azospirillum a partir de la rizósfera de cultivos de algodón en el Espinal (Tolima. Las poblaciones microbianas se caracterizaron fenotípicamente en los medios de cultivo semiespecíficos: Ashby y LG (Azotobacter sp. y NFb, LGI y Batata (Azospirillum sp.. La promoción de crecimiento vegetal se determinó mediante la actividad de la enzima nitrogenasa por medio de la técnica de reducción de acetileno y producción de índoles por el método colorimétrico de Salkowsky. Se obtuvieron 9 aislamientos tentativos de Azotobacter sp. y 4 de Azospirillum sp. Se presentaron diferencias significativas en la prueba de reducción de acetileno con las cepas presuntivas de Azotobacter sp.: NAT 9 (206.43 nmol C2H2 mL-1.h-1, NAT 4, (292.77 nmol C2H2 mL-1.h-1, y NAT 6 (460.60 nmol C2H2 mL-1.h-1 y en la producción de índoles de las cepas NAT 19 (19.87 μg.mL-1 y NAT 13 (20.08 μg.mL-1. Por su eficiencia in vitro en la promoción de crecimiento vegetal se seleccionaron las cepas NAT9, NAT4, NAT6, NAT19 y NAT13 para ser evaluadas como principio activo en futuros inoculantes para el algodón en esta zona del departamento del Tolima. Palabras clave: fijación biológica de nitrógeno; producción de índoles; promoción del crecimiento

  18. Sensitivity of some nitrogen fixers and the target pest Fusarium oxysporum to fungicide thiram.

    Science.gov (United States)

    Osman, Awad G; Sherif, Ashraf M; Elhussein, Adil A; Mohamed, Afrah T

    2012-03-01

    This study was carried out to investigate the toxic effects of the fungicide thiram (TMTD) against five nitrogen fixers and the thiram target pest Fusarium oxysporum under laboratory conditions. Nitrogen fixing bacteria Falvobacterium showed the highest values of LD(50) and proved to be the most resistant to the fungicide followed by Fusarium oxysporum, while Pseudomonas aurentiaca was the most affected microorganism. LD(50) values for these microorganisms were in 2-5 orders of magnitude lower in comparison with LD(50) value for Fusarium oxysporum. Thiram was most toxic to Pseudomonas aurentiaca followed by Azospirillum. The lowest toxicity index was recorded for Fusarium oxysporum and Flavobacterium. The slope of the curve for Azomonas, Fusarium oxysporum and Flavobacterium is more steep than that of the other curves, suggesting that even a slight increase of the dose of the fungicide can cause a very strong negative effect. Thiram was more selective to Pseudomonas aurentiaca followed by Azospirillum, Rhizobium meliloti and Azomonas. The lowest selectivity index of the fungicide was recorded for Falvobacterium followed by Fusarium oxysporum. The highest safety coefficient of the fungicide was assigned for Flavobacterium, while Pseudomonas aurentiaca showed the lowest value. PMID:22783146

  19. Reclamation of abandoned ash pond of Neyveli thermal power plant by enrichment and its effect on growth and yield of gingelly

    Energy Technology Data Exchange (ETDEWEB)

    Sheela, A.M.; Shanmugasundaram, R.; Sundaram, M.D. [Annamalai Nagar University, Annamalai, Nagar (India). Dept. of Microbiology

    2003-07-01

    Ash ponds are the common disposal sites of ash generated from India's thermal power stations. An attempt was made to enrich the ash pond of Neyveli Lignite Corporation Ltd., Neyveli, using organic amendments and microbial inoculants to promote crop growth. The oil seed crop gingelly was grown in two seasons and more growth and yield was recorded in the second crop, which was enriched in the second time also. The inoculation effect of the crop with VAM fungus Glomus mosseae and the acid-tolerant Azospirillum isolate, A. lipoferum PAI-1 was studied. The co-inoculation of Azospirillum with VAM enhanced the rhizosphere dehydrogenase enzyme activity, growth, yield, N, and P content of the plant in the enriched ash pond. Hence, the nutritionally and biologically poor medium like ash ponds could be enriched successively to increase in the nutrient contents and microbial activity. Prolonged enrichment would be providing favourable conditions for the establishment of vegetation and the environmental pollution is greatly reduced by the vegetative cover on barren land. 30 refs., 6 tabs.

  20. Fertilizer nitrogen prescription for cotton by 15N recovery method under integrated nutrient management using soil test crop response function

    International Nuclear Information System (INIS)

    Fertilizer efficiency is a vital parameter in prescription functions to compute fertilizer requirements of crops for achieving a specific yield target. In Soil Test Crop Response (STCR) function, nitrogen fertilizer efficiency is calculated by Apparent N Recovery (ANR) method, which includes the effect of added N interaction (ANI) on soil N reserves. In order to exclude soil effect and refine STCR function, the real efficiency of fertilizer N was estimated by 15N recovery method. By fitting 15N recovery in the function, the fertilizer N required for a specific yield target of cotton was estimated. The estimated N requirement by 15N recovery method was lesser than ANR method when available soil N relatively increased. The approach also fine-tuned the N contributing efficiency of soil, farmyard manure and Azospirillum under Integrated Nutrient Management (INM). For achieving 25 q of seed cotton yield in a soil having 220 kg of available N ha-1, the predicted N requirement was 159 kg ha-1 under ANR method, whereas in 15N recovery method fertilizer N to be applied was 138 kg ha-1 with urea alone and 79 kg ha-1 with urea + FYM + Azospirillum. (author)

  1. Evaluation of the possibility to use the plant-microbe interaction to stimulate radioactive 137Cs accumulation by plants in a contaminated farm field in Fukushima, Japan.

    Science.gov (United States)

    Djedidi, Salem; Terasaki, Akimi; Aung, Han Phyo; Kojima, Katsuhiro; Yamaya, Hiroko; Ohkama-Ohtsu, Naoko; Bellingrath-Kimura, Sonoko Dorothea; Meunchang, Phatchayaphon; Yokoyama, Tadashi

    2015-01-01

    Field experiments in a contaminated farmland in Nihonmatsu city, Fukushima were conducted to assess the effectiveness of the plant-microbe interaction on removal of radiocesium. Before plowing, 93.3% of radiocesium was found in the top 5 cm layer (5,718 Bq kg DW(-1)). After plowing, Cs radioactivity in the 0-15 cm layer ranged from 2,037 to 3,277 Bq kg DW(-1). Based on sequential extraction, the percentage of available radiocesium (water soluble + exchangeable) was fewer than 10% of the total radioactive Cs. The transfer of (137)Cs was investigated in three agricultural crops; komatsuna (four cultivars), Indian mustard and buckwheat, inoculated with a Bacillus or an Azospirillum strains. Except for komatsuna Nikko and Indian mustard, inoculation with both strains resulted in an increase of biomass production by the tested plants. The highest (137)Cs radioactivity concentration in above-ground parts was found in Bacillus-inoculated komatsuna Nikko (121 Bq kg DW(-1)), accompanied with the highest (137)Cs TF (0.092). Furthermore, komatsuna Nikko-Bacillus and Indian mustard-Azospirillum associations gave the highest (137)Cs removal, 131.5 and 113.8 Bq m(-2), respectively. Despite the beneficial effect of inoculation, concentrations of (137)Cs and its transfer to the tested plants were not very high; consequently, removal of (137)Cs from soil would be very slow. PMID:25398196

  2. Waste rock revegetation: Evaluation of nutrient and biological amendments

    Energy Technology Data Exchange (ETDEWEB)

    Meikle, T.W.; Lu, S.; Barta, J.P.

    1999-07-01

    Lack of salvaged topsoil for the reclamation of historical waste rock piles is a common problem in the arid Great Basin region. Utilization of amended waste rock as a growth media could reduce further disturbance resulting from topsoil harvest, minimize hauling costs, and potentially allow for the use of a higher quality material for plant growth. Getchell Gold Corporation initiated a study in 1995 to determine the suitability of waste rock substrates to support plant growth following application of nutrient and biological amendments. Three nutrient amendments and a biological seed treatment were evaluation for use in establishing vegetative cover on three distinct waste rock substrates. Completely randomized blocks were placed on the three substrates. Treatments included organic fertilizers (Biosol and Gro-Power), a mineral fertilizer (16-20-0), and Azospirillum bacterial inoculant, plus controls. The seed mix consisted of Agropyron riparium, Agropyron spicatum, Elymus cinereus, Poa secunda, and Sitanion hystrix. Canopy and ground cover were monitored for three growing seasons. Conclusions from the study are: (1) two of the three substrates supported plant growth following amendment with organic fertilizers; (2) organic fertilizers increased cover substantially over the mineral fertilizer; and (3) Azospirillum had no effect on canopy cover.

  3. Phytoremediation of Polycyclic Aromatic Hydrocarbons in Soils Artificially Polluted Using Plant-Associated-Endophytic Bacteria and Dactylis glomerata as the Bioremediation Plant.

    Science.gov (United States)

    Gałązka, Ann; Gałązka, Rafał

    2015-01-01

    The reaction of soil microorganisms to the contamination of soil artificially polluted with polycyclic aromatic hydrocarbons (PAHs) was evaluated in pot experiments. The plant used in the tests was cock's foot (Dactylis glomerata). Three different soils artificially contaminated with PAHs were applied in the studies. Three selected PAHs (anthracene, phenanthrene, and pyrene) were used at the doses of 100, 500, and 1000 mg/kg d.m. of soil and diesel fuel at the doses of 100, 500, and 1000 mg/kg d.m. of soil. For evaluation of the synergistic effect of nitrogen fixing bacteria, the following strains were selected: associative Azospirillum spp. and Pseudomonas stutzerii. Additionally, in the bioremediation process, the inoculation of plants with a mixture of the bacterial strains in the amount of 1 ml suspension per 500 g of soil was used. Chamber pot-tests were carried out in controlled conditions during four weeks of plant growth period. The basic physical, microbiological and biochemical properties in contaminated soils were determined. The obtained results showed a statistically important increase in the physical properties of soils polluted with PAHs and diesel fuel compared with the control and also an important decrease in the content of PAHs and heavy metals in soils inoculated with Azospirillum spp. and P. stutzeri after cock's foot grass growth. The bioremediation processes were especially intensive in calcareous rendzina soil artificially polluted with PAHs. PMID:26638532

  4. Role of bio-fertilizers in phosphorus utilization by wheat with various levels of N, P and FYM

    International Nuclear Information System (INIS)

    An experiment was conducted at Indian Agricultural Research Institute, New Delhi to study P utilization by wheat with various combinations of N, P, FYM and bio-fertilizers. The grain and straw yield of wheat increased with increasing levels of nitrogen along with P and FYM. The highest yield was obtained with 120 kg N + 60 kg P2O5 and 20 t FYM under no inoculation. However, it was highest with 80 kg N + 60 kg P2O5 + 20 t FYM under both the inoculation treatments. Almost similar trend was followed for the total P uptake. The values for per cent P derived from fertilizer (% Pdff) and P utilization were higher with 120 kg N + 60 kg P2O5 + 20 t FYM than the other treatments under no inoculation as well as Azospirillum inoculation. However, highest Pdff and P utilization were observed with 80 kg N + 60 kg P2O5 + 20 t FYM under the Azotobacter inoculation. The Azotobacter was superior to uninoculation and Azospirillum inoculation with respect to yield, total P uptake, percent Pdff and per cent P utilization by wheat. (author)

  5. Utilization of Lignocellulosic Waste for the Preparation of Nitrogenous Biofertilizer

    Directory of Open Access Journals (Sweden)

    Farhat R. Malik

    2001-01-01

    Full Text Available This work is a part of solid waste management project. Bagasse, a lignocellulosic waste of sugarcane industry was utilized for producing the nitrogenous biofertilizer. Nitrogen fixing free living bacteria were isolated from soil samples using dilution plate method. Selection of bacteria Azotobacter chroococcum was made due to its capability to survive and fix the maximum nitrogen as compared to other bacteria tested in a medium in which bagasse was the only carbon source. A. chroococcum, A. indicus and Azospirilum brasilense were tested for nitrogen fixation from 7 to 28 days. Maximum nitrogen fixed by these bacteria was 67.81, 28.00 and 43.20 mg/L respectively. Experimental results justified that bagasse biomass with A. chroococcum is a good source of nitrogen and organic matter, which can be utilized as a biofertilizer.

  6. Cultivation-Based and Molecular Assessment of Bacterial Diversity in the Rhizosheath of Wheat under Different Crop Rotations.

    Directory of Open Access Journals (Sweden)

    Muhammad Tahir

    Full Text Available A field study was conducted to compare the formationand bacterial communities of rhizosheaths of wheat grown under wheat-cotton and wheat-rice rotation and to study the effects of bacterial inoculation on plant growth. Inoculation of Azospirillum sp. WS-1 and Bacillus sp. T-34 to wheat plants increased root length, root and shoot dry weight and dry weight of rhizosheathsoil when compared to non-inoculated control plants, and under both crop rotations. Comparing both crop rotations, root length, root and shoot dry weight and dry weight of soil attached with roots were higher under wheat-cotton rotation. Organic acids (citric acid, malic acid, acetic acid and oxalic acid were detected in rhizosheaths from both rotations, with malic acid being most abundant with 24.8±2 and 21.3±1.5 μg g(-1 dry soil in wheat-cotton and wheat-rice rotation, respectively. Two sugars (sucrose, glucose were detected in wheat rhizosheath under both rotations, with highest concentrations of sucrose (4.08±0.5 μg g(-1 and 7.36±1.0 μg g(-1 and glucose (3.12±0.5 μg g(-1 and 3.01± μg g(-1 being detected in rhizosheaths of non-inoculated control plants under both rotations. Diversity of rhizosheath-associated bacteria was evaluated by cultivation, as well as by 454-pyrosequencing of PCR-tagged 16S rRNA gene amplicons. A total of 14 and 12 bacterial isolates predominantly belonging to the genera Arthrobacter, Azospirillum, Bacillus, Enterobacter and Pseudomonaswere obtained from the rhizosheath of wheat grown under wheat-cotton and wheat-rice rotation, respectively. Analysis of pyrosequencing data revealed Proteobacteria, Bacteriodetes and Verrucomicrobia as the most abundant phyla in wheat-rice rotation, whereas Actinobacteria, Firmicutes, Chloroflexi, Acidobacteria, Planctomycetes and Cyanobacteria were predominant in wheat-cotton rotation. From a total of 46,971 sequences, 10.9% showed ≥97% similarity with 16S rRNA genes of 32 genera previously shown to include

  7. Cultivation-Based and Molecular Assessment of Bacterial Diversity in the Rhizosheath of Wheat under Different Crop Rotations.

    Science.gov (United States)

    Tahir, Muhammad; Mirza, M Sajjad; Hameed, Sohail; Dimitrov, Mauricio R; Smidt, Hauke

    2015-01-01

    A field study was conducted to compare the formationand bacterial communities of rhizosheaths of wheat grown under wheat-cotton and wheat-rice rotation and to study the effects of bacterial inoculation on plant growth. Inoculation of Azospirillum sp. WS-1 and Bacillus sp. T-34 to wheat plants increased root length, root and shoot dry weight and dry weight of rhizosheathsoil when compared to non-inoculated control plants, and under both crop rotations. Comparing both crop rotations, root length, root and shoot dry weight and dry weight of soil attached with roots were higher under wheat-cotton rotation. Organic acids (citric acid, malic acid, acetic acid and oxalic acid) were detected in rhizosheaths from both rotations, with malic acid being most abundant with 24.8±2 and 21.3±1.5 μg g(-1) dry soil in wheat-cotton and wheat-rice rotation, respectively. Two sugars (sucrose, glucose) were detected in wheat rhizosheath under both rotations, with highest concentrations of sucrose (4.08±0.5 μg g(-1) and 7.36±1.0 μg g(-1)) and glucose (3.12±0.5 μg g(-1) and 3.01± μg g(-1)) being detected in rhizosheaths of non-inoculated control plants under both rotations. Diversity of rhizosheath-associated bacteria was evaluated by cultivation, as well as by 454-pyrosequencing of PCR-tagged 16S rRNA gene amplicons. A total of 14 and 12 bacterial isolates predominantly belonging to the genera Arthrobacter, Azospirillum, Bacillus, Enterobacter and Pseudomonaswere obtained from the rhizosheath of wheat grown under wheat-cotton and wheat-rice rotation, respectively. Analysis of pyrosequencing data revealed Proteobacteria, Bacteriodetes and Verrucomicrobia as the most abundant phyla in wheat-rice rotation, whereas Actinobacteria, Firmicutes, Chloroflexi, Acidobacteria, Planctomycetes and Cyanobacteria were predominant in wheat-cotton rotation. From a total of 46,971 sequences, 10.9% showed ≥97% similarity with 16S rRNA genes of 32 genera previously shown to include isolates

  8. Cultivation-Based and Molecular Assessment of Bacterial Diversity in the Rhizosheath of Wheat under Different Crop Rotations

    Science.gov (United States)

    Tahir, Muhammad; Mirza, M. Sajjad; Hameed, Sohail; Dimitrov, Mauricio R.; Smidt, Hauke

    2015-01-01

    A field study was conducted to compare the formationand bacterial communities of rhizosheaths of wheat grown under wheat-cotton and wheat-rice rotation and to study the effects of bacterial inoculation on plant growth. Inoculation of Azospirillum sp. WS-1 and Bacillus sp. T-34 to wheat plants increased root length, root and shoot dry weight and dry weight of rhizosheathsoil when compared to non-inoculated control plants, and under both crop rotations. Comparing both crop rotations, root length, root and shoot dry weight and dry weight of soil attached with roots were higher under wheat-cotton rotation. Organic acids (citric acid, malic acid, acetic acid and oxalic acid) were detected in rhizosheaths from both rotations, with malic acid being most abundant with 24.8±2 and 21.3±1.5 μg g-1 dry soil in wheat-cotton and wheat-rice rotation, respectively. Two sugars (sucrose, glucose) were detected in wheat rhizosheath under both rotations, with highest concentrations of sucrose (4.08±0.5 μg g-1and 7.36±1.0 μg g-1) and glucose (3.12±0.5 μg g-1 and 3.01± μg g-1) being detected in rhizosheaths of non-inoculated control plants under both rotations. Diversity of rhizosheath-associated bacteria was evaluated by cultivation, as well as by 454-pyrosequencing of PCR-tagged 16S rRNA gene amplicons. A total of 14 and 12 bacterial isolates predominantly belonging to the genera Arthrobacter, Azospirillum, Bacillus, Enterobacter and Pseudomonaswere obtained from the rhizosheath of wheat grown under wheat-cotton and wheat-rice rotation, respectively. Analysis of pyrosequencing data revealed Proteobacteria, Bacteriodetes and Verrucomicrobia as the most abundant phyla in wheat-rice rotation, whereas Actinobacteria, Firmicutes, Chloroflexi, Acidobacteria, Planctomycetes and Cyanobacteria were predominant in wheat-cotton rotation. From a total of 46,971 sequences, 10.9% showed ≥97% similarity with 16S rRNA genes of 32 genera previously shown to include isolates with plant

  9. Antisera production to detect indoleacetic acid in cultures of plant-growth promoting bacteria

    International Nuclear Information System (INIS)

    Rabbit polyclonal antisera against indoleacetic acid (IAA) bound to nitrocellulose membrane were obtained, which exhibited a high titer and specificity. The dot immunobinding technique with colloidal gold was used to detect auxin production by several strains belonging to Gluconacetobacter, Herbaspirillum, Azospirillum, Pseudomonas, Burkholderia and Bacillus genera, using culture supernatants as antigens. Moreover, auxin production was quantified by the Salkowski's method to corroborate the previous results. It was found that that all the studied microorganisms produce IAA and the feasibility of using these antisera to detect the metabolite was confirmed. Taking into account the potentialities of plant growth promoting bacteria as biofertilizers, the use of these antisera for a rapid and easy detection of IAA in bacteria associated with important crops is thus recommended.

  10. Isolation and Identification of Phosphate Solubilizing and Nitrogen Fixing Bacteria from Soil in Wamena Biological Garden, Jayawijaya, Papua

    Directory of Open Access Journals (Sweden)

    SRI WIDAWATI

    2005-07-01

    Full Text Available A study was undertaken to investigate the occurrence of phosphate solubilizing bacteria (PSB and nitrogen-fixing bacteria (NFB from soil samples of Wamena Biological Garden (WbiG. Eleven soil samples were collected randomly to estimate microbial population which used plate count method. The result showed that the microbial population ranged from 5.0x103-7.5x106 cells of bacteria/gram of soil and 5.0x103-1.5x107 cells of bacteria/gram of soil for PSB and NFB respectively. There were 17 isolates which have been identified till genus and species. The isolated microorganism were identified as PSB i.e. Bacillus sp., B. pantothenticus, B. megatherium, Flavobacterium sp., F. breve, Klebsiella sp., K. aerogenes, Chromobacterium lividum, Enterobacter alvei, E. agglomerans, Pseudomonas sp., Proteus sp. and as NFB i.e. Azotobacter sp., A. chroococcum, A. paspalii, Rhizobium sp., and Azospirillum sp.

  11. The influence of agro-industrial effluents on River Nile pollution

    Directory of Open Access Journals (Sweden)

    Sayeda M. Ali

    2011-01-01

    Full Text Available The major agro-industrial effluents of sugarcane and starch industries pose a serious threat to surface waters. Their disposal in the River Nile around Cairo city transitionally affected the microbial load. In situ bacterial enrichment (50–180% was reported and gradually diminished downstream; the lateral not vertical effect of the effluent disposal was evident. Disposed effluents increased BOD and COD, and then progressively decreased downstream. Ammoniacal N was elevated, indicating active biological ammonification and in situ biodegradability of the effluents. In vitro, the nitrogen-fixing rhizobacteria Crysomonas luteola, Azospirillum spp., Azomonas spp. and K. pneumoniae successfully grew in batch cultures prepared from the crude effluents. This was supported by adequate growth parameters and organic matter decomposition. Therefore, such biodegradability of the tested agro-industrial effluents strongly recommends their use for microbial biomass necessary for the production of bio-preparates.

  12. Associative diazotrophic bacteria in grass roots and soils from heavy metal contaminated sites

    Directory of Open Access Journals (Sweden)

    Fátima M.S. Moreira

    2008-12-01

    Full Text Available This work aimed to evaluate density of associative diazotrophic bacteria populations in soil and grass root samples from heavy metal contaminated sites, and to characterize isolates from these populations, both, phenotypically (Zinc, Cadmium and NaCl tolerance in vitro, and protein profiles and genotypically (16S rDNA sequencing, as compared to type strains of known diazotrophic species. Densities were evaluated by using NFb, Fam and JNFb media, commonly used for enrichment cultures of diazotrophic bacteria. Bacterial densities found in soil and grass root samples from contaminated sites were similar to those reported for agricultural soils. Azospirillum spp. isolates from contaminated sites and type strains from non-contaminated sites varied substantially in their in vitro tolerance to Zn+2 and Cd+2, being Cd+2 more toxic than Zn+2. Among the most tolerant isolates (UFLA 1S, 1R, S181, S34 and S22, some (1R, S34 and S22 were more tolerant to heavy metals than rhizobia from tropical and temperate soils. The majority of the isolates tolerant to heavy metals were also tolerant to salt stress as indicated by their ability to grow in solid medium supplemented with 30 g L-1 NaCl. Five isolates exhibited high dissimilarity in protein profiles, and the 16S rDNA sequence analysis of two of them revealed new sequences for Azospirillum.Objetivou-se avaliar a densidade de populações de bactérias diazotróficas associativas em amostras de solos e de raízes de gramíneas oriundas de sítios contaminados com metais pesados, e caracterizar isolados destas populações através da análise fenotípica (tolerância aos metais pesados zinco e cádmio e à NaCl in vitro, perfis protéicos, e genotípica (seqüenciamento de 16S rDNA, comparados às estirpes tipo das mesmas espécies. As densidades foram avaliadas nos meios NFb, Fam e LGI, comumente utilizados para culturas de enriquecimento de populações de bactérias diazotróficas associativas. As densidades

  13. Inoculant production in developing countries - Problems, potentials and success

    International Nuclear Information System (INIS)

    Sustainable agriculture is a long-term goal that seeks to overcome some of problems and constraints that confront the economic viability, environmental soundness and social acceptance of agricultural production systems. In this context, bio-fertilizers assume special significance particularly because they are 'eco-friendly', but also since their alternative, chemical fertilizers are expensive. Undoubtedly, the most commonly used bio-fertilizers are soil bacteria of the genus Rhizobium, but others like Azolla, Azospirillum, various cyanobacteria also contribute significant amounts of N to e.g. rice. Other bacteria like Frankia and Acetobacter contribute N to trees of the genus Casuarina and sugarcane, respectively. Furthermore, although they are rarely used as inoculants, vesicular arbuscular mycorrhizae (VAM) and phosphobacteria help countless plants solubilise and assimilate soil phosphorus. Despite these advantages, bio-fertilizers could be more widely used in developing countries. Contingent upon greater use is improved quality of the inoculants, and all aspects of their production are discussed here. (author)

  14. Studies on utilization of nitrogen-fixing bacteria for saving energy; Chisso koteikin no katsuyo ni yoru sho energy no kenkyu

    Energy Technology Data Exchange (ETDEWEB)

    Uozumi, T.; Koyama, R.; Horiuchi, M.; Hidaka, M.; Masaki, H. [The University of Tokyo, Tokyo (Japan); Shigematsu, T.; Inoue, A. [New Energy and Industrial Technology Development Organization, Tokyo, (Japan)

    1997-02-01

    This paper describes analysis and enhancement of nitrogen-fixing gene of rice root bacteria, such as Klebsiella oxytoca, Azospirillum lipoferumn and Sphingomonas paucimobilis, for realizing energy saving through conservation of nitrogenous fertilizers. For K. oxytoca, modified strain R-16 was developed, which can fix nitrogen effectively even in the presence of NH4{sup +}. Nitrogen-fixing ability of A. lipoferumn depends on the activity control by the modification of nitrogen-fixing enzyme as well as on the adjustment of transcription level by the transcription activating gene, nifA. The control gene relating to the above was analyzed by making clones. As a result, a modified strain TAl without the control by NH4{sup +} was developed. The R-16 and TAl strains were inoculated into rice sterile-cultured without nitrogen. Consequently, inoculated strains were settled in the root, which resulted in the increased vegetation weight of plant to two times heavier than that without inoculation. 9 refs.

  15. Evaluation of Four Bio fertilizers for Bioremediation of Pesticide contaminated Soil

    International Nuclear Information System (INIS)

    Experiments were conducted to asses the ability of mixed populations of microorganisms which produced as a bio fertilizers by the General Organization of Agriculture Fund, Ministry of Agriculture, Egypt (phosphoren, microbien, cerealin and azospirillum) to degrade five selected pesticides representing different classes including organophosphate, carbamate and chlorinated organic compounds. There were differences in rates of biotransformation, suggesting the selective induction of certain metabolic enzymes. Inoculation of soil incorporated with malathion, fenamiphos, carbaryl, aldicarb and dieldrin, resulted in ca. 80-90% removal of malathion and fenamiphos within 8 days, carbaryl and aldicarb within 11-15 days respectively. Dieldrin removal occurred slowly within 2 months. These data suggest that bioremediate may act as potential candidates for soil inoculation to bioremediate pesticide contaminated soil. The production of Co2 (soil respiration ) was stimulated by some pesticides. In samples with microbien, an about 2 times higher Co2 production was measured

  16. Isolation And Characterization Of Certain Pgpr Isolates From Maize Rhizosphere Soil Samples Ofperambalur District Soil Samples Ofperambalur District

    Directory of Open Access Journals (Sweden)

    K. Vinithadali

    2013-12-01

    Full Text Available In the present study, an attempt was made to isolate and characterize certain important plant growth promoting rhizobacteria (PGPR from ten locations of Perambalur district of Tamilnadu. The results showed that 4all the maize soils harbouredPGPR such as Azospirillum, Bacillus and Pseudomonas to the tune of 10 CFU/g of rhizosphere soil sample. Pure culture of the above PGPR were isolated and characterized for tentative identification at their species level. General and biochemical characterization studies revealed that five each isolate of A. brasilenseand A. lipoferum, six isolates of P. fluorescens and four isolates of P. putida and five each of B. megaterium and B. polymyxa were found among the ten rhizosphere soils.

  17. The influence of Plant Growth Promoting Rhizobacteria (PGPR on the reduction of abiotic stresses in crops

    Directory of Open Access Journals (Sweden)

    Omid Alizadeh

    2011-12-01

    Full Text Available Plants are always subjected to biotic and abiotic stresses in the environment which haveinfluences on the growth and development of the plants. Beneficial free-living soil bacteria are usuallyreferred as Plant-Growth Promoting Rhizobacteria or PGPR. Different plant growth-promotingRhizosphere bacteria, including associative bacteria such as: Azospirillum, Bacillus, Pseudomonas andEnterobacter group have been used for their beneficial influences on plants. Typically, PGPRs areassociated with plants root and augment plant productivity and immunity; however, recent worksshowed that PGPRs not have just induced the systemic tolerance to abiotic stress such as salt anddrought, but also they have increased the nutrient uptake from soils, and as a result the hazardousaccumulation of nitrates and phosphates in the agricultural soils can be reduced by usage of them.

  18. Influence of one or two Bt genes transgenic cotton free living nitrogen fixers and p-solubilising microorganisms in vertisols and alfisols

    Science.gov (United States)

    Sudha, T.; Babu, R.; Biradar, D. P.; Patil, V. C.; Shirnalli, G.

    2012-04-01

    India, the largest cotton grower in the world benefited from the cultivation of genetically modified Bt transgenic cotton. Bt cotton with the single gene (cry 1Ac) contributed to increased productivity over the last eight years. But in the recent years, there has been an increasing trend to adopt two genes (cry 1Ac and cry 2Ab) transgenic cotton in India. The two gene Bt cotton hybrids were planted over a large area (57%) during 2009 than the single gene Bt cotton hybrids. In this context, the field experiments were conducted in farmers field in both Vertisols and Alfisols during monsoon season of 2009 to study the effect of a single gene Bt hybrid (RCH-2Bt, JK-99Bt, Mallika Bt, MRC-6918 Bt, Brahma Bt, RCH-708 Bt, Bunny Bt) as well as two gene Bt hybrids (RCH-2 BGII Bt, Bunny BGII Bt) compared with the non genetically modified (non-Bt) hybrid (DHH-11) on the population of free living nitrogen fixing microorganisms (Azospirillum and methylotrophs) and P-solubilizers in two different soil types under rainfed situation. Observations on microbial population were recorded at flowering and at harvest in both the soil types. Results indicated a higher population of Azospirillum, methylotrophs and P-solubilisers in the rhizosphere grown with single or two gene Bt hybrid and non-Bt hybrid at flowering stage in both the soil types. In Vertisol, significantly higher population of methylotrophs in MRC-6918 Bt (30 x 102/g of soil), P-solubilizers in RCH-2 Bt (31x103/g of soil) and Azospirillum in RCH-708 Bt (0.79 x 106 /g of soil) was recorded as compared to non-Bt hybrid DHH-11 (2 x 102/g of soil, 12 x 103/g of soil, 0.54 x 106/g of soil), respectively. Whereas, in Alfisol, significantly higher population of methylotrophs in RCH-2 Bt (13x 102/g of soil), P-solubilisers in JK-99 Bt (38 x 103/g of soil) and Azospirillum in RCH-2Bt (0.57 x 106/g of soil) was recorded over non Bt hybrid DHH-11 (2x 102/g of soil, 13x 103/g of soil and 0.17 x106/g of soil) respectively. Our results

  19. Development of nitrogen-fixing monocot-bacteria associations. Final progress report, September 1, 1980-August 31, 1983

    Energy Technology Data Exchange (ETDEWEB)

    Brill, W.J.

    1984-01-01

    Experiments have demonstrated the feasibility of breeding bacteria and cereal plants so that the plant may obtain some of its nitrogen through nitrogen fixation. Corn lines with associative activity were compared to lines without such activity. There is no significant difference between numbers of nitrogen-fixing bacteria on roots of these lines. Azospirillum are found in the extracellular mucilage of the root. Other, yet-to-be-identified bacteria also are found in the mucilage. Techniques, using colloidal gold, have been developed to identify root-associated microbes and to determine which ones contain nitrogenase. Nitrogen fixation seems to require an interaction between an unidentified nitrogen-fixing bacterium and another unidentified bacterium unable to fix nitrogen.

  20. Intact soil-core microcosms for evaluating the fate and ecological impact of the release of genetically engineered microorganisms

    Energy Technology Data Exchange (ETDEWEB)

    Fredrickson, J.K.; Van Voris, P.; Li, S.W. (Pacific Northwest Lab., Richland, WA (USA)); Bentjen, S.A. (Univ. of Idaho, Moscow (USA))

    1989-01-01

    Intact soil-core microcosms were studied to determine their applicability for evaluating the transport, survival, and potential ecosystem effects of genetically engineered microorganisms before they are released into the environment. Soil-core microcosms were planted with wheat and maize seeds and inoculated with Azospirillum lipoferum SpBr17 and SpRG20a Tn5 mutants, respectively. Microcosm leachate, rhizosphere soil, plant endorhizosphere, insects, and xylem exudate were sampled for A. lipoferum Tn5 mutant populations. A. lipoferum TN5 populations, determined by most-probable-number technique-DNA hybridization, varied from bellow detection to 10{sup 6} g of dry root{sup {minus}1} in the rhizosphere, with smaller populations detected in the endorhizosphere. Intact soil-core microcosms were found to maintain some of the complexities of the natural ecosystem and should be particularly useful for initial evaluations of the fate of plant-associated genetically engineered bacteria.

  1. application of nuclear techniques to study the bioavailability of essential nutrients under adverse soil conditions

    International Nuclear Information System (INIS)

    the present study aims to investigate the effect of microbial inocula (Rhozobium, Azospirillum and AM) on growth, uptake of some nutrients (N,P,K,Na, Ca and Mg) of barley and canola plants in saline soil. Also, nitrogenase and dehydrogenase activities of barley root rhizosphere are measured and N15 isotop dilution (ID) technique had been used with canola. of the techniques available to quantify plant-associated N2 fixation in the field the N15 isotope dilution (ID) technique has come to be regarded as the most reliable, because if carefully utilized, it is capable of estimating the proportion of crop N derived from BNF. to trace the effect of microbial activity in improving the salt-tolerance of the plants used, set of experiments were conducted even in green house

  2. Sustainability of grassland on rehabilitated strip mines in South Africa

    Energy Technology Data Exchange (ETDEWEB)

    Rethman, N.F.G.; Tanner, P.D. [University of Pretoria, Pretoria (South Africa)

    1995-06-01

    The potential role of legumes and grass inoculants as a source of biological nitrogen for establishment of planted pastures on rehabilitated areas is examined. The relative yield response of mixed pastures to the level of nitrogen fertilization and the effect of soil depth on the relative productivity of a mixed pasture are examined for several South African collieries. There is concern about the sustainability of grass pastures receiving nitrogen fertilization. Alfalfa, lovegrass, fingergrass, various mixtures, and forage legumes are examined for nitrogen fixation. Research is proposed to evaluate Azospirillum inoculation of grasses, the possible role of Mycorrhiza in the revegetation of disturbed sites, and the interaction of nitrogen with organic materials in the soil. 24 refs., 8 tabs.

  3. Characterization of Endophytic Diazotroph Bacteria Isolated from Rice

    Directory of Open Access Journals (Sweden)

    JOKO PRAYITNO

    2010-06-01

    Full Text Available Attempt to extend the biological nitrogen fixation to important crops such as rice has been conducted by isolating endophytic diazotrophs from rice rhizosphere and roots. In this study, three bacterial isolates of R2, R4, and E4 isolated from rice-legume rotation in the Nile Delta Egypt and four bacterial isolates of R38-O, R38-T, R53, and R58 isolated from wild rice in the Philippines were characterized using classical methods of bacterial identification and using biochemical test kits (API20E and API20NE. R2 and R4 isolates were identified as Rhizobium sp., E4 isolate was identified as Rhizobium leguminosarum bv. trifolii, and R38-T, R53, and R58 isolates were identified as Sphingomonas, Azospirillum, and Agrobacterium, respectively. Of all Rhizobium isolates, only E4 could form nodules on legumes other than their original host berseem clover (Trifolium alexandrum L. as their original host.

  4. EFFECT OF EPS RICH PGPR CELLS ON THE GROWTH CHARACTERISTICS AND THEIR ENHANCED DEFENSIVE MECHANISM IN RICE (PYRICULARIA ORYZAE PATHOSYSTEM UNDER LOWLAND CONDITION

    Directory of Open Access Journals (Sweden)

    S. Kalaiarasu

    2014-03-01

    Full Text Available The Effect of EPS rich PGPR cells viz., vegetative cell application, co-inoculation and cofloculation Pseudomonas fluorescens and Azospirillum together with challenge inoculation of Pyricularia oryzae on the enhancement of induced systemic resistance (ISR in Rice-Pyricularia oryzae pathosystem was studied under pot culture condition with rice cv.IR.50. It was observed that the application of Pseudomonas fluorescens and Azospirillum as co-floculation, altered the biochemical and physiological parameters viz., reducing and non-reducing sugars, total phenol content and defense enzymes activities such as peroxidase (PO, Polyphenol oxidase (PPO, of rice plant to a significant level followed by co-inoculation and vegetative cell application of PGPR cells. The application of PGPR cells, as co-floculation, was found to augment the total phenol content and defense enzyme activities such as PO and PPO content of rice plant to a higher level whereas a reduction in reducing and non-reducing sugar level was recorded, which ultimately lead to a reduction of Pyricularia oryzae incidence in lowland rice. It has been postulated that the EPS biosynthesis of PGPR cells during co-floculation processes might act as elicitor for the enhancement of ISR in Rice- Pyricularia oryzae pathosystem whereas the vegetative cells and co-inoculation processes, without any involvement of EPS, responded poorly for the enhancement of ISR in the same pathosystem. This is the first comprehensive report on the role of bacterial EPS, as a determinant of ISR, in Rice - Pyricularia oryzae pathosytem and it needs further elaborate research on the topic.

  5. Benefits from Bio and organic fertilization by cucumber (Cucumis Sativus) with application of 15N stable isotope

    International Nuclear Information System (INIS)

    Benefits from bio and organic fertilizer were evaluated under cucumber (Cucumis Sativus) crop grown on sandy soil at a field scale. The experiment was conducted under drip irrigation system. Fertilization treatment indicated that the combination of 50% mineral fertilizer (MF) + 50% organic compost (OC) was superior over all other fertilization treatment when the fresh weight of cucumber biomass or fruits was considered. It means that half of the recommended dose of of mineral fertilizer is enough to meet the requirement of cucumber crop when supplemented with organic compost. Nitrogen derived from mineral fertilizer (Ndff) by cucumber at different plant growth stages was significantly affected by the rate of addition and enhanced with microbial inoculation. Arbuscular mycorrhizea (AMF) was superior over Azospirillum and Rhizobium inoculations. The enhancement of Ndff uptake by plants was more pronounced at the fruit stage than at vegetative, flowering and hay growth stages. The highest values of Ndfa were induced by Rhizobium at hay stage followed by fruit. Similar trend, but to different extents was noticed with AMF and Azospirillum inoculum s. Most of nitrogen derived from compost (Ndfc) was occurred by addition of 50% MF + 50% Oc. Rhizobium and AMF were more effective than Azospirilum. High quantities of Ndfc were recognized at hay stage compared to other growth stages.The efficient use of mineral fertilizer-N (%NUE) was increased by addition of half:half mineral and organic fertilizer. Similarly, it seems that microbial inoculation in general has a synergistic effect on enhancement of %NUE. Higher NUE occurred at hay growth stage than others. (Author)

  6. Study of quantitative and qualitative yield, chlorophyll content and some growth indices of wheat (Triticum aestivum L. in response to seed inoculation with PGPR at different levels of soil salinity

    Directory of Open Access Journals (Sweden)

    M. Hagh Bahari

    2014-07-01

    Full Text Available In order to study of quantitative and qualitative yield, chlorophyll content and some growth indices of wheart (Triticum aestivum L. in response to seed inoculation with plant growth promoting rhizobacteria (PGPR at different levels of soil salinity, a factorial experiment based on randomized complete block design with three replications was conducted at Research Greenhouse of Faculty of Agriculture, University of Mohaghegh Ardabili, Ardabil, in 2011. Experimental factors were soil salinity at four levels (0, 15, 30 and 60 Mm as Nacl and seed inoculation with PGPR in four levels (no inoculation as control, seed inoculation with Azotobacter chrocoocum strain 5, Azospirillum lipoferum strain OF, Pseudomonas putida strain 186. Comparison of means showed that in soil salinity conditions, grain yield per plant, number of grain per spike, grain 100 weight, spike length and root weight increased due to seed inoculation with PGPR compared to without seed inoculation. Investigation of total dry matter accumulation indicated that in all treatment combinations, it increased rapidly until 85 days after sowing. From 85 days after sowing till harvest time, it decreased due to increasing of competition, shedding and aging of leaves. In all treatment combinations, the highest grain yield and total dry matter accumulation per unit area was obtained in treatment combination of seed inoculation with Azosperilium × no soil salinity and the lowest amount was in the highest level of soil salinity × no seed inoculation. Similar trend was obtained in crop growth rate and relative growth rate. Hence, the results of this study showed that in order to increase the quantitative and qualitative yield, chlorophyll content and some other growth indices such as total biomass, crop growth rate and relative growth rate of wheat in soil salinity conditions, it could be suggested that wheat seed inoculation with Azospirillum be applied

  7. Ammonium inhibition of nitrogenase activity in Herbaspirillum seropedicae

    Energy Technology Data Exchange (ETDEWEB)

    Fu, H.; Burris, R.H. (Univ. of Wisconsin, Madison (USA))

    1989-06-01

    The effect of oxygen, ammonium ion, and amino acids on nitrogenase activity in the root-associated N{sub 2}-fixing bacterium Herbaspirillum seropedicae was investigated in comparison with Azospirillum spp. and Rhodospirillum rubrum. H. seropedicae is microaerophilic, and its optimal dissolved oxygen level is from 0.04 to 0.2 kPa for dinitrogen fixation but higher when it is supplied with fixed nitrogen. No nitrogenase activity was detected when the dissolved O{sub 2} level corresponded to 4.0 kPa. Ammonium, a product of the nitrogenase reaction, reversible inhibited nitrogenase activity when added to derepressed cell cultures. However, the inhibition of nitrogenase activity was only partial even with concentrations of ammonium chloride as high as 20 mM. Amides such as glutamine and asparagine partially inhibited nitrogenase activity, but glutamate did not. Nitrogenase in crude extracts prepared from ammonium-inhibited cells showed activity as high as in extracts from N{sub 2}-fixing cells. The pattern of the dinitrogenase and the dinitrogenase reductase revealed by the immunoblotting technique did not change upon ammonium chloride treatment of cells in vivo. No homologous sequences were detected with the draT-draG probe from Azospirillum lipoferum. There is no clear evidence that ADP-ribosylation of the dinitrogenase reductase is involved in the ammonium inhibition of H. seropedicae. The uncoupler carbonyl cyanide m-chlorophenylhydrazone decreased the intracellular ATP concentration and inhibited the nitrogenase activity of whole cells. The ATP pool was significantly disturbed when cultures were treated with ammonium in vivo.

  8. Ticks (Acari: Ixodidae) infesting birds in an Atlantic rain forest region of Brazil.

    Science.gov (United States)

    Ogrzewalska, Maria; Pacheco, Richard C; Uezu, Alexandre; Richtzenhain, Leonardo J; Ferreira, Fernando; Labruna, Marcelo B

    2009-09-01

    Brazil has the third richest bird diversity of the world; however, there are few data concerning ticks (Acari: Ixodidae) parazitizing birds. The aim of the study was to report tick infestations on wild birds from an Atlantic rain forest region of Brazil. During 2 yr, ticks were collected from birds and from the environment in 12 forest sites. A total of 1,725 birds were captured representing 80 species from 24 families. In total, 223 (13%) birds were found infested by immature stages of Amblyomma ticks: 1,800 larvae and 539 nymphs. The prevalence of ticks was higher among birds from the families Thamnophilidae, Conopophagidae, and Momotidae. The most common tick parasitizing birds was Amblyomma nodosum Koch. Other tick species, Amblyomma coelebs Neumann, Amblyomma cajennense (F.), Amblyomma ovale Koch, Amblyomma longirostre (Koch), Amblyomma calcaratum Neumann, and Amblyomma naponense (Packard), were found sporadically. Among free-living ticks collected in the environment, A. cajennense was the most common, followed by A. coelebs, A. naponense, Amblyomma brasilense Aragão, and Hemaphysalis juxtakochi Cooley. PMID:19769058

  9. bio fertilization of soybean in sandy soils of egypt using N-15 tracer technique

    International Nuclear Information System (INIS)

    The effect of inoculation of soybeans with B. Japonicum and A. brasilense either solely or in mixture, and N fertilizer levels had been studied in pot experiment Nodulation of soybean grown in sandy soil was enhanced by inoculation. The highest values of nodules number and fresh weight were recorded at rate of 20 Kg N ha-1, and decreased with increasing N rate up to 40 kg N ha-1. In contrast, the dry weight of the above ground parts, as well as the N uptake was increased with increasing N fertilizer level. Similar effect was observed for inoculation as compared with the un inoculated treatment. Despite the nodulating and nonnodulating soybeans has almost the same dry weight, the nodulating isoline accumulated more N than the non-nodulating. Percentages of nitrogen derived from air (%Ndfa) was depressed with increasing N rates from 10 to 40 kg N ha-1 either estimated by isotope dilution (I D) or N difference method (D M). Dual inoculation resulted in high percent of N 2-fixed (42.5%) at rate of 10 kg N ha-1. Correlation between I D and D M methods was found to be dependent on inoculation treatments. However, nitrogen utilized by nodulating soybean (FUE%) was enhanced as a function of inoculation with B. Japonicum. 2 figs., 3 tabs

  10. Efecto de la inoculación con bacterias rizosféricas en dos variedades de trigo. Fase II: invernadero Effect of inoculation with rihizospheric bacteria in two varieties of wheat. Phase II: greenhouse

    Directory of Open Access Journals (Sweden)

    Carlos José Bécquer Granados

    Full Text Available Se llevó a cabo un experimento de invernadero para evaluar la influencia de la inoculación simple y combinada, efectuada con las bacterias rizosféricas Sinorhizobium y Azospirillum, en dos variedades de trigo. Materiales y métodos según lo descrito en las metodologías convencionales para este campo de estudio. El diseño experimental fue completamente aleatorizado, con 4 réplicas y 10 tratamientos. Análisis estadístico varianza bifactorial. Se utilizó tratamiento fertilizado con NH4NO3 (150 ppm/kg suelo. Se evaluó contenido de clorofila foliar, peso seco aéreo, peso seco radical, longitud del tallo y germinación. En caso de aparecer diferencias, se determinaron mediante la prueba de Duncan, y las diferencias entre las variedades con t-Student. Se concluye que la inoculación combinada de la cepaA2 (Sinorhizobium meliloti con la cepaN7 (Azospirillum zeae, fue la de mayor influencia positiva en el contenido de clorofila de las plantas. Por otra parte, existió una alta diferenciación entre las dos variedades de trigo en la longitud del tallo, peso seco aéreo y peso seco radical. Los resultados en peso seco aéreo y peso seco radical, al combinarse los dos factores estudiados, dependieron notablemente de las características varietales de la planta y del efecto significativo de la población autóctona de rizobacterias. La germinación de las plantas no estuvo vinculada a ninguno de los factores aplicados en el experimento.The experiment was carried out in a greenhouse so that the inoculation, both simple and combined (with the rhizospheric bacteria- Sinorhizobium andAzospirllium, en two varieties of Wheat. Materials and methodologies were used in accordance with previously prescribed conventional methodologies for this study. The experimental design was completely randomized, with 4 replicas and 10 treatments. A statistical analysis using two-way variance was done. Fertilized treatment was applied with NH4NO3 (150 ppm/kg soil. The

  11. Nitrous oxide reductase gene (nosZ) and N2O reduction along the littoral gradient of a eutrophic freshwater lake

    Institute of Scientific and Technical Information of China (English)

    Chaoxu Wang; Guibing Zhu; Yu Wang; Shanyun Wang; Chengqing Yin

    2013-01-01

    Lake littoral zones are characterized by heterogeneity in the biogeochemistry of nutrient elements.This study aimed to explore the relationship between the nitrous oxide reductase gene (nosZ)-encoding denitrifier community composition/abundance and N2O reduction.Five samples (deep sediment,near-transition sediment,transition site,near-transition land and land soil) were collected along a littoral gradient of eutrophic Balyangdian Lake,North China.To investigate the relationship between the nosZ-encoding denitrifier community structure and N2O reduction,the nosZ-encodimg denitrifier community composition/abundance,potential denitrification rate (DNR) and potential N2O production rate (pN2O) were investigated using molecular biological technologies and laboratory incubation experiments.The results showed that the average DNR of sediments was about 25 times higher than that of land soils,reaching 282.5 nmol N/(g dry weight (dw)·hr) and that the average pN2O of sediments was about 3.5 times higher than that of land soils,reaching 15.7 nmol N/(g dw.hr).In the land area,the nosZ gene abundance showed a negative correlation with the N2O/(N2O+N2) ratio,indicating that nosZ gene abundance dominated N2O reduction both in the surface soils of the land area and in the soil core of the transition site.Phylogenetic analysis showed that all the nosZ sequences recovered from sediment clustered closely with the isolates Azospirillum largimobile and Azospirillum irakense affiliated to Rhodospirillaceae in alpha-Proteobacteria,while about 92.3% (12/13) of the nosZ sequences recovered from land soil affiliated to Rhizobiaceae and Bradyrhizobiaceae in α-Proteobacteria.The community composition of nosZ gene-encoding denitrifiers appeared to be coupled with N2O reduction along the littoral gradient.

  12. EFFECT OF INTEGRATED NUTRIENT MANAGEMENT ON VEGETATIVE GROWTH AND YIELD OF TRANSPLANTED HYBRID RICE (ORYZA SATIVA L. CROP

    Directory of Open Access Journals (Sweden)

    RAYEES A. SHAH* SANDEEP KUMAR

    2014-09-01

    Full Text Available The integrated use of organic and inorganic sources of plant nutrients can help in sustainable and environmentally sound nutrient management of soils that are low in organic matter. A study was conducted  during 2009- 10 & 2010-11, on sandy loam soils, low in organic carbon, medium in available phosphorus and potash with pH of 7.5 at Agricultural Research Farm of C.C.R.(P.G. College, Muzaffarnagar U.P. India, to investigate the comparative use of  integrated nutrient management on vegetative growth and yield of hybrid rice. The experiment was laid out with fifteen treatments in a RBD. The treatments were; Control (T1, NPK 100% RDF (T2, NPK 75% RDF (T3, NPK 50% RDF + FYM @ 10 tons  ha-1 (T4, NPK 50% RDF + FYM @15 tons ha-1 (T5, NPK 50% RDF + wheat cut straw @10 tons ha-1 (T6, NPK 50% RDF + wheat cut straw @15 tons ha-1 (T7, NPK 50% RDF + Neem cake @ 2.5 tones ha-1 (T8, NPK 50% RDF + Neem cake @ 5 tones ha-1 (T9, NPK 50% RDF + Vermicompost @ 2.5 tons ha-1 (T10, NPK 50% RDF + Vermicompost @ 2.5 tons ha-1 +Azotobacter (T11, NPK 50% RDF + Vermicompost @ 2.5 tones ha-1 +PSB @ 5Kg ha-1 (T12, NPK 50% RDF + Vermicompost @ 2.5 tones ha-1 + Azospirillum (T13, NPK 50% RDF  + Azotobacter + Azospirillum + PSB @ 5 Kg ha-1(T14, and NPK 50% RDF + Neem cake @ 2.5 tones ha-1 +FYM @5 tons  ha-1 + Azotobacter+PSB @ 5Kg ha-1 (T15. The maximum grain yield (63 and 67 q per hectare during 2009 and 2010, respectively was obtained with the integration of NPK 50% RDF + Neem cake @2.5 tonnes ha-1 + FYM @5 tonnes ha-1+Azotobacter+PSB @ 5kg ha-1.

  13. PRODUCCIÓN DE ANTISUEROS PARA LA DETECCIÓN DE ÁCIDO INDOLACÉTICO EN CULTIVOS DE BACTERIAS PROMOTORAS DEL CRECIMIENTO VEGETAL Antisera Production to Detect Indoleacetic Acid in Cultures of Plant-Growth Promoting Bacteria

    Directory of Open Access Journals (Sweden)

    MARCIA M ROJAS

    2012-05-01

    Full Text Available Se obtuvieron antisueros en conejo utilizando como antígeno el AIA adherido a membranas de nitrocelulosa que mostraron un elevado título y especificidad. Mediante la técnica de inmunoadsorción por manchas marcadas con oro coloidal se detectó la producción de esta auxina por cepas de los géneros Gluconacetobacter, Herbaspirillum, Azospirillum, Pseudomonas, Burkholderia y Bacillus empleando como antígenos los sobrenadantes de los cultivos. Para cuantificar la producción de AIA y corroborar los datos obtenidos se empleó la técnica colorimétrica derivada de Salkowski. Los resultados muestran que todos los géneros bacterianos estudiados tienen la capacidad de producir AIA y se demuestra la factibilidad del uso de este antisuero policlonal para la detección de este metabolito. Teniendo en cuenta las potencialidades de estas bacterias, resulta de gran importancia la utilización de antisueros y técnicas serológicas para la detección rápida y sencilla de este tipo de metabolitos en bacterias asociadas a cultivos de interés económico.Rabbit polyclonal antisera against indoleacetic acid (IAA bound to nitrocellulose membrane were obtained, which exhibited a high titer and specificity. The dot immunobinding technique with colloidal gold was used to detect auxin production by several strains belonging to Gluconacetobacter, Herbaspirillum, Azospirillum, Pseudomonas, Burkholderia and Bacillus genera, using culture supernatants as antigens. Moreover, auxin production was quantified by the Salkowski's method to corroborate the previous results. It was found that that all the studied microorganisms produce IAA and the feasibility of using these antisera to detect the metabolite was confirmed. Taking into account the potentialities of plant growth promoting bacteria as biofertilizers, the use of these antisera for a rapid and easy detection of IAA in bacteria associated with important crops is thus recommended.

  14. Identificación de algunos géneros microbianos asociados al cultivo del maíz (Zea mays L. en diferentes suelos de Cuba Identification of some microbial genera associated to the maize crop (Zea mays L in different Cuban soils

    Directory of Open Access Journals (Sweden)

    Heydrich Mayra

    2003-06-01

    Full Text Available Se ha demostrado que la aplicación de bioproductos a partir de microorganismos rizosféricos en la agricultura, provoca incrementos en la productividad de los cultivos. Si se trabaja con cepas nativas aumenta la factibilidad biológica de los mismos. Esta investigación se realizó con el objetivo de determinar algunos géneros microbianos asociados al cultivo del maíz variedad Francisco mejorado en suelos Nitisol Rhodic, Cambisol Eutric-Humic y Cambisol Eutric procedentes de diferentes localidades cubanas. Para ello se emplearon tres métodos de aislamiento: Método Convencional, Tubos Espermosféricos y Modelo Microcosmos. Los aislados fueron clasificados mediante la utilización de técnicas clásicas. Los resultados obtenidos demostraron que los géneros Pseudomona, Azospirillum, Azotobacter, Bacillus y Streptomyces forman parte de la comunidad microbiana de la rizosfera del cultivo del maíz en las condiciones estudiadas, constituyendo Pseudomonas el género dominante. Los métodos de aislamiento emplea­dos resultaron adecuados para la obtención de representantes típicos de las poblaciones microbianas en estudio, demostrándose la superioridad de los Tubos Espermosféricos y el Modelo Microcosmos para estos fines, ya que los mismos permiten aislar los microorganismos capaces de vivir a expensas de los exudados radicales del cultivo, en la interacción planta-bacteria. Palabras clave: rizosfera; maíz; modelo espermosférico; modelo microcosmos; Pseudomonas.It has been demonstrated that applying bio-products based on native rhizosphere micro-organisms in agriculture increases crop productivity. Working with native strains also improves their biological feasibility. Some microbial genera associated with the improved corn variety Francisco were isolated from Nitisol Rhodic, Cambisol Eutric-Humic and Cambisol Eutric soil from different Cuban regions using three isolation methods: the convencional method, the spermosphere model and the

  15. Microorganismos rizosféricos, potenciales antagonistas de Fusarium sp. causante de la pudrición radicular de maracuyá (Passiflora edulis Sims

    Directory of Open Access Journals (Sweden)

    Luisa Fernanda Quiroga-Rojas

    2012-07-01

    Full Text Available El cultivo de maracuyá (Passiflora edulis, de gran importancia económica para Colombia, actualmente es afectado por la enfermedad del marchitamiento vascular causado por Fusarium sp. lo que hace necesario la búsqueda de alternativas que permitan un control eficiente de esta enfermedad. Aislados de las bacterias Azotobacter spp., Azospirillum spp. y el hongo Trichoderma spp., fueron evaluados como potenciales biocontroladores de Fusarium sp. en pruebas in vitro e in vivo. Las pruebas de “test dual” evidenciaron que un aislado nativo de Trichoderma sp. y un producto comercial (Trichoderma lignorum, provocaron la inhibición del crecimiento micelial de Fusarium sp. entre 94.2% y 93.6%, respectivamente. La evaluación de aislados de Trichoderma sobre plántulas de maracuyá en tres momentos de aplicación indicó que la inoculación previa disminuyó el porcentaje de infección de las plantas entre un 75 y 50%, mientras que con aplicaciones después o simultáneamente con el patógeno, el porcentaje de infección disminuyó en 25%. Estos resultados indican que la aplicación de organismos de biocontrol en semillas pregerminadas mejora la protección de las plantas contra el fitopatógeno estudiado y son un recurso importante en el manejo preventivo de las enfermedades de maracuyá.

  16. Plant-microbe interactions promoting plant growth and health: perspectives for controlled use of microorganisms in agriculture.

    Science.gov (United States)

    Berg, Gabriele

    2009-08-01

    Plant-associated microorganisms fulfill important functions for plant growth and health. Direct plant growth promotion by microbes is based on improved nutrient acquisition and hormonal stimulation. Diverse mechanisms are involved in the suppression of plant pathogens, which is often indirectly connected with plant growth. Whereas members of the bacterial genera Azospirillum and Rhizobium are well-studied examples for plant growth promotion, Bacillus, Pseudomonas, Serratia, Stenotrophomonas, and Streptomyces and the fungal genera Ampelomyces, Coniothyrium, and Trichoderma are model organisms to demonstrate influence on plant health. Based on these beneficial plant-microbe interactions, it is possible to develop microbial inoculants for use in agricultural biotechnology. Dependent on their mode of action and effects, these products can be used as biofertilizers, plant strengtheners, phytostimulators, and biopesticides. There is a strong growing market for microbial inoculants worldwide with an annual growth rate of approximately 10%. The use of genomic technologies leads to products with more predictable and consistent effects. The future success of the biological control industry will benefit from interdisciplinary research, e.g., on mass production, formulation, interactions, and signaling with the environment, as well as on innovative business management, product marketing, and education. Altogether, the use of microorganisms and the exploitation of beneficial plant-microbe interactions offer promising and environmentally friendly strategies for conventional and organic agriculture worldwide. PMID:19568745

  17. Bacterias solubilizadoras de fosfato y sus potencialidades de uso en la promoción del crecimiento de cultivos de importancia económica

    Directory of Open Access Journals (Sweden)

    Gloria María Restrepo-Franco

    2015-01-01

    Full Text Available La mayoría de los suelos tropicales y subtropicales son deficientes en fósforo biodisponible, por lo que el empleo de bacterias promotoras del crecimiento vegetal, principalmente las solubilizadoras de fosfato, pueden reducir el uso de fertilizantes químicos. El objetivo de este trabajo es ofrecer una panorámica actual acerca de los principales géneros y mecanismos de acción de las bacterias solubilizadoras de fosfatos (BSF, así como analizar su posible empleo en cultivos de importancia económica. La utilización de géneros bacterianos con mayores potencialidades de uso como Pseudomonas y Bacillus unido a aislados promisorios de Azospirillum y Herbaspirilum en cultivos como arroz y café permitiría reducir a largo plazo el uso de productos químicos en la agricultura, así como desarrollar estrategias agronómicas que preserven el medio ambiente. El éxito de estos inoculantes bacterianos depende de la selección de cepas autóctonas eficientes por tipo de suelo, su capacidad de colonizar la rizosfera y de mantener la actividad biológica.

  18. Pyrosequencing Reveals a Core Community of Anodic Bacterial Biofilms in Bioelectrochemical Systems from China.

    Science.gov (United States)

    Xiao, Yong; Zheng, Yue; Wu, Song; Zhang, En-Hua; Chen, Zheng; Liang, Peng; Huang, Xia; Yang, Zhao-Hui; Ng, I-Son; Chen, Bor-Yann; Zhao, Feng

    2015-01-01

    Bioelectrochemical systems (BESs) are promising technologies for energy and product recovery coupled with wastewater treatment, and the core microbial community in electrochemically active biofilm in BESs remains controversy. In the present study, 7 anodic communities from 6 bioelectrochemical systems in 4 labs in southeast, north and south-central of China are explored by 454 pyrosequencing. A total of 251,225 effective sequences are obtained for 7 electrochemically active biofilm samples at 3% cutoff level. While Alpha-, Beta-, and Gamma-proteobacteria are the most abundant classes (averaging 16.0-17.7%), Bacteroidia and Clostridia are the two sub-dominant and commonly shared classes. Six commonly shared genera i.e., Azospira, Azospirillum, Acinetobacter, Bacteroides, Geobacter, Pseudomonas, and Rhodopseudomonas dominate the electrochemically active communities and are defined as core genera. A total of 25 OTUs with average relative abundance >0.5% were selected and designated as core OTUs, and some species relating to these OTUs have been reported electrochemically active. Furthermore, cyclic voltammetry and chronoamperometry tests show that two strains from Acinetobacter guillouiae and Stappia indica, bacteria relate to two core OTUs, are electrochemically active. Using randomly selected bioelectrochemical systems, the study has presented extremely diverse bacterial communities in anodic biofilms, though, we still can suggest some potentially microbes for investigating the electrochemical mechanisms in bioelectrochemical systems. PMID:26733958

  19. Nitrogen fixation by free-living microorganisms in tropical rice soils using labelled fertilizer. Part of a coordinated programme on isotope techniques in studies of biological nitrogen fixation for the dual purpose of increasing crop production and decreasing nitrogen fertilizer use to conserve the environment

    International Nuclear Information System (INIS)

    Both acetylene-reduction and 15N techniques were used to study heterotrophic N fixation in the rhizosphere of rice plants. Soils subjected to flooding in 4 soil types in both greenhouse and the field were found to stimulate greater heterotrophic nitrogen fixation than moist soils. The addition of organic materials, in particular, cellulose and rice straw, in general, enhanced nitrogen fixed by heterotrophic organisms living in the rhizosphere of rice plants. The highest amount of N fixed was 38 kg N/ha, and was obtained in a flooded lateritic soil to which had been added cellulose. Heterotrophic nitrogen fixation was influenced by soil type. In this study, the lowest value for fixed N was recorded in an acid sulphate soil of low pH. The addition of increasing amounts of inorganic nitrogen fertilizer in the form of ammonium sulphate suppressed rhizospheric nitrogen fixation in all soils, but the extent of suppression differed in the different soils. Benomyl fungicide and methyl carbamate insecticide had a stimulatory effect on heterotrophic nitrogen fixation in soils under rice roots. Different rice cultivars stimulated strains of Azospirillum to varying extent, and thus did not fix nitrogen to the same extent. It is thus possible that varieties of rice could be selected on the basis of their ability to support non-symbiotic N fixation in their rhizosphere

  20. Endophytes in commercial micropropagation - friend or foe?

    Directory of Open Access Journals (Sweden)

    Rödel, Philipp

    2016-07-01

    Full Text Available Medicinal and aromatic plants are superorganisms like all plant species- naturally colonized by bacteria, fungi and protists. Micropropagated plants are facing different challenges under in vitro and ex vitro conditions: Mixotrophic growth under low light conditions on artificial nutrient media, poor gas exchange in small vessels, abiotic stress, bad rooting, transplanting stress, low survival rate during acclimatization in greenhouse. The use of endophytes in micropropagation can improve plant growth, yield, and health and induce tolerance to abiotic and biotic stress. A tool for the use of competent endophytes in micropropagation under in vitro and ex vitro conditions is “biotization” of plantlets with useful bacterial and fungal inocula. Fungal inocula which are used commercially are e.g. arbuscular mycorrhizal fungi in form of spores and extraradical mycelium on different carrier materials like expanded clay, vermiculite, sand or peat. Furthermore representatives of the root fungal genus Trichoderma are applied as spores formulated in powder. Plantgrowth promoting rhizobacteria of the important genera Bacillus, Pseudomonas, Azospirillum and Azotobacter in form of lyophilised endospores/bacterial cells in powder or liquid formulation are also available on the market.

  1. A metagenomic study highlights phylogenetic proximity of quorum-quenching and xenobiotic-degrading amidases of the AS-family.

    Science.gov (United States)

    Tannières, Mélanie; Beury-Cirou, Amélie; Vigouroux, Armelle; Mondy, Samuel; Pellissier, Franck; Dessaux, Yves; Faure, Denis

    2013-01-01

    Quorum-sensing (QS) signals of the N-acylhomoserine lactone (NAHL) class are cleaved by quorum-quenching enzymes, collectively named NAHLases. Here, functional metagenomics allowed the discovery of a novel bacterial NAHLase in a rhizosphere that was treated with γ-caprolactone. As revealed by rrs-DGGE and rrs-pyrosequencing, this treatment increased the percentage of the NAHL-degrading bacteria and strongly biased the structure of the bacterial community, among which Azospirillum dominated. Among the 29 760 fosmids of the metagenomic library, a single one was detected that expressed the qsdB gene conferring NAHL-degradation upon E. coli and decreased QS-regulated virulence in Pectobacterium. Phylogenetic analysis of the 34 orfs of the fosmid suggested that it would belong to an unknown Proteobacterium - probably a γ-proteobacterium. qPCR quantification of the NAHLase-encoding genes attM, qsdA, and qsdB revealed their higher abundance in the γ-caprolactone-treated rhizosphere as compared to an untreated control. The purified QsdB enzyme exhibited amidase activity. QsdB is the first amidase signature (AS) family member exhibiting NAHLase-activity. Point mutations in the AS-family catalytic triad K-S-S abolished the NAHLase activity of QsdB. This study extends the diversity of NAHLases and highlights a common phylogenic origin of AS-family enzymes involved in the degradation of natural compounds, such as NAHLs, and xenobiotics, such as nylon and linuron. PMID:23762380

  2. Efecto del uso del suelo sobre rizobacterias fosfatosolubizadoras y diazotroficas en el distrito de riego del río zulia,norte de santander (colombia

    Directory of Open Access Journals (Sweden)

    Ronal Fernando-Cañon

    2009-07-01

    Full Text Available It was quantified the population of diazotrophic and phosphate solubilizer bacteria with the aim of determine the effect of the use of soils during different periods of intervention with culture of rice in three agro-ecological zones of the District of Irrigation of the Zulia river. The results showed that the management of the culture of rice in the different studied zones significantly influenced the population of microorganisms in all the studied culture media, excepting the semi-solid culture media JMV. The populations of the genera Azospirillum spp., Azotobacter spp., Beijerinckia spp., were influenced by the fertility of the soils in the zones of Buena Esperanza and Restauración compared with Limoncito, where the quantities of organic matter and nutritional escential elements were lower. It were obtained 28 isolations of entophytic, associative, free-living diazotrophic and phosphate solubilizer rhizobacteria according with their macroscopic characteristics in the culture media Batata, JMV, Ashby and nutritive, from the analysis of the population in the zones of Buena Esperanza, Restauración and Limoncito. These isolations were purified and preserved in sterilized saline solution (0.85% NaCl at 4°C in the Laboratory of Microbiology of the Colombian Agricultural Institute, ICA, with the purpose to be used in subsequent studies about their potential as biofertilizers in rice cultured soils of the department.

  3. The Diversity and Co-occurrence Patterns of N₂-Fixing Communities in a CO₂-Enriched Grassland Ecosystem.

    Science.gov (United States)

    Tu, Qichao; Zhou, Xishu; He, Zhili; Xue, Kai; Wu, Liyou; Reich, Peter; Hobbie, Sarah; Zhou, Jizhong

    2016-04-01

    Diazotrophs are the major organismal group responsible for atmospheric nitrogen (N2) fixation in natural ecosystems. The extensive diversity and structure of N2-fixing communities in grassland ecosystems and their responses to increasing atmospheric CO2 remain to be further explored. Through pyrosequencing of nifH gene amplicons and extraction of nifH genes from shotgun metagenomes, coupled with co-occurrence ecological network analysis approaches, we comprehensively analyzed the diazotrophic community in a grassland ecosystem exposed to elevated CO2 (eCO2) for 12 years. Long-term eCO2 increased the abundance of nifH genes but did not change the overall nifH diversity and diazotrophic community structure. Taxonomic and phylogenetic analysis of amplified nifH sequences suggested a high diversity of nifH genes in the soil ecosystem, the majority belonging to nifH clusters I and II. Co-occurrence ecological network analysis identified different co-occurrence patterns for different groups of diazotrophs, such as Azospirillum/Actinobacteria, Mesorhizobium/Conexibacter, and Bradyrhizobium/Acidobacteria. This indicated a potential attraction of non-N2-fixers by diazotrophs in the soil ecosystem. Interestingly, more complex co-occurrence patterns were found for free-living diazotrophs than commonly known symbiotic diazotrophs, which is consistent with the physical isolation nature of symbiotic diazotrophs from the environment by root nodules. The study provides novel insights into our understanding of the microbial ecology of soil diazotrophs in natural ecosystems. PMID:26280746

  4. Interactions between diazotrophic bacteria and mycorrhizal fungus in maize genotypes Interações entre bactérias diazotróficas e fungo micorrízico em genótipos de milho

    Directory of Open Access Journals (Sweden)

    Marina Yumi Horta Miyauchi

    2008-01-01

    Full Text Available Some diazotrophic bacteria can fix nitrogen biologically in gramineous host plants. Generally, gramineous plants are also associated with mycorrhizal fungi, that can improve mainly plant P uptake. Among the factors affecting plant-microbe interactions, the plant genotype plays an important role. This study evaluates the effect of diazotrophic bacteria and an arbuscular mycorrhizal fungus (AMF, on five genotypes of maize (Zea mays L., in relation to plant biomass, shoot N and P concentrations, and fine root morphological traits. The experimental design was entirely randomized in a factorial 5 × 4 × 2 arrangement, i.e., five maize genotypes (hybrids C333B, AS3466, and PREMIUM, and the inbreed lines lg40897-1 and lg40505-1, three diazotrophic bacteria (Azospirillum lipoferum, A. amazonense, and Burkholderia sp. in addition to a control without bacterial inoculation, co-inoculated or not with the AMF Glomus clarum. The non-mycorrhizal plants inoculated with Azospirillum exhibited the highest N concentrations. The lines lg40897-1 and lg40505-1 showed higher P concentrations as compared to the hybrids, mainly when colonized by AMF. The higher levels of mycorrhizal colonization (90% occurred in the C333B and lg40897-1 genotypes, which also exhibited a greater root diameter. Mycorrhiza increased shoot and root biomass, besides root traits as total length, specific length, total surface, and incidence of root hairs in all genotypes. In addition, mycorrhiza also stimulated the root colonization by diazotrophic bacteria. The bacteria did not affect root morphological traits and mycorrhizal colonization.Algumas bactérias diazotróficas podem fixar N biologicamente em gramíneas, as quais se associam a fungos micorrízicos, o que pode levar a um aumento principalmente da absorção de P. Dentre os fatores que afetam as interações planta-microrganismos, o genótipo da planta tem importante papel. Esse trabalho avalia o efeito de bactérias diazotr

  5. Fluctuation of microbial activities after influent load variations in a full-scale SBR. Recovery of the biomass after starvation

    Energy Technology Data Exchange (ETDEWEB)

    Cabezas, Angela; Draper, Patricia; Etchebehere, Claudia [Universidad de la Republica, Montevideo (Uruguay). Catedra de Microbiologia, Facultad de Quimica y Facultad de Ciencias

    2009-10-15

    Due to variations in the production levels, a full-scale sequencing batch reactor (SBR) for post-treatment of tannery wastewater was exposed to low and high ammonia load periods. In order to study how these changes affected the N-removal capacity, the microbiology of the reactor was studied by a diverse set of techniques including molecular tools, activity tests, and microbial counts in samples taken along 3 years. The recover capacity of the biomass was also studied in a lab-scale reactor operated with intermittent aeration without feeding for 36 days. The results showed that changes in the feeding negatively affected the nitrifying community, but the nitrogen removal efficiencies could be restored after the concentration stress. Species substitution was observed within the nitrifying bacteria, Nitrosomonas europaea and Nitrobacter predominated initially, and after an ammonia overload period, Nitrosomonas nitrosa and Nitrospira became dominant. Some denitrifiers, with nirS related to Alicycliphilus, Azospirillum, and Marinobacter nirS, persisted during long-term reactor operation, but the community fluctuated both in composition and in abundance. This fluctuating community may better resist the continuous changes in the feeding regime. Our results showed that a nitrifying-denitrifying SBR could be operated with low loads or even without feeding during production shut down periods. (orig.)

  6. ESTUDIO DE ALGUNOS GÉNEROS MICROBIANOS ASOCIADOS A DIFERENTES VARIEDADES DE TRIGO (Triticum aestivum L. EN SUELO FERRALÍTICO ROJO

    Directory of Open Access Journals (Sweden)

    Annia Hernández

    2002-01-01

    Full Text Available Se estudiaron los géneros bacterianos predominantes en la rizosfera de cuatro variedades de trigo (Triticum aestivum L. crecido en un suelo Ferralítico Rojo. También se evaluó la quimioatracción de algunas rizobacterias hacia los exudados radicales de este cultivo. Se utilizó el Modelo Espermosférico para el aislamiento y los tubos colectores y la cámara de quimiotaxis modificada para la evaluación del efecto quimiotáctico de los exudados radicales. Los resultados obtenidos demostraron que en las variedades Gang y Caeté, Pseudomonas es la población dominante, siendo Pseudomonas (Burkholderia cepacia la especie más fuertemente atraída por los exudados radicales a los 14 días y 40 minutos de exposición. En las variedades Culiacam y Antisama, es el género Azospirillum el predominante en la rizosfera, siendo esta especie la más fuertemente atraída por los exudados radicales a los 14 días y 60 minutos de exposición. Esta investigación permite la aplicación de biofertilizantes a base de los géneros microbianos predominantes en la rizosfera del trigo, potenciando su actividad sin alterar la biología del suelo.

  7. Geminicoccus roseus gen. nov., sp. nov., an aerobic phototrophic Alphaproteobacterium isolated from a marine aquaculture biofilter.

    Science.gov (United States)

    Foesel, Bärbel U; Gössner, Anita S; Drake, Harold L; Schramm, Andreas

    2007-12-01

    A Gram-negative, strictly aerobic, diplococcoid bacterium (strain D2-3(T)) was isolated from the biofilter of a recirculating marine aquaculture system. Phylogenetic analysis of the 16S rRNA gene sequence of D2-3(T) indicated that the new organism occupied a novel lineage within the alpha-1 subclass of Proteobacteria and was related to the genera Rhodothalassium, Azospirillum, Craurococcus, Acidiphilium, and Tistrella. The highest sequence similarity (90.8%) of the 16S rRNA gene sequence of D2-3(T) was to that of Candidatus "Alysiosphaera europaea". D2-3(T) was mesophilic, heterotrophic, required sea salt, and had a pH optimum of 8.0. Growth in the presence of light resulted in the formation of pink colonies, a 25% increased cell yield, and a slightly increased growth rate. D2-3(T) contained carotenoids and low amounts of bacteriochlorophyll a. Membranes of D2-3(T) contained b-type cytochromes. The G+C content of the DNA was 60.3+/-0.1mol%. Phylogenetic, morphological, physiological, and biochemical analyses demonstrated that D2-3(T) represented a new aerobic phototrophic genus, for which the name Geminicoccus roseus gen. nov., sp. nov. is proposed for the type species (D2-3(T)=DSM 18922(T)=ATCC BAA-1445(T)). PMID:17643894

  8. Detection of antibiotic-resistant bacteria endowed with antimicrobial activity from a freshwater lake and their phylogenetic affiliation

    Science.gov (United States)

    Zothanpuia; Passari, Ajit K.; Gupta, Vijai K.

    2016-01-01

    Antimicrobial resistance poses a serious challenge to global public health. In this study, fifty bacterial strains were isolated from the sediments of a freshwater lake and were screened for antibiotic resistance. Out of fifty isolates, thirty-three isolates showed resistance against at least two of the selected antibiotics. Analysis of 16S rDNA sequencing revealed that the isolates belonged to ten different genera, namely Staphylococcus(n = 8), Bacillus(n = 7), Lysinibacillus(n = 4), Achromobacter(n=3), bacterium(n = 3), Methylobacterium(n = 2), Bosea(n = 2), Aneurinibacillus(n = 2), Azospirillum(n = 1), Novosphingobium(n = 1). Enterobacterial repetitive intergenic consensus (ERIC) and BOX-PCR markers were used to study the genetic relatedness among the antibiotic resistant isolates. Further, the isolates were screened for their antimicrobial activity against bacterial pathogens viz., Staphylococcus aureus(MTCC-96), Pseudomonas aeruginosa(MTCC-2453) and Escherichia coli(MTCC-739), and pathogenic fungi viz., Fusarium proliferatum (MTCC-286), Fusarium oxysporum (CABI-293942) and Fusarium oxy. ciceri (MTCC-2791). In addition, biosynthetic genes (polyketide synthase II (PKS-II) and non-ribosomal peptide synthetase (NRPS)) were detected in six and seven isolates, respectively. This is the first report for the multifunctional analysis of the bacterial isolates from a wetland with biosynthetic potential, which could serve as potential source of useful biologically active metabolites. PMID:27330861

  9. Organic and mineral fertilization of squash plant with application of 1'5N staple isotope

    International Nuclear Information System (INIS)

    A field experiment was conducted on virgin sand soil under drip irrigation system using squash fertilized with ammonium sulfate fertilizer, commercial compost locally manufactured in Egypt and artificial compost prepared fertilizer were applied either completely (100%) of mineral or of organic; or 50%: 50% (mineral: organic) by the authors at the Atomic Energy Authority of Egypt. All fertilization treatments were either inoculated or not inoculated with Azospirillum. Inoculation increased roots fresh weight. This was more pronounced with application of 50% mineral fertilizer plus 50% commercial compost, 100% artificial compost and 100% commercial compost. Similar trends, but to high extent were noticed with shoot fresh weight as affected by microbial inoculation and different organic composts. The 50%: 50% treatments as well as 100% artificial compost treatment gave high root and shoot dry weights. Inoculation and 50%: 50% fertilization treatments were more effective on N uptake. Higher N uptake was by shoots than roots. Portion and absolute value of N derived by roots from mineral fertilizer were significantly affected by combined fertilization treatments. Nitrogen derived from air (Ndfa) was positively affected by addition of organic compost and bacterial inoculation. Reversible trend was noticed with N derived from soil (Ndfa) which decreased when treated with compost and bacterial inoculation. All measurements were high in shoots than roots

  10. Differential distribution and abundance of diazotrophic bacterial communities across different soil niches using a gene-targeted clone library approach.

    Science.gov (United States)

    Yousuf, Basit; Kumar, Raghawendra; Mishra, Avinash; Jha, Bhavanath

    2014-11-01

    Diazotrophs are key players of the globally important biogeochemical nitrogen cycle, having a significant role in maintaining ecosystem sustainability. Saline soils are pristine and unexplored habitats representing intriguing ecosystems expected to harbour potential diazotrophs capable of adapting in extreme conditions, and these implicated organisms are largely obscure. Differential occurrence of diazotrophs was studied by the nifH gene-targeted clone library approach. Four nifH gene clone libraries were constructed from different soil niches, that is saline soils (low and high salinity; EC 3.8 and 7.1 ds m(-1) ), and agricultural and rhizosphere soil. Additionally, the abundance of diazotrophic community members was assessed using quantitative PCR. Results showed environment-dependent metabolic versatility and the presence of nitrogen-fixing bacteria affiliated with a range of taxa, encompassing members of the Alphaproteobacteria, Betaproteobacteria, Deltaproteobacteria, Gammaproteobacteria, Cyanobacteria and Firmicutes. The analyses unveiled the dominance of Alphaproteobacteria and Gammaproteobacteria (Pseudomonas, Halorhodospira, Ectothiorhodospira, Bradyrhizobium, Agrobacterium, Amorphomonas) as nitrogen fixers in coastal-saline soil ecosystems, and Alphaproteobacteria and Betaproteobacteria (Bradyrhizobium, Azohydromonas, Azospirillum, Ideonella) in agricultural/rhizosphere ecosystems. The results revealed a repertoire of novel nitrogen-fixing bacterial guilds particularly in saline soil ecosystems. PMID:25196726

  11. Using 32 P to evaluation of bio fertilizers symbiotic efficiency in wheat

    International Nuclear Information System (INIS)

    In order to study the symbiotic efficiency of bio fertilizers in wheat specially Azospirillam, Mycorrhizal and streptomyces, an experiment have been carried out for 2 years by using 32p in greenhouse condition. The results showed that number of till/plant dry weight and activity/plant were increased in concordance with the increase of phosphorus amount. In addition, the application of Mycorrhizal in comparison with its non-application resulted in significant increase in entire above-mentioned measured characteristics, but its efficiency reduced by increasing phosphorous.Moreover, it was proven that there was a negative antagonistic effect by Streptomyces on Mycorrhizal, so that in all examined characteristics in which these two microorganisms were simultaneously used, a significant decrease was observed. Otherwise, study on phosphorus and mycorrhizal at different levels applications showed that phosphorus usage amount (0.40g/pot), in comparison with its more usage(0.60g/pot) had better effects on mycorrhizal. Application of Streptomyces had no significant on the examined characteristics. However, when applying both mycorrhizal and streptomyces, because of the sensitivity of mycorrhizal to Streptomyces presence, a decrease effect was observed. Application of Azospirillum, Mycorrhizal and specially organic fertilizer (manure), had positive and significant effects on the many of the measured characters

  12. Biofertilizer- A possible substitute of fertilizers in production of wheat variety zardana in Balochistan

    International Nuclear Information System (INIS)

    The study was conducted to investigate the effect of bio fertilizer on wheat variety Zardana production at four locations of Balochistan. Biofertilizer (Azospirillum AI-Q + N 45 kg ha/sup -1/, P20S 30 kg ha/sup -1/) was used to substitute for half of the Nitrogen (N) and phosphorus (P) fertilizer application rates as compared to a high fertilizer treatment (N 90 kgha/sup -1/ P/sub 2/O/sub 5/ 60 kg ha/sup -l/). The high mineral fertilizer and bio fertilizer + half mineral fertilizer treatments were compared with a control treatment (no fertilizer). Significant grain yield were measured at all sites, although, at all sites both fertilizer treatments apparently out yielded the control and the bio fertilizer + half mineral fertilizer treatment out yielded the high fertilizer treatment by 220-1180 kgha/sup -1/. Fresh yields differed significantly at all sites. At Mastung field, both fertilizer treatments out yielded the control by 3000 kgha-1 and at Quetta (Aghbarg field-2) the bio fertilizer + half mineral fertilizer treatment out. yielded the others by over 3000 kghal. The results proved that the application of bio fertilizer in combination with N 45 kgha/sup -1/ and P/sub 2/O/sub 5 / 30 kgha/sup -1/ increased fresh yield from 11 % to 59% and suggested increases in grain yield of 20-46% as compared with control treatment. (author)

  13. Relevance of various nitrogen fixing microorganisms in ecology and plant productivity as a basis for evaluating their damage by environmental chemicals

    Energy Technology Data Exchange (ETDEWEB)

    Jagnow, G.

    1981-01-01

    To evaluate detrimental side-effects of environmental chemicals on the biological N/sub 2/-fixation the relative importance of the N/sub 2/-fixation of legume and non-legume root nodules, of symbiotic and free living blue-green algae, of aerobic and facultatively anaerobic rhizosphere bacteria and of anaerobic bacteria is discussed on the basis of their fixation rate and their contribution to the conservation of ecosystems. From an agricultural and ecological point of view the symbiotic N/sub 2/-fixation of legumes and non-legumes takes the first place, being followed by that of blue-green algae and rhizosphere bacteria. Compared with these, the strictly anaerobic N/sub 2/-fixation has only a minor importance. Variable side-effects of herbicides on N/sub 2/-fixing bacteria are cited to stress the necessity of testing representatives of various ecological groups. Suitable test systems are proposed with soybeans, white clover, Rhizobium cultures, N/sub 2/-fixing blue-green algae and with Azospirillum species.

  14. Evaluation of rhizobacterial indicators of tobacco black root rot suppressiveness in farmers' fields.

    Science.gov (United States)

    Kyselková, Martina; Almario, Juliana; Kopecký, Jan; Ságová-Marečková, Markéta; Haurat, Jacqueline; Muller, Daniel; Grundmann, Geneviève L; Moënne-Loccoz, Yvan

    2014-08-01

    Very few soil quality indicators include disease-suppressiveness criteria. We assessed whether 64 16S rRNA microarray probes whose signals correlated with tobacco black root rot suppressiveness in greenhouse analysis could also discriminate suppressive from conducive soils under field conditions. Rhizobacterial communities of tobacco and wheat sampled in 2 years from four farmers' fields of contrasted suppressiveness status were compared. The 64 previously identified indicator probes correctly classified 72% of 29 field samples, with nine probes for Azospirillum, Gluconacetobacter, Sphingomonadaceae, Planctomycetes, Mycoplasma, Lactobacillus crispatus and Thermodesulforhabdus providing the best prediction. The whole probe set (1033 probes) revealed strong effects of plant, field location and year on rhizobacterial community composition, and a smaller (7% variance) but significant effect of soil suppressiveness status. Seventeen additional probes correlating with suppressiveness status in the field (noticeably for Agrobacterium, Methylobacterium, Ochrobactrum) were selected, and combined with the nine others, they improved correct sample classification from 72% to 79% (100% tobacco and 63% wheat samples). Pseudomonas probes were not informative in the field, even those targeting biocontrol pseudomonads producing 2,4-diacetylphloroglucinol, nor was quantitative polymerase chain reaction for 2,4-diacetylphloroglucinol-synthesis gene phlD. This study shows that a subset of 16S rRNA probes targeting diverse rhizobacteria can be useful as suppressiveness indicators under field conditions. PMID:24992533

  15. FY1995 studies on saving energy by use of nitrogen- fixing bacteria; 1995 nendo chisso koteikin no katsuyo ni yoru sho energy no kenkyu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    To save energy by improving the ability of nitrogen-fixing bacteria (Kebsiella oxytoca, Azospirillum lipoferum and Sphingomonas paucimobilis) in the rhizosphere of rice, by means of genetic analysis and engineering of the nif genes. Analysis and improvement of the nif genes were performed in 3 species of nitrogen-fixing bacteria in the rhizoshere of rice. (1) In an facultative anaerobe, K. oxytoca, the repressor gene, nifL was destroyed, and the activator gene, nifA was fortified, to attain a novel mutant strain R16, which fixes nitrogen even in the presence of NH{sub 4}{sup +}. (2) In a microaerophilic nitrogen fixer, A. lipoferum, the regulatory genes draT and draG were cloned and analysed, and an improved strain TA1 was obtained by introduction of K. oxytoca nifA gene. (3) In an aerobic nitrogen-fixer S. paucimobilis, the nifA gene was cloned and sequenced, and the activity was expressed in E. coil to show that the product activates the nif promoters of Azospirillurn and Klebsiella. (4) The improved strains K. oxytoca R16 and A. lipoferun TA1 were inoculated to rice plant cultured in a pot without addition of nitrogen source. The inoculated plant showed twice as much dry weight as the noninoculated plant, showing that the improved strains are effective to stimulate the growth of rice. (NEDO)

  16. The bacterial signal transduction protein GlnB regulates the committed step in fatty acid biosynthesis by acting as a dissociable regulatory subunit of acetyl-CoA carboxylase.

    Science.gov (United States)

    Gerhardt, Edileusa C M; Rodrigues, Thiago E; Müller-Santos, Marcelo; Pedrosa, Fabio O; Souza, Emanuel M; Forchhammer, Karl; Huergo, Luciano F

    2015-03-01

    Biosynthesis of fatty acids is one of the most fundamental biochemical pathways in nature. In bacteria and plant chloroplasts, the committed and rate-limiting step in fatty acid biosynthesis is catalyzed by a multi-subunit form of the acetyl-CoA carboxylase enzyme (ACC). This enzyme carboxylates acetyl-CoA to produce malonyl-CoA, which in turn acts as the building block for fatty acid elongation. In Escherichia coli, ACC is comprised of three functional modules: the biotin carboxylase (BC), the biotin carboxyl carrier protein (BCCP) and the carboxyl transferase (CT). Previous data showed that both bacterial and plant BCCP interact with signal transduction proteins belonging to the PII family. Here we show that the GlnB paralogues of the PII proteins from E. coli and Azospirillum brasiliense, but not the GlnK paralogues, can specifically form a ternary complex with the BC-BCCP components of ACC. This interaction results in ACC inhibition by decreasing the enzyme turnover number. Both the BC-BCCP-GlnB interaction and ACC inhibition were relieved by 2-oxoglutarate and by GlnB uridylylation. We propose that the GlnB protein acts as a 2-oxoglutarate-sensitive dissociable regulatory subunit of ACC in Bacteria. PMID:25557370

  17. A bioinformatics approach to the determination of genes involved in endophytic behavior in Burkholderia spp.

    Science.gov (United States)

    Ali, Shimaila; Duan, Jin; Charles, Trevor C; Glick, Bernard R

    2014-02-21

    The vast majority of plants harbor endophytic bacteria that colonize a portion of the plant's interior tissues without harming the plant. Like plant pathogens, endophytes gain entry into their plants hosts through various mechanisms. Bacterial endophytes display a broad range of symbiotic interactions with their host plants. The molecular bases of these plant-endophyte interactions are currently not fully understood. In the present study, a set of genes possibly responsible for endophytic behavior for genus Burkholderia was predicted and then compared and contrasted with a number (nine endophytes from different genera) of endophytes by comparative genome analysis. The nine endophytes included Burkholderia phytofirmans PsJN, Burkholderia spp. strain JK006, Azospirillum lipoferum 4B, Enterobacter cloacae ENHKU01, Klebsiella pneumoniae 342, Pseudomonas putida W619, Enterobacter spp. 638, Azoarcus spp. BH72, and Serratia proteamaculans 568. From the genomes of the analyzed bacterial strains, a set of bacterial genes orthologs was identified that are predicted to be involved in determining the endophytic behavior of Burkholderia spp. The genes and their possible functions were then investigated to establish a potential connection between their presence and the role they play in bacterial endophytic behavior. Nearly all of the genes identified by this bioinformatics procedure encode function previously suggested in other studies to be involved in endophytic behavior. PMID:24513137

  18. Land use type significantly affects microbial gene transcription in soil.

    Science.gov (United States)

    Nacke, Heiko; Fischer, Christiane; Thürmer, Andrea; Meinicke, Peter; Daniel, Rolf

    2014-05-01

    Soil microorganisms play an essential role in sustaining biogeochemical processes and cycling of nutrients across different land use types. To gain insights into microbial gene transcription in forest and grassland soil, we isolated mRNA from 32 sampling sites. After sequencing of generated complementary DNA (cDNA), a total of 5,824,229 sequences could be further analyzed. We were able to assign nonribosomal cDNA sequences to all three domains of life. A dominance of bacterial sequences, which were affiliated to 25 different phyla, was found. Bacterial groups capable of aromatic compound degradation such as Phenylobacterium and Burkholderia were detected in significantly higher relative abundance in forest soil than in grassland soil. Accordingly, KEGG pathway categories related to degradation of aromatic ring-containing molecules (e.g., benzoate degradation) were identified in high abundance within forest soil-derived metatranscriptomic datasets. The impact of land use type forest on community composition and activity is evidently to a high degree caused by the presence of wood breakdown products. Correspondingly, bacterial groups known to be involved in lignin degradation and containing ligninolytic genes such as Burkholderia, Bradyrhizobium, and Azospirillum exhibited increased transcriptional activity in forest soil. Higher solar radiation in grassland presumably induced increased transcription of photosynthesis-related genes within this land use type. This is in accordance with high abundance of photosynthetic organisms and plant-infecting viruses in grassland. PMID:24553913

  19. Effect of combined microbes on plant tolerance to Zn-Pb contaminations.

    Science.gov (United States)

    Ogar, Anna; Sobczyk, Łukasz; Turnau, Katarzyna

    2015-12-01

    The presence and composition of soil microbial communities has been shown to have a large impact on plant-plant interactions and consequently plant diversity and composition. The goal of the present study was to evaluate impact of arbuscular mycorrhizal fungi (AMF) and nitrogen-fixing bacteria, which constitutes an essential link between the soil and the plant's roots. A greenhouse pot experiment was conducted to evaluate the feasibility of using selected microbes to improve Hieracium pilosella and Medicago sativa growth on Zn-Pb-rich site. Results of studies revealed that biomass, the dry mass of shoots and roots, increased significantly when plants were inoculated with mycorrhizal fungi and nitrogen-fixing bacteria. The addition of Azospirillum sp. and Nostoc edaphicum without mycorrhiza suppressed plant growth. Single bacterial inoculation alone does not have a positive effect on M. sativa growth, while co-inoculation with AMF improved plant growth. Plant vitality (expressed by the performance index) was improved by the addition of microbes. However, our results indicated that even dry heat sterilization of the substratum created imbalanced relationships between soil-plant and plants and associated microorganisms. The studies indicated that AMF and N2-fixers can improve revegetation of heavy metal-rich industrial sites, if the selection of interacting symbionts is properly conducted. PMID:26250813

  20. Inoculación de Cilantro (Coriandrum sativum L. con Rizobacterias en Villa del Rosario, Norte de Santander / Inoculation of Cilantro (Coriandrum sativum L. with Rhizobacterias in Villa del Rosario, Norte de Santander

    Directory of Open Access Journals (Sweden)

    Katherine Carrillo Becerra

    2014-12-01

    Full Text Available Resumen. Las rizobacterias promotoras de crecimiento vegetalrepresentan una alternativa de biofertilización. En este estudiose evaluó el efecto de su inoculación en plantas de cilantro y lautilización de la práctica de quema de cascarilla de arroz en lapreparación del suelo para el establecimiento del cultivo. Seempleó un diseño experimental en parcelas divididas donde, lasparcelas principales correspondieron a la preparación del suelo conquema de cascarilla de arroz y sin quema con la inoculación previade Trichoderma sp. Las subparcelas eran los tratamientos con lainoculación simple y en co-inoculación de Azospirillum RzH132y Azotobacter RzH120 y los testigos absoluto y químico. Unavez se comprobaron los supuestos en los residuales del modelo,normalidad, homogeneidad de varianzas y aleatoriedad, se realizóel análisis de varianza y pruebas de comparación múltiple porel test de Tukey y un análisis de componentes principales comotécnica de reducción de dimensiones. Los resultados mostraronun efecto positivo en el crecimiento de las plantas inoculadas conlas rizobacterias en las dos parcelas con quema y sin quema decascarilla de arroz; sin embargo, en la variable rendimiento nose obtuvieron diferencias significativas (P≤0,05. Así mismo, seencontró que la población de bacterias rizosféricas en los mediosde cultivo NFb semisólido, Ashby y King B, se vio favorecida por lano quema de cascarilla de arroz en el suelo. Es importante resaltarque los resultados se obtuvieron con la disminución al 30% de lafertilización química, con lo cual se puede reducir el uso de estosproductos químicos. /  Abstract. Plant growth promoting rhizobacteria (PGPR representan alternative biofertilization form. In this study, was evaluatedPGPR inoculation in cilantro plants. Likewise, was evaluatedthe practice of burning rice husk in soil preparation for cropestablishment. An experimental design was used in a split plotwhere the main plots were