WorldWideScience

Sample records for azolla filiculoides colectadas

  1. An ecophysiological study of the Azolla filiculoides- Anabaena azollae association

    Science.gov (United States)

    van Kempen, Monique; Smolders, Fons; Speelman, Eveline; Reichart, Gert Jan; Barke, Judith; Brinkhuis, Henk; Lotter, Andy; Roelofs, Jan

    2010-05-01

    The long term effects of salinity stress on the growth, nutrient content and amino acid composition of the Azolla filiculoides - Anabaena azollae association was studied in a laboratory experiment. It was demonstrated that the symbiosis could tolerate salt stress up to 90 mM NaCl, even after a 100 day period of preconditioning at salt concentrations that were 30 mM NaCl lower. In the 120 mM NaCl treatment the Azolla filiculoides survived, but hardly any new biomass was produced. It was shown that during the experiment, A. filiculoides became increasingly efficient in excluding salt ions from the plant tissue and was thus able to increase its salt tolerance. The amino acid analysis revealed that the naturally occurring high glutamine concentration in the plants was strongly reduced at salt concentrations of 120 mM NaCl and higher. This was the result of the reduced nitrogenase activity at these salt concentrations, as was demonstrated in an acetylene reduction assay. We suggest that the high glutamine concentration in the plants might play a role in the osmoregulatory response against salt stress, enabling growth of the A. filiculoides -Anabaena azollae association up to 90 mM NaCl. In a mesocosm experiment it furthermore was demonstrated that Azolla might manipulate its own microenvironment when grown at elevated salt concentration (up to ~50 mmol•L-1) by promoting salinity stratification, especially when it has formed a dense cover at the water surface. Beside salt stress, we also studied the growth of Azolla filiculoides in response to elevated atmospheric carbon dioxide concentration, in combination with different light intensities and different pH of the nutrient solution. The results demonstrated that as compared to the control (ambient pCO2 concentrations), Azolla filiculoides was able to produce twice as much biomass at carbon dioxide concentrations that were five times as high as the ambient pCO2 concentration. However, it was also shown that this

  2. Response of growth and antioxidant enzymes in Azolla plants (Azolla pinnata and Azolla filiculoides) exposed to UV-B.

    Science.gov (United States)

    Masood, Amjad; Zeeshan, M; Abraham, G

    2008-06-01

    Effect of ultravilolet-B (0.4 Wm(-2)) irradiation on growth, flavonoid content, lipid peroxidation, proline accumulation and activities of superoxide dismutase and peroxidase was comparatively analysed in Azolla pinnata and Azolla filiculoides. Growth measured as increment in dry weight reduced considerably due to all UV-B treatments. However, the reduction was found to be severe in A. filiculoides as compared to A. pinnata. The level of UV-absorbing compound flavonoids increased significantly in A. pinnata plants whereas only a slight increase in the flavonoid content was observed in A. filiculoides. UV-B exposure led to enhanced production of malondialdehyde (MDA) and electrolyte leakage in A. filiculoides than A. pinnata. Proline accumulation also showed a similar trend. Marked differences in the activity of antioxidant enzymes such as superoxide dismutase (SOD) and peroxidase (POD) was noticed in both the plants exposed to UV-B. Our comparative studies indicate A. pinnata to be better tolerant to UV-B as compared with A. filiculoides which appears to be sensitive.

  3. Effects of the naturally-occurring contaminant microcystins on the Azolla filiculoides-Anabaena azollae symbiosis.

    Science.gov (United States)

    Pereira, A L; Monteiro, B; Azevedo, J; Campos, A; Osório, H; Vasconcelos, V

    2015-08-01

    Harmful algal blooms (HABs) contaminate aquatic ecosystems and are responsible for animal poisoning worldwide. We conducted a toxicity test with the aquatic fern and the biofertilizer, Azolla filiculoides. The sporophytes were exposed to three concentrations (0.01, 0.1 and 1μgmL(-1)) of a microcystin (MC) cyanobacterial crude extract and purified MC-LR. The growth of A. filiculoides decreased only at 1μgmL(-1) crude extract concentration while with MC-LR it decreased at all the tested concentrations, indicating that the presence of other compounds in the crude extract altered toxicity and stimulated the fern growth at lower concentrations (0.01 and 0.1μgmL(-1)). Both phycoerythrocyanin and allophycocyanin levels decreased in all the concentrations of crude extract and MC-LR. The phycocyanin had a marked increase at 0.1μgmL(-1) crude extract concentration and a marked decrease at 1μgmL(-1) MC-LR concentration. These changes in the phycobiliprotein content indicate a shift in the antenna pigments of the cyanobionts of A. filiculoides. The changes in two oxidative stress enzymes, glutathione reductase for the crude extract assay and glutathione peroxidase for MC-LR assay, points towards the induction of stress defense responses. The low bioconcentration factor in both crude extract and MC-LR treatments can suggest the low uptake of microcystins, and indicates that the aquatic fern can be used as a biofertilizer and as animal feed but is not suitable for MC phytoremediation.

  4. Arsenic accumulation by the aquatic fern Azolla: Comparison of arsenate uptake, speciation and efflux by A. caroliniana and A. filiculoides

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Xin [State Key Lab of Urban and ONAL Ecology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Lin Aijun [Department of Environmental Science and Engineering, Beijing University of Chemical Technology, Beijing 100029 (China); Zhao Fangjie [Soil Science Department, Rothamsted Research, Hertfordshire AL5 2JQ (United Kingdom); Xu Guozhong [Agricultural Ecology Institute, Fujian Academy of Agricultural Sciences, Fuzhou 350013 (China); Duan Guilan [State Key Lab of Urban and ONAL Ecology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Zhu Yongguan [State Key Lab of Urban and ONAL Ecology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing 100085 (China); Institute of Urban Environment, Chinese Academy of Sciences, Xiamen 361003 (China)], E-mail: ygzhu@rcees.ac.cn

    2008-12-15

    This study investigates As accumulation and tolerance of the aquatic fern Azolla. Fifty strains of Azolla showed a large variation in As accumulation. The highest- and lowest-accumulating ferns among the 50 strains were chosen for further investigations. Azolla caroliniana accumulated two times more As than Azolla filiculoides owing to a higher influx velocity for arsenate. A. filiculoides was more resistant to external arsenate due to a lower uptake. Both strains showed a similar degree of tolerance to internal As. Arsenate and arsenite were the dominant As species in both Azolla strains, with methlyated As species accounting for <5% of the total As. A. filiculoides had a higher proportion of arsenite than A. caroliniana. Both strains effluxed more arsenate than arsenite, and the amount of As efflux was proportional to the amount of As accumulation. The potential of growing Azolla in paddy fields to reduce As transfer from soil and water to rice should be further evaluated. - Arsenic accumulation and efflux differ between strains of the aquatic fern Azolla.

  5. Performance of dead Azolla filiculoides biomass in Biosorption of Au from wastewater.

    Science.gov (United States)

    Umali, L J; Duncan, J R; Burgess, J E

    2006-01-01

    Dried milled biomass of Azolla filiculoides removed up to 98.2% of gold from wastewater from a gold plating factory containing 5 mg gold/l in solution in batch biosorption. The gold uptake capacity of the biomass was 98 mg/g. Whole dried biomass used in a continuous flow column removed up to 100% of gold from diluted wastewater. A similar column was linked to a sulphide precipitation process to provide a two-step system which was able to remove 98% of gold from undiluted wastewater containing 41 mg Au/l. The lifetime of the column was five days.

  6. Phytoremediation of petroleum hydrocarbons by using a freshwater fern species Azolla filiculoides Lam.

    Science.gov (United States)

    Kösesakal, Taylan; Ünal, Muammer; Kulen, Oktay; Memon, Abdülrezzak; Yüksel, Bayram

    2016-01-01

    In this study, the phytoremediation capacity of Azolla filiculoides Lam. for the water resources contaminated with petroleum hydrocarbons was investigated. The plants were grown in nitrogen-free Hoagland nutrient solution containing 0.005%, 0.01%, 0.05%, 0.1%, 0.2%, 0.3%, 0.4%, and 0.5% crude oil under greenhouse conditions for 15 days. Although the growth rate of the plants were not negatively influenced by the presence of crude oil in the media for the concentration of 0.005% and 0.01% v/v, a gradual impeding effect of crude oil in the growth media has been observed at concentrations 0.05-0.1%. More than 0.1% crude oil in the growth medium ostensibly retarded the growth. For example, 0.2% oil in the media reduced growth approximately 50% relative to the control, and the presence of crude oil at concentrations 0.3% or more were lethal. The data about the percentage of plant growth, fresh weight increase and root growth clearly indicated that the tolerance level of A. filiculoides plants to crude oil ranges between 0.1% and 0.2%. In comparison to control samples, the biodegradation rate of total aliphatic and aromatic (phenathrene) hydrocarbons at 0.05-0.2% oil concentrations, was 94-73% and 81-77%, respectively. On the other hand, in case of further increases in oil concentration in media, i.e.; 0.3-0.5%, the biodegradation rate was still higher in the experimental samples, respectively 71-63% and 75-71%. The high biodegradation rates of petroleum hydrocarbons in the experimental samples suggested that A. filiculoides plants could be a promising candidate to be used for the phytoremediation of low crude oil contaminated precious freshwater resources.

  7. Growth and feed utilization by juvenile grass carp (Ctenopharyngodon idella feed with Azolla filiculoides with low lipid diet/ Desempenho e conversão alimentar de juvenis de carpa capim (Ctenopharyngodon idella alimentadas com Azolla filiculoides e ração com baixo teor lipídico

    Directory of Open Access Journals (Sweden)

    Karina Dufech Esteves

    2008-08-01

    Full Text Available The total supply of fish available for human consumption will depend more of the expansion of low trophy level fish farming than of wild-caught fish. Aquatic plants used at treatment of aquaculture wastewater have been showed like an alternative to exclusive diet feed. The aquatic fern, Azolla filiculoides is an example with high level of protein. Consequently, more research on feed requirements of herbivorous fish is required. The aim of this study was to evaluate the growth performance and feed efficiency of juvenile grass carp (Ctenopharyngodon idella fed with three different diets using low lipid feed and water fern (Azolla filiculoides. The experiment was carried out in nine (9 tanks of 300 L capacity with three fish per tank (initial body weight = 55,43g. Feeding rate was 2.5% Fish were fed on two times a day with three treatments (R= Diet/Azolla on dry weight R= 2.5; R = 5 and R= 10. The specific growth rate (SGR = 1.39%, daily growth gain (DGG = 1.06 g / day and were significantly (p A oferta de pescado para o consumo humano dependerá mais da expansão do cultivo de peixes que se alimentam dos primeiros níveis tróficos do que daqueles oriundos da pesca extrativa. Plantas aquáticas usadas em fitotratamento de efluentes de aquacultura vêm sendo referidas como uma alternativa alimentar ao uso exclusivo de rações. A Azolla filiculoides é uma pteridófita que apresenta alto nível protéico. Assim, pesquisas sobre as exigências nutricionais de espécies herbívoras são necessárias. O objetivo principal deste estudo foi avaliar o crescimento e eficiência alimentar de juvenis de carpa capim (Ctenopharyngodon idella alimentadas com três relações (R entre ração com baixo teor lipídico e a planta aquática in natura (Azolla filiculoides. O experimento foi conduzido em nove reservatórios com capacidade de 300L e três indivíduos por unidade (Peso Inicial = 53,43g. A taxa alimentar diária foi de 2,5%, dividida em duas refei

  8. Potential of the aquatic fern Azolla filiculoides in biodegradation of an azo dye: modeling of experimental results by artificial neural networks.

    Science.gov (United States)

    Khataee, A R; Movafeghi, A; Vafaei, F; Lisar, S Y Salehi; Zarei, M

    2013-01-01

    The potential of an aquatic fern, Azolla filiculoides, in phytoremediation of a mono azo dye solution, C.I. Acid Blue 92 (AB92), was studied. The effects of operational parameters such as reaction time, initial dye concentration, fern fresh weight, pH, temperature and reusability of the fern on biodegradation efficiency were investigated. The intermediate compounds produced by biodegradation process were analyzed using GC-MS analysis. An artificial neural network (ANN) model was developed to predict the biodegradation efficiency. The findings indicated that ANN provides reasonable predictive performance (R2 = 0.961). The effects of AB92 solutions (10 and 20 mg L(-1)) on growth, chlorophylls and carotenoids content, activity of antioxidant enzymes such as superoxide dismutase, peroxidase and catalase and formation of malondialdehyde were analyzed. AB92 generally showed inhibitory effects on the growth. Moreover, photosynthetic pigments in the fronds significantly decreased in the treatments. An increase was detected for lipid peroxidation and antioxidant enzymes activity, suggesting that AB92 caused reactive oxygen species production in Azolla fronds, which were scavenged by induced activities of antioxidant enzymes.

  9. Molecular identification of Azolla invasions in Africa: The Azolla specialist, Stenopelmus rufinasus proves to be an excellent taxonomist

    Science.gov (United States)

    Biological control of Azolla filiculoides in South Africa with the Azolla specialist Stenopelmus rufinasus has been highly successful. However, field surveys showed that the agent utilized another Azolla species, thought to be the native Azolla pinnata subsp. africana, which contradicted host specif...

  10. PENGARUH PEMBERIAN PUPUK HIJAU CAIR KIHUJAN (Samanea saman) DAN AZOLLA (Azolla pinnata) TERHADAP KANDUNGAN SELULOSA DAN HEMISELULOSA RUMPUT GAJAH (Pennisetum purpureum)

    OpenAIRE

    KARIMUDDIN, KHAERUN NUR

    2016-01-01

    2016 KHAERUN NUR KARIMUDDIN (I11111018). Pengaruh Pemberian Pupuk Hijau Cair Ki hujan (Samanea saman) dan Azolla (Azolla pinnata) Terhadap Kandungan Selulosa dan Hemiselulosa Rumput Gajah (Pennisetum purpureum). Dibawah bimbingan SYAMSUDDIN NOMPO sebagai pembimbing utama dan MARHAMAH NADIR sebagai pembimbing anggota. Penelitian ini bertujuan untuk mengetahui pengaruh pemberian pupuk hijau cair dari tanaman Ki hujan (Samanea saman), dan Azolla (Azolla pinnata) terhadap ...

  11. Na(+) regulation by combined nitrogen in Azolla pinnata-Anabaena azollae symbiotic association during salt toxicity.

    Science.gov (United States)

    Singh, Satya S; Singh, Santosh K; Mishra, Arun K

    2008-01-01

    To study the regulation of Na(+) ion by combined-N sources in Azolla pinnata-Anabaena azollae, Na(+) influx, intracellular Na(+) and Na(+) efflux were investigated in the presence of different N-sources (N(2), NH(4)(+), NO(3)(-) and urea) and various NaCl concentrations. Sodium influx by Azolla pinnata fronds was minimum in the presence of NO(3)(-). Almost identical levels of intracellular sodium, although less than N(2) and NH(4)(+) incubated fronds were observed in the presence of NO(3)(-) and urea. Efflux of sodium was minimum in urea and NO(3)(-) grown fronds. A low residual sodium was observed in the fronds incubated in NO(3)(-) and urea supplemented media. Results suggest that nitrate and urea curtailed the entry of sodium, reduced salt toxicity maximally by maintaining the minimum level of sodium and also conserved energy due to slow influx and efflux of Na(+) within the fronds during salt shock and the process of adaptation.

  12. Heavy metal pollutant tolerance of Azolla pinnata

    Energy Technology Data Exchange (ETDEWEB)

    Sarkar, A.; Jana, S.

    1986-01-01

    The effects of Hg, As, Pb, Cu, Cd, and Cr (1,2 and 5 mg L/sup -1/ each) on Azolla pinnata R. Br. were analyzed. The treatments (2 and 5 mg L/sup -1/) of the heavy metal pollutants decreased Hill activity, chlorophyll, protein and dry wt, and increased tissue permeability over control values. The effects were most pronounced with the treatment of 5 mg L/sup -1/. The harmful effects of the metals were, in general, found by the treatments in the order: Cd > Hg > Cu > As > Pb > Cr. There was no significant change in these parameters at 1 mg L/sup -1/ of the metals over control. Thus Azolla pinnata shows tolerance to the heavy metals tested up to 1 mg L/sup -1/ each.

  13. Biosorption of uranium by Azolla, SP, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T., E-mail: lcvieira@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Ferreira, Rafael V. de P., E-mail: rafael@itatijuca.com [Itatijuca Biotech, Sao Paulo, SP (Brazil); Canevesi, Rafael L.S.; Silva, Edson A., E-mail: edson.silva2@unioeste.br [Universidade Estadual do Oeste Parana (UNIOESTE), Toledo, PR (Brazil)

    2015-07-01

    Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)

  14. Aquatic microphylla Azolla: a perspective paradigm for sustainable agriculture, environment and global climate change.

    Science.gov (United States)

    Kollah, Bharati; Patra, Ashok Kumar; Mohanty, Santosh Ranjan

    2016-03-01

    This review addresses the perspectives of Azolla as a multifaceted aquatic resource to ensure ecosystem sustainability. Nitrogen fixing potential of cyanobacterial symbiont varies between 30 and 60 kg N ha(-1) which designates Azolla as an important biological N source for agriculture and animal industry. Azolla exhibits high bioremediation potential for Cd, Cr, Cu, and Zn. Azolla mitigates greenhouse gas emission from agriculture. In flooded rice ecosystem, Azolla dual cropping decreased CH4 emission by 40 % than did urea alone and also stimulated CH4 oxidation. This review highlighted integrated approach using Azolla that offers enormous public health, environmental, and cost benefits.

  15. Azolla - A Model Organism for Plant Genomic Studies

    Institute of Scientific and Technical Information of China (English)

    Yin-Long Qiu; Jun Yu

    2003-01-01

    The aquatic ferns of the genus Azolla are nitrogen-fixing plants that have great potentials in agricultural production and environmental conservation. Azolla in many aspects is qualified to serve as a model organism for genomic studies because of its importance in agriculture, its unique position in plant evolution, its symbiotic relationship with the N2-fixing cyanobacterium, Anabaena azollae, and its moderate-sized genome. The goals of this genome project are not only to understand the biology of the Azolla genome to promote its applications in biological research and agriculture practice but also to gain critical insights about evolution of plant genomes. Together with the strategic and technical improvement as well as cost reduction of DNA sequencing, the deciphering of their genetic code is imminent.

  16. Polyamine-Induced Rapid Root Abscission in Azolla pinnata

    OpenAIRE

    Sushma Gurung; Cohen, Michael F.; Jon Fukuto; Hideo Yamasaki

    2012-01-01

    Floating ferns of the genus Azolla detach their roots under stress conditions, a unique adaptive response termed rapid root abscission. We found that Azolla pinnata plants exhibited dose-dependent rapid root abscission in response to the polyamines spermidine and spermine after a substantial time lag (>20 min). The duration of the time lag decreased in response to high pH and high temperature whereas high light intensity increased the time lag and markedly lowered the rate of abscission. The ...

  17. PENGARUH PEMBERIAN PUPUK HIJAU CAIR KIHUJAN (Samanea saman) DAN AZOLLA (Azolla pinnata) TERHADAP KANDUNGAN NDF DAN ADF PADA RUMPUT SIGNAL (Brachiaria decumbens)

    OpenAIRE

    SYAM, NURFAJRI

    2016-01-01

    2016 Penelitian ini bertujuan untuk mengetahui pengaruh pemberian pupuk hijau cair dari tanaman Kihujan (Samanea saman), dan Azolla (Azolla pinnata) terhadap kandungan NDF dan ADF rumput signal.Penelitian ini disusun berdasarkan Rancangan Acak Lengkap (RAL) dengan 3 perlakuan dan 5 kali ulangan sehingga di peroleh 15 unit percobaan. Perlakuan penelitian ini yaitu P0 (Kontrol), P1 (azolla), P2 (kihujan). Parameter yaitu kandungan NDF dan ADF. Hasil penelitian menunjukkan b...

  18. VARIASI KOMBINASI TEPUNG LABU KUNING (Cucurbita moschata D.) DAN TEPUNG AZOLLA (Azolla pinnata R.br.) PADA KECERAHAN WARNA IKAN KOI (Cyprinus carpio L.)

    OpenAIRE

    Utami, Diah Ayu Tri

    2014-01-01

    Warna memegang peranan penting dalam menentukan kualitas ikan koi (Cyprinus carpio L.), bahkan dipandang sebagai komponen penting dalam proses seleksi ikan hias. Permasalahan yang sering timbul adalah memudarnya warna ikan bila dipelihara dalam jangka waktu yang lama. Penelitian ini menambahkan tepung labu kuning (Cucurbita moschata D.) dan tepung Azolla (Azolla pinnata R.Br.) ke dalam pakan buatan. Dengan penambahan tepung labu kuning dan tepung Azolla ini memungkinkan ikan memperoleh lebih ...

  19. Aquatic Fern (Azolla Sp.) Assisted Synthesis of Gold Nanoparticles

    Science.gov (United States)

    Jha, Anal K.; Prasad, K.

    2016-02-01

    Aquatic pteridophyte (Azolla sp.) was taken to assess its potential to synthesize the metal (Au) nanoparticles. The synthesized particles were characterized using X-ray, UV-visible, scanning and transmission electron microscopy analyses. Nanoparticles almost spherical in shape having the sizes of 5-17nm are found. UV-visible study revealed the surface plasmon resonance at 538nm. Responsible phytochemicals for the transformation were principally phenolics, tannins, anthraquinone glycosides and sugars present abundantly in the plant thereby bestowing it adaptive prodigality. Also, the use of Azolla sp. for the synthesis of gold nanoparticles offers the benefit of eco-friendliness.

  20. Microcosm investigation on phytoremediation of Cr using Azolla pinnata.

    Science.gov (United States)

    Rai, Prabhat Kumar

    2010-01-01

    The extent of Chromium (Cr) pollution in Singrauli industrial region, India was assessed and phytoremediation capacity of a small water fern, Azolla pinnata R.BR (Azollaceae) was observed to purify waters polluted by Cr under microcosm condition. Azolla pinnata endemic to India is a potential hyper-accumulator of heavy metals. During 13 days of the experiment the fern was grown in the aqueous medium containing Cr3+ and CrO4(2-) ions, each in a concentration 0.5, 1.0, and 3.0 mg L(-1). The presence of these ions caused a + 3.1 to -37.5% inhibition of Azolla pinnata growth in comparison to the control. After 13 days of the experiment, metal contents in the solution was decreased up to 70% (CrO4(2-) 3.0 mg L(-1) treatment) to 88% (CrO4(2-) 0.5 mg L(-1) treatment). In the Azolla pinnata tissues, the concentration of couple of the ionic forms of Cr under investigation ranged from 415 to 1095 mg kg(-1) dry mass (dm); the highest level being found for Cr (III) containing solution.

  1. Tingkat Penggunaan Azolla Pinnata Pada Pakan Terhadap Pertumbuhan Ikan Nila (Oreochromis niloticus).

    OpenAIRE

    Sinaga, Daniel

    2015-01-01

    Nila fish is economic valuable fish, consumer demand increasing, but has not been followed by intensive cultivation and optimal. One of attempt to overcome these problems by substituting commercial feed with fish meat meal Azolla pinnata for growth nila fish. The tested fish are nila fish size 6 cm which maintained in an pain diameter 50 cm by 12 unit. With completely randomized design. With treatment commercial pakan 100% without added azolla flour, commercial pakan 94 % added 10 % azolla f...

  2. ESPECIES NATIVAS DE Trichogramma (HYMENOPTERA: TRICHOGRAMMATIDAE) COLECTADAS EN CULTIVOS AGRÍCOLAS DEL NORTE DE MÉXICO

    OpenAIRE

    2011-01-01

    Trichogramma atopovirilia Oatman y Platner, T. deion Pinto y Oatman, T. exiguum Pinto y Platner, T. fuentesi Torre y T. pretiosum Riley, fueron determinadas de 27 muestras colectadas en los siguientes cultivos: algodonero, caña de azúcar, chile serrano, col, girasol, maíz, naranjo, nogal, soya y tomate, establecidos en ocho estados del norte de México. T. pretiosum se determinó en algodonero, chile serrano, col, girasol, maíz, naranjo, nogal, soya y tomate; T. fuentesi en muestras de maíz y n...

  3. Accumulation of mercury by Azolla and its effect on growth

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, B.B.; Nanda, D.R.; Misra, B.N.

    1987-10-01

    Of the various industrial set-ups polluting the environment with mercury, chloralkali factories are the most important. The presence of mercury in the exhaust air has been reported, and the presence of a large amount of mercury has also been reported in the solid waste of chloralkali factories. The loss of mercury from the culture medium through microbial activities under laboratory conditions has been established. The present investigation deals with the effect of mercury contaminated solid wastes of chloralkali factories on the growth of Azolla (A water-weed) and loss of mercury from the medium under field conditions following its culture. It was noticed that the discharge of chloralkali greatly affected the local vegetation including cultivated cereals. An attempt was, therefore, made to reclaim the waste soil with Azolla.

  4. PROTEIN FRACTIONATION AND IN VITRO DIGESTIBILITY OF AZOLLA IN RUMINANTS

    Directory of Open Access Journals (Sweden)

    S. PARASHURAMULU

    2013-05-01

    Full Text Available A study was undertaken to evaluate the nutritive value and digestibility of Azolla in ruminants by in vitro techniques. The crude protein, crude fibre and ether extract contents were at a level of 21.37%, 12.5% and 2.3%, respectively. The neutral and acid detergent fibre levels were about 35.4 and 23.9%, respectively. The average in vitro dry matter digestibility, in vitro organic matter digestibility and metabolozable energy contents were 79.5%, 63.8 mg/200mg and 7.36 MJ/kg DM (1759 kcal/kg, respectively. The various protein fractions A, B1, B2, B3 and C estimated by Cornell net crude protein solubility system were 18.22, 42.56, 15.15, 7.47 and 16.61% of total protein, respectively. The Azolla contained significantly higher B1 fraction followed by A, B2 and C and lowest fraction of C. Thus in view of above, present study indicated Azolla to be a good source protein supplement with 21.37% crude protein with highest B protein fractions, moderate source of energy (1759 kcal ME/kg, high dry matter and organic matter digestibilities and rich in trace minerals thus could be used as an alternate protein supplement or as supplementary protein supplement to ruminants.

  5. The optimum energy harvest efficiency of nitrogen fixing hydrophyte: Azolla pinnata

    Energy Technology Data Exchange (ETDEWEB)

    Tennakone, K. (Institute of Fundamental Studies, Kandy (LK) Ruhuna Univ., Matara (LK). Dept. of Physics); Punchihewa, S.; Jayasuriya, A.C. (Institute of Fundamental Studies, Kandy (LK))

    1989-01-01

    Azolla is a nitrogen fixing hydrophyte that can be cultivated in absence of nitrogenous fertilizer. It is found that when biomass is continuously harvested from a culture of Azolla, solar energy can be converted at an optimum efficiency of 1.1%. (author).

  6. Methane Emissions and Microbial Communities as Influenced by Dual Cropping of Azolla along with Early Rice

    Science.gov (United States)

    Liu, Jingna; Xu, Heshui; Jiang, Ying; Zhang, Kai; Hu, Yuegao; Zeng, Zhaohai

    2017-01-01

    Azolla caroliniana Willd. is widely used as a green manure accompanying rice, but its ecological importance remains unclear, except for its ability to fix nitrogen in association with cyanobacteria. To investigate the impacts of Azolla cultivation on methane emissions and environmental variables in paddy fields, we performed this study on the plain of Dongting Lake, China, in 2014. The results showed that the dual cropping of Azolla significantly suppressed the methane emissions from paddies, likely due to the increase in redox potential in the root region and dissolved oxygen concentration at the soil-water interface. Furthermore, the floodwater pH decreased in association with Azolla cultivation, which is also a factor significantly correlated with the decrease in methane emissions. An increase in methanotrophic bacteria population (pmoA gene copies) and a reduction in methanogenic archaea (16S rRNA gene copies) were observed in association with Azolla growth. During rice cultivation period, dual cropping of Azolla also intensified increasing trend of 1/Simpson of methanogens and significantly decreased species richness (Chao 1) and species diversity (1/Simpson, 1/D) of methanotrophs. These results clearly demonstrate the suppression of CH4 emissions by culturing Azolla and show the environmental and microbial responses in paddy soil under Azolla cultivation.

  7. Protection against salt toxicity in Azolla pinnata-Anabaena azollae symbiotic association by using combined-N sources.

    Science.gov (United States)

    Mishra, A K; Singh, Satya S

    2006-09-01

    Protection from salt stress was observed in the terms of yield (fresh and dry weight, chlorophyll and protein) and nitrogenase activity. Azollapinnata appeared highly sensitive to 40 mM external NaCl stress. Fronds of Azolla unable to grow beyond a concentration of 30 mM NaCl and accordingly death was recorded at 40 mM NaCl on the 6th day of incubation. Yield was inhibited by various levels of NaCl (0, 10, 20 and 30 mM). Addition of combined-N to the growth medium protected the association partially from salt toxicity. Among the N-sources (NO3-, NH4+ and urea) tried, urea mitigated the salt-induced toxicity most efficiently. Reduction in nitrogenase activity was observed when intact Azolla was grown in nutrient medium either supplemented with different levels of NaCl or combined nitrogen. Only NO3- (5 mM) protected the enzymatic activity from salt toxicity while other concentrations of ammonium, nitrate and urea slowed down the salt-induced inhibition of enzyme activity in Azolla-Anabaena association. These results suggested that an optimum protection from salt stress could be obtained by using a combination of combined nitrogen sources. The reason for this protection might be due to the availability of combined nitrogen to the association, nitrogen is only available through the biological nitrogen fixation which is the most sensitive to salt stress.

  8. PENGARUH PEMBERIAN PUPUK HIJAU CAIR KIHUJAN (Samanea saman) DAN AZOLLA (Azolla pinnata) TERHADAP KANDUNGAN NDF DAN ADF PADA RUMPUT GAJAH (Pennisetum purpureum)

    OpenAIRE

    -, SUCI RAMADANI

    2016-01-01

    2016 ABSTRAK Suci Ramadani (I111 11 006). Pengaruh Pemberian Pupuk Hijau Cair Kihujan (Samanea saman) dan Azolla (Azolla pinnata) Terhadap Kandungan NDF dan ADF Pada Rumput Gajah (Pennisetum purpureum). Dibawah bimbingan Dr. Ir Syamsuddin Nompo, MP sebagai Pembimbing Utama dan Dr Ir Budiman Nohong,MP sebagai Pembimbing Anggota. Hijauan merupakan sumber makanan utama bagi ternak ruminansia untuk dapat bertahan hidup, berproduksi serta berkembangbiak. Produksi ternak...

  9. Micro-halocline enabled nutrient recycling may explain extreme Azolla event in the Eocene Arctic Ocean.

    Directory of Open Access Journals (Sweden)

    Monique M L van Kempen

    Full Text Available In order to understand the physicochemical mechanisms that could explain the massive growth of Azolla arctica in the Eocene Arctic Ocean, we carried out a laboratory experiment in which we studied the interacting effects of rain and wind on the development of salinity stratification, both in the presence and in the absence of a dense Azolla cover. Additionally, we carried out a mesocosm experiment to get a better understanding of the nutrient cycling within and beneath a dense Azolla cover in both freshwater and brackish water environments. Here we show that Azolla is able to create a windproof, small-scale salinity gradient in brackish waters, which allows for efficient recycling of nutrients. We suggest that this mechanism ensures the maintenance of a large standing biomass in which additional input of nutrients ultimately result in a further expansion of an Azolla cover. As such, it may not only explain the extent of the Azolla event during the Eocene, but also the absence of intact vegetative Azolla remains and the relatively low burial efficiency of organic carbon during this interval.

  10. The potential of the fresh-water fern Azolla in aquatic farming systems

    Science.gov (United States)

    Bijl, Peter K.; Werf, vd, Adrie; Schluepmann, Henriette; Reichart, Gert-Jan; Brouwer, Paul; Nierop, Klaas G. J.; Hellgardt, Klaus; Brinkhuis, Henk

    2014-05-01

    With aquatic farming systems a new avenue in agriculture is explored, in which the competition with conventional arable land is avoided. The aquatic, ubiquitous, floating fern Azolla is not yet widely explored as potential crop in such farming systems, despite its high potential because it grows in many natural systems under low-light intensities, has an enormous annual yield, and has special biomass qualities for applications in food, feed and specialty chemical industries. But, what makes Azolla particularly interesting as cost-effective crop is its capability to take up atmospheric nitrogen through symbiosis with nitrogen-fixing bacteria Anabaena azollae. This makes Azolla independent of nitrogen fertilization. In order to explore the potential of Azolla as a crop for a suite of applications, we have assembled a team of expertise: AZOFAST, consisting of agricultural engineers, plant physiologists, chemical engineers and organic chemists. Our growth experiments reveal high annual production yields with constant harvest. We are developing a germination and spore collecting/preservation protocol as a first step to domestication. Finally we have explored the biomass quality of different species of extant Azolla. We performed organic chemical analyses on lipid and tannin extracts, and quantified yields of specific compounds within these fractions. In our presentation we will present some of our results to show the potential of Azolla as a new, sustainable aquatic crop serving all kinds of industrial streams from protein feed to platform chemicals.

  11. Crowdfunding the Azolla fern genome project: a grassroots approach.

    Science.gov (United States)

    Li, Fay-Wei; Pryer, Kathleen M

    2014-01-01

    Much of science progresses within the tight boundaries of what is often seen as a "black box". Though familiar to funding agencies, researchers and the academic journals they publish in, it is an entity that outsiders rarely get to peek into. Crowdfunding is a novel means that allows the public to participate in, as well as to support and witness advancements in science. Here we describe our recent crowdfunding efforts to sequence the Azolla genome, a little fern with massive green potential. Crowdfunding is a worthy platform not only for obtaining seed money for exploratory research, but also for engaging directly with the general public as a rewarding form of outreach.

  12. Polyamine-Induced Rapid Root Abscission in Azolla pinnata

    Directory of Open Access Journals (Sweden)

    Sushma Gurung

    2012-01-01

    Full Text Available Floating ferns of the genus Azolla detach their roots under stress conditions, a unique adaptive response termed rapid root abscission. We found that Azolla pinnata plants exhibited dose-dependent rapid root abscission in response to the polyamines spermidine and spermine after a substantial time lag (>20 min. The duration of the time lag decreased in response to high pH and high temperature whereas high light intensity increased the time lag and markedly lowered the rate of abscission. The oxidation products of polyamines, 1,3-diaminopropane, β-alanine and hydrogen peroxide all failed to initiate root abscission, and hydroxyethyl hydrazine, an inhibitor of polyamine oxidase, did not inhibit spermine-induced root abscission. Exposure of A. pinnata to the polyamines did not result in detectable release of NO and did not affect nitrite-dependent NO production. The finding of polyamine-induced rapid root abscission provides a facile assay for further study of the mode of action of polyamines in plant stress responses.

  13. Polyamine-Induced Rapid Root Abscission in Azolla pinnata.

    Science.gov (United States)

    Gurung, Sushma; Cohen, Michael F; Fukuto, Jon; Yamasaki, Hideo

    2012-01-01

    Floating ferns of the genus Azolla detach their roots under stress conditions, a unique adaptive response termed rapid root abscission. We found that Azolla pinnata plants exhibited dose-dependent rapid root abscission in response to the polyamines spermidine and spermine after a substantial time lag (>20 min). The duration of the time lag decreased in response to high pH and high temperature whereas high light intensity increased the time lag and markedly lowered the rate of abscission. The oxidation products of polyamines, 1,3-diaminopropane, β-alanine and hydrogen peroxide all failed to initiate root abscission, and hydroxyethyl hydrazine, an inhibitor of polyamine oxidase, did not inhibit spermine-induced root abscission. Exposure of A. pinnata to the polyamines did not result in detectable release of NO and did not affect nitrite-dependent NO production. The finding of polyamine-induced rapid root abscission provides a facile assay for further study of the mode of action of polyamines in plant stress responses.

  14. Studies on Using Azolla for O2-Supplementation and Its Test

    Science.gov (United States)

    Liu, C.-C.; Liu, X.-S.; Chen, M.; Bian, Z.-L.

    Establishment of Controlling Ecological Life Safety System (CELSS) is a key technical part in the study on manned station. In order to meet the requirement of long-term out-earth man-carrying flight, it is necessary to build plant-based O2-supplying CELSS. It also possesses the possibility to contribute the realization of mankind dream to live in out-earth planets. Using the physiological reaction of organisms, this system settled the problem in food supply, O2 and water recycle, the regeneration and utilization of CO2 and life residues, thus guarantee the spacemen the health, safety and efficient work when they are far from earth and arrived the space where human is difficult to life in. Azolla as a plant that possesses high growing speed, short growing cycle, high photosynthesis and O2-releasing capacity, and can be artificially grow in multi-layer facilities, it is hopeful to be an important biological part in CELSS for it's the function in O2 production and to be a part of fresh vegetable as well as CO2 absorption. This paper described the study in Azolla as a plant for supplementary O2 supply in future space station flight. The "Azolla-dog" controlling tight system was firstly established in order to determine the regulation of O2-CO2 variation and balance using different weights of dogs with different Azolla growing areas. The further studies included the development of air-tight cabinets where "Azolla-human" airtight experiments were conducted, and the relationship between Azolla-growing area and O2 requirement by human was analyzed. Based on these works, the further experiment on supplementary O2-supply of Azolla-human system was conducted in demonstration cabin for environmental controlling and life security. The O2-supplying amount of Azolla was further gained, and it will provide the experimental basis to probe optimum condition to grow Azolla in space and human-machine combining experiment, also to lay a basis for Azolla as a biological part to enter

  15. Salinity induced physiological and biochemical changes in the freshly separated cyanobionts of Azolla microphylla and Azolla caroliniana.

    Science.gov (United States)

    Yadav, Ravindra Kumar; Tripathi, Keshawanand; Ramteke, Pramod Wasudeo; Varghese, Eldho; Abraham, Gerard

    2016-09-01

    Freshly separated cyanobionts of Azolla microphylla and Azolla caroliniana plants exposed to salinity showed decline in the cellular constituents such as chlorophyll (23.1 and 38.9%) and protein (12.9 and 19.3%). However, an increase in the carotenoid and sugar content was observed. Exposure to salinity stress reduced the heterocyst frequency (35.4 and 57.2%) and nitrogenase activity (37.7 and 46.3%) of the cyanobionts. Increase in the activity of antioxidant enzymes such as super oxide dismutase (50.6 and 11.5%), ascorbate peroxidase (63.7 and 57.9%), catalase (94.2 and 22.5%) as well as non-enzymatic antioxidant proline (18.8 and 13.3%) was also observed in response to salinity. The cyanobionts exhibited significant increase in the intracellular Na(+) level and reduced intracellular K(+)/Na(+) and Ca(2+)/Na(+) ratio in response to salinity. The results demonstrate the adverse impact of salinity on the freshly separated cyanobionts as similar to free living cyanobacteria. These results may be helpful in the critical evaluation of salinity tolerance mechanism of the cyanobiont and its interaction with the host.

  16. Classification and phylogeny of the cyanobiont Anabaena azollae Strasburger: an answered question?

    Science.gov (United States)

    Pereira, Ana L; Vasconcelos, Vitor

    2014-06-01

    The symbiosis Azolla-Anabaena azollae, with a worldwide distribution in pantropical and temperate regions, is one of the most studied, because of its potential application as a biofertilizer, especially in rice fields, but also as an animal food and in phytoremediation. The cyanobiont is a filamentous, heterocystic cyanobacterium that inhabits the foliar cavities of the pteridophyte and the indusium on the megasporocarp (female reproductive structure). The classification and phylogeny of the cyanobiont is very controversial: from its morphology, it has been named Nostoc azollae, Anabaena azollae, Anabaena variabilis status azollae and recently Trichormus azollae, but, from its 16S rRNA gene sequence, it has been assigned to Nostoc and/or Anabaena, and from its phycocyanin gene sequence, it has been assigned as non-Nostoc and non-Anabaena. The literature also points to a possible co-evolution between the cyanobiont and the Azolla host, since dendrograms and phylogenetic trees of fatty acids, short tandemly repeated repetitive (STRR) analysis and restriction fragment length polymorphism (RFLP) analysis of nif genes and the 16S rRNA gene give a two-cluster association that matches the two-section ranking of the host (Azolla). Another controversy surrounds the possible existence of more than one genus or more than one species strain. The use of freshly isolated or cultured cyanobionts is an additional problem, since their morphology and protein profiles are different. This review gives an overview of how morphological, chemical and genetic analyses influence the classification and phylogeny of the cyanobiont and future research.

  17. Azolla pinnata growth performance in different water sources.

    Science.gov (United States)

    Nordiah, B; Harah, Z Muta; Sidik, B Japar; Hazma, W N Wan

    2012-07-01

    Azolla pinnata R.Br. growth performance experiments in different water sources were conducted from May until July 2011 at Aquaculture Research Station, Puchong, Malaysia. Four types of water sources (waste water, drain water, paddy field water and distilled water) each with different nutrient contents were used to grow and evaluate the growth performance of A. pinnata. Four water sources with different nutrient contents; waste, drain, paddy and distilled water as control were used to evaluate the growth performance of A. pinnata. Generally, irrespective of the types of water sources there were increased in plant biomass from the initial biomass (e.g., after the first week; lowest 25.2% in distilled water to highest 133.3% in drain water) and the corresponding daily growth rate (3.61% in distilled water to 19.04% in drain water). The increased in biomass although fluctuated with time was consistently higher in drain water compared to increased in biomass for other water sources. Of the four water sources, drain water with relatively higher nitrate concentration (0.035 +/- 0.003 mg L(-l)) and nitrite (0.044 +/- 0.005 mg L(-1)) and with the available phosphate (0.032 +/- 0.006 mg L(-1)) initially provided the most favourable conditions for Azolla growth and propagation. Based on BVSTEP analysis (PRIMER v5), the results indicated that a combination of more than one nutrient or multiple nutrient contents explained the observed increased in biomass of A. pinnata grown in the different water sources.

  18. The potential of the aquatic water fern Azolla within a biobased economy

    Science.gov (United States)

    Nierop, Klaas G. J.; Jongerius, Anna L.; Bijl, Peter K.; Bruijnincx, Pieter C. A.; Klein Gebbink, Robertus J. M.; Reichart, Gert-Jan

    2014-05-01

    Azolla is a free-floating freshwater fern capable of fixing atmospheric carbon dioxide and nitrogen, the latter of which through its symbiosis with the cyanobacteria Anabaena azollae. It is currently ranked among the fastest growing plants on Earth and occurs in both tropical and temperate freshwater ecosystems. Therefore, it is non-directly competitive with food crops. In addition, Azolla does not require inorganic fertilizers, which makes it a potential and unique source of biomass for the sustainable production of fuels and chemicals that are currently derived from fossil (fuel) sources. The biochemical composition of Azolla allows the production of biofuel or biobased chemicals that are of interest to the chemical industry. Of Azolla, two extractable groups of compounds are of particular interest, i.e. the polyphenols (condensed tannins and ester-bound caffeic acid) and the lipids. The antioxidant property of polyphenols and their application to the treatment of cancer, diabetes and cardiovascular diseases has further contributed to the growth of the polyphenol market. In addition, they can be chemically transformed into aromatic platform and specialty chemicals. The composition of the lipid fraction of Azolla is characterized by highly specific compounds consisting of C26-C36 carbon chains all bearing a ω20-hydroxy group. Such compounds produce an oil fraction upon hydrous pyrolysis, or, alternatively, are well suited to be converted to e.g. various specialty chemicals that are hardly available from both natural sources. Indeed, upon chemical conversion these lipids may yield components for fuels, plastics, cosmetics, and lubricants. Another group of interesting compounds within the lipid group are the polyunsaturated fatty acids (PUFAs). The demand for PUFAs has witnessed a significant increase over the last three years, particularly due to their benefits as cholesterol lowering agents. Here we will present some of the thermal and chemical conversions of the

  19. Growth and cellular ion content of a salt-sensitive symbiotic system Azolla pinnata-Anabaena azollae under NaCl stress.

    Science.gov (United States)

    Rai, Vandna; Sharma, Naveen Kumar; Rai, Ashwani K

    2006-09-01

    Salinity, at a concentration of 10 mM NaCl affected the growth of Azolla pinnata-Anabaena azollae association and became lethal at 40 mM. Plants exposed up to 30 mM NaCl exhibited longer roots than the control, especially during the beginning of incubation. Average root number in plants exposed to 10 and 20 mM NaCl remained almost the same as in control. A further rise in NaCl concentration to 30 mM reduced the root number, and roots shed off at 40 mM NaCl. Presence of NaCl in the nutrient solution increased the cellular Na+ of the intact association exhibiting differential accumulation by individual partners, while it reduced the cellular Ca2+ level. However, cellular K+ content did not show significant change. Cellular Na+ based on fresh weight of respective individual partners (host tissues and cyanobiont) remained higher in the host tissues than the cyanobiont, while reverse was true for K+ and Ca2+ contents. The contribution of A. azollae in the total cellular ion content of the association was a little because of meagre contribution of the cyanobiont mass (19-21%). High salt sensitivity of Azolla-Anabaena complex is due to an inability of the association to maintain low Na+ and high Ca2+ cellular level.

  20. [Physiological and ecological characteristics of Azolla pinnata and its possible use in biological life support systems].

    Science.gov (United States)

    Shepelev, E Ia; Tkhyok, N; Meleshko, G I; Antonian, A A; Galkina, T B

    1983-01-01

    The principal physiological and ecological characteristics of Azolla pinnata were investigated in order to determine its potential use in biological life support systems. Plant requirements for biogenic elements were specified in order to develop balanced nutrient mixtures for continuous cultivation. Data on the growth and development, photosynthetic and nitrogen fixation rate, and biochemical composition of the plant were obtained for optimal cultivation conditions. The plant biomass contains large quantities of carotenoids and sulfur-containing amino acids, which are deficient in unicellular algae. This makes Azolla an attractive source of the above compounds for biological life support systems and other applications.

  1. Azolla pinnata as a possible replacement of palm kernel cake in the diet of oreochromis niloticus.

    OpenAIRE

    Abioye, O.M.; Adeyemo, A. A.; Ayinla, O.A.; Bekibele, D.O.

    1993-01-01

    Azolla pinnata as a possible replacement of the palm kernel cake in the diet of Oreochromis niloticus. Compounded diets from a control with palm kernel cake replaced at varying levels of 0, 20, 40, 60, 80, and 100% with the aquatic fern (oven dried Azolla pinnata) were fed to Oreochromis niloticus for twelve weeks to determine the acceptability and utilization of the fern in the diet, verify the nutritional influence of the fern on the performance of the fish and possible optimum palm kernel ...

  2. Azolla-anabaena-bacteria system as a natural microcosm

    Science.gov (United States)

    Carrapico, Francisco J.

    2002-02-01

    Azolla is an aquatic fern that contains a permanent endosymbiotic prokaryotic community (cyanobacteria and bacteria) inside of the cavity in the leaf dorsal lobe of the pteridophyte. This is a unique situation and can be seen as a microcosm inside of an organism and also can be considered a good example of a living model for biological and environmental studies. These symbionts are specific of this symbiosis and lives immobilized in a mucilaginous fibrillar network, which fills part of the cavity. The symbionts works as immobilized organisms in a natural system that can be used as a model for biotechnological research and in biologically based life support systems. The nature and the complexity of this system is simultaneously a reference and a challenge for the research in the communication between the two levels of nature organization (microcosm and mesocosm), and can also be used as a reference for the design of new environmental engineered symbiotic systems that include man as a prelude to life in space.

  3. Determination of thermal stability of specific biomarker lipids of the freshwater fern Azolla through hydrous pyrolysis

    Science.gov (United States)

    Sap, Merel; Speelman, Eveline N.; Lewan, Michael D.; Sinninghe Damsté, Jaap S.; Reichart, Gert-Jan

    2010-05-01

    Enormous blooms of the free-floating freshwater fern Azolla occurred within the Arctic Basin during an extended period of ~1.2 Ma during the middle Eocene (Brinkhuis et al. 2006; Speelman et al., GB, 2009). The sustained growth of Azolla, currently ranking among the fastest growing plants on Earth, in a major anoxic basin may have substantially contributed to decreasing atmospheric CO2 levels by burial of Azolla-derived organic matter. Speelman et al. (OG, 2009) reported biomarkers for Azolla (1,w20 C32 - C36 diols, structurally related C29 ω20,ω21 diols, C29 1,20,21 triols, C29 dihydroxy fatty acids as well as a series of wax esters containing these mono- and dihydroxy lipids), which can be used to reconstruct palaeo-environmental conditions. Here we assess the thermal stability of these compounds, to extend their biomarker potential. We specifically focused on the thermal stability of the Azolla biomarkers using hydrous pyrolysis in order to determine which burial conditions allow reconstruction of past occurrences of Azolla. In addition, hydrous pyrolysis was also performed on samples from the Eocene Arctic Ocean (ACEX core), to test if and how the biomarkers change under higher temperatures and pressures in situ. During hydrous pyrolysis, the biomass was heated under high pressure at temperatures ranging between 220 and 365°C for 72 hours. Four experiments were also run using different durations to explore the kinetics of biomarker degradation at specific temperatures. First results indicate that the Azolla specific diols are still present at 220°C, while the corresponding wax esters are already absent. At 300°C all Azolla specific biomarkers are destroyed. More specific determination of the different biomarkers' stability and kinetics would potentially allow the reconstruction of the temperature and pressure history of Azolla deposits. Literature: • Brinkhuis, H., Schouten, S., Collinson, M. E., Sluijs, A., Sinninghe Damste, J. S., Dickens, G. R., Huber

  4. Phytoremediation of Hg and Cd from industrial effluents using an aquatic free floating macrophyte Azolla pinnata.

    Science.gov (United States)

    Rai, Prabhat Kumar

    2008-01-01

    The level of heavy metal pollution in Singrauli, an industrial region in India, was assessed and the phytoremediation capacity of a small water fern, Azolla pinnata R.BR (Azollaceae), was observed to purify waters polluted by two heavy metals, i.e., mercury (Hg) and cadmium (Cd) under a microcosm condition. Azolla pinnata is endemic to India and is an abundant and easy-growing free-floating water fern usually found in the rice fields, polluted ponds, and reservoirs of India. The fern was grown in 24 40-L aquariums containing Hg2+ and Cd2+ ions each in concentrations of 0.5, 1.0, and 3.0 mgL(-1) during the course of this study. The study revealed an inhibition of Azolla pinnata growth by 27.0-33.9% with the highest in the presence of Hg (II) ions at 0.5 mgL(-1) in comparison to the control After 13 days of the experiment, metal contents in the solution were decreased up to 70-94%. In the tissues of Azolla pinnata, the concentration of selected heavy metals during investigation was recorded between 310 and 740 mgKg(-1) dry mass, with the highest levelfoundfor Cd (II) treatment at 3.0 mgL(-1) containing a metal solution.

  5. Susceptibility of Biomphalaria alexandrina to the plant Azolla pinnata and some herbicides in relation to infection with Schistosoma mansoni miracidia.

    Science.gov (United States)

    Zidan, Z H; Hafez, A M; Abdel-Megeed, M I; el-Emam, M A; Ragab, F M; el-Deeb, F A

    1998-04-01

    Molluscicidal activity of the herebicides 2,4-D and Graminol, as well as both extracts and dry powder of the plant Azolla pinnata were evaluated against B. alexandrina snails. It was observed that 2,4-D proved to be the most toxic compound among he tested ones, showing LC90 of 52 ppm after 24 h of exposure. Ethanol extract of Azolla showed the highest molluscicidal activity against the tested snails compared with the other extracts and dry powder (LC90 = 3300 ppm). Ethanol extract at 6600 ppm after 3 h of exposure killed 100% and 19.4% of S. mansoni miracidia and cercariae, respectively. The molluscicidal activity of 2,4-D was not influenced by the presence of Azolla (900 plants/liter) for 7 days, while Graminol effect was significantly reduced. However, the infectivity of S. mansoni miracidia to B. alexandrina snails was not affected by Azolla existence.

  6. Combined use of Azolla and loach suppressed paddy weeds and increased organic rice yield: second season results

    Directory of Open Access Journals (Sweden)

    Weiguo Cheng

    2015-07-01

    Full Text Available Organic farming uses alternatives to agricultural chemicals such as synthetic fertilizers and pesticides. The primary challenge in organic rice farming is controlling weeds without using herbicides and improving rice yield without chemical fertilizers. In our previous paper entitled as combined use of Azolla and loach suppressed weed Monochoria vaginalis and increased rice yield without agrochemicals, we reported the first year rice growth season results from an in situ container experiment. The experiment was designed with 4 treatments—control (with neither Azolla nor loach, Azolla (Azolla alone, loach (loach alone, and Az+Lo (combined Azolla and loach—with 3 replications each. The first year results showed that combined use of Azolla and loach was successful in weed suppression and increase in rice yield in 2012. In this paper, we report the second year results from the continuous container experiment in 2013. M.vaginalis emergences were very low in second year rice growth season on all treatments. Compared first year, the rice yields decreased in second year on all treatments due to different weather condition and with or without organic soybean oil cake application between two rice growth seasons. The second year results also showed the raising loach had a stronger effect to increase tiller and panicle numbers, and spikelet number per panicle, then improve rice yields to 2.3 times than control. The Azolla residues left from first year have weaker effect on rice growth and yield, but increase soil organic matter accumulation at second year. The two years study indicated that combined use of Azolla and loach can meet two of the greatest challenges in organic rice production: providing effective weed control and improving rice nutrition without agrochemicals.

  7. A preliminary examination of the phytochemical profile of Azolla microphylla with respect to Seasons

    Institute of Scientific and Technical Information of China (English)

    G. Abraham; Vidhu Aeri

    2012-01-01

    Objective: To evaluate the role of seasons on the phytochemical properties of Azolla microphylla.Methods:Dried and powdered leaves (50g) were extracted with 300 ml of methanol using soxhlet extractor for 16 h at a temperature not exceeding the boiling point of the solvent. Standard methods have been used to screen the phytochemical constituents. Conclusions: From the observations it can be concluded that the plant extracts show the presence of several bioactive compounds which could be exploited further.

  8. Removal of methyl orange from aqueous solution by Azolla filicoloides: Synthesis of Fe3O4 nano-particles and its surface modification by the extracted pectin of Azolla

    Institute of Scientific and Technical Information of China (English)

    Roohan Rakhshaee; Masoud Giahi; Afshin Pourahmad

    2011-01-01

    The modified Fe3O4 nano-particles with the extracted pectin from the cell wall of Azolla filicoloides (FN-EP) can remove methyl orange as a water-soluble azo dye from waste water better than Azolla and the extracted pectin from Azolla (EPA), alone. It could be due to more crowding the main functional groups of uptake after binding pectin with nano-particles. Thermodynamic studies showed that adsorption equilibrium constant (KL) and maximum adsorption capacities (Qmax) were increased with decreasing temperature (exothermic). The maximum uptake capacity (Qmax) of dye by FN-EP in a batch reactor was 0.533, 0.498 and 0.446 mmol/g at 5, 25 and 50 ℃, respectively. The enthalpy change (AH) and entropy change (△S) were -15.31 kJ/mol and -0.02434 kJ/mol K, respectively.

  9. Ability of the aquatic fern Azolla to remove chemical oxygen demand and polyphenols from olive mill wastewater

    Directory of Open Access Journals (Sweden)

    Sacchi, Angelo

    2007-03-01

    Full Text Available We investigated the biofiltration ability of the aquatic fern Azolla to remove polyphenols and chemical oxygen demand (COD from olive mill wastewater (OMWw collected from the traditional (TS and continuous (CS extraction systems. Azolla biomass was packed into five sequential Imhoff cones and five sequential columns. In both experiments, the filtrates collected from the 5th biofilter showed a decrease in polyphenol contents: from 7650 mg l–1 to 3610 mg l–1 in TS OMWw and from 3852 mg l–1 to 1351 mg l–1 in CS OMWw. The COD contents decreased from 110200 mg L–1 to 52400 mg L–1 in TS OMWw and from 41600 mg L–1 to 2300 mg L–1 in CS OMWw. A 5:1 OMWw to Azolla-fresh-weight ratio was optimal for both polyphenol and COD removal. The biofiltration ability of alfalfa was compared with that of Azolla, but the treatment with alfalfa did not result in the reduction of COD or polyphenols.La eficacia del helecho de agua azolla para eliminar polifenoles y reducir la demanda química de oxígeno (DQO de los alpechines obtenidos en el proceso de obtención tradicional y continuo del aceite de oliva, fue investigado mediante ensayos de filtración. Cinco conos secuenciales de Imhoff y cinco columnas secuenciales se rellenaron de biomasa de Azolla. En ambos experimentos, el filtrado procedente de la quinta extracción mostró una disminución en el contenido de polifenoles de 7650 mg L–1 a 3610 mg L–1en el alpechín obtenido mediante el sistema tradicional y de 3852 mg L–1 a 1351 mg L–1en el alpechín del sistema continuo. La demanda química de oxígeno del alpechín del sistema tradicional disminuyó de 110200 mg L–1 a 52400 mg L–1 en y de 41600 mg L–1a 2300 mg L–1en el procedente del sistema continuo. Una proporción en peso 5:1 de alpechín: Azolla fue la óptima tanto para la reducción de los polifenoles como para la de la DQO. La eficiencia del tratamiento biológico con alfalfa se comparó con la obtenida con Azolla. Los

  10. Azolla as an Economic Substitute to Soybean Based Feed for Poultry

    Directory of Open Access Journals (Sweden)

    Dev Raj Paudel

    2015-12-01

    Full Text Available A study on azolla as an economical substitute to soybean based poultry feed was conducted. The experiment consisted of four treatments laid out in Completely Randomized Design (CRD with five replications. Each experimental unit consisted of three birds. For this purpose, eight-day old, unsexed Hubbard broiler chicks were weighed and randomly assigned to each treatment. Four different levels of azolla meal were incorporated in the starter and finisher ration at a level of 0%, 10%, 15%, and 20% respectively. Body weight, weight gain, feed consumption, and feed efficiency were measured. The average cumulative weekly body weight for all weeks were found to be significantly different (P<0.05 for the various treatments. Maximum cumulative body weight (1360 g was found in broiler fed T2 ration in 5th week. Similar trend was also observed in 6th week showing highest cumulative weight (1882 g in control diet (T1 which was at par with T2 (1841 g. Significantly highest (420.3 g live weight gain was observed in T2 diet during 5th week. Overall mean of weekly feed consumption was recorded highest (784.33 g in T2 diet. The economic analysis of net income/kg live weight was the highest (Rs 18.86 in T1 which was at par with T2 (Rs 18.35. Likewise, cost of production/bird was highest (Rs 124.5 in T1 and lowest (Rs 112.2 in T4. The results show that azolla meal could be utilized to substitute up to 10% soybean meal from overall production and economic point of view.

  11. The Contribution of Azolla and Urea in Lowland Rice Growth Production for Three Consecutive Seasons

    Directory of Open Access Journals (Sweden)

    EL. Sisworo

    2008-01-01

    Full Text Available Three field experiments have been carried out in three consecutive seasons namely wet season (120 days, dry season (120 days, wet season (120 days at Pusakanegara. The purpose of this experiment is to test whether urea combined with Azolla could increase lowland rice production and soil quality. The experimental plots have a size of 20 m2 and in each experimental plot an isotope plot was placed with a size of 1 m2. The isotope plots were used to apply labeled 15N urea. Treatments conducted were lowland varieties: Atomita I (V1 and IR-64 (V2; several levels of urea and Azolla : Pu1 = urea-tablets + an Azolla cover (Azc, Pu2 = urea-tablets + Azolla incorporated (Azi , Pu3 = urea-prill + Azc , Pu4 = urea-prill + Azi; seasons : Ss 1 = wet season, Ss2 = dry season, Ss3 = wet season. The experimental design used was a factorial experiment in a Randomized Block Design, where each treatment was replicated four times. Parameters used were, dry weight of straw (St, grain (G, plant (P1 = St + G in kg/ha; N-total percentage (% N-to of St and G, percentage N-derived from urea + Az (% N-Pu of St and G; percentage N-derived from soil (% N-S of St and G; uptake of N-Pu and N-S in St, G and P1. Some results of these experiment were, N-Pu play a less important role in growth of lowland crop expressed in several parameters compared to N-soil. The form of N-urea in tablets are superior to that the form of urea in prills. For the last product of lowland rice which is grain obviously V1 (Atomita-1 is better than V2 (IR-64 expressed in t/ha. The progress of seasons showed clearly that there is an N accumulation which might be the increase of soil organic matter (SOM and that means there is an increase in soil quality in the view point of N

  12. Reconstruction of the Arctic Ocean environment during the Eocene Azolla interval using geochemical proxies and climate modeling. Geologica Ultraiectina (331)

    NARCIS (Netherlands)

    Speelman, E.N.

    2010-01-01

    With the realization that the Arctic Ocean was covered with enormous quantities of the aquatic floating fern Azolla 49 Myrs ago, new questions regarding the Eocene conditions facilitating these blooms arose. This dissertation describes the reconstruction of paleo-environmental conditions facilitatin

  13. Phytoremediation of domestic wastewaters in free water surface constructed wetlands using Azolla pinnata.

    Science.gov (United States)

    Akinbile, Christopher O; Ogunrinde, Temitope A; Che Bt Man, Hasfalina; Aziz, Hamidi Abdul

    2016-01-01

    Two constructed wetlands, one with Azolla pinnata plant (CW1) and the other without (CW2) for treating domestic wastewaters were developed. Fifteen water parameters which include: Dissolved Oxygen (DO), Biochemical Oxygen Demand (BOD5), Chemical Oxygen Demand (COD), Total Suspended Solid (TSS), Total Phosphorus (TP), Total Nitrogen (TN), Ammoniacal Nitrogen (NH3N), Turbidity, pH, Electrical Conductivity (EC), Iron (Fe), Magnesium (Mg), Manganese (Mn), and heavy metals such as Lead (Pb) and Zinc (Zn) were analyzed using standard laboratory procedures. The experiments were conducted in two (dry and wet) seasons simultaneously. Results showed considerable reductions in all parameters and metals including Zn in CW1 compared with CW2 in the two seasons considered while Pb and Mn were not detected throughout the study. Zn concentration levels reduced significantly in both seasons just as removal efficiencies of 70.03% and 64.51% were recorded for CW1 while 35.17% and 33.45% were recorded for CW2 in both seasons. There were no significant differences in the removal efficiencies of Fe in both seasons as 99.55%, 59.09%, 88.89%, and 53.56% were recorded in CW1 and CW2 respectively. Azolla pinnata has proved effective in domestic wastewater phytoremediation studies.

  14. Hepatoprotective and antioxidant effects of Azolla microphylla based gold nanoparticles against acetaminophen induced toxicity in a fresh water common carp fish (Cyprinus carpio L.

    Directory of Open Access Journals (Sweden)

    Selvaraj Kunjiappan

    2015-04-01

    Conclusion: Azolla microphylla phytochemically synthesized GNaP protects liver against oxidative damage and tissue damaging enzyme activities and could be used as an effective protector against acetaminophen-induced hepatic damage in fresh water common carp fish.

  15. Ecotoxicidade de herbicidas para a macrófita aquática (Azolla caroliniana Ecotoxicity of herbicides for the aquatic macrophyte (Azolla caroliniana

    Directory of Open Access Journals (Sweden)

    A.F. Silva

    2012-09-01

    Full Text Available Os objetivos deste estudo foram avaliar Azolla caroliniana como planta-teste em estudos ecotoxicológicos e estimar a CL50;7d dos herbicidas 2,4-D, glyphosate, clomazone e oxyfluorfen. As plantas foram aclimatadas em sala de bioensaio. Para isso, foram selecionadas cinco plantas em 50 mL de meio de cultivo Hoagland. Após esse período, foram adicionados 50 mL de Hoagland mais o herbicida, completando o volume para 100 mL. A concentração letal de 50% (CL50;7d para A. caroliniana exposta ao herbicida 2,4-D foi de 708,35 mg L-1; ao glyphosate (formulação Scout®, de 23,66 mg L-1; ao glyphosate (formulação Trop®, de 38,91 mg L-1; ao clomazone, de 129,63 mg L-1; e ao oxyfluorfen, de 80,50 mg L-1. Os herbicidas glyphosate (Scout® e Trop® e oxyflourfen foram classificados como moderadamente tóxicos a A. caroliniana, e o clomazone e o 2,4-D, como praticamente não tóxicos. Conclui-se que A. caroliniana pode ser utilizada como planta bioindicadora de herbicidas à base de glyphosate e oxyfluorfen.The objectives of this study were to evaluate Azolla caroliniana as test plant in ecotoxicological studies and to estimate the LC50; 7d of the herbicides 2,4 D , glyphosate, and clomazone oxyfluorfen. The plants were acclimatized in the bioassay room. Five plants in 50 mL Hoagland culture medium were selected. After that, 50 mL of Hoagland and the herbicide were added, completing the volume to 100 mL. The 50% lethal concentration (LC50; 7d for A. caroliniana exposed to the herbicide 2,4- D, was 708.35 mg L-1; to glyphosate (formulation Scout®, 23.66 mg L-1; to glyphosate (formulation Trop®, 38.91 mg L-1; to clomazone, 129.63 mg L-1; and to oxyflourfen, 80.50 mg L-1. The herbicides glyphosate (Scout® and Trop® and oxyflourfen were classified as moderately toxic to A. caroliniana, while clomazone and 2,4-D were classified as practically non-toxic. It was concluded that A. caroliniana plants can be used as bio-indicators for glyphosate and

  16. Production of biogas from Azolla pinnata R. Br. and Lemna minor L. : effect of heavy metal contamination

    Energy Technology Data Exchange (ETDEWEB)

    Jain, S.K.; Gujral, G.S.; Jha, N.K.; Vasudevan, P. (Indian Inst. of Tech., New Delhi (India))

    1992-01-01

    The absorption of iron, copper, cadmium, nickel, lead, zinc, manganese and cobalt by Azolla pinnata R.Br and Lemna minor L., and subsequent utilization of this biomass for production of biogas (methane), have been investigated. Iron or manganese did not have any toxic effect on the anaerobic fermentation of Azolla and Lemna, while copper, cobalt, lead and zinc showed toxicity. At low concentrations cadmium and nickel showed a favourable effect on the rate of biogas production and its methane content, but with increase in concentrations,rate of biogas production and methane content decreased. However, although there was this decrease in biogas production and methane content, the methane content of biogas was still higher than that which was obtained from non-contaminated biomass. (author).

  17. Photoproduction of hydrogen by a non-sulphur bacterium isolated from root zones of water fern Azolla pinnata

    Energy Technology Data Exchange (ETDEWEB)

    Singh, S.P.; Srivastava, S.C.; Pandey, K.D. (Banaras Hindu Univ., Varanasi (IN). Centre of Advanced Study in Botany)

    1990-01-01

    A photosynthetic bacterium Rhodopseudomonas sp. BHU strain 1 was isolated from the root zone of water fern Azolla pinnata. The bacterium was found to produce hydrogen with potato starch under phototrophic conditions. The immobilized bacterial cells showed sustained hydrogen production with a more than 4-fold difference over free cell suspensions. The data have been discussed in the light of possible utilization of relatively cheaper raw materials by non-sulphur bacteria to evolve hydrogen. (author).

  18. Validación de un método de análisis para la determinación de metales pesados en partículas pM10 colectadas en aire ambiente

    Directory of Open Access Journals (Sweden)

    Jorge Herrera-Murillo

    2010-10-01

    Full Text Available Se validó un método de análisis para la determinación del contenido de metales presentes en partículas PM10 colectadas del aire ambiente de la ciudad de San José.Las muestras se tomaron utilizando dos muestreadores de aire de alto volumen con controlador de flujo, sobre filtros de cuarzo (20,3 cm x 25,4 cm, con un flujo promedio de 1,13 m3min-1 durante 24 h en dos sitios de la ciudad capital: Catedral Metropolitana y Junta de Educación de San José.  Para la determinación se utilizó espectrofotometría de absorción atómica con horno de grafito.Al analizar las muestras colectadas se determinó que las especies metálicas más abundantes son: Al, Fe y Mn; sin embargo solamente el Pb y Cu presentan factores de enriquecimiento importantes debido al posible aporte de actividades antropogénicas en la ciudad.

  19. Effect of feeding different levels of Azolla pinnata on blood biochemicals, hematology and immunocompetence traits of Chabro chicken

    Directory of Open Access Journals (Sweden)

    Deepesh Bharat Mishra

    2016-02-01

    Full Text Available Aim: The present study was conducted to see the effect of feeding different levels of Azolla meal on blood biochemicals, hematology and immunocompetence traits of Chabro chicken. Materials and Methods: The study was conducted on 160 Chabro chicks, which were randomly divided into four treatment groups each with four replicates of 10 birds. The first treatment (T1 served as a control in which basal diets was offered without Azolla supplementation while in T2, T3, and T4 groups, basal diet was replaced with Azolla meal at 5%, 7.5%, and 10% levels, respectively. A feeding trial was conducted upto 8 weeks. At the last week of trial, blood samples were collected randomly from one bird of each replicate and plasma was separated to estimate certain biochemical parameters, some blood metabolites, minerals and enzymes like alanine aminotransferase and aspartate aminotransferase (AST. Hematological parameters such as hemoglobin, packed cell volume, total leukocytes count and differential leukocytes count were estimated in fresh blood just after collection. The humoral immune response was measured against sheep red blood cells,and cell-mediated immune response was measured against phyto hemagglutinin lectin from Phaseolus vulgaris (PHA-P. Results: The study showed that hematological profile of the Chabro bird was not affected by any treatment except heterophil and lymphocyte which was found higher in T2 and T3 groups and eosinophil was found higher in a T3 group than control. Blood glucose, creatinine, cholesterol, total protein, albumin, uric acid, and triglycerides were found similar in all the groups and within the normal values for broiler chicken. Liver enzymes and macro mineral content in blood were found similar in all the treatment groups and within normal physiological range. Although AST was found higher in 10% replacement group than control, the value was within normal range for broiler chicken. Although antibody titer was found similar in all

  20. Uptake and toxicity of arsenic, copper, and silicon in Azolla caroliniana and Lemna minor.

    Science.gov (United States)

    Rofkar, Jordan R; Dwyer, Daryl F; Bobak, Deanna M

    2014-01-01

    Here we report on the analysis of two aquatic plant species, Azolla caroliniana and Lemna minor, with respect to tolerance and uptake of co-occurring arsenic, copper, and silicon for use in engineered wetlands. Plants were cultured in nutrient solution that was amended with arsenic (0 or 20 microM), copper (2 or 78 microM), and silicon (0 or 1.8 mM) either singly or in combination. We hypothesized that arsenic and copper would negatively affect the uptake of metals, growth, and pigmentation and that silicon would mitigate those stresses. Tolerance was assessed by measuring growth of biomass and concentrations of chlorophyll and anthocyanins. Both plant species accumulated arsenic, copper, and silicon; L. minor generally had higher levels on a per biomass basis. Arsenic negatively impacted A. caroliniana, causing a 30% decrease in biomass production and an increase in the concentration of anthocyanin. Copper negatively impacted L. minor, causing a 60% decrease in biomass production and a 45% decrease in chlorophyll content. Silicon augmented the impact of arsenic on biomass production in A. caroliniana but mitigated the effect of copper on L. minor. Our results suggest that mixtures of plant species may be needed to maximize uptake of multiple contaminants in engineered wetlands.

  1. Effects of lead accumulation on the Azolla caroliniana-Anabaena association.

    Science.gov (United States)

    Roberts, Anne E; Boylen, Charles W; Nierzwicki-Bauer, Sandra A

    2014-04-01

    The effect of lead accumulation on photopigment production, mineral nutrition, and Anabaena vegetative cell size and heterocyst formation in Azolla caroliniana was investigated. Plants were exposed to 0, 1, 5, 10, and 20 mg L(-1) lead acetate for ten days. Lead accumulation increased when plants were treated with higher lead concentrations. Results revealed a statistically significant decline in total chlorophyll, chlorophyll a, chlorophyll b, and carotenoids in 5, 10, and 20 mg Pb L(-1) treatment groups as compared to plants with 0 or 1 mg Pb L(-1) treatments. No statistically significant change in anthocyanin production was observed. Calcium, magnesium, and zinc concentrations in plants decreased in increasing treatment groups, whereas sodium and potassium concentrations increased. Nitrogen and carbon were also found to decrease in plant tissue. Anabaena vegetative cells decreased in size and heterocyst frequency declined rapidly in a Pb dose-dependent manner. These results indicate that, while A. caroliniana removes lead from aqueous solution, the heavy metal causes physiological and biochemical changes by impairing photosynthesis, changing mineral nutrition, and impeding the growth and formation of heterocysts of the symbiotic cyanobacteria that live within leaf cavities of the fronds.

  2. Phytochemical studies on Azolla pinnata R. Br., Marsilea minuta L. and Salvinia molesta Mitch

    Institute of Scientific and Technical Information of China (English)

    Johnson Marimuthu Antonisamy; Mony Mahesh; Zachariah Miller Paul; Solomon Jeeva

    2011-01-01

    Objective: To evaluate the phytochemical properties of Azolla pinnata R. Br., Marsilea minuta L. and Salvinia molesta Mitch. Methods: The dried and powered leaves materials (50 g) were extracted successively with 250 mL of petroleum ether, ethyl acetate, methanol, chloroform, acetone, benzene and water by using Soxhlet extractor for 8 h at a temperature not exceeding the boiling point of the solvent. Phytochemical screening of the extracts was carried out according to the standard methods. Results: Out of eighteen tested extracts, eighteen extracts showed the presence of phenolics. Next to that, fourteen extracts were illustrated their existence of tannin. Ten extracts showed the occurrence of carbohydrates in the crude extracts of the selected plants. Steroid and saponin are present in eight extracts, next to that xanthoprotein is present in six extracts, followed by flavonoid and protein which are present in five extracts. Carboxylic acid showed its presence only in two extracts. Conclusions: From the results, it can be concluded that the three plants extracts show the presence of many bioactive compounds after extensive investigation. We recommend further research on these plants to quantify the concentration of these compounds. Further work will accentuate the isolation and characterization of active principles responsible for bio-efficacy and bioactivity.

  3. Interpolation of microtubules into cortical arrays during cell elongation and differentiation in roots of Azolla pinnata.

    Science.gov (United States)

    Hardham, A R; Gunning, B E

    1979-06-01

    Longitudinal sections of roots of Azolla pinnata R. Br. were prepared for electron microscopy so that cortical microtubules could be counted along the longitudinal walls in cell files in the endodermis, pericycle, and inner and outer cortex, and in sieve and xylem elements. With the exception of the xylem, where there are no transverse cell divisions, each file of cells commences with its initial cell and then possesses a zone of concomitant cell expansion and transverse cell division, followed, after completion of the divisions, by a zone of terminal cell differentiation. The cells augment their population of cortical microtubules as they elongate and divide, showing a net increase of up to 0.6 micron of polymerized microtubule length per min. Two main sub-processes were found: (i) When a longitudinal wall is first formed it is supplied with a higher number of microtubules per unit length of wall than it will have later, when it is being expanded. This initial quota becomes diluted as the second sub-process commences. (ii) The cells interpolate new microtubules at a rate which is characteristic of the cell, and, in the endodermis, of the face of the cell, while the cell elongates. Most cell types thus maintain a set density of cortical microtubules while they elongate and divide. Comparisons of endodermal cells in untreated controls, and roots that had been treated with colchicine, low temperature, or high pressure indicate that the initial quota of microtubules, and the later interpolations, and differentially sensitive to microtuble perturbations. Three types of behaviour, all related to changes in the cell walls, were noted as cortex, xylem and sieve element cells entered their respective phases of cell differentiation. The cortical cells expanded in all dimensions, and the interpolation of microtubules diminished or ceased. The sieve elements continued to elongate, and interpolated at a high rate, reaching unusually high densities of microtubules when the cell

  4. A green chemistry approach for the synthesis and characterization of bioactive gold nanoparticles using Azolla microphylla methanol extract

    Science.gov (United States)

    Kunjiappan, Selvaraj; Chowdhury, Ranjana; Bhattacharjee, Chiranjib

    2014-06-01

    This article reports the environmentally benign synthesis of gold nanoparticles (GNPs) using methanol extract of Azolla microphylla as the stabilizing and reducing agent. The GNPs were characterized by UV-vis spectrophotometry and FTIR, and the morphological characteristics were analyzed by XRD, FESEM-EDX and HRTEM. The GNPs could be formed in very short time, even in less than 30 min. The nanoparticles measured by UV-spectrophotometer demonstrated a peak at 540 nm corresponding to surface plasmon resonance spectra, and the peaks showed by FTIR suggested the presence of organic biomolecules on the surface of the GNPs. XRD results confirmed the crystalline nature of the GNPs, and FESEM-EDX and HRTEM analyses had been performed in the size ranges of 17-40 nm and 1.25-17.5 nm respectively. The synthesized GNPs showed excellent antioxidant activity. This study shows the feasibility of using plant sources for the biosynthesis of GNPs.

  5. Water ferns Azolla spp. (Azollaceae as new host plants for the small China-mark moth, Cataclysta lemnata (Linnaeus, 1758 (Lepidoptera, Crambidae, Acentropinae

    Directory of Open Access Journals (Sweden)

    Atousa Farahpour-Haghani

    2017-01-01

    Full Text Available Water ferns (Azolla spp., Azollaceae are reported for the first time as host plants for the larvae of the small China-mark moth Cataclysta lemnata (Linnaeus (Lepidoptera: Crambidae: Acentropinae in rice fields and waterways of northern Iran. Cataclysta lemnata is a semi-aquatic species that has been recorded to feed on Lemnaceae and a few other aquatic plants. However, it has not been reported before on Azolla spp. Larvae use water fern as food source and shelter and, at high population density in the laboratory, they completely wiped water fern from the water surface. Feeding was confirmed after rearing more than eight continual generations of C. lemnata on water fern in the laboratory. Adults obtained this way are darker and have darker fuscous markings in both sexes compared with specimens previously reported and the pattern remains unchanged after several generations.

  6. Bimodal effect of hydrogen peroxide and oxidative events in nitrite-induced rapid root abscission by the water fern Azolla pinnata.

    Science.gov (United States)

    Cohen, Michael F; Gurung, Sushma; Birarda, Giovanni; Holman, Hoi-Ying N; Yamasaki, Hideo

    2015-01-01

    In the genus Azolla rapid abscission of roots from floating fronds occurs within minutes in response to a variety of stresses, including exposure to nitrite. We found that hydrogen peroxide, though itself not an inducer of root abscission, modulates nitrite-induced root abscission by Azolla pinnata in a dose-dependent manner, with 2 mM H2O2 significantly diminishing the responsiveness to 2 mM NaNO2, and 10 mM H2O2 slightly enhancing it. Hypoxia, which has been found in other plants to result in autogenic production of H2O2, dramatically stimulated root abscission of A. pinnata in response to nitrite, especially for plants previously cultivated in medium containing 5 mM KNO3 compared to plants cultivated under N2-fixing conditions without combined nitrogen. Plants, including Azolla, produce the small signaling molecule nitric oxide (NO) from nitrite using nitrate reductase. We found Azolla plants to display dose-dependent root abscission in response to the NO donor spermine NONOate. Treatment of plants with the thiol-modifying agents S-methyl methanethiosulfonate or glutathione inhibited the nitrite-induced root abscission response. Synchrotron radiation-based Fourier transform infrared spectromicroscopy revealed higher levels of carbonylation in the abscission zone of dropped roots, indicative of reaction products of polysaccharides with potent free radical oxidants. We hypothesize that metabolic products of nitrite and NO react with H2O2 in the apoplast leading to free-radical-mediated cleavage of structural polysaccharides and consequent rapid root abscission.

  7. Bimodal effect of hydrogen peroxide and oxidative events in nitrite-induced rapid root abscission by the water fern Azolla pinnata

    Directory of Open Access Journals (Sweden)

    Michael F Cohen

    2015-07-01

    Full Text Available In the genus Azolla rapid abscission of roots from floating fronds occurs within minutes in response to a variety of stresses, including exposure to nitrite. We found that hydrogen peroxide, though itself not an inducer of root abscission, modulates nitrite-induced root abscission by Azolla pinnata in a dose-dependent manner, with 2 mM H2O2 significantly diminishing the responsiveness to 2 mM NaNO2, and 10 mM H2O2 slightly enhancing it. Hypoxia, which has been found in other plants to result in autogenic production of H2O2, dramatically stimulated root abscission of A. pinnata in response to nitrite, especially for plants previously cultivated in medium containing 5 mM KNO3 compared to plants cultivated under N2-fixing conditions without combined nitrogen. Plants, including Azolla, produce the small signaling molecule nitric oxide (NO from nitrite using nitrate reductase. We found Azolla plants to display dose-dependent root abscission in response to the NO donor spermine NONOate. Treatment of plants with the thiol-modifying agents S-methyl methanethiosulfonate or glutathione inhibited the nitrite-induced root abscission response. Synchrotron radiation-based Fourier transform infrared (SR-FTIR spectromicroscopy revealed higher levels of carbonylation in the abscission zone of dropped roots, indicative of reaction products of polysaccharides with potent free radical oxidants. We hypothesize that metabolic products of nitrite and NO react with H2O2 in the apoplast leading to free-radical-mediated cleavage of structural polysaccharides and consequent rapid root abscission.

  8. Salinity-induced inhibition of growth in the aquatic pteridophyte Azolla microphylla primarily involves inhibition of photosynthetic components and signaling molecules as revealed by proteome analysis.

    Science.gov (United States)

    Thagela, Preeti; Yadav, Ravindra Kumar; Mishra, Vagish; Dahuja, Anil; Ahmad, Altaf; Singh, Pawan Kumar; Tiwari, Budhi Sagar; Abraham, Gerard

    2017-01-01

    Salinity stress causes adverse physiological and biochemical changes in the growth and productivity of a plant. Azolla, a symbiotic pteridophyte and potent candidate for biofertilizer due to its nitrogen fixation ability, shows reduced growth and nitrogen fixation during saline stress. To better understand regulatory components involved in salinity-induced physiological changes, in the present study, Azolla microphylla plants were exposed to NaCl (6.74 and 8.61 ds/m) and growth, photochemical reactions of photosynthesis, ion accumulation, and changes in cellular proteome were studied. Maximum dry weight was accumulated in control and untreated plant while a substantial decrease in dry weight was observed in the plants exposed to salinity. Exposure of the organism to different concentrations of salt in hydroponic conditions resulted in differential level of Na(+) and K(+) ion accumulation. Comparative analysis of salinity-induced proteome changes in A. microphylla revealed 58 salt responsive proteins which were differentially expressed during the salt exposure. Moreover, 42 % spots among differentially expressed proteins were involved in different signaling events. The identified proteins are involved in photosynthesis, energy metabolism, amino acid biosynthesis, protein synthesis, and defense. Downregulation of these key metabolic proteins appears to inhibit the growth of A. microphylla in response to salinity. Altogether, the study revealed that in Azolla, increased salinity primarily affected signaling and photosynthesis that in turn leads to reduced biomass.

  9. Genetic Characterization of Old Grapevines collected in Oases of the Atacama Desert Caracterización Genética de Vides Antiguas colectadas en Oasis del Desierto de Atacama

    Directory of Open Access Journals (Sweden)

    Ingrid Poblete

    2011-09-01

    variantes génicas que pueden ser rescatadas para su uso directo o su incorporación en programas de fitomejoramiento. La primera etapa de este rescate es la colecta y caracterización del germoplasma propio de una región particular. Este estudio describe la caracterización genética de 21 accesiones de vid colectadas en el desierto de Atacama, en el Norte de Chile. La caracterización se basó en 12 marcadores de microsatélites (SSR, complementado con marcadores de tipo fragmentos amplificados de largo variable (AFLP. La mayoría de las accesiones colectadas con bayas negras corresponden al genotipo ‘País’, un cultivar antiguo que se encuentra distribuido en toda América. Sin embargo, entre las accesiones de baya negra, una de ellas mostró un fenotipo abortivo severo (22S7, y otro (6S4 difirió en un alelo con respecto a ‘País’. Ambos podrían ser ejemplos de mutaciones somáticas, aun cuando no fue posible detectar variaciones en sus patrones de AFLP. Por otra parte, la única accesión con bayas negras que exhibió características genéticas diferentes a ‘País’ correspondió a ‘Gros Colman’ (5CN, un genotipo supuestamente proveniente de Georgia, Rusia, introducido en esta región a mediados del siglo XX. Una mayor diversidad genética fue detectada entre las accesiones de bayas blancas y rosadas, que se clasificaron en cinco clados en base a sus alelos de microsatélites. De estos genotipos, 11Si se identificó como ‘Emperatriz’ o ‘Red Seedless’, una variedad de origen argentino, mientras que las accesiones 16H1 y 17H2 correspondieron a un cruzamiento de ‘Moscatel de Alejandría’ × ‘País’. Por último, la accesión 20S5 se identificó como ‘Ahmeur bou Ahmeur’, un genotipo argelino de bayas de color rosado. Dos genotipos semillados de bayas blancas, pequeñas o grandes, no se asimilaron con alguna variedad conocida. Se discute también la posibilidad de utilizar algunas de estas accesiones en fitomejoramiento, para aumentar

  10. EFECTO DE LA INCORPORACIÓN DEL ABONO VERDE Azolla sp. EN LA REDUCCIÓN DE LOS DAÑOS CAUSADOS POR FITONEMATODOS EN CULTIVOS DE ORGANOPÓNICOS

    Directory of Open Access Journals (Sweden)

    R. Castro

    2009-01-01

    productores de agallas pertenecientes al género Meloidogyne sp., en los cuales se incorporó Azolla sp. como abono verde a razón de 2 kg.m-2. Los resultados mostraron que la incorporación del helecho Azolla sp. redujo significativamente los daños por nematodos fitoparásitos e incrementó a su vez los rendimientos de cultivos, tales como pepino, remolacha, zanahoria, tomate, acelga y lechuga. En este último cultivo, se comprobó que las agallas en las raíces se redujeron significativamente durante dos cosechas consecutivas.

  11. Role of certain environmental factors on cadmium uptake and toxicity in Spirodela polyrhiza (L.) Schleid. and Azolla pinnata R. Br.

    Science.gov (United States)

    Gaur, J P; Noraho, N

    1995-09-01

    Effects of pH, temperature, EDTA and photosynthetically available radiation on the uptake and toxicity of Cd was investigated in Spirodela polyrhiza (L.) Schleid. and Azolla pinnata R. Br. In general, Cd toxicity was accentuated in conditions which favoured enhanced intracellular Cd uptake. Extracellular binding and intracellular uptake of Cd were lowered at pH values > 7 due to reduced availability of the aquo ion; consequently, toxicity was markedly reduced. At pH value 99%) remains available as the aquo ion. The presence of EDTA in the medium decreased extracellular binding, intracellular uptake and toxicity of Cd in test plants. This was due to formation of Cd-EDTA complex which was obviously not available to test plants. Elevation of temperature increased intracellular Cd uptake and this resulted in enhanced toxic effects. Similarly, increase in photosynthetically available radiation caused a slight increase in Cd uptake and toxicity in test plants. Obviously, rise in temperature or PAR increased metabolic activities of test plants thereby leading to increased Cd transport and toxicity.

  12. Separation of toxic rhodamine B from aqueous solution using an efficient low-cost material, Azolla pinnata, by adsorption method.

    Science.gov (United States)

    Kooh, Muhammad Raziq Rahimi; Lim, Linda B L; Lim, Lee Hoon; Dahri, Muhammad Khairud

    2016-02-01

    This study investigated the potential of untreated Azolla pinnata (AP) to remove toxic rhodamine B (RB) dye. The effects of adsorbent dosage, pH, ionic strength, contact time, and concentration were studied. Experiments involving the effects of pH and ionic strength indicated that hydrophobic-hydrophobic interactions might be the dominant force of attraction for the RB-AP adsorption system. The kinetics modelling of the kinetics experiment showed that pseudo-second-order best represented the adsorption process. The Weber-Morris intraparticle diffusion model showed that intraparticle diffusion is not the rate-limiting step, while the Boyd model suggested that film diffusion might be rate-limiting. The adsorption isotherm model, Langmuir, best represented the adsorption process, and the maximum adsorption capacity was predicted to be 72.2 and 199.7 mg g(-1) at 25 and 65 °C, respectively. Thermodynamics study indicates spontaneity, endothermic and physisorption-dominant adsorption process. The adsorbents were regenerated to satisfactory level with distilled water, HNO3 and NaOH. Pre-treatment of adsorbent with oxalic acid, citric acid, NaOH, HCl and phosphoric acid was investigated but the adsorption capacity was less than the untreated AP.

  13. Interactive effects of herbicide and enhanced UV-B on growth, oxidative damage and the ascorbate-glutathione cycle in two Azolla species.

    Science.gov (United States)

    Prasad, Sheo Mohan; Kumar, Sushil; Parihar, Parul; Singh, Rachana

    2016-11-01

    A field experiment was conducted to investigate the impact of alone and combined exposures of herbicide pretilachlor (5, 10 and 20μgml(-1)) and enhanced UV-B radiation (UV-B1; ambient +2.2kJm(-2) day(-1) and UV-B2; ambient +4.4kJm(-2) day(-1)) on growth, oxidative stress and the ascorbate-glutathione (AsA-GSH) cycle in two agronomically important Azolla spp. viz., Azolla microphylla and Azolla pinnata. Decreased relative growth rate (RGR) in both the species under tested stress could be linked to enhanced oxidative stress, thus higher H2O2 accumulation was observed, that in turn might have caused severe damage to lipids and proteins, thereby decreasing membrane stability. The effects were exacerbated when spp. were exposed to combined treatments of enhanced UV-B and pretilachlor. Detoxification of H2O2 is regulated by enzymes/metabolites of AsA-GSH cycle such as ascorbate peroxidase (APX) and glutathione reductase (GR) activity that were found to be stimulated. While, dehydroascorabte reductase (DHAR) activity, and the amount of metabolites: ascorbate (AsA), glutathione (GSH) and ratios of reduced/oxidized AsA (AsA/DHA) and GSH (GSH/GSSG), showed significant reduction with increasing doses of both the stressors, either applied alone or in combination. Glutathione-S-transferase (GST), an enzyme involved in scavenging of xenobiotics, was found to be stimulated under the tested stress. This study suggests that decline in DHAR activity and in AsA/DHA ratio might have led to enhanced H2O2 accumulation, thus decreased RGR was noticed under tested stress in both the species and the effect was more pronounced in A. pinnata. Owing to better performance of AsA-GSH cycle in A. microphylla, this study substantiates the view that A. microphylla is more tolerant than A. pinnata.

  14. Comparative assessment of Azolla pinnata and Vallisneria spiralis in Hg removal from G.B. Pant Sagar of Singrauli Industrial region, India.

    Science.gov (United States)

    Rai, Prabhat Kumar; Tripathi, B D

    2009-01-01

    The aim of the present work was to monitor the Hg pollution in water and sediments of G.B. Pant Sagar located in Singrauli Industrial Region, India and to suggest the efficient aquatic plants for its phytoremediation. The study assessed the comparative potential of a free floating water fern Azolla pinnata and submerged aquatic macrophyte Vallisneria spiralis to purify waters polluted by Hg. Six days laboratory experiments have been conducted to mark the percentage removal of Hg at initial concentration of 0.1, 0.5, 1.0 and 3.0 mg L(-1). The percentage removal of Hg was higher for A. pinnata (80-94%) than V. spiralis (70-84%). Likewise, the Hg accumulated in dry mass was much higher for A. pinnata and a high correlation (R(2) = 0.91 for A. pinnata and 0.99 for V. spiralis) was obtained between applied Hg doses and accumulated amounts in biomass. A concentration dependent decrease in chlorophyll a, protein, RNA, DNA and nutrients (NO(3-) and PO(4)(3-)) uptake was detected in A. pinnata and V. spiralis due to Hg toxicity. The decrease was more prominent in Azolla than Vallisneria. The results recommended the use of A. pinnata and V. spiralis to ameliorate the industrial effluents (thermal power, chlor-alkali and coal mine effluent) contaminated with Hg.

  15. Effect of the plant Azolla pinnata on survival, growth rate, fecundity and hatchability of egg-masses of Biomphalaria alexandrina snails.

    Science.gov (United States)

    Abdel Hafez, A M; Zidan, Z H; Abdel-Megeed, M I; el-Emam, M A; Ragab, F M; el-Deeb, F A

    1997-12-01

    Data indicated that Azolla pinnata plants variously reduce the growth rate of Biomphalaria alexandrina snails expressed as net increase in shell diameter (direct or indirect exposure). The plant density played an important role in this respect. The higher the plant density was the lower the growth rate and vice versa. Too, indirect exposure of newly hatched B. alexandrina resulted from exposed treated eggs reduced the growth rate of these snails. Data revealed that direct and/or indirect exposure to the abnormal high density (50,000 plants/L) resulted in complete kill of B. alexandrina snails after two weeks from continuous exposure. Snails exposed directly to Azolla at 50,000 and 25,000 plants/L failed to lay eggs. On the other hand, sanils exposed to 10,000 plants/L laid few eggs, resulted in low reproductive rate (57.94) compared with unexposed ones (110.6). The same trend of results was recorded with hatchability of Biomphalaria eggs.

  16. Spatial and temporal regulation of nucleating sites for arrays of cortical microtubules in root tip cells of the water fern Azolla pinnata.

    Science.gov (United States)

    Gunning, B S

    1980-12-01

    Root primordia of the water fern Azolla pinnata were examined by conventional and high voltage electron microscopy to extend previous evidence concerning the existence and behaviour of nucleating sites (NS) for microtubule arrays in the cortex of plant cells. Putative NS are visible as foci consisting of clusters of microtubules, a population of particles or vesicles and associated dense material. They are concentrated along the edges of the cells but become conspicuous only when cortical arrays are being generated, i.e. at the early post-cytokinesis phase when interphase arrays are being reinstated and when pre-prophase bands are forming. Examples of temporal regulation during the cell cycle are documented. The predictable anatomy of the Azolla root allows specified edges of cells to be examined in successive cell cycles. The NS first appear at a newly generated edge (where one of the walls that meet at the edge is derived from a new cell plate) and reappear after cytokinesis at that same edge in later cycles, irrespective of the plane of division, when it is no longer newly formed but one, two or more cell cycles old. All of the edges of a cell, whether radial, longitudinal, or tangential, have the potential to develop NS but a strong element of selectivity appears to be imposed. The possible role of the system of NS in microtubule development and overall morphogenesis in the root is discussed.

  17. Physiological Effects of Lanthanum on Cyanobacterium Anabaena azollae%稀土元素镧对满江红鱼腥藻的生理影响

    Institute of Scientific and Technical Information of China (English)

    宋凌云; 胡文月; 赵继贞; 邵宏翔; 张昀

    2000-01-01

    对稀土元素镧(La)对满江红鱼腥藻(Anabaena azollae)的生理影响和满江红鱼腥藻对镧的富集作用进行了研究.结果显示低浓度镧对满江红鱼腥藻生长表现出促进作用,高浓度则表现出抑制作用.镧对满江红鱼腥藻的叶绿素a的合成、光合放氧活性也有影响,同样表现为低浓度促进,高浓度抑制.满江红鱼腥藻对镧的富集作用可能与其光合作用电子传递和能量合成有关.

  18. THE GENETIC DIVERSITY OF ANABAENA AZOLLAE BASED ON RAPD ANALYSIS%满江红鱼腥藻遗传多样性的RAPD分析

    Institute of Scientific and Technical Information of China (English)

    陈坚; 郑伟文; 宋铁英; 徐国忠; 唐龙飞

    2001-01-01

    @@共生在水生蕨类植物满江红(又称“红萍”:Azolla)叶腔中的固氮兰细菌曾被认为是一个种满江红鱼腥藻(Anabaena azollae Strasb.)。但由于现存的满江红在分类学上有2个亚属,7个种[1],对不同满江红叶腔中鱼腥藻的鉴别,多年来引起人们的重视。80年代,鱼腥藻的单克隆抗体和RFLP的研究,发现了它与宿主分类上一定程度的对应关系[2,3]。90年代以后,Van Coppenolle和Eskew分别以RAPD-PCR和DAF-PCR对从满江红共生体中提取的DNA进行了分析[4,5],但后者发现了共生体中藻的DNA对整个PCR产物的干扰作用会影响满江红属本身系统分类。近年来对满江红鱼腥藻的脂肪酸组分,nif基因RFLP和STRR序列PCR产物指纹分析,建立了各自的聚类分支图[6—8],其间的结果有所差异。为此作者对征集的16种不同种属和地域来源的满江红叶腔中分离出来的鱼腥藻进行了RAPD分析,探讨了满江红鱼腥藻的遗传多样性。

  19. The simulation model of growth and cell divisions for the root apex with an apical cell in application to Azolla pinnata.

    Science.gov (United States)

    Piekarska-Stachowiak, Anna; Nakielski, Jerzy

    2013-12-01

    In contrast to seed plants, the roots of most ferns have a single apical cell which is the ultimate source of all cells in the root. The apical cell has a tetrahedral shape and divides asymmetrically. The root cap derives from the distal division face, while merophytes derived from three proximal division faces contribute to the root proper. The merophytes are produced sequentially forming three sectors along a helix around the root axis. During development, they divide and differentiate in a predictable pattern. Such growth causes cell pattern of the root apex to be remarkably regular and self-perpetuating. The nature of this regularity remains unknown. This paper shows the 2D simulation model for growth of the root apex with the apical cell in application to Azolla pinnata. The field of growth rates of the organ, prescribed by the model, is of a tensor type (symplastic growth) and cells divide taking principal growth directions into account. The simulations show how the cell pattern in a longitudinal section of the apex develops in time. The virtual root apex grows realistically and its cell pattern is similar to that observed in anatomical sections. The simulations indicate that the cell pattern regularity results from cell divisions which are oriented with respect to principal growth directions. Such divisions are essential for maintenance of peri-anticlinal arrangement of cell walls and coordinated growth of merophytes during the development. The highly specific division program that takes place in merophytes prior to differentiation seems to be regulated at the cellular level.

  20. Effets de l'alimentation des poissons avec Azolla sur la production d'un écosystème agro-piscicole en zones marécageuses au Rwanda

    Directory of Open Access Journals (Sweden)

    Kanangire, CK.

    2002-01-01

    Full Text Available Effects of Azolla-based Meal on the Production of an Agro-piscicultural Ecosystem in Rwanda Marshlands. Cette étude analyse les différences de caractères au niveau de la descendance des croisements interspécifiques entre Sesamum indicum L. et Ceratotheca sesamoides Endl. Les résultats obtenus montrent que l'héritabilité de la présence d'une forte pilosité sur les tiges et sur les pétioles est contrôlée par deux gènes assortis et indépendants. Les deux gènes dominants S et P confèrent aux plantes une importante pilosité sur les tiges et sur les pétioles tandis qu'un allèle dominant S-pp et ss-P confère aux plantes une pilosité respectivement abondante sur les tiges st sur les pétioles. Seuls les génotypes homozygotes sspp avec deux gènes récessifs produisent des plantes avec peu de poils sur les tiges et sur les pétioles. Les implications de ces résultats dans l'évolution de ces espèces sont discutées.

  1. 镉诱导满江红(Azolla imbricata)花色素苷的初步鉴定、抗氧化活性及其作用机理%Preliminary identification, antioxidant activity and mechanism of anthocyanins from Azolla imbricata induced by cadmium

    Institute of Scientific and Technical Information of China (English)

    戴灵鹏; 董新姣; 马海虎; 盛丽梅

    2011-01-01

    In order to study the molecular structure of the anthocyanins which are induced by Cd in Azolla imbricata, anthocyanins were induced with 0.1mg·L-1 Cd, extracted with 0.1% HCI in methanol, purified by an Amberlite XAD-7 column and separated by Sephedex LH-20 column. The main compound was preliminarily identified as luteolinidin- 5-glucoside by its ultraviolet/visible absorbance spectrum and high performance liquid ( HPLC )chromatography. In vitro antioxidant properties of anthocyanins before and after purification were also evaluated by different analytical methods. The results showed that the total antioxidant capacity, reducing power, scavenging activity of superoxide anion radical (O2 - )and hydroxyl radical ( · OH )increased significantly with increasing concentrations of anthocyanin extracts, and the antioxidant activity of anthocyanins after purification was higher than the values of anthocyanins before purification. When the concentration of anthocyanins reached 0. 5 mg · mL-1, the values of anthocyanins after purification were increased by 3.16,1.36,2.71 and 1.86 times respectively, compared to anthocyanins before purification, indicating that luteolinidin-5-glucoside was the most important substance responsible for the antioxidant properties of A. imbricata. In addition, the antioxidant mechanism of anthocyanins is also discussed in this paper. In conclusion, the results obtained in this work indicated that the increase in the content of anthocyanins may be involved in internal detoxification mechanisms of A. imbricata against Cd toxicity.%为了研究镉诱导的满江红花色素苷的分子结构,分别用0.1 mg·L-1Cd、0.1%盐酸-甲醇溶液、XAD-7大孔树脂和葡聚糖凝胶SephadexLH-20柱对其进行诱导、提取、纯化和分离.经紫外可见光谱特性和HPLC图谱分析.初步确定此物质为木犀草定-5-葡萄糖苷.采用不同的体外实验方法评价了满江红花色素苷纯化前后的抗氧化活性.结果表明,花

  2. Estudios sobre hongos tropicales. Algunas especies colectadas en Ecuador y Guatemala.

    OpenAIRE

    Calonge, F. D.; Moreno-Arroyo, B.; Gómez, J.

    2008-01-01

    [EN] Seven species are described in this article, among which three ofthem are worthy to stand out for their rarity in the world: Bovista cf. trachyspora, Radiigera paulensis and Scleroderma leptopodium. Notes on their taxonomy and chorology are also added.

  3. Effect of arsenic on reflectance spectra and chlorophyll fluorescence of aquatic plants.

    Science.gov (United States)

    Iriel, Analia; Dundas, Gavin; Fernández Cirelli, Alicia; Lagorio, Maria G

    2015-01-01

    Arsenic pollution of groundwater is a serious problem in many regions of Latin America that causes severe risks to human health. As a consequence, non-destructive monitoring methodologies, sensitive to arsenic presence in the environment and able to perform a rapid screening of large polluted areas, are highly sought-after. Both chlorophyll - a fluorescence and reflectance of aquatic plants may be potential indicators to sense toxicity in water media. In this work, the effects of arsenic on the optical and photophysical properties of leaves of different aquatic plants (Vallisneria gigantea, Azolla filiculoides and Lemna minor) were evaluated. Reflectance spectra were recorded for the plant leaves from 300 to 2400 nm. The spectral distribution of the fluorescence was also studied and corrected for light re-absorption processes. Photosynthetic parameters (Fv/Fm and ΦPSII) were additionally calculated from the variable chlorophyll fluorescence recorded with a pulse amplitude modulated fluorometer. Fluorescence and reflectance properties for V. gigantea and A. filiculoides were sensitive to arsenic presence in contrast to the behaviour of L. minor. Observed changes in fluorescence spectra could be interpreted in terms of preferential damage in photosystem II. The quantum efficiency of photosystem II for the first two species was also affected, decreasing upon arsenic treatment. As a result of this research, V. gigantea and A. filiculoides were proposed as bioindicators of arsenic occurrence in aquatic media.

  4. Potential of some aquatic plants for removal of arsenic from wastewater by green technology

    Directory of Open Access Journals (Sweden)

    Mohammed Barznji Dana A.

    2015-03-01

    Full Text Available Phytoremediation or green technology is counted among the successful and effective biological contaminated water treatment techniques. Basically, the concept of this green, cost-effective, simple, environmentally nondisruptive method consists in using plants and microbiological processes to reduce contaminants in the ecosystem. Different species from aquatic plants (emerged, free-floating, and submerged have been studied to mitigate toxic contaminants such as arsenic, cadmium, chromium, copper, lead, mercury, zinc, etc. Arsenic is one of the most severe toxic elements; it is widely distributed in the environment, usually found in combination with chloride, oxygen, sulphur and metal ions as a result of mineral dissolution from sedimentary or volcanic rocks and the dilution of geothermal water. The effluents from both industrial and agricultural sectors are also regarded as sources to contaminate water. From the accumulation point of view, several aquatic plants have been mentioned as good arsenic accumulators and their performance is evaluated using the green technology method. These include Spirodela polyrhiza, Wolffia globosa, Lemna gibba, L. minor, Eichhornia crassipes, Azolla caroliniana, Azolla filiculoides, Azolla pinnata, Ceratophyllum demersum and Pistia stratiotes. The up-to-date information illustrated in this review paper generates knowledge about the ability of some common aquatic plants around the globe to remediate arsenic from contaminated water.

  5. Aquatic macrophytes can be used for wastewater polishing but not for purification in constructed wetlands

    Science.gov (United States)

    Tang, Yingying; Harpenslager, Sarah F.; van Kempen, Monique M. L.; Verbaarschot, Evi J. H.; Loeffen, Laury M. J. M.; Roelofs, Jan G. M.; Smolders, Alfons J. P.; Lamers, Leon P. M.

    2017-02-01

    The sequestration of nutrients from surface waters by aquatic macrophytes and sediments provides an important service to both natural and constructed wetlands. While emergent species take up nutrients from the sediment, submerged and floating macrophytes filter nutrients directly from the surface water, which may be more efficient in constructed wetlands. It remains unclear, however, whether their efficiency is sufficient for wastewater purification and how plant species and nutrient loading affects nutrient distribution over plants, water and sediment. We therefore determined nutrient removal efficiencies of different vegetation (Azolla filiculoides, Ceratophyllum demersum and Myriophyllum spicatum) and sediment types (clay, peaty clay and peat) at three nutrient input rates, in a full factorial, outdoor mesocosm experiment. At low loading (0.43 mg P m-2 d-1), plant uptake was the main pathway (100 %) for phosphorus (P) removal, while sediments showed a net P release. A. filiculoides and M. spicatum showed the highest biomass production and could be harvested regularly for nutrient recycling, whereas C. demersum was outcompeted by spontaneously developing macrophytes and algae. Higher nutrient loading only stimulated A. filiculoides growth. At higher rates ( ≥ 21.4 mg P m-2 d-1), 50-90 % of added P ended up in sediments, with peat sediments becoming more easily saturated. For nitrogen (N), 45-90 % was either taken up by the sediment or lost to the atmosphere at loadings ≥ 62 mg N m-2 d-1. This shows that aquatic macrophytes can indeed function as an efficient nutrient filter but only for low loading rates (polishing) and not for high rates (purification). The outcome of this controlled study not only contributes to our understanding of nutrient dynamics in constructed wetlands but also shows the differential effects of wetland sediment types and plant species. Furthermore, the acquired knowledge may benefit the application of macrophyte harvesting to remove

  6. Genome erosion in a nitrogen-fixing vertically transmitted endosymbiotic multicellular cyanobacterium.

    Directory of Open Access Journals (Sweden)

    Liang Ran

    Full Text Available BACKGROUND: An ancient cyanobacterial incorporation into a eukaryotic organism led to the evolution of plastids (chloroplasts and subsequently to the origin of the plant kingdom. The underlying mechanism and the identities of the partners in this monophyletic event remain elusive. METHODOLOGY/PRINCIPAL FINDINGS: To shed light on this evolutionary process, we sequenced the genome of a cyanobacterium residing extracellularly in an endosymbiosis with a plant, the water-fern Azolla filiculoides Lam. This symbiosis was selected as it has characters which make it unique among extant cyanobacterial plant symbioses: the cyanobacterium lacks autonomous growth and is vertically transmitted between plant generations. Our results reveal features of evolutionary significance. The genome is in an eroding state, evidenced by a large proportion of pseudogenes (31.2% and a high frequency of transposable elements (approximately 600 scattered throughout the genome. Pseudogenization is found in genes such as the replication initiator dnaA and DNA repair genes, considered essential to free-living cyanobacteria. For some functional categories of genes pseudogenes are more prevalent than functional genes. Loss of function is apparent even within the 'core' gene categories of bacteria, such as genes involved in glycolysis and nutrient uptake. In contrast, serving as a critical source of nitrogen for the host, genes related to metabolic processes such as cell differentiation and nitrogen-fixation are well preserved. CONCLUSIONS/SIGNIFICANCE: This is the first finding of genome degradation in a plant symbiont and phenotypically complex cyanobacterium and one of only a few extracellular endosymbionts described showing signs of reductive genome evolution. Our findings suggest an ongoing selective streamlining of this cyanobacterial genome which has resulted in an organism devoted to nitrogen fixation and devoid of autonomous growth. The cyanobacterial symbiont of Azolla

  7. Early and Middle Pleistocene vegetation history of the Médoc region, southwest France

    Science.gov (United States)

    O'Brien, C. E.; Jones, R. L.

    2003-09-01

    Pleistocene deposits, together with their pollen, plant macrofossil, foraminiferal, dinoflagellate and coleopteran remains, from five sites along the Atlantic coast of the Médoc Peninsula are described and discussed. Sediments making up the Négade Formation are shown to have been laid down under either estuarine or lagoonal conditions when closed Quercus-Pinus-Tsuga canadensis regional woodland existed. Comparison with plant records from The Netherlands indicates that these deposits are most likely attributable to either the Early Pleistocene Bavel Interglacial (marine oxygen isotope stage (MIS) 31), or an interglacial of the Waalian (MIS 37-49) or Tiglian (MIS 63-79). In addition, clays assigned to the Argiles du Gurp sensu stricto, were similarly deposited in either an estuary or lagoon, which subsequently was cut off from the sea. A freshwater lake with vegetation dominated by Azolla filiculoides then developed. This was succeeded by reedswamp and an organic mud (termed Lignite in the corresponding French stratigraphical records) formed. Regional Quercus-Abies woodland was replaced by one with Pinus dominant and Pterocarya a minor component. Comparison with plant records from France and other parts of Europe suggest that the clays and organic mud might be correlated with the Holsteinian (Praclaux) Interglacial (MIS 11c). Copyright

  8. Evolutionary Conservation of ABA Signaling for Stomatal Closure in Ferns.

    Science.gov (United States)

    Cai, Shengguan; Chen, Guang; Wang, Yuanyuan; Huang, Yuqing; Marchant, Blaine; Wang, Yizhou; Yang, Qian; Dai, Fei; Hills, Adrian; Franks, Peter J; Nevo, Eviatar; Soltis, Doug; Soltis, Pamela; Sessa, Emily; Wolf, Paul G; Xue, Dawei; Zhang, Guoping; Pogson, Barry J; Blatt, Mike R; Chen, Zhong-Hua

    2017-02-23

    ABA-driven stomatal regulation reportedly evolved after the divergence of ferns, during the early evolution of seed plants approximately 360 Mya. This hypothesis is based on the observation that the stomata of certain fern species are unresponsive to ABA, but exhibit passive hydraulic control. However, ABA-induced stomatal closure was detected in some mosses and lycophytes. Here, we observed that a number of ABA signaling and membrane transporter protein families diversified over the evolutionary history of land plants. The aquatic ferns Azolla filiculoides and Salvinia cucullata have representatives of 23 families of proteins orthologous to those of Arabidopsis thaliana and all other land plant species studied. Phylogenetic analysis of the key ABA signaling proteins indicates an evolutionarily conserved stomatal response to ABA. Moreover, comparative transcriptomic analysis has identified a suite of ABA responsive genes that differentially expressed in a terrestrial fern species, Polystichum proliferum. These genes encode proteins associated with ABA biosynthesis, transport, reception, transcription, signaling, and ion and sugar transport, which fit the general ABA signaling pathway constructed from Arabidopsis thaliana and Hordeum vulgare. The retention of these key ABA-responsive genes could have had a profound effect on the adaptation of ferns to dry conditions. Furthermore, stomatal assays have shown the primary evidence for ABA-induced closure of stomata in two terrestrial fern species P. proliferum and Nephrolepis exaltata. In summary, we report new molecular and physiological evidence for the presence of active stomatal control in ferns.

  9. Pengaruh lama waktu pengomposan kiambang (Azolla Pinnata) terhadap kadar C-Organik, N, P, dan K

    OpenAIRE

    Sinaga, Judika Meylisza

    2013-01-01

    A research about the effect of Kiambang’s decomposition time on C-Organic, Nitrogen, Phosfor, and Kalium level has been carried out. The sample was taken from Liberia village and was cut into small pieces, then start the decomposition process with adding the EM4 bacteria and varying the decomposition time with interval 3 days. The C-Organic was determined by Walkey Black method, Nitrogen with Kjeldahl method, Phosfor with UV-Visible Spectrophotometer, and Potassium with Atomic Absorption Spec...

  10. Adsorption and uptake of cadmium by Azolla pinnata: kinetics of inhibition by cations.

    Science.gov (United States)

    Gaur, J P; Noraho, N

    1995-06-01

    A. pinnata showed a remarkable ability of taking up Cd from the external medium. Of the total Cd taken up by the test plant, surface adsorption was about 90%. Cd adsorption did not occur at a constant rate, however, an equilibrium was reached in 2 h. The uptake of Cd occurred at a constant rate. Test cations, including heavy metals (Ca, Mg, K, Na, Ni, Fe, Cu and Zn), inhibited adsorption as well as uptake of Cd. Cd adsorption was competitively inhibited by Cu, Fe and Zn, whereas Ca, Mg, K, Na and Ni caused non-competitive inhibition. Similarly, Cd uptake was competitively (Ca, Mg, Fe) or non-competitively (Na, K, Ni, Zn) inhibited by cations. Inhibition of Cd uptake by Cu was not wholly competitive.

  11. Adsorption and Uptake of Cadmium by Azolla pinnata:Kinetics of Inhibition by Cations

    Institute of Scientific and Technical Information of China (English)

    J.P.GAUR; N.NORAHO

    1995-01-01

    A.pinnata showed a remarkable ability of taking up Cd from the external medium.Of the total Cd taken up by the test plant,surface adsorption was about 90%.Cd adsorption did not occur at a constant rate,however,an equilibrium was reached in 2h.The uptake of Cd occurred at a constant rate.Test cations.Including heavy metals(Ca,Mg,K,Na,Ni,F,Cu and Zn),inhibited adsorption as well as uptake of Cd.Cd adsorption was competitively inhibited by Cu,Fe and Zn,whereas Ca,Mg,K,Na and Ni caused non-competitive inhibition,Similarly,Cd uptake was competitively(Ca,Mg,Fe)or non-competitively(Na,K,Ni,Zn) inhibited by cations.Inhibition of Cd uptake by Cu was not wholly competitive.

  12. Aprovechamiento de desechos orgánicos: 1. Extracción y caracterización del aceite de semillas de naranja colectadas en expendios ambulantes de jugos

    Directory of Open Access Journals (Sweden)

    María Escalante

    2012-12-01

    Full Text Available The Soxhlet extraction, using n-hexane as solvent, of the orange seed oil from waste residues obtained in street sales of fruit juices of Merida, Venezuela, was studied. Yields of 5.1% oil (w/w and 42.7% (w/w relative to the initial mass of the residue and dry seeds, respectively, were obtained. The oil was subjected to a transesterification process with methanol and the main components of the mixture of methyl esters achieved were quantified by gas chromatography coupled to mass spectrometry (GC-MS, which turned out to be: linoleate (311%, oleate (311%, palmitate (303% and magnesium stearate (7.10.5%. The mixture of methyl esters was subjected to the hydrolysis reaction in aqueous alkaline medium yielding the respective acid mixture which, after a precipitation process in HCl aqueous solution and its re-crystallization in n-hexane, generated an acid mixture with a higher content of unsaturated acids.

  13. Tolerancia a la desecación y caracterización química de semillas de piñón mexicano (Jatropha curcas L.) colectadas en el Totonacapan.

    OpenAIRE

    Bautista Ramírez, Edgardo

    2011-01-01

    El piñón mexicano (Jatropha curcas L.) es una especie de vital importancia debido a su potencial utilitario como alternativa para la generación de biodiesel y alimenticio tanto humano como animal. Dado que es una especie a la que recientemente se le ha prestado atención, se carece de información para la conservación adecuada del germoplasma. Asimismo, se han encontrado colectas o genotipos que presentan altos niveles de compuestos que causan toxicidad. Con la finalidad de dar alternativas par...

  14. Contaminación y viabilidad de huevos de Toxocara spp. en suelo y heces colectadas en parques públicos, calles y perros en Toluca, México

    OpenAIRE

    Camilo Romero-Núñez; Selene Yañez-Arteaga; Germán David Mendoza-Martínez; Lilia Patricia Bustamante-Montes; Ninfa Ramírez-Durán

    2013-01-01

    Se realizó un estudio de contaminación y viabilidad de huevos de Toxocara spp, parásito zoonótico en la ciudad de Toluca, México, para lo cual se colectaron 2374 muestras de suelos de siete parques, 350 de suelo de jardines de casas, 199 heces de perros con propietario y 199 heces obtenidas de la vía pública en las áreas cercanas a los parques. En los parques, la conta- minación con Toxocara fue de 24,7% y la viabilidad de 73,3%, siendo menor en los jardines de casa (13,9 y 40,3%, respe...

  15. Fate of methane in aquatic systems dominated by free-floating plants.

    Science.gov (United States)

    Kosten, Sarian; Piñeiro, Marcia; de Goede, Eefje; de Klein, Jeroen; Lamers, Leon P M; Ettwig, Katharina

    2016-11-01

    Worldwide the area of free-floating plants is increasing, which can be expected to alter methane (CH4) emissions from aquatic systems in several ways. A large proportion of the CH4 produced may become oxidized below the plants due to the accumulation of CH4 as a result of a decrease in the diffusive water-atmosphere flux and the entrapment of part of the ebullitive CH4, in combination with suitable conditions for methane oxidizing (MOX) bacteria in the aerobic rhizosphere. We used a set of essays to test this hypothesis and to explore the effect of different densities for three widespread free-floating species: Azolla filiculoides, Salvinia natans, and Eichhornia crassipes. The gas exchange velocity, proportion of CH4 bubbles trapped by the plants, occurrence of radial oxygen loss from roots, and MOX rates on the roots were assessed. We subsequently used the outcome of these experiments to parameterize a simple model. With this model we estimated the proportion of the produced CH4 that is oxidized, for different plant species and different densities. We found that in a shallow (1 m) system up to 70% of the CH4 produced may become oxidized as a result of a strong decrease in gas exchange combined with high MOX activity of the rhizosphere microbiome. As floating plants also are likely to increase CH4 production by organic matter production, especially when their presence induces anaerobic conditions, the overall effect on CH4 emission will strongly depend on local conditions. This explains the contrasting effects of floating plants on CH4 emissions in literature as reviewed here. As the effect of floating plants on CH4 emissions, including the high MOX rates we show here, can be substantial, there is an urgent need to consider this impact when assessing greenhouse gas budgets.

  16. Desarrollo de una metodología in vitro para estimar la tasa de fermentación de los forrajes en el intestino grueso del cerdo

    Directory of Open Access Journals (Sweden)

    Leterme Pascal

    2005-12-01

    Full Text Available La metodología para estimar la tasa de fermentación de los forrajes se desarrolló en dos etapas. La primera, de digestibilidad enzimática, simula la digestión ocurrida en el estómago e intestino delgado, mediante el empleo de pepsina y pancreatina; en esta se determina la digestibilidad de la materia seca. La segunda etapa de fermentación simula la fermentación que ocurre en el intestino grueso utilizando como inóculo heces de cerdo; en esta se determina la cantidad de gas producido durante la fermentación de los forrajes y la degradación de la fibra detergente neutra (FDN. Las dos etapas presentaron buena repetibilidad en el tiempo. Abstract Develop of an in vitro methodology to determine the forages fermentation in to the large intestine. The methodology was developing in two phases. The first phase (enzymatic digestibility simulates the digestion occurred in the stomach and small intestine, by means of the employment of pepsin and pancreatin; and the digestibility of the dry matter is determined. The second phase (in vitro fermentation simulates the fermentation that occurs in the large intestine utilizing pig faeces; the quantity of gas produced during the fermentation of the feedstuff is determined and determine the degradation of neutral detergent fiber (NDF. All the phases show a good repeatability throw the time. Key words: digestibility in vitro, pigs, fermentación, forages (Azolla filiculoides, Xanthosoma saggitifolium, Morus alba, Trichanthera gigantea y Salvinia molesta.

  17. Protein (Cyanobacteria): 175822 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available agen triple helix repeat-containing protein 'Nostoc azollae' 0708 MRLIEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGEDGGEIFLMPYALCPMPYALCPMPYALCPMPYALCPMPYALCPMPYAQNQDFSHPNRESSVKLFSSVAPKP ...

  18. Protein (Cyanobacteria): 56219 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ndent nitrogenase family protein 'Nostoc azollae' 0708 MKVFESTTKKIFFASSVSLHEAETKKADVSQLQVSYSQSAWNFLRPFRDWLDNLKVGDRQFAHRLCQLIPAQCPFERDVKLFGKTLFHIPPMCKLNPLYEEVVALRFRALCYLADECGEDISQYC ...

  19. CHOICE OF MACROPHYTE SUBSTRATE IN THE USE OF DIATOMS AS INDICATORS OF POND WATER QUALITY ASSESSMENT: PRELIMINARY DATA ON THE CASE OF ALALAY POND (COCHABAMBA, BOLIVIA

    Directory of Open Access Journals (Sweden)

    Eduardo A. Morales

    2012-06-01

    Full Text Available Alalay Pond is a 230-hectare, shallow aquatic ecosystem within Cochabamba, the third largest city in Bolivia. With the aim to determine the suitability of epiphytic diatoms for water quality assessment in the pond and to choose a substrate that would hold a representative bioindicator epiphytic community, the macrophytes Schoenoplectus californicus subsp. tatora (Kunth T. Koyama, Typha dominguensis Pers., Myriophyllum verticillatum L. and Azolla filiculoides Lam. were selected and differences in diatom community composition and structure were tested. Diatoms were collected during four sampling campaigns in the March-September, 2011 period, from three stations contiguous to the pelagic zone and prepared for analysis using standard, internationally used protocols. In all, 27 samples were collected from which 28 taxa characteristic of eutrophic environments were identified and 17 others could not be assigned names from the literature. Although many of the species are shared among sampling sites, the epiphytic communities developing at each station were different in structure and composition. Although, there are marked temporal variations in community features on each of the macrophytes, Shannon-Wiener and Pielou indexes, as well as canonical correspondence analysis, showed no marked differences within a single campaign and station among the 4 macrophytes. Shifts in structure and composition are denoted less commonly by species replacement and more often by changes in percent relative abundance of dominant and rare species. Very few species are restricted to a station or seem to show strong preference for a particular substrate. Taking into account growth, structural and ecological characteristics, as well as some phenological features of the macrophytes, S. californicus subsp. tatora and T. dominguensis are the most suitable substrates for water quality assessments in the pond. As demonstrated by multivariate analyses, among-site and time

  20. NCBI nr-aa BLAST: CBRC-PCAP-01-1416 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1416 ref|ZP_03766346.1| hypothetical protein AazoDRAFT_3512 ['Nostoc azolla...e' 0708] gb|EEG03140.1| hypothetical protein AazoDRAFT_3512 ['Nostoc azollae' 0708] ZP_03766346.1 0.56 20% ...

  1. Cytokinin-induced promotion of root meristem size in the fern Azolla supports a shoot-like origin of euphyllophyte roots

    NARCIS (Netherlands)

    de Vries, Jan; Fischer, Angela Melanie; Roettger, Mayo; Rommel, Sophie; Schluepmann, Henriette; Bräutigam, Andrea; Carlsbecker, Annelie; Gould, Sven Bernhard

    2016-01-01

    The phytohormones cytokinin and auxin orchestrate the root meristem development in angiosperms by determining embryonic bipolarity. Ferns, having the most basal euphyllophyte root, form neither bipolar embryos nor permanent embryonic primary roots but rather an adventitious root system. This raises

  2. From phytoaccumulation to post-harvest use of water fern for landfill management.

    Science.gov (United States)

    Song, Uhram; Kim, Dae Won; Waldman, Bruce; Lee, Eun Ju

    2016-11-01

    We examined the potential of Azolla japonica as a remediating plant for leachate channels and post-accumulation use as fertilizer for landfill slope. The harvested biomass of Azolla after one month grown in leachate was 254% that of the initial biomass and the predicted annual harvestable biomass of Azolla using a growth model was 32 times that of the initial biomass. Na, Fe, Mn, Mg, and P were accumulated in Azolla at very high concentrations. Such rapid increase of biomass and high accumulation rates suggest that this plant could be an excellent remediating plant. The post-harvest use of Azolla as compost was studied for the management and use of phytoaccumulating Azolla. Metal contents of Azolla compost were below permissible limits for co-composting material. Nitrogen, organic matter, P, and Mg content of the Azolla compost improved the soil condition of the landfill and enhanced ecophysiological responses of the plants. The application of Azolla compost can improve management of sanitary landfills, including the restoration of vegetation. Considering its ease of harvesting, high accumulation rates, harvestable biomass and suitability for composting, Azolla can provide a suitable solution for sustainable management of leachate channels and landfill slopes.

  3. The omnipresent water fern

    NARCIS (Netherlands)

    Nierop, K.G.J.; Speelman, E.N.; de Leeuw, J.W.; Reichart, G.J.

    2011-01-01

    Several studies have reported the presence of large amounts of lignin in ubiquitously occurring species of the freshwater fern Azolla. Molecular analysis using flash pyrolysis and thermally assisted hydrolysis and methylation shows, however, that neither the leaves nor the roots of Azolla contain li

  4. NCBI nr-aa BLAST: CBRC-STRI-01-1723 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1723 ref|ZP_03763981.1| glycosyl transferase family 2 ['Nostoc azollae...' 0708] gb|EEG05547.1| glycosyl transferase family 2 ['Nostoc azollae' 0708] ZP_03763981.1 0.25 25% ...

  5. Mitigating yield-scaled greenhouse gas emissions through combined application of soil amendments: A comparative study between temperate and subtropical rice paddy soils

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Muhammad Aslam, E-mail: litonaslam@yahoo.com [Dept. of Environmental Science, Bangladesh Agricultural University, Mymensingh 2202 (Bangladesh); Dept. of Agricultural Chemistry, Gyeongsang National University, Jinju (Korea, Republic of); Division of Environmental Horticulture, Chiba University, Matsudo, Chiba 271-8510 (Japan); Kim, P.J., E-mail: pjkim@nongae.gsnu.ac.kr [Dept. of Agricultural Chemistry, Gyeongsang National University, Jinju (Korea, Republic of); Inubushi, K. [Division of Environmental Horticulture, Chiba University, Matsudo, Chiba 271-8510 (Japan)

    2015-10-01

    Effects of different soil amendments were investigated on methane (CH{sub 4}) and nitrous oxide (N{sub 2}O) emissions, global warming potential (GWP) and yield scaled GWPs in paddy soils of Republic of Korea, Japan and Bangladesh. The experimental treatments were NPK only, NPK + fly ash, NPK + silicate slag, NPK + phosphogypsum(PG), NPK + blast furnace slag (BFS), NPK + revolving furnace slag (RFS), NPK + silicate slag (50%) + RFS (50%), NPK + biochar, NPK + biochar + Azolla-cyanobacteria, NPK + silicate slag + Azolla-cyanobacteria, NPK + phosphogypsum (PG) + Azolla-cyanobacteria. The maximum decrease in cumulative seasonal CH{sub 4} emissions was recorded 29.7% and 32.6% with Azolla-cyanobacteria plus phospho-gypsum amendments in paddy soils of Japan and Bangladesh respectively, followed by 22.4% and 26.8% reduction with silicate slag plus Azolla-cyanobacteria application. Biochar amendments in paddy soils of Japan and Bangladesh decreased seasonal cumulative N{sub 2}O emissions by 31.8% and 20.0% respectively, followed by 26.3% and 25.0% reduction with biochar plus Azolla-cyanobacteria amendments. Although seasonal cumulative CH{sub 4} emissions were significantly increased by 9.5–14.0% with biochar amendments, however, global warming potentials were decreased by 8.0–12.0% with cyanobacterial inoculation plus biochar amendments. The maximum decrease in GWP was calculated 22.0–30.0% with Azolla-cyanobacteria plus silicate slag amendments. The evolution of greenhouse gases per unit grain yield (yield scaled GWP) was highest in the NPK treatment, which was decreased by 43–50% from the silicate slag and phosphogypsum amendments along with Azolla-cyanobacteria inoculated rice planted soils. Conclusively, it is recommended to incorporate Azolla-cyanobacteria with inorganic and organic amendments for reducing GWP and yield scaled GWP from the rice planted paddy soils of temperate and subtropical countries. - Highlights: • Azolla-cyanobacteria with organic and

  6. Azolla—A Model Organism for Plant Genomic Studies

    Institute of Scientific and Technical Information of China (English)

    Yin-LongQiu; JunYu

    2003-01-01

    The aquatic ferns of the genus Azolla are nitrogen-fixing plants that have great potentials in agricultural production and environmental conservation.Azolla in many aspects is qualified to serve as a model organism for genomic studies because of its importance in agriculture,its unique position in plant evolution,its symbiotic relationship with the N2-fixing cyanobacterium,Anabaena azollae,and its moderate-sized genome.The goals of this genome project are not only to understand the biology of the Azolla genome to promote its applications in biological research and agriculture practice but also to gain critical insights about evolution of plant genomes.Together with the strategic and technical improvement as well as cost reduction of DNA sequencing,the deciphering of their genetic code is imminent.

  7. Determinación de la estructura poblacional de litopenaeus vannamei mediante issrs a lo largo de la costa ecuatoriana

    OpenAIRE

    Fresneda Rodríguez, Adriana

    2003-01-01

    Determinación de la estructura poblacional de Litopenaeus vannamei mediante ISSRs a lo largo de la costa ecuatoriana Muestras de Litopenaeus vannamei fueron colectadas en siete localidades a lo largo de la costa ecuatoriana desde Esmeraldas hasta Machala.

  8. Effect of three polycyclic aromatic hydrocarbons on nodulation of Rhizobium tropici CIAT 899 on Phaseolus vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Paredes, Y.; Ferrera-Cerrato, R.; Alarcon, A.

    2009-07-01

    Polycyclic aromatic hydrocarbons (PAH) are ubiquitous organic pollutants that are considered toxic and carcinogenic compounds to living organisms. There us scarce information about the effect of PAH on symbiotic systems such as Azolla-Anabaena, arbuscular mycorrhizal fungi-plants, or legume-rhizobia. (Author)

  9. Arabidopsis CDS blastp result: AK067601 [KOME

    Lifescience Database Archive (English)

    Full Text Available to Nitrogen fixation protein nifU (SP:Q43885) {Anabaena azollae}; contains Pfam profile: PF01106 NifU-like domain 1e-74 ... ...AK067601 J013108O03 At5g49940.1 nitrogen fixation NifU-like family protein similar

  10. Arabidopsis CDS blastp result: AK071874 [KOME

    Lifescience Database Archive (English)

    Full Text Available to Nitrogen fixation protein nifU (SP:Q43885) {Anabaena azollae}; contains Pfam profile: PF01106 NifU-like domain 3e-52 ... ...AK071874 J023121E22 At5g49940.1 nitrogen fixation NifU-like family protein similar

  11. Arabidopsis CDS blastp result: AK060074 [KOME

    Lifescience Database Archive (English)

    Full Text Available to Nitrogen fixation protein nifU (SP:Q43885) {Anabaena azollae}; contains Pfam profile: PF01106 NifU-like domain 1e-74 ... ...AK060074 006-306-B05 At5g49940.1 nitrogen fixation NifU-like family protein similar

  12. Nuevos bivalvos para el Perú en Bahía Independencia

    Directory of Open Access Journals (Sweden)

    Oswaldo Cornejo

    2013-06-01

    Full Text Available Se registran por primera vez para el Perú las siguientes especies de bivalvos Nucula (Nucula pisum Sowerby I, 1833, y Lyonsia delicata Marincovich, 1973, colectadas en Bahía Independencia, Pisco, Perú, en el 2002.

  13. Nardus stricta and Eleusine multiflora (Gramineae), new to Mesoamerica

    OpenAIRE

    Pohl, Richard W

    2016-01-01

    Nardus stricta L. se encuentra en el volcán Turrialba, Costa Rica, acompañado por varias especies de gramineas europeas. Eleusine multiflora Hochst ex A. Rich., una especie africana, fue colectada en Jalisco y Chiapas, México.

  14. Application of macrophytes as biosorbents for radioactive liquid waste treatment; Aplicacao de macrofitas como biossorventes no tratamento de rejeitos radioativos liquidos

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Ludmila Cabreira

    2016-07-01

    Radioactive waste as any other type of waste should be treated and disposed adequately. It is necessary to consider its physical, chemical and radiological characteristics for choosing the appropriate action for the treatment and final disposal. Many treatment techniques currently used are economically costly, often invalidating its use and favoring the study of other treatment techniques. One of these techniques is biosorption, which demonstrates high potential when applied to radioactive waste. This technology uses materials of biological origin for removing metals. Among potential biosorbents found, macrophyte aquatics are useful because they may remove uranium present in the liquid radioactive waste at low cost. This study aims to evaluate the biosorption capacity of macrophyte aquatics Pistia stratiotes, Limnobium laevigatum, Lemna sp and Azolla sp in the treatment of liquid radioactive waste. This study was divided into two stages, the first one is characterization and preparation of biosorption and the other is tests, carried out with uranium solutions and real samples. The biomass was tested in its raw form and biosorption assays were performed in polypropylene vials containing 10 ml of solution of uranium or 10ml of radioactive waste and 0.20g of biomass. The behavior of biomass was evaluated by sorption kinetics and isotherm models. The highest sorption capacities found was 162.1 mg / g for the macrophyte Lemna sp and 161.8 mg / g for the Azolla sp. The equilibrium times obtained were 1 hour for Lemna sp, and 30 minutes for Azolla sp. With the real waste, the macrophyte Azolla sp presented a sorption capacity of 2.6 mg / g. These results suggest that Azolla sp has a larger capacity of biosorption, therefore it is more suitable for more detailed studies of treatment of liquid radioactive waste. (author)

  15. CYANOBACTERIA FOR MITIGATING METHANE EMISSION FROM SUBMERGED PADDY FIELDS

    Energy Technology Data Exchange (ETDEWEB)

    Upasana Mishra; Shalini Anand [Department of Environmental Studies, Inderprastha Engineering College, Sahibabad, Ghaziabad (India)

    2008-09-30

    Atmospheric methane, a potent greenhouse gas with high absorption potential for infrared radiation, is responsible for one forth of the total anticipated warming. It is forming a major part of green house gases, next after carbon dioxide. Its concentration has been increasing alarmingly on an average at the rate of one percent per year. Atmospheric methane, originating mainly from biogenic sources such as paddy fields, natural wetlands and landfills, accounts for 15-20% of the world's total anthropogenic methane emission. With intensification of rice cultivation in coming future, methane emissions from paddy fields are anticipated to increase. India's share in world's rice production is next after to China and likewise total methane emission from paddy fields also. Methane oxidation through planktophytes, particularly microalgae which are autotrophic and abundant in rice rhizospheres, hold promise in controlling methane emission from submerged paddy fields. The present study is focused on the role of nitrogen fixing, heterocystous cyanobacteria and Azolla (a water fern harboring a cyanobacterium Anabaena azollae) as biological sink for headspace concentration of methane in flooded soils. In this laboratory study, soil samples containing five potent nitrogen fixer cyanobacterial strains from paddy fields, were examined for their methane reducing potential. Soil sample without cyanobacterial strain was tested and taken as control. Anabaena sp. was found most effective in inhibiting methane concentration by 5-6 folds over the control. Moist soil cores treated with chemical nitrogen, urea, in combination with cyanobacteria mixture, Azolla microphylla or cyanobacteria mixture plus Azolla microphylla exhibited significance reduction in the headspace concentration of methane than the soil cores treated with urea alone. Contrary to other reports, this study also demonstrates that methane oxidation in soil core samples from paddy fields was stimulated by

  16. Evaluation of butachlor for control of some submerged macrophytes along with its impact on biotic components of freshwater system

    Directory of Open Access Journals (Sweden)

    A. Chattopadhyay, S. Adhikari, S. P. Adhikary, S. Ayyappan

    2006-04-01

    Full Text Available In this investigation, the efficacy of the herbicide butachlor, (N-butoxymethyl-2 chloro-21, 61 diethyl acetanilide was tested against few common submerged macrophytes namely Hydrilla (Hydrilla verticillata (L. Royale, Najas (Najas minor All., Nechamandra (Nechamandra alternifolia (Roxb. Thwaites and Ottelia (Ottelia alismoides (L. Pers. of freshwater fish ponds. Almost complete decay of Hydrilla, Nechamandra and Ottelia was achieved at 7.5 L of active ingredient/ha/m butachlor within 15 days while the herbicide showed no negative effect on Najas. However at the same concentration of butachlor, total mortality of zooplankton and water fern Azolla (Azolla caroliniana Lamarck occurred within seven days. In case of few freshwater fish species like Rohu (Labeo rohita, Channa (Channa punctatus, Anabas (Anabas testitudineus and Heteropneustes (Heteropneustes fossilis, total mortality occurred upto 90 days after application of the same dose of butachlor but fish survived beyond 120 days of herbicide application indicating degradation of the herbicides.

  17. 河南外来入侵植物新报%New materials to the alien invasive plants in Henan

    Institute of Scientific and Technical Information of China (English)

    张云霞; 刘兆云; 陈付合; 朱长山

    2010-01-01

    报道新确认的河南外来入侵植物9种:细叶满江红(Azolla filiculioides)、野老鹳草(Geranium carolinianum)、假酸浆(Nicandra physaloides)、毛酸浆(Physalis pubescens)、牛茄子(Solanum surattense)、北美车前(Plantago virginica)、霍香蓟(Ageratum conyzoides)、鬼针草(Bidens pilosa)和两耳草(Paspalum conjugatum).

  18. Efficiency of nitrogen fertilizers for rice

    OpenAIRE

    Roger, Pierre-Armand; I. F. Grant; Reddy, P. M.; Watanabe, I.

    1987-01-01

    The photosynthetic biomass that develops in the floodwater of wetland rice fields affects nitrogen dynamics in the ecosystem. This review summarizes available data on the nature, productivity, and composition of the photosynthetic aquatic biomass, and its major activities regarding the nitrogen cycle, i.e., nitrogen fixation by free living blue-green algae and #Azolla$, nitrogen trapping, nitrogen accumulation at the soil surface, its effect on nitrogen losses by ammonia volatilization, nitro...

  19. Between Two Fern Genomes

    OpenAIRE

    Sessa, Emily B.; Banks, Jo; Michael S Barker; Der, Joshua P; Duffy, Aaron M; Graham, Sean W.; Hasebe, Mitsuyasu; Langdale, Jane; Li, Fay-Wei; Marchant, D; Kathleen M. Pryer; Rothfels, Carl J.; Roux, Stanley J.; Salmi, Mari L; Sigel, Erin M.

    2014-01-01

    Ferns are the only major lineage of vascular plants not represented by a sequenced nuclear genome. This lack of genome sequence information significantly impedes our ability to understand and reconstruct genome evolution not only in ferns, but across all land plants. Azolla and Ceratopteris are ideal and complementary candidates to be the first ferns to have their nuclear genomes sequenced. They differ dramatically in genome size, life history, and habit, and thus represent the immense divers...

  20. Environmental Impact Analysis Process. Environmental Assessment for Defense Satellite Communications System III With Integrated Apogee Boost System

    Science.gov (United States)

    1995-07-01

    milkweed E FDA n/o Cocoa nuvifera Coconut palm T FDA o Avicennia germinans Black mangrove SP FCREA o Azolla caroliniana Mosquito fern T FDA o Ernodea...Cumulative Impacts cent. To produce an additional one excess cancer per one million persons, an estimated 0.2 percent reduction in ozone would be nec...FL2800016121. Toxic air pollutants are chemicals that are known to or are suspected of causing cancer or other serious health effects, including

  1. Primer registro de miasis por Sarcophagidae (Diptera: Oestroidea en Hyalinobatrachium fleischmanni (Anura: Centrolenidae de Panamá First record of myiasis by Sarcophagidae (Diptera: Oestroidea in Hyalinobatrachium fleischmanni (Anura: Centrolenidae from Panama

    Directory of Open Access Journals (Sweden)

    Daniel Medina

    2009-04-01

    Full Text Available Se registra por primera vez un caso de miasis por larva de Sarcophagidae sobre Halinobatrachium fleishmanni colectada en el Parque Nacional Soberanía (Panamá, siendo éste el primer registro de miasis en anuros de la familia Centrolenidae.We report the first record of myiasis by Sarcophagidae, on the glass frog Hyalinobatrachium fleishmanni collected in the Parque Nacional Soberanía (Panama, representing the first record of myiasis for Centrolenidae anurans.

  2. Primer Registro para el Perú de Brachycaudus schwartzi (Bórner (Hemiptera: Aphididae

    Directory of Open Access Journals (Sweden)

    Walter Díaz

    2013-04-01

    Full Text Available Se registra por primera vez para el Perú la especie Brachycaudus schwartzi (Bórner (Hemiptera: Aphididae, “pulgón pardo del duraznero”. La especie ha sido colectada en el departamento de Tacna. Material de referencia se encuentra depositado en la Colección Referencial de Insectos de la Unidad del Centro de Diagnóstico de Sanidad Vegetal del SENASA, Lima, Perú.

  3. Lista de cigarritas (Hemiptera: Cicadellidae de Cusco, Perú

    Directory of Open Access Journals (Sweden)

    Juan F. Costa

    2011-05-01

    Full Text Available Se presenta una lista de cigarritas registradas para Cusco, conteniendo 111 géneros y 203 especies. Esta lista incluye especies citadas en la literatura y también de material depositado en la colección de la Universidad Nacional de San Antonio Abad del Cusco. Las cigarritas identificadas por los autores fueron colectadas de 8 provincias de Cusco: Anta, Calca, Canchis, Cusco, La Convención, Paucartambo, Quispicanchi y Urubamba.

  4. Infestación por esparganos en ranas del genero Pristimantis (Anura, Strabomantidae del Perú

    Directory of Open Access Journals (Sweden)

    Luis A. Gomez-Puerta

    2011-05-01

    Full Text Available En el presente estudio, reportamos el parasitismo por esparganos del cestode Spirometra sp. en los anfibios: Pristimantis nephophilus y Pristimantis rhodostichus, provenientes del departamento de San Martin, Perú. Tres estructuras filiformes localizadas a nivel subcutáneo, fueron colectadas e identificadas como esparganos. El hallazgo de este metacestode constituye el primer registro en anfibios del Perú y demuestra que las ranas P. nephophilus y P. rhodostichus son nuevos hospederos intermediarios para Spirometra sp.

  5. Effects of organic matter application on methane emission from paddy fields adopting organic farming system

    Directory of Open Access Journals (Sweden)

    P Nungkat

    2015-01-01

    Full Text Available A study that was aimed to determine the effect of the use of organic manure and azolla on methane emission on paddy field of organic systems was conducted on paddy fields in the Gempol Village, Sambirejo District of Sragen Regency, Indonesia. The experimental design performed for this study was a completely randomized block design consisting of three factors; the factor I was rice cultivars (Mira-1; Mentik Wangi; Merah Putih; factor II was dose of organic manure (0 t/ha and 10 t/ha and factor III was Azolla inoculums dose (0 t/ha and 2 t/ha. Gas sampling was conducted 3 times in one growing season when the rice plants reached ages of 38, 66 and 90 days after planting. The results showed that there was no correlation between the uses of organic fertilizers for rice production on methane emission. The increase of methane emission was very much influenced by the redox potential. Methane emission from Mira-1 field was higher than that from Mentik Wangi and Merah Putih fields. Emission of methane gas from Mira-1 field ranged from -509.82 to 791.34 kg CH4/ha; that from Wangi ranged from -756.77 to d 547.50 kg CH4/ha and that from Merah Putih ranged from -399.63 to 459.94 kg CH4/ha. Application of 10 t organic manure /ha and 2 t azolla/ha in Mentik Wangi reduced methane emissions with a high rice production compared to Merah Putih and Mira-1.

  6. The effect of type and ratio of vermicompost on selected growth indices and nutrients content of tomato at greenhouse conditions

    OpenAIRE

    M.H. Rasouli-Sadaghiani; Moradi, N.; R. Hamzenejhad

    2016-01-01

    This study was conducted to investigate the effect of type and ratio of vermicompost on tomato growth, with five different types of vermicompost (platanus leaves, maple leaves, pruning apple trees and grape, waste of herbal extracts and azolla residues) and four ratios of vermicompost to peat and perlite (2:1 v/v) as 0, 1:3, 2:3 and 3:3, at greenhouse conditions. Results showed that type of vermicompost had a significant effect (P≤ 0.05) on plant height, shoot dry weight, root dry weight, ...

  7. The organic matter of the Potosi basin (Cordillera Oriental, Bolivia) during the Upper Cretaceous-Lower tertiary: stratigraphic and palaeogeographic data

    Energy Technology Data Exchange (ETDEWEB)

    Blanc-Valleron, M.M.; Rouchy, J.M. (Centre National de la Recherche Scientifique (CNRS), 75 - Paris (France)); Schuler, M.; Rauscher, R. (Strasbourg-1 Univ., 67 (France)); Camoin, G. (Aix-Marseille-1 Univ., 13 - Marseille (France))

    1994-12-01

    Palynological and Rock-Eval pyrolysis studies of the Chaunaca and El Molino Fm (Santonian to Thanetian, Cordillera Oriental, Bolivia) indicate that some facies have economic significance as potential oil source rocks. The occurrence of Pediastrum and Azolla testify a lacustrine environment. In the Upper Molino, the environmental interpretation of an almost monospecific association of dinocysts is discussed. The presence of Apectodinium quinquelatum indicates that the age of the upper part of the Upper El Molino Fm is likely to be Upper Thanetian. (authors). 22 refs., 5 figs.

  8. Pteridophyta collected in Northern Nigeria and Northern Cameroon

    Directory of Open Access Journals (Sweden)

    Jan kornaś

    2014-01-01

    Full Text Available 25 species of Pteridophyta were collected in Northern Nigeria (mainly the Lake Chad Basin and the Mandara Mts. and in the neighbouring parts of Cameroon. 11 of them have not been recorded previously from this area: Isoetes schweinfurthii A. Br. in Bak., Selaginella tenerrima A. Br. ex Kuhn, Ophioglossum gomenzianum Welw. ex A. Br., Marsilea coromandeliana Willd., M. distorta A. Br., M. nubica A. Br., M. subterranea Lepr. ex A. Br., Azolla africana Desv., Ceratopteris richardii Brogn., Adiantum capillus-veneris Linn., and Actiniopleris semiflabellata Pic. Ser.

  9. Riesgo de enfermedades infecciosas transmitidas por transfusión en el Valle del Cauca, Colombia.

    OpenAIRE

    Armando Cortés B.; Mauricio Beltrán; Beatriz Olaya; Marlene Hernández

    2009-01-01

    Se informa el potencial de riesgo para enfermedades infecciosas obtenidas a través de transfusión en el Valle del Cauca en 1997. Todas de las unidades de sangre colectadas en este departamento se tamizaron para los siguientes marcadores de infección: anticuerpos contra el virus de la inmunodeficiencia humana (anti-VIH-1,2), anticuerpos contra el virus de la hepatitis C (anti-VHC), antígeno de superficie de la hepatitis B (AgHBs) y anticuerpos contra Trypanosoma cruzi (anti-Tc), y parcialmente...

  10. Evaluación de la capacidad productiva de Pleurotus ostreatus con el uso de hoja de plátano (Musa paradisiaca l., cv . roatan) deshidratada, en relación con otros sustratos agrícolas

    OpenAIRE

    Romero, Omar; Huerta, Manuel; Damián Huato, Miguel Angel; Macías, Antonio; Tapia, Ana María; Parraguirre Lezama, José F.C.; Juárez, Jaime

    2010-01-01

    El objetivo de este estudio fue evaluar la producción de la cepa CP-50 de P. ostreatus en residuos de hoja de plátano deshidratada en contraste con otros sustratos agrícolas de desecho del Municipio de Tetela de Ocampo-Puebla. Las hojas de plátano (M. paradisiaca) fueron colectadas en la zona de Martínez de la Torre, Veracruz- México y los demás sustratos agrícolas como paja de trigo (T. aestivum), paja de cebada (H. vulgare), pajilla de frijol (P. vulgaris) y rastrojo de maíz (Z. mays) se ad...

  11. Evaluación de la capacidad productiva de Pleurotus ostreatus utilizando hoja de plátano deshidratada (Musa paradisiaca L.), en relación con otros sustratos agrícolas

    OpenAIRE

    Omar Romero; Manuel Huerta; Miguel Angel Damián; Antonio Macías; Ana María Tapia; José F.C. Parraguirre; Jaime Juárez

    2010-01-01

    El objetivo de este estudio fue evaluar la producción de la cepa CP-50 de P. ostreatus en residuos de hoja de plátano deshidratada en contraste con otros sustratos agrícolas de desecho del Municipio de Tetela de Ocampo-Puebla. Las hojas de plátano (M. paradisiaca) fueron colectadas en la zona de Martínez de la Torre, Veracruz- México y los demás sustratos agrícolas como paja de trigo (T. aestivum), paja de cebada (H. vulgare), pajilla de frijol (P. vulgaris) y rastrojo de maíz (Z. mays) se ad...

  12. Distribución de especies de la clase mollusca en el corregimiento de Veracruz, Distrito de Arraiján, Provincia de Panamá

    OpenAIRE

    Avilés E., Miguel C.; Córdoba G., Darío E.

    2008-01-01

    En este trabajo se presenta la distribución de las especies de moluscos colectadas en el corregimiento de Veracruz, distrito de Arraiján, Panamá. Las muestras están depositadas en la Colección Nacional de Referencia de Moluscos del Museo de Malacología de la Universidad de Panamá (MUMAUP). Esta localidad se caracteriza por ser un área fangosa, arenosa y pedregosa, con poca vegetación. Se elaboró un mapa de ocurrencia para las especies, en dos sitios: playa Veracruz e isla Venado, distinguiénd...

  13. Efecto de la heparina en la capacidad fecundante in vitro de espermatozoides caprinos Effect of heparin on the in vitro fertilizing ability of goat spermatozoa as assessed by heterologous solubilized zona pellucidae

    OpenAIRE

    1997-01-01

    El presente estudio está destinado a establecer la etapa del proceso de fecundación en que la heparina ejerce el efecto estimulatorio de la fecundación en caprinos. Oocitos bovinos fueron madurados en medio 199 y alternativamente utilizados para la producción de zonas pelúcidas solubilizadas o para estudios de fecundación. Las zonas pelúcidas, colectadas eliminando mecánicamente al oocito, fueron solubilizadas en ácido acético, liofilizadas y almacenadas a -20° C, hasta su reconstitución. Los...

  14. Lista de esponjas marinas asociadas al arrecife Tuxpan, Veracruz, México Checklist of marine sponges from Tuxpan Reef, Veracruz, Mexico

    OpenAIRE

    Carlos González-Gándara; Abelardo Patiño-García; Uribe Asís-Anastasio; Arturo Serrano; Patricia Gómez

    2009-01-01

    Se presenta la lista de esponjas marinas (Porifera: Demospongiae) del arrecife Tuxpan, Veracruz, México, colectadas en 2004, 2005 y 2006 mediante buceo libre y con equipo autónomo SCUBA. Los resultados muestran la presencia de 18 especies pertenecientes a 13 géneros y 13 familias, 17 de estas especies son nuevos registros para los arrecifes coralinos del norte de Veracruz y una (Aplysina cauliformis Carter, 1882) para el estado. La información puede auxiliar para definir las estrategias de ma...

  15. First record of sandflies for Carchi Province in Ecuador, Lutzomyia trapidoi (Diptera: Pshychodidae: Phlebotominae)

    OpenAIRE

    Arrivillaga Henríquez, Josafá de Jesús

    2013-01-01

    http://www.scielo.org.ve/scielo.php?script=sci_arttext&pid=S1690-46482013000200010 Se registra por primera vez la ocurrencia de flebotomínos para la Provincia de Carchi en el Ecuador. Flebotomínos hembras de Lutzomyia trapidoi fueron colectadas en el Bosque del Chocó, cerca de una comunidad indígena AWA (localidad El Baboso), sin antecedentes epidemiológicos oficiales de leishmaniasis cutánea. Instituto Nacional de Investigación en Salud Pública

  16. Relación de fitoplasmas, bactericera cockerelli y geminivirus con el síndrome del declanamiento del jitomate

    OpenAIRE

    García Tapia, Francisco

    2012-01-01

    En los últimos años en las zonas productoras de jitomate en el país, se ha observado un síndrome en el cultivo, relacionado con la presencia del insecto Bactericera cockerelli y fitoplasmas; pero además los geminivirus podrían estar también involucrados en el desarrollo de dicho síndrome. Las plantas de jitomate con síntomas fueron colectadas en Ixtlahuaca, Chapingo y Montecillo, Estado de México, Tlayacapan y Zacatepec, Morelos, y Sayula, Jalisco; las muestras de tejido d...

  17. Haemophilus influenzae susceptibilidad a los antimicrobianos y comportamiento frente a la vacuna en Cuba

    OpenAIRE

    Llop Hernández, Alina Etelvina

    2006-01-01

    Se presenta el resultado del Monitoreo/Vigilancia de la Resistencia de las cepas circulantes de Haemophilus influenzae en Cuba, aisladas de pacientes con procesos invasivos de meningoencefalitis bacteriana. Fueron estudiadas 1155 cepas colectadas recibidas de todo el paí­s, durante un período ininterrumpido de 17 años, desde enero del 1989 a diciembre de 2005. El trabajo se desarrolló en el Laboratorio Nacional de Referencia de Microbiologí­a del Instituto de Medicina Tropical "Pedro Kourí" M...

  18. Checklist of leafhoppers (Hemiptera: Cicadellidae) from Cusco, Peru

    OpenAIRE

    JUAN F. COSTA; Pedro W. Lozada

    2011-01-01

    Se presenta una lista de cigarritas registradas para Cusco, conteniendo 111 géneros y 203 especies. Esta lista incluye especies citadas en la literatura y también de material depositado en la colección de la Universidad Nacional de San Antonio Abad del Cusco. Las cigarritas identificadas por los autores fueron colectadas de 8 provincias de Cusco: Anta, Calca, Canchis, Cusco, La Convención, Paucartambo, Quispicanchi y Urubamba. We present a list of leafhoppers recorded for Cusco, containing...

  19. PLOMO Y ARSÉNICO EN LA SUBCUENCA DEL ALTO ATOYAC EN TLAXCALA, MÉXICO

    OpenAIRE

    Edelmira García-Nieto; Leticia Carrizales-Yañez; Libertad Juárez-Santacruz; Elizabeth García-Gallegos; Elizabeth Hernández-Acosta; Elia Briones-Corona; Oscar G. Vázquez-Cuecuecha

    2011-01-01

    Se evaluaron indicadores ambientales en el sistema hidrológico Zahuapan-Atoyac (SH:ZA), en Tlaxcala, México. Una región impactada por descargas de aguas residuales de origen urbano, agrícola e industrial. Las muestras fueron colectadas en la primavera del año 2008, época de estiaje. Se seleccionaron 16 estaciones de muestreo; abarcando desde el nacimiento del río Zahuapan, incluyendo tres muestras del río Atoyac, hasta su salida del estado de Tlaxcala. En las muestras de agua se midieron arsé...

  20. Primeros registros de helmintos parásitos en Fulica ardesiaca (Aves: Rallidae para el Perú : Pantanos de Villa – Lima

    Directory of Open Access Journals (Sweden)

    Gisella Guillén

    2013-06-01

    Full Text Available En el presente trabajo se registran por primera vez para el Perú, los parásitos de un ejemplar de Fulica ardesiaca «gallareta andina» colectada en los Pantanos de Villa. Se colectaron un total de 698 especimenes: los tremátodos Notocotylus pacifera y Psilostomum sp. con 529 y 149 individuos respectivamente y el céstodo Diorchis americana, con 20. El presente trabajo constituye el primer reporte para el Perú de helmintos en F. ardesiaca y Psilostomum sp. y D. americana son primeros registros para la helmintofauna peruana.

  1. Relaciones tróficas de los peces pelágicos asociados a la pesquería del atún en el Océano Pacífico oriental

    OpenAIRE

    Bocanegra Castillo, Noemí

    2007-01-01

    Este estudio pretende dar un mejor entendimiento de las relaciones tróficas entre los depredadores asociados con la pesquería del atún en el Océano Pacífico Oriental (OPO). Se realizaron un total de 173 lances pertenecientes a 37 cruceros durante el 2003-2004 de los barcos atuneros de Ecuador y Mazatlán, México colectadas por los técnicos observadores de la Comisión Interamericana del Atún tropical (CIAT), incluyendo 38 lances sobre manadas de delfines, 124 lances sobre objetos flotantes y 11...

  2. Cepas de Pseudomonas aeruginosa de origen hospitalario multirresistentes a 21 antibióticos

    OpenAIRE

    Jane Castillo Vera; Rosa María Ribas Aparicio; Lourdes Osorio Carranza; Gerardo Aparicio

    2006-01-01

    Se llevó a cabo la determinación del perfil de resistencia a 21 antibióticos en 24 cepas de Pseudomonas aeruginosa aisladas del Hospital de Infectología del Instituto Mexicano del Seguro Social (IMSS). Las muestras fueron colectadas durante un periodo de tres meses y correspondieron a 2 aislamientos por semana. Se realizó la identificación de las especies por procedimientos microbiológicos estándar. Se investigó la susceptibilidad a 21 antibióticos usando el método de difusión en agar utiliza...

  3. Caracterización fisiológica, físico-química, reológica, nutraceútica, estructural y sensorial de la guanábana (Annona muricata L. cv. Elita)

    OpenAIRE

    Márquez Cardozo, Carlos Julio

    2009-01-01

    Se utilizaron frutas de guanábana (Annona muricata L. cv. Elita) obtenidas de huertos establecidos en la zona agroindustrial del Valle del Cauca, (Colombia), sector rural del municipio de Pradera, Agrícola Varahonda, Finca la Española, localizada a 1.070 msnm. 23°C de temperatura promedio, 1.225 mm de precipitación promedio anual, radiación solar media de 4,8 W•m-2•día y humedad relativa promedio de 83%. Las frutas fueron colectadas en igual grado de madurez, correspondiente a 16 semanas lueg...

  4. Diversidad de peces demersales en la plataforma continental del Ecuador

    OpenAIRE

    Coello, D.; Herrera, M.

    2010-01-01

    A partir de información colectada de cuatro cruceros de investigación a bordo del B/l Tohalli, se analiza la diversidad de peces óseos y elasmobranquios presentes en la plataforma continental del Ecuador. Los valores medios de diversidad estimados indican que tanto las poblaciones de peces óseos y condrictios demersales hasta los 120 m de profundidad presenten heterogeneidad, con un grado significativo de organización. Las fluctuaciones en el índice de diversidad en las diferentes subáreas y ...

  5. Caracterización bioquímica y fisiológica de algunos frutos amazónicos (Capsicum sp. Y Eugenia stipitata MC VAUGH)

    OpenAIRE

    Hernández María Soledad; Melgarejo Luz Marina; Manduca Fermín Juan Francisco

    2006-01-01

    Los niveles de la actividad poligalacturonasa (PG) fueron cuantificados en diferentes estadios de madurez de frutos de cuatro especies de ají Capsicum chinense, Capsicum baccatum, Capsicum annuum y Capsicum frutescens. Las muestras fueron colectadas y almacenadas a -10º C. La determinación de la actividad poligalacturonasa fue medida por el método de azúcares reductores de Somogyi-Nelson y el contenido de proteínas por Bradford. El comportamiento de la actividad PG de la especie C. chinense e...

  6. Descripción de una nueva especie del género Hypoplectrus (Actinopterigy: Serranidae) del Sistema Arrecifal Veracruzano, suroeste del Golfo de México

    OpenAIRE

    Luis Fernando Del Moral Flores; José Luis Tello-Musi; José Antonio Martínez-Pérez

    2011-01-01

    Se describe una nueva especie del género Hypoplectrus, colectada en el Sistema Arrecifal Veracruzano (SAV), parte suroeste del Golfo de México. La nueva especie difiere de sus congéneres por los patrones de coloración,K cuerpo amarillento pálido, con una banda vertical negra que va desde el borde dorsal de la cabeza hasta el límite ventral del preopérculo, presenta una mancha negra de forma triangular en posición preocular y otra que recorre el pedúnculo caudal. La cabeza se caracteriza por p...

  7. The logistic model for predicting the non-gonoactive Aedes aegypti females

    OpenAIRE

    Filiberto Reyes; Rodríguez, Mario A.

    2004-01-01

    Objetivo. Estimar la probabilidad para que una hembra de Aedes aegypti, previamente alimentada con sangre humana, permanezca no gonoactiva, sin madurar huevos, dependiendo del tamaño corporal y tipo de colecta. Material y métodos. Se hicieron 10 muestreos de Ae aegypti.: seis de hembras capturadas en cebo humano, dos de nulíparas y dos colectadas en reposo intradomiciliar. Cada muestreo incluyó 60 hembras, en tres colonias endémicas para dengue, en Monterrey, Nuevo León, México, entre 1994 y ...

  8. RELACIÓN ENTRE VARIABLES CLIMÁTICAS CON LA MORFOLOGÍA Y CONTENIDO DE ACEITE DE SEMILLAS DE HIGUERILLA (Ricinus communis L.) DE CHIAPAS

    OpenAIRE

    María Antonieta Goytia-Jiménez; Carlos Horacio Gallegos-Goytia; Carlos Alberto Núñez-Colín

    2011-01-01

    Ciento cincuenta y un accesiones de higuerilla (Ricinus communis L.), colectadas en el estado de Chiapas, México, fueron caracterizadas por contenido de aceite, forma, tamaño y peso de la semilla, con el objetivo de generar información que pueda servir de base en un programa de mejoramiento para esta especie, que podría ser una opción rentable para la producción de biodiesel y bioturbosina. De acuerdo con su distribución, se establecieron las cuatro siguientes zonas climáticas: Región 1) clim...

  9. Estudio de polifenoles, taninos y métodos químicos para determinar la actividad antioxidante de la semilla de Sacha Inchi (Plukenetia volubilis L)

    OpenAIRE

    2013-01-01

    Sacha inchi, es una euphorbiaceae conocida como maní del Inca. Se encuentra distribuida en el Perú, en San Martín, Huánuco, Amazonas, Madre de Dios y Loreto.OBJETIVODeterminar la actividad de los compuestos fenólicos de las semillas de sacha inchi y su rol en el color, conservación, sabor de los alimentos y bebidas.MATERIAL Y MÉTODOEl presente estudio se realizó con semillas de sacha inchi colectadas en Tarapoto por el Instituto Nacional de Investigación y Extensión Agraria (INIA). En el Cent...

  10. Presencia y viabilidad de Toxocara spp en suelos de parques públicos, jardines de casas y heces de perros en Nezahualcóyotl, México

    OpenAIRE

    Camilo Romero Núñez; Germán David Mendoza Martínez; Lilia Patricia Bustamante; María Magdalena Crosby Galván; Ninfa Ramírez Durán

    2011-01-01

    Con el objetivo de identificar la presencia y viabilidad de huevos de Toxocara spp. en parques de Nezahualcóyotl, México, muestras de suelos de parques públicos y jardines de casa, heces de perros con propietario y colectadas en vía pública cercanas a los parques fueron analizadas mediante técnicas de flotación sedimentación para identificar la presencia de huevos, las muestras positivas fueron incubadas para conocer el potencial de infestación. La contaminación por Toxocara en los suelos de ...

  11. CARACTERIZACIÓN DE LA DIVERSIDAD Y SELECCIÓN PARTICIPATIVA DE PROSPECCIONES DE MAÍZ EN CHIAPAS, MÉXICO

    Directory of Open Access Journals (Sweden)

    M. Martínez

    2006-01-01

    Full Text Available En marzo y abril del 2003, se realizó una prospección de maíz en 20 municipios pertenecientes a cinco regiones del estado de Chiapas, México. Se lograron colectar 331 accesiones de maíz, de las cuales dos son donadas por el INIFAP y el resto son colectadas en las fincas de los campesinos; dentro de estas accesiones hay granos de color negro, blanco, amarillo, rojo y pinto. El 30 de mayo del 2003, en el Centro de Desarrollo Comunitario CEDECO ¿La Albarrada¿, ubicado en el municipio San Cristóbal de las Casas, se realizó la siembra de 85 accesiones de maíz, colectadas en localidades que se encontraban en un rango de altitud entre 1 500 y 2 260 m snm. Durante el ciclo del cultivo se realizaron diferentes evaluaciones, mostrándose una amplia variabilidad tanto entre las accesiones de diferentes colores como dentro de ellas; además, la variabilidad también se muestra entre las diferentes localidades donde fueron colectadas. El 6 de diciembre del 2003, se realizó una feria de biodiversidad a la que asistieron campesinos provenientes de cinco municipios del estado de Chiapas. Durante la feria de las 85 accesiones expuestas, los campesinos seleccionaron al menos una vez 51, lo que constituye el 60 % de toda la diversidad expuesta. Los campesinos mostraron un mayor interés por las accesiones de granos de color negro y amarillo, constituyendo el 66.6 % de la diversidad colectada. Durante la selección, los hombres y las mujeres tuvieron diferentes criterios a la hora de seleccionar las accesiones y, además, difirieron en el número de accesiones seleccionadas. En general, se mostró un gran interés por parte de los campesinos en accesiones criollas que mostraran cierta tolerancia a las condiciones específicas de sus fincas.

  12. Aislamiento, caracterización genética y análisis filogenético de Rickettsia massiliae, Ciudad Autónoma de Buenos Aires

    OpenAIRE

    Gabriel L Cicuttin

    2016-01-01

    Rickettsia massiliae es un miembro del grupo de la fiebre manchada del género Rickettsia que fue aislado por primera vez en una garrapata Rhipicephalus turanicus de Francia. En el nuevo mundo, se detectó en garrapatas Rhipicephalus sanguineus de diferentes lugares de Argentina y EE.UU., pero sólo fue aislada en Arizona. El objetivo de este estudio fue el aislamiento y la caracterización genética de R. massiliae desde garrapatas R. sanguineus colectadas en perros de la Ciudad Autónoma de Bueno...

  13. Detección por RT-PCR Punto Final y Tiempo Real de Tres Especies de Viroides en Cítricos de Nuevo León y Tamaulipas, México

    OpenAIRE

    César Enrique Guerrero Gámez; Omar Guadalupe Alvarado Gómez; Hazael Gutiérrez Mauleón; Ramiro González Garza; María Genoveva Álvarez Ojeda; Mauricio Luna Rodríguez

    2013-01-01

    Se desarrollaron tres protocolos de R T -PCR tiempo real con el sistema SYBR Green y se compararon con el método convencional R T -PCR punto final para la detección del viroide de la exocortis de los cítricos (CEVd), el viroide del enanismo del lúpulo (HSVd) y el viroide del enanismo de los cítricos (CDVd) tras evaluar distintas combinaciones de iniciadores específicos; adicionalmente se realizó el análisis para los tres viroides referidos en 90 muestras de cítricos colectadas en huertas del ...

  14. Disponibilidad de cinc, cobre, hierro y manganeso extraíble con DTPA en suelos de córdoba (Argentina) y variables edáficas que la condicionan Availability of DTPA extractable zinc, copper, iron and manganese in Córdoba (Argentina) soils and its relationship with other properties

    OpenAIRE

    Eduardo Volmer Buffa; Silvia Elisa Ratto

    2005-01-01

    Se midió el contenido en suelo de Cu, Zn, Fe y Mn extraíbles con DTPA y se relacionó con la materia orgánica, pH, tenor salino y cantidad de carbonatos en Molisoles, Entisoles y Alfisoles de la llanura chaco-pampeana, en la provincia de Córdoba, Argentina. Las muestras de suelo, colectadas en 48 situaciones, correspondientes a distintas condiciones texturales (desde franco limoso a franco arenoso), de acidez (débil acidez a alta alcalinidad) y con salinidad baja a media, fueron contrastadas c...

  15. Detección de Rickettsia spp. en Garrapatas de Myrmecophaga tridactyla de Vida Libre en la Sabana Inundable de Casanare‚ Colombia -resumen-

    OpenAIRE

    César Rojano-Bolaño; R Ávila-Avilán; L Miranda-Cortés; V Contreras-Cogollo; Jorge Miranda-Regino; Laura Hernández-Fernández; Salim Mattar-Velilla; Santiago Monsalve-Buriticá; J Carrascal-Velásquez

    2014-01-01

    Las bacterias del género Rickettsia son organismos con distribución mundial‚ causantes de algunas enfermedades zoonóticas de gran importancia en salud pública. Sin embargo‚ en Colombia son pocos los estudios enfocados a conocer su distribución y los vectores involucrados. El objetivo de este estudio fue detectar la presencia de Rickettsia spp.‚ en garrapatas colectadas en nueve osos palmeros (Myrmecophaga tridactyla) de vida libre en el municipio de Pore‚ Casanare‚ entre los años 2013 y 2014....

  16. Hábitos alimentarios del Coyote en el parque nacional Pico de Orizaba

    OpenAIRE

    Jesús Martínez-Vázquez; Rosa María González-Monroy; Diana Díaz-Díaz

    2010-01-01

    Se examinó la dieta del coyote (Canis latrans) en el Parque Nacional Pico de Orizaba mediante el análisis de 136 heces fecales que fueron colectadas mensualmente por 11 meses en un transecto de 7 km. Los resultados indican que la dieta de coyote se compone principalmente de cuatro grupos tales como: mamíferos (48.96%), plantas (20.28%), aves (6.76%) e insectos (0.68%). La dieta anual del coyote estuvo conformada por 15 especies-presa. Los porcentajes más altos de la dieta están constituidos p...

  17. Residuos de plaguicidas organoclorados en leche pasteurizada comercializada en Ciudad de México Organochlorine pesticide residues in commercial pasteurised milk in Mexico City

    OpenAIRE

    1998-01-01

    Los residuos de algunos plaguicidas organo-clorados presentes en lasmuestras de leche pasteurizada analizadas representan un riesgo para lasalud de los consumidores. Se determinó el contenido de plaguicidas organoclorados en 96 muestras de leche pasteurizada, por cromatografía gas líquido. Las muestras fueron colectadas quincenalmente y durante un año en la Ciudad de México, de cuatro marcas comerciales.En las muestras analizadas se determinó el valor promedio X en µg/gbase grasa, la razón X/...

  18. Isolation of Ricket tsia bellii from Amblyomma ovale and Amblyomma incisum ticks from southern Brazil

    OpenAIRE

    Richard Pacheco; Simone Rosa; Leonardo Richtzenhain; Szabó, Matias P. J.; Labruna, Marcelo B.

    2008-01-01

    Objetivo. Aislar Rickettsias mediante cultivo celular a partir de muestras de garrapatas Amblyomma ovale y Amblyomma incisum del estado de São Paulo Materiales y métodos. A. ovale y A. incisum adultas de vida libre fueron colectadas en una área de selva tropical Atlántica en el estado de São Paulo, Brazil. Cada garrapata fue sometida a la prueba de hemolinfa, las garrapatas positivas en esta prueba fueron evaluadas con la técnica de shell vial con el propósito de aislar rickettsias en cultivo...

  19. Fluctuación poblacional y parasitismo de larvas de Copitarsia Decolora Guenée, Plutella Xylostella L. y Trichoplusia ni Hübner (Lepidoptera) en Brassica Oleracea L.

    OpenAIRE

    2007-01-01

    La fluctuación poblacional y los porcentajes de parasitismo se determinaron para larvas de Copitarsia decolora (Guenée), Plutella xylostella L. y Trichoplusia ni Hübner, asociadas con Brassica oleracea L. en tres variedades, col, coliflor y brócoli, durante abril de 2004 a abril de 2005, en Acatzingo, Puebla, México. Se realizaron muestreos al azar cada 14 días en 10 plantas por variedad; las larvas totales fueron contabilizadas, colectadas y mantenidas en una cámara de cría a 27º C ± 1º C y ...

  20. Estudio fitoquímico de la corteza de acacia farnesianautilizada tradicionalmente para el tratamiento de la malaria

    OpenAIRE

    Daza Bareño, Ada Zurima

    2014-01-01

    En Colombia se ha reportado el uso de decocciones de las hojas y la corteza de Acacia farnesiana para el tratamiento de fiebres y malaria. El presente trabajo es una contribución al estudio fitoquímico de la corteza de esta especie colectada en dos épocas del año, época seca (junio) y de lluvia (octubre). Para tal fin se recolectó el material vegetal en Armero-Guayabal, Departamento Tolima (Colombia) y se realizó una caracterización fitoquímica del extracto etanólico obtenido por percolación ...

  1. Caracterización bioquímica y genética de hiperfenilalaninemias en la ciudad de Cali

    OpenAIRE

    Montoya Villegas, Julio César; Satizábal Soto, José María

    2007-01-01

    La fenilcetonuria (PKU) es una enfermedad autosómica recesiva causada por desórdenes metabólicos debidos a mutaciones en el gen de la fenilalanina hidroxilasa y afecta a cerca de uno de cada diez mil individuos de la población y si no es tratada oportunamente trae graves consecuencias como el retardo mental. Se estableció la prevalencia de fenilcetonuria en niños con discapacidad intelectual de la ciudad de Cali determinando la concentración de fenilalanina en sangre seca colectada en papel d...

  2. DESCOMPOSICIÓN Y LIBERACIÓN DE NITRÓGENO Y MATERIA ORGÁNICA EN HOJAS DE Leucaena leucocephala (Lam.) de Wit, Guazuma ulmifolia Lam. Y Moringa oleifera Lam. EN UN BANCO MIXTO DE FORRAJE

    OpenAIRE

    Judith Petit-Aldana; Gabriel Uribe-Valle; Fernando Casanova-Lugo; Javier Solorio-Sánchez; Luis Ramírez-Avilés

    2012-01-01

    Se evaluaron las tasas de descomposición, la liberación de N y MO en hojas de Leucaena leucocephala (Lam.) de Wit, Guazuma ulmifolia Lam. y Moringa oleifera Lam. en un banco mixto de forraje en Yucatán, México, en las épocas de lluvias y sequía, en un diseño de bloques completos al azar, cinco tratamientos y cuatro repeticiones. Se llenaron 120 bolsas con hojas frescas de las especies colectadas, y se colocaron en cada unidad experimental. Se evaluaron tres periodos de incubación para cada tr...

  3. Química y Funcionalidad Biológica de Mollinedia racemosa (Monimiaceae) Chemical and Biological Functionality of Mollinedia racemosa (Monimiaceae)

    OpenAIRE

    Elizabeth Murillo; Oscar Lombo; MÉNDEZ, JONH J

    2011-01-01

    En este trabajo se caracterizó la especie Mollinedia racemosa, colectada en Yopal-Casanare-Colombia, desde el punto de vista del perfil fitoquímico, cuantificación de algunos de sus metabolitos secundarios, potencial antioxidante, composición y perfil químico del aceite esencial, de su actividad antimicrobiana y de su toxicidad aguda. Con ello se busca dar soporte científico al conocimiento empírico de comunidades indígenas y campesinas colombianas y para aportar al mejor conocimiento de esta...

  4. Utilidad en la combinación de oligonucleótidos universales para la detección del virus del papiloma humano en cáncer cervicouterino y lesiones premalignas Usefulness of combining universal oligonucleotides in detecting human papillomavirus in cervical cancer and premalignant lesions

    OpenAIRE

    Adela Carrillo; Alejandro Mohar; Abelardo Meneses; Mauricio Frías-Mendivil; Gilberto Solorza; Marcela Lizano

    2004-01-01

    OBJETIVO: Determinar la frecuencia y distribución del virus del papiloma humano en los diferentes estadios que conforman la historia natural del cáncer cérvico uterino, y optimizar la detección mediante el uso de diferentes oligonucleótidos universales. MATERIAL Y MÉTODOS: Se trata de un estudio transversal, descriptivo, en el que las muestras fueron colectadas durante enero a diciembre de 1999. El procesamiento de las muestras y el análisis de los datos se realizaron en el Instituto Nacional...

  5. OPTIMIZACION DEL CULTIVO DE LENGUADO CHILENO MEDIANTE HERRAMIENTAS BIOTECNOLOGICAS, NUTRICIONALES Y REPRODUCTIVAS

    OpenAIRE

    Comite Selman, Shella

    2013-01-01

    El presente trabajo se centró en la optimización del cultivo del lenguado chileno Paralichthys adspersus, abordando una serie de problemáticas que se encontraron de forma previa al inicio de la investigación. Estas problemáticas sobre las cuales se desprenden los principales objetivos se pueden resumir en: la alta variabilidad en cantidad y calidad que presentaban las ovas colectadas, debido al característico desove intermitente que presenta la especie, seguido por la baja eficiencia...

  6. Diversidad de mamíferos de la región de Nizanda, Juchitán, Oaxaca, México

    OpenAIRE

    Antonio Santos-Moreno; Elder Ruiz-Velásquez

    2011-01-01

    Se presenta el inventario de mamíferos de la región de Nizanda, Juchitán, Oaxaca. En el que realizaron siete periodos de colecta que comprendieron de abril de 2007 a febrero de 2008. Un total de 7 órdenes, 17 familias y 40 especies. Diez de las especies colectadas se encuentran incluidas en alguna categoría de riesgo de acuerdo a normas nacionales e internacionales. La especie más abundante fue el murciélago Choeroniscus godmani y el orden más diverso es el Carnívora, con 12 especies. ...

  7. Variabilidad en poblaciones de maíz nativo de la Mixteca Baja Oaxaqueña, México

    OpenAIRE

    Diego-Flores, Prisciliano; Carrillo Rodríguez, José Cruz; Chávez-Servia, José Luis; Castillo-González, Fernando

    2012-01-01

    La diversidad genética poblacional de maíz en México es muy dinámica y depende de factores biológicos, agroecológicos y socio-económicos, y necesidades familiares. En este trabajo se describió y clasificó la variabilidad morfológica de una colección de 60 muestras poblacionales de maíz, colectadas en 44 municipios de la Mixteca Baja Oaxaqueña (846 msnm a 1842 msnm). Las muestras se sembraron y cultivaron durante ...

  8. Design of an integrated piggery system with recycled water, biomass production and water purification by vermiculture, macrophyte ponds and constructed wetlands.

    Science.gov (United States)

    Morand, Philippe; Robin, Paul; Pourcher, Anne-Marie; Oudart, Didier; Fievet, Sebastien; Luth, Daniel; Cluzeau, Daniel; Picot, Bernadette; Landrain, Brigitte

    2011-01-01

    Since 2001 the swine experimental station of Guernévez has studied biological treatment plants for nutrient recovery and water recycling, suited to the fresh liquid manure coming out of flushing systems. An integrated system with continuous recycling was set up in 2007, associated with a piggery of 30 pregnant sows. It includes a screen, a vermifilter, and macrophyte ponds alternating with constructed wetlands. The screen and the vermifilter had a lower removal efficiency than in previous studies on finishing pigs. A settling tank was then added between the vermifilter and the first lagoon to collect the worm casts. A second vermifilter was added to recover this particulate organic matter. A storage lagoon was added to compensate for evaporative losses and complete pollution abatement, with goldfish as a bioindicator of water quality. The removal efficiency of the whole system was over 90% for COD and nitrogen, over 70% for phosphorus and potassium, and more than 4 logarithmic units for pathogens (E. coli, enterococci, C perfringens). Plant production was about 20 T DM ha(-1) y(-1). Floating macrophytes (Azolla caroliniana, Eichhornia crassipes, Hydrocotyle vulgaris) were more concentrated in nutrients than helophytes (Phragmites australis, Glyceria aquatica,…). Azolla caroliniana was successfully added to feed finishing pigs.

  9. Effect of Land Use Pattern on Mineralization of Residual C and N from Plant Materials Decomposing Under Field Conditions

    Institute of Scientific and Technical Information of China (English)

    CHENGLILI; WENQIXIAO

    1998-01-01

    Four kinds of plant materials(astragalus,azolla,rice straw and water hyacinth) were allowed to decom-pose for 10 years in two soils with different mineralogical characteristics in fields under upland and submerged conditions.Greater amounts of C and N from azolla were retained in soils throughout the 10-year experi-mental period compared to those from the other plant materials.The residual C of all the plant materials in the two soils under upland conditions mineralized at rates corresponding to half-lives between 4.4-6.6 years,while the corresponding figures for those under submerge conditions were between 6.5-13.1 years,Minera-liztion of residual organic N followed the same pattern as residual C.Compared to residual C,however,the mineralization rates of residual organic N in most cases were significantly lower and the percentages of added N retained in soils were higher.More N from plant materials was retained in the yellow-brown soil than in the red soil,but no consistent differences in the amounts of C from plant materials and in the mineraliztion rates of both residual C and residual organic N between the wto soils could be folund.

  10. The effect of type and ratio of vermicompost on selected growth indices and nutrients content of tomato at greenhouse conditions

    Directory of Open Access Journals (Sweden)

    M.H. Rasouli-Sadaghiani

    2016-02-01

    Full Text Available This study was conducted to investigate the effect of type and ratio of vermicompost on tomato growth, with five different types of vermicompost (platanus leaves, maple leaves, pruning apple trees and grape, waste of herbal extracts and azolla residues and four ratios of vermicompost to peat and perlite (2:1 v/v as 0, 1:3, 2:3 and 3:3, at greenhouse conditions. Results showed that type of vermicompost had a significant effect (P≤ 0.05 on plant height, shoot dry weight, root dry weight, number of internodes and stem diameter. The interaction between type and ratio of vermicompost had significant effect on root and shoot dry weight, stem diameter, nitrogen (N percent, and potassium (K percent. The highest effect on shoot dry weight, stem diameter and the N percentage was observed in the ratio of 2:3 vermicompost of azolla residues. The amount of K in the ratio of 2:3 vermicompost of maple leaves increased 66.18% as compared to the control treatment. Also, different ratios of vermicompost increased percentage of phosphorus and concentration of iron and zinc, as compared to peat+ perlite treatment. Generally, different types and ratios of vermicompost compared to peat+ perlite medium had a positive effect on growth indices and mineral concentration in the tomato plant.

  11. 新食物链生态系统中水流速度对净化效果的影响%Effect of Flow Velocity on Decontamination of Aquaculture Circulating Water in New Food Chain Ecological System

    Institute of Scientific and Technical Information of China (English)

    陈敏; 杨有泉; 邓素芳; 刘中柱

    2011-01-01

    利用不同流量的循环水流经新食物链生态系统中的栽培层架,研究水流速度对循环水净化效果,旨在揭示新食物链生态系统节水和减排的本质.试验结果表明,流经各单层红萍的水样中溶解氧(DO)含量的上升幅度为0.76~0.96mg·L,铵态氮(NH-N)含量的下降幅度为0.94-1.19mg·L,分别是流经单层莴苣的5.07~6.40倍和1.71-2.16倍,说明红萍对提高水体中DO含量和去除NH-N的效果均明显优于莴苣.当养殖循环水流量控制在50mL·s时,流经1层莴苣和3层红萍组成的单个植物栽培床后,DO含量上升了2.80mg·L,系统增O总量为504.0mg·h;NH-N含量下降了3.82mg·L,系统NH-N去除总量为687.6mg·h.可见,红萍是新食物链生态系统的关键植物,在水质净化中起重要作用.利用红萍等植物改善水产养殖水环境,为解决高密度集约化水产养殖的瓶颈问题提供新途径,真正意义上实现新食物链生态系统中养殖污水零排放.%In order to reveal the essence of water conservation and emission reduction in New Food Chain ecological shed, different current water was flew through the cultivation shelves for studying the effect of water flow velocity on purification. The results showed that using Azolla to decontaminate, the concentration of dissolved oxygen (DO) in the water increased by 0.76 ~ 0. 96 mg · L-1 per layer, the concentration of ammonium nitrogen ( NH4+ - N) decreased by 0.94 ~ 1.19mg · L-1 per layer, was 5.07 ~6.40 times and 1.71 ~2. 16 times of using lettuce respectively, which indicated that the effect of Azolla on increasing DO and removing NH4+ - N was much better than lettuce. Controlled the water flow at 50mL · s- 1, after water flew through one layer of lettuce and three layers of Azolla, the concentration of DO increased by 2.80mg · L-1, the total content of O2 increasing of the system was 504.0mg · h -1, the concentration of NH4+ -N decreased by 3.82mg · L-1, the total content of

  12. EVALUACIÓN PRELIMINAR DE LAS COMUNIDADES DE MACROINVERTEBRADOS BENTÓNICOS DE LA LAGUNA DE QUISTOCOCHA, IQUITOS, PERÚ

    Directory of Open Access Journals (Sweden)

    Jemima Alván Alvarado

    2012-12-01

    Full Text Available El objetivo del presente trabajo fue realizar una evaluación preliminar de la riqueza y abundancia de las comunidades de macroinvertebrados bentónicos colectados en dos estratos (orilla y 1 metro de profundidad de la Laguna de Quistococha (Loreto, Perú. Las muestras de orilla fueron colectadas utilizándose una red de colecta de bentos (en forma de D con malla de 1 mm2, mientras que las de 1 m de profundidad fueron colectadas con una draga tipo Eckman, colectándose en total 30 muestras (15 de orilla y 15 de 1 m de profundidad. En la orilla se registró la mayor riqueza (11 especies y abundancia (109 individuos de macroinvertebrados bentónicos, en comparación con la de 1 m de profundidad, donde solo se registraron 5 especies y 51 individuos, registrándose diferencias significativas según la prueba de Mann-Whitney (P<0,05. Para todas las zonas de colecta, la especie Chironomus sp. fue la más abundante tanto en orilla (79 individuos, 72,48%, como a 1 m de profundidad (43 individuos, 84,31%.

  13. Nueva especie de Brachistosternus Pocock (Scorpiones: Bothriuridae del sur del Per˙

    Directory of Open Access Journals (Sweden)

    José Antonio Ochoa

    2013-06-01

    Full Text Available Se describe Brachistosternus turpuq, nueva especie de escorpiÛn Bothriuridae del desierto costero en el sur del Perú, colectada en los cerros alrededores de MejÌa (Departamento de Arequipa. Esta especie pertenece al subgÈnero Brachistosternus (Leptosternus Maury, y est· muy relacionada con las especies argentinas B. pentheri Mello-Leit„o, B. multidentatus Maury y B. angustimanus Ojanguren Affilastro & Roig Alsina. La nueva especie se diferencia de ellas por el menor n˙mero de setas en el segmento caudal V y del tarso III, algunos detalles en el hemiespermatÛforo (espinas del lÛbulo interno y en el patrÛn de pigmentaciÛn del prosoma y del segmento caudal V.

  14. Adaptaciones morfológicas de las hojas en una zona de bosque alto andino en la Reserva Natural Ranchería en Paipa, Boyacá, Colombia

    OpenAIRE

    2005-01-01

    La hoja es uno de los órganos más importantes de las plantas y tanto su morfología como su fisiología dependen de los factores ambientales de la zona donde se encuentren y de los organismos con los cuales tengan que competir para sobrevivir. En este trabajo se hizo una descripción de la morfología de las hojas de las plantas dicotiledóneas, colectadas en una zona de
    bosque alto andino en la “Reserva Municipal Natural  ranchería”, ubicada entre los 2.400- 3.400 m.s.n.m, en Paipa, Bo...

  15. A new species of Callistethus from Mexico (Coleoptera, Melolonthidae, Rutelinae Una nueva especie de Callistethus de México (Coleoptera, Melolonthidae, Rutelinae

    Directory of Open Access Journals (Sweden)

    Andrés Ramírez-Ponce

    2012-06-01

    Full Text Available Callistethus tlapanecus, a new species collected in pine forest located at 2160 meters of altitude in eastern mountains of the state of Guerrero, Mexico is described. The morphological characters that distinguish it from other Mexican and Central American species are discussed. The diagnostic characters are illustrated, and a key to Mexican species of Callistethus is also included.Se describe Callistethus tlapanecus, nueva especie colectada en bosques de pino situados a 2160 metros de altitud en las montañas orientales del estado de Guerrero, México. Se comentan los caracteres morfológicos que distinguen a esta especie de otras especies mexicanas y centroamericanas de Callistethus. Se ilustran los caracteres diagnósticos y se incluye una clave para separar las especies mexicanas de Callistethus.

  16. EFECTO DE DIFERENTES INOCULANTES SOBRE LA ACTIVIDAD MICROBIANA EN LA RIZÓSFERA DEL CULTIVO DE PALLAR (Phaseolus lunatus var. sieva) EN CONDICIONES DE CAMPO

    OpenAIRE

    Ramos Vásquez, Elena; Universidad Nacional Agraria La Molina (Perú).; Zúñiga Dávila, Doris; Universidad Nacional Agraria La Molina (Perú).

    2008-01-01

    Se evaluó la actividad microbiana en la rizósfera de Phaseolus lunatus var. sieva, a partir de muestras de suelo colectadas en campo durante los diferentes estados fenológicos del cultivo, cuyas semillas fueron inoculadas con Bradyrhizobium sp. cepa PCYGIVN3, cepa PSNC4N2 y la interacción de éstas; además, se evaluó la aplicación de fertilizante nitrogenado N-P-K y el control sin inocular. Se determinaron la respiración y la actividad deshidrogenasa de los microorganismos en la rizósfera, las...

  17. MORFOLOGIA EXTERNA DA OPERÁRIA DE Lestrimelitta ehrhardti (FRIESE, 1931 (HYMENOPTERA: MELIPONINI. Morfología externa de la obrera de Lestrimelitta ehrhardti (Friese, 1931 (Hymenoptera: Meliponini. Worker External Morphology of Lestrimelitta ehrhardti (Friese, 1931 (Hymenoptera: Meliponini.

    Directory of Open Access Journals (Sweden)

    DANIELE R. PARIZOTTO

    Full Text Available Operárias de Lestrimelitta ehrhardti (Friese, 1931 foram estudadas, a partir de um grande número de exemplares coletados no município de Castro, Paraná, Brasil. Os espécimes foram descritos morfologicamente, medidos e ilustrados.Se estudió un gran número de obreras de Lestrimelitta ehrhardti (Friese, 1931 colectadas en el municipio de Castro, Paraná, Brasil. Los especímenes fueran descritos morfológicamente, medidos e ilustrados.Workers of Lestrimelitta ehrhardti (Friese, 1931 were studied based on a great number of individuals collected in the municipality of Castro, Paraná State, Brazil. The specimens were described morphologically, measured and illustrated.

  18. Lista de Insectos Identificados para el Museo Entomológico de la Facultad de Ciencias Agrícolas U.N. Medellín, Durante los Años 1971 a 1973

    Directory of Open Access Journals (Sweden)

    Vélez Angel Raúl

    1973-12-01

    Full Text Available La presente catalogación de insectos presenta en forma resumida la mayor parte de información acumulada sobre material entomológico colectada durante excursiones del Área Entomología durante los años 1971 a 1973. No todo el material colectado ha sido identificado. La clasificación de insectos es una labor difícil y lenta, que ha sido en este caso realizada, en su mayoría, en forma gratuita por taxónomos extranjeros, particularmente del Museo Nacional de los Estados Unidos. Huella parte del material permanece preparado para posteriores envíos a entidades de reconocido prestigio y con los cuales han existido cordiales relaciones desde hace más de 30 años.

  19. Estudio histológico, inmuno-histoquímico y de cultivo celular de mamas humana y canina normal y cancerosa

    OpenAIRE

    Carine Fernandes B.; Marcelo José V.; Ricardo Junqueira Del C.; Liana Mesquita V.; Mastoby Martinez M.

    2012-01-01

    RESUMENObjetivo. Comparar las características morfológicas de células normales y cancerosas derivadas de glándulas mamarias de las especies humana y canina. Materiales y métodos. Fueron colectadas 10 muestras de parénquima mamario normal y 14 de parénquima tumoral de la especie canina, así como seis muestras de parénquima mamario normal y tres de parénquima tumoral de la especie humana. Para el cultivo de células fue utilizada la técnica de cultivo de células de mamíferos y para la histoquími...

  20. Variabilidad en poblaciones de maíz nativo de la Mixteca Baja Oaxaqueña, México

    OpenAIRE

    Prisciliano Diego-Flores; José Cruz Carrillo-Rodríguez; José Luis Chávez-Servia; Fernando Castillo-González

    2012-01-01

    La diversidad genética poblacional de maíz en México es muy dinámica y depende de factores biológicos, agroecológicos y socio-económicos, y necesidades familiares. En este trabajo se describió y clasificó la variabilidad morfológica de una colección de 60 muestras poblacionales de maíz, colectadas en 44 municipios de la Mixteca Baja Oaxaqueña (846 msnm a 1842 msnm). Las muestras se sembraron y cultivaron durante el ciclo primavera-verano de 2010, en Santo Domingo Tonala, Oaxaca, bajo un diseñ...

  1. Análisis fitoquímico y farmacológico de extractos de Allophylus cominia (L. Sw

    Directory of Open Access Journals (Sweden)

    Tania Véliz Rodríguez

    2004-01-01

    Full Text Available El efecto sobre la glicemia provocado por la administración oral de los extractos acuoso y alcohólico de la planta Allophylus cominia (L.Sw (Palo de caja, 1g/kg m.c., colectada en San José de las Lajas y Nueva Paz, fue estudiado en ratas normoglicémicas, sin observarse diferencias significativas entre estos grupos. En el ensayo con sobrecarga de glucosa (PTG, el extracto acuoso de las hojas fue el que presentó un efecto biológico sobre las concentraciones séricas de glucosa, a diferencia del de los tallos y la corteza para este modelo farmacológico, mientras que el estudio fitoquímico, indicó una misma composición química general para todos los extractos analizados. Finalmente, la evaluación de la toxicidad aguda oral tras la administración de una dosis de 5 000 mg/kg. m.c. del extracto acuoso de las hojas colectadas en San José de las Lajas, reveló que, bajo las condiciones experimentales, la sustancia ensayada no provoca alteraciones que pudieran interpretarse como tóxicas, como se había observado previamente para el caso del extracto acuoso de la corteza. Estos resultados permiten afirmar que el consumo de decocciones de hojas de Allophylus cominia (L.Sw, además de constituir una ventaja desde el punto de vista medioambiental, no provoca efecto sobre la glucosa sanguínea en modelos normoglicémicos bajo las condiciones experimentales empleadas. Se debe valorar el resultado de su administración en dosis repetidas en modelos diabéticos, en concordancia con su uso etnomédico.

  2. Presencia de Spiroplasma penaei en plancton, bentos y fauna acompañante en fincas camaroneras de Colombia

    Directory of Open Access Journals (Sweden)

    José Altamiranda M.

    2011-05-01

    Full Text Available Objetivo. Determinar la presencia de Spiroplasma penaei en el plancton, bentos y fauna acompañante en 2 fincas comerciales de camarones. Materiales y métodos. Fueron colectadas 200 muestras para identificación de lesiones características de Spiroplasma, a través de la técnica de histología, mientras que para la técnica de PCR se tomaron 326 muestras de plancton, bentos y fauna acompañante. Las muestras colectadas fueron preservadas en tubos estériles con etanol al 95% para análisis de PCR y en solución Davidson para análisis histológicos. Resultados. En los muestreos realizados en las dos fincas camaroneras fue detectada la presencia de Spiroplasma en una muestra de un representante de los dípteros (mosca de agua a través de la técnica de PCR en tiempo real, el cual arrojo una Tm=84, similar a la del control positivo de Spiroplasma utilizado. Esta muestra fue secuenciada y comparada con secuencias de bacterias almacenadas en el banco de datos GenBank usando el algoritmo BLAST, encontrando 100% de homología con un fragmento de los genes ribosomales 16S de la bacteria Spiroplasma penaei. Conclusiones. La mosca de agua es portadora de Spiroplasma penaei, sin embargo no se puede afirmar que este organismo sea el transmisor de la infección, por lo que se recomienda realizar ensayos de tipo experimental con moscas de agua infectadas con Spiroplasma penaei, en camarones libres de patógenos, para evaluar si en realidad es el vector de infección.

  3. Anopheles larval abundance and diversity in three rice agro-village complexes Mwea irrigation scheme, central Kenya

    Directory of Open Access Journals (Sweden)

    Mwangangi Joseph M

    2010-08-01

    Full Text Available Abstract Background The diversity and abundance of Anopheles larvae has significant influence on the resulting adult mosquito population and hence the dynamics of malaria transmission. Studies were conducted to examine larval habitat dynamics and ecological factors affecting survivorship of aquatic stages of malaria vectors in three agro-ecological settings in Mwea, Kenya. Methods Three villages were selected based on rice husbandry and water management practices. Aquatic habitats in the 3 villages representing planned rice cultivation (Mbui Njeru, unplanned rice cultivation (Kiamachiri and non-irrigated (Murinduko agro-ecosystems were sampled every 2 weeks to generate stage-specific estimates of mosquito larval densities, relative abundance and diversity. Records of distance to the nearest homestead, vegetation coverage, surface debris, turbidity, habitat stability, habitat type, rice growth stage, number of rice tillers and percent Azolla cover were taken for each habitat. Results Captures of early, late instars and pupae accounted for 78.2%, 10.9% and 10.8% of the total Anopheles immatures sampled (n = 29,252, respectively. There were significant differences in larval abundance between 3 agro-ecosystems. The village with 'planned' rice cultivation had relatively lower Anopheles larval densities compared to the villages where 'unplanned' or non-irrigated. Similarly, species composition and richness was higher in the two villages with either 'unplanned' or limited rice cultivation, an indication of the importance of land use patterns on diversity of larval habitat types. Rice fields and associated canals were the most productive habitat types while water pools and puddles were important for short periods during the rainy season. Multiple logistic regression analysis showed that presence of other invertebrates, percentage Azolla cover, distance to nearest homestead, depth and water turbidity were the best predictors for Anopheles mosquito larval

  4. Effect of heating systems in litter quality in broiler facilities in winter conditions

    Directory of Open Access Journals (Sweden)

    Ricardo Brauer-Vigoderis

    2014-01-01

    Full Text Available El objetivo de este trabajo, fue evaluar la influencia de los sistemas de calefacción en galpones avícolas, las condiciones psicométricas del aire interno y en la calidad de la cama (humedad y pH, en condiciones de invierno, en el oeste del Estado de Santa Catarina. El experimento fue desarrollado en tres propiedades avícolas integradas en la industria Brasilera Perdigão, en núcleos con tres galpones similares, equipados con diferentes sistemas de calefacción (Campanas infrarrojas a gas, hornos a leña de calentamiento indirecto del aire e intercambiadores de calor por radiación con calentamiento como suplemento de las campanas infrarrojas a gas. Valores de la humedad relativa y la temperatura del aire fueron obtenidos continuamente, en tres puntos de medida de cada instalación al nivel de las aves, para determinar el índice de temperatura y humedad (ITH. Para los análisis de humedad y pH de la cama, fueron colectadas cuatro muestras en cuatro puntos diferentes en cada galpón, cada dos días, durante el periodo en que fueron utilizados los sistemas de calefacción. Los sistemas de calentamiento en campanas infrarrojas a gas y el sistema conjugado de intercambiador más campanas infrarrojas a gas, proporcionaron valores de humedad de la cama, inferiores a los observados en ambientes calentados por el sistema con horno a leña. En los aviarios calentados por los sistemas de campanas a gas y el horno a leña, los valores de ITH, se mantuvieron en una franja de confort para el bienestar de las aves, pero en el sistema conjugado con más campanas a gas, fue detectado estrés y desperdicio de energía. Para todos los sistemas de calentamiento los valores de humedad de la cama se mostraron adecuados, sin embargo, los valores del pH de las muestras de cama, colectadas en los ambientes de cría, evidenciaron un ambiente básico, tornándolo propicio para el crecimiento de bacterias amonificantes.

  5. Postlarval settlement of spiny lobster, Panulirus argus (Latreille, 1804 (Decapoda: Palinuridae, at the Caribbean coast of Costa Rica Asentamiento postlarval en la langosta espinosa, Panulirus argus (Latreille, 1804 (Decapoda: Palinuridae en la costa Caribe de Costa Rica

    Directory of Open Access Journals (Sweden)

    Oscar González

    2011-11-01

    Full Text Available Lobster fishery (Panulirus argus forms an important part of the fishing activities along the Caribbean coast of Central America. The present study provides information regarding the seasonal abundance and distribution of postlarval P. argus in Parque Nacional Cahuita, Costa Rica. During the study period (March 2004-February 2005, a total of 1907 pueruli were obtained from GuSi collectors. Postlarvae were present during all months, with a pronounced peak in January-February 2005 (CPUE of 21.82 and 22.18, pueruli/collector/month, respectively, and minor peaks in May and October 2004. The abundance of postlarval P. argus in the study area was comparable to locations which support important lobster fisheries, e.g. Mexico. A majority of the postlarvae (1027 ind. was collected during the first quarter moon, the remaining pueruli (880 ind. during new moon; these results are in general agreement with similar findings for P. argus in the Caribbean area. Based upon our results, we recommend introducing a local or regional monitoring program, studying spiny lobster migration and distribution patterns, and evaluate the introduction of artificial shelters for P. argus.Las capturas de langosta (Panulirus argus son de gran importancia en la actividad pesquera a lo largo de las costas del Caribe de Centroamérica. El presente estudio proporciona información relevante de la abundancia temporal y la distribución de postlarvas de P. argus en el Parque Nacional Cahuita, Costa Rica. Durante el periodo de estudio (Marzo 2004-Febrero 2005, un total de 1907 puérulos fueron obtenidos del colector GuSi. Las postlarvas fueron colectadas durante todos los meses, con máximos en enero-febrero 2005 (CPUE de 21.82 y 22.18, puérulos/colector/mes, respectivamente, y mínimos en mayo y octubre de 2004. La abundancia de postlarvas de P. argus en el estudio es comparada con áreas que soportan importantes pesquerías, p. ej. México. La mayoría de las postlarvas (1027 ind

  6. Modelado computacional usando regresión lineal y simbólica a B para determinar ópticamente el tamaño del poro de la piel

    Directory of Open Access Journals (Sweden)

    N. P. Puente Ramírez

    2015-01-01

    Full Text Available La apariencia de los poros de la piel normalmente es causada por glándulas sebáceas hiperactivas, sin embargo, en los últimos años se ha reportado que además se ve afectada por diversas enfermedades, entre ellas la diabetes [1], obesidad [2] o cáncer [3]. Generalmente los principales factores que contribuyen a la dilatación de los poros son la edad, género, acné, la exposición crónica al sol o la predispocisión genética. El desarrollo de un método no invasivo que permita conocer las condiciones de la piel, ayudara a relacionar los factores que determinan el tamaño del poro de la piel. En este trabajo se pretende caracterizar por medio de un modelo computacional y con ayuda de un esquema óptico, el tamaño del poro de la piel. El principio físico consiste en iluminar con leds (543nm el antebrazo de voluntarios, el esparcimiento de luz generado por la piel es colectada en una camara ccd. La captura de imágenes, el procesamiento y el análisis estadístico son parte de la metodología para la obtención de datos. Se propone un modelo matemático que relaciona género, edad, tono de piel y tamaño del poro (calculado estadísticamente en las imágenes colectadas ópticamente. Una base de datos se genera y se utiliza para construir matemáticamente modelos mediante regresión simbólica con optimizacion por enjambre de particulas (PSO y se realiza una comparación por medio de regresión lineal. Algunos indicadores estadísticos como el cuadrado medio de error, error de predicción suma de los cuadrados y porcentaje de variabilidad se utilizan en la comparación. Los resultados indican que el modelo propuesto con el tamaño de los poros de cada individuo puede ayudar a hacer una interpretación objetiva de indicadores de enfermedad que afecten directamente el tamaño del poro en la piel.

  7. Replacement

    Directory of Open Access Journals (Sweden)

    S. Radhakrishnan

    2014-03-01

    Full Text Available The fishmeal replaced with Spirulina platensis, Chlorella vulgaris and Azolla pinnata and the formulated diet fed to Macrobrachium rosenbergii postlarvae to assess the enhancement ability of non-enzymatic antioxidants (vitamin C and E, enzymatic antioxidants (superoxide dismutase (SOD and catalase (CAT and lipid peroxidation (LPx were analysed. In the present study, the S. platensis, C. vulgaris and A. pinnata inclusion diet fed groups had significant (P < 0.05 improvement in the levels of vitamins C and E in the hepatopancreas and muscle tissue. Among all the diets, the replacement materials in 50% incorporated feed fed groups showed better performance when compared with the control group in non-enzymatic antioxidant activity. The 50% fishmeal replacement (best performance diet fed groups taken for enzymatic antioxidant study, in SOD, CAT and LPx showed no significant increases when compared with the control group. Hence, the present results revealed that the formulated feed enhanced the vitamins C and E, the result of decreased level of enzymatic antioxidants (SOD, CAT and LPx revealed that these feeds are non-toxic and do not produce any stress to postlarvae. These ingredients can be used as an alternative protein source for sustainable Macrobrachium culture.

  8. The effects of mixed algal diets on population growth, egg productivity and nutritional profiles in cyclopoid copepods (Thermocyclops hyalinus and Mesocyclops aspericornis

    Directory of Open Access Journals (Sweden)

    Kumar Vidhya

    2014-03-01

    Full Text Available This experiment was carried out to evaluate the effect of mixed algal diet on dietary profiles of copepods. The microalgae like Spirulina platensis, Chlorella vulgaris and Azolla pinnata were mass cultured in artificial medium for a period of 20 days, cells are harvested, dried, powdered and used as feed. The small freshwater cyclopoids Thermocyclops hyalinus were compared to Mesocyclops aspericornis a species of copepod genera commonly preferred by most of the fish larvae. Both species are easily maintained in culture, when fed with mixed algal diets of equal ratios (1:1:1. Biochemical composition, egg production ratios, growth performance and fatty acids profile of the two different species were analyzed after an experimental period of 15 days, all the nutritional values were found to be high and statistically variable. On the basis of biochemical composition, egg production ratio, growth performance, amino acids and fatty acids profile it is found that M. aspericornis was the suitable candidate for larval fish diets.

  9. Aquatic Food Plants and their Consumer Birds at Sandi Bird Sanctuary, Hardoi, Northern India

    Directory of Open Access Journals (Sweden)

    Kaushalendra Kumar Jha

    2013-07-01

    Full Text Available One of the Bird Sanctuaries of Uttar Pradesh, Sandi, was selected for studying some ecological aspects like, aquatic food plants, their food calendar and dependent birds of migratory as well as resident origin. The study site is considered as an ideal wetland. This is located at 27o15’ N and 79o55’ E. Thirty four food plant species were identified to be eaten by 16 birds.These plants were the species of Alloteropsis, Arundo, Azolla, Ceratophyllum, Chloris, Commelina, Cyperus, Echinochloa, Eichhornia, Eleocharis, Hydrilla, Ipomoea, Jussiaea, Lemna, Najas, Nelumbo, Nymphea, Nymphoides, Oryza, Pistia, Polygonum, Potamogeton, Scirpus, Spirodela, Trapa, Typha, Vallisneria, and Wolffia. Common consumer birds eating plant parts were Coot, Pochards, Teal, Wigeon, Gadwal, Gargany, Goose, Whistling-duck, Mallard, Pintail, Shoveler, and Swamphen. These are primarily the migratory birds except Coot, Whistling-duck and Swamphen. Spot-billed Duck, and Indian Moorhen were occasionally seen eating submerged hydrophytes and filamentous slimy green algae. On the basis of multi-strata growth of plants in the Sanctuary a wetland profile was prepared. Food calendar i.e., availability of palatable parts of plants during different months was recorded. Information collected in the study could be used for habitat management, especially the weed removal and ensuring food sustainability for the vegetarian birds.

  10. Effect of organic fertiliser residues from rice production on nitrogen fixation of soya (Glycine max L. Merrill, Chiang Mai 60 variety

    Directory of Open Access Journals (Sweden)

    Nattida Luangmaka

    2013-09-01

    Full Text Available A field study was undertaken on the residual effect of organic fertilisers applied to the preceding rice cropping on nitrogen fixation of soya in a rice-soya cropping system. The experiment was conducted on a farmer’s lowland paddy in Mae Rim district, Chiang Mai province, Thailand. Organic fertiliser treatments assigned were: 1 control (no fertiliser, 2 animal manure of cattle (AM, 3 compost (CP, 4 azolla (AZ, 5 AM + CP, 6 AM + AZ, 7 CP + AZ and 8 AM + CP + AZ. Soya seeds were planted without rhizobial inoculation in December 2011, four months after the application of organic fertilisers. Nodule weight, total shoot nitrogen accumulation and relative ureide index at various growth stages were recorded as the indices of nitrogen fixation. Results of the study demonstrate that the residues from the application the organic fertilisers of narrow C/N ratios during the land preparation for rice cropping four months before soya cultivation promoted nitrogen fixation by native rhizobia.

  11. Current approaches of the management of mercury poisoning: need of the hour.

    Science.gov (United States)

    Rafati-Rahimzadeh, Mehrdad; Rafati-Rahimzadeh, Mehravar; Kazemi, Sohrab; Moghadamnia, Ali Akbar

    2014-06-02

    Mercury poisoning cases have been reported in many parts of the world, resulting in many deaths every year. Mercury compounds are classified in different chemical types such as elemental, inorganic and organic forms. Long term exposure to mercury compounds from different sources e.g. water, food, soil and air lead to toxic effects on cardiovascular, pulmonary, urinary, gastrointestinal, neurological systems and skin. Mercury level can be measured in plasma, urine, feces and hair samples. Urinary concentration is a good indicator of poisoning of elemental and inorganic mercury, but organic mercury (e.g. methyl mercury) can be detected easily in feces. Gold nanoparticles (AuNPs) are a rapid, cheap and sensitive method for detection of thymine bound mercuric ions. Silver nanoparticles are used as a sensitive detector of low concentration Hg2+ ions in homogeneous aqueous solutions. Besides supportive therapy, British anti lewisite, dimercaprol (BAL), 2,3-dimercaptosuccinic acid (DMSA. succimer) and dimercaptopropanesulfoxid acid (DMPS) are currently used as chelating agents in mercury poisoning. Natural biologic scavengers such as algae, azolla and other aquatic plants possess the ability to uptake mercury traces from the environment.

  12. Fish growth, yield and economics of conventional feed and weed based polyculture in ponds

    Directory of Open Access Journals (Sweden)

    Md Asadujjaman

    2016-04-01

    Full Text Available Fish growth, yield and economics of polyculture were evaluated for six months from April to September, 2011 in ponds of Kushtia district, Bangladesh under 4 treatments of feeds and weeds as T0: rice bran, wheat bran and mustard oilcake; T1: Azolla; T2: Grass and T3: Banana leaf. Each treatment had 3 replications. Mean initial stocking weight of fishes like Hypophthalmichthyes molitrix, Catla catla, Labeo rohita, Cirrhinus mrigala, Cyprinus carpio, Ctenopharyngodon idella and Barbonymus gonionotus was 62, 64, 57, 54, 63, 65 and 25 g, respectively. Stocking density (11,115 fishes/ha, liming (250 kg/ha, basal fertilization (Cowdung, 1,500 kg/ha; urea, 60 kg/ha; and Triple Super Phosphate, TSP 60 kg/ha and periodic fertilization (Urea, 2.5 kg/ha/day; and TSP, 2.5 kg/ha/day were same for all the treatments. Water quality parameters (water temperature, transparency, dissolved oxygen, pH, alkalinity and free carbon dioxide were monitored fortnightly and fish growth parameters (weight gain and Specific Growth Rate, SGR were monitored monthly. Treatments did not vary significantly for the mean water quality parameters. Treatment T0 varied more significantly (P<0.05 for the mean final weight, weight gain, SGR, survival rate and yield for almost all the species except C. idella and B. gonionotus. Significantly highest CBR was recorded with treatment T1.

  13. Late cretaceous aquatic plant world in Patagonia, Argentina.

    Science.gov (United States)

    Cúneo, N Rubén; Gandolfo, María A; Zamaloa, María C; Hermsen, Elizabeth

    2014-01-01

    In this contribution, we describe latest Cretaceous aquatic plant communities from the La Colonia Formation, Patagonia, Argentina, based on their taxonomic components and paleoecological attributes. The La Colonia Formation is a geological unit deposited during a Maastrichtian-Danian transgressive episode of the South Atlantic Ocean. This event resulted in the deposition of a series of fine-grained sediments associated with lagoon systems occurring along irregular coastal plains in northern Patagonia. These deposits preserved a diverse biota, including aquatic and terrestrial plants and animals. The aquatic macrophytes can be broadly divided into two groups: free-floating and rooted, the latter with emergent or floating leaves. Free-floating macrophytes include ferns in Salviniaceae (Azolla and Paleoazolla) and a monocot (Araceae). Floating microphytes include green algae (Botryoccocus, Pediastrum and Zygnemataceae). Among the rooted components, marsileaceous water ferns (including Regnellidium and an extinct form) and the eudicot angiosperm Nelumbo (Nelumbonaceae) are the dominant groups. Terrestrial plants occurring in the vegetation surrounding the lagoons include monocots (palms and Typhaceae), ferns with affinities to Dicksoniaceae, conifers, and dicots. A reconstruction of the aquatic plant paleocommuniy is provided based on the distribution of the fossils along a freshwater horizon within the La Colonia Formation. This contribution constitutes the first reconstruction of a Cretaceous aquatic habitat for southern South America.

  14. Late cretaceous aquatic plant world in Patagonia, Argentina.

    Directory of Open Access Journals (Sweden)

    N Rubén Cúneo

    Full Text Available In this contribution, we describe latest Cretaceous aquatic plant communities from the La Colonia Formation, Patagonia, Argentina, based on their taxonomic components and paleoecological attributes. The La Colonia Formation is a geological unit deposited during a Maastrichtian-Danian transgressive episode of the South Atlantic Ocean. This event resulted in the deposition of a series of fine-grained sediments associated with lagoon systems occurring along irregular coastal plains in northern Patagonia. These deposits preserved a diverse biota, including aquatic and terrestrial plants and animals. The aquatic macrophytes can be broadly divided into two groups: free-floating and rooted, the latter with emergent or floating leaves. Free-floating macrophytes include ferns in Salviniaceae (Azolla and Paleoazolla and a monocot (Araceae. Floating microphytes include green algae (Botryoccocus, Pediastrum and Zygnemataceae. Among the rooted components, marsileaceous water ferns (including Regnellidium and an extinct form and the eudicot angiosperm Nelumbo (Nelumbonaceae are the dominant groups. Terrestrial plants occurring in the vegetation surrounding the lagoons include monocots (palms and Typhaceae, ferns with affinities to Dicksoniaceae, conifers, and dicots. A reconstruction of the aquatic plant paleocommuniy is provided based on the distribution of the fossils along a freshwater horizon within the La Colonia Formation. This contribution constitutes the first reconstruction of a Cretaceous aquatic habitat for southern South America.

  15. Depositional environments of the Hart coal zone (Paleocene), Willow Bunch Coalfield, southern Saskatchewan, Canada from petrographic, palynological, paleobotanical, mineral and trace element studies

    Energy Technology Data Exchange (ETDEWEB)

    Potter, J.; Beaton, A.P.; McDougall, W.J.; Nambudiri, E.M.V.; Vigrass, L.W. (University of Regina, SK (Canada). Energy Research Unit)

    1991-12-01

    Coal petrology, palynology, paleobotany and mineralogy of the Hart coal indicate deposition under wet, warm-temperate to subtropical climatic conditions in low-lying backswamps with fluvial channels and locally ponded areas. The coal is dominated by mixed xylitic/attrital lithotypes and by huminite macerals with secondary inertinite macerals and minor liptinite macerals. Good correlation exists between lithotypes and maceral composition. Local and vertical variations in proportions of huminites and inertinites reflect frequent fluctuations in water levels, periodic flooding, desiccation and burning of the peat. Swamps were dominated by {ital Glyptostrobus-Taxodium} forest with {ital Betula-Myrica-Alnus} communities and, locally {ital Laevigatosporites}, which are the dominant contributors to the xylite-rich lithotypes. Attrital lithotypes with abundant {ital Pandanus}, {ital Typha} and {ital Azolla} are consistent with wetter areas of a fluvial environment, including ponds and channels. Trace elements Cr, Cu, Mo, Ni, Si, Ti, U, Se, V, W, K and Th, typically associated with syngenetic minerals kaolinite, calcite and quartz, may have a volcanic source. High concentrations of Na, Ba and Ca found in organic complexes are of secondary origin and probably originate in deep source brines rather than marine surface waters. 55 refs., 11 figs., 5 tabs.

  16. Between two fern genomes.

    Science.gov (United States)

    Sessa, Emily B; Banks, Jo Ann; Barker, Michael S; Der, Joshua P; Duffy, Aaron M; Graham, Sean W; Hasebe, Mitsuyasu; Langdale, Jane; Li, Fay-Wei; Marchant, D Blaine; Pryer, Kathleen M; Rothfels, Carl J; Roux, Stanley J; Salmi, Mari L; Sigel, Erin M; Soltis, Douglas E; Soltis, Pamela S; Stevenson, Dennis W; Wolf, Paul G

    2014-01-01

    Ferns are the only major lineage of vascular plants not represented by a sequenced nuclear genome. This lack of genome sequence information significantly impedes our ability to understand and reconstruct genome evolution not only in ferns, but across all land plants. Azolla and Ceratopteris are ideal and complementary candidates to be the first ferns to have their nuclear genomes sequenced. They differ dramatically in genome size, life history, and habit, and thus represent the immense diversity of extant ferns. Together, this pair of genomes will facilitate myriad large-scale comparative analyses across ferns and all land plants. Here we review the unique biological characteristics of ferns and describe a number of outstanding questions in plant biology that will benefit from the addition of ferns to the set of taxa with sequenced nuclear genomes. We explain why the fern clade is pivotal for understanding genome evolution across land plants, and we provide a rationale for how knowledge of fern genomes will enable progress in research beyond the ferns themselves.

  17. Accumulation of arsenic by aquatic plants in large-scale field conditions: opportunities for phytoremediation and bioindication.

    Science.gov (United States)

    Favas, Paulo J C; Pratas, João; Prasad, M N V

    2012-09-01

    This work focuses on the potential of aquatic plants for bioindication and/or phytofiltration of arsenic from contaminated water. More than 71 species of aquatic plants were collected at 200 sampling points in running waters. The results for the 18 most representative plant species are presented here. The species Ranunculus trichophyllus, Ranunculus peltatus subsp. saniculifolius, Lemna minor, Azolla caroliniana and the leaves of Juncus effusus showed a very highly significant (P<0.001) positive correlation with the presence of arsenic in the water. These species may serve as arsenic indicators. The highest concentration of arsenic was found in Callitriche lusitanica (2346 mg/kg DW), Callitriche brutia (523 mg/kg DW), L. minor (430 mg/kg DW), A. caroliniana (397 mg/kg DW), R. trichophyllus (354 mg/kg DW), Callitriche stagnalis (354 mg/kg DW) and Fontinalis antipyretica (346 mg/kg DW). These results indicate the potential application of these species for phytofiltration of arsenic through constructed treatment wetlands or introduction of these plant species into natural water bodies.

  18. Microrefugia and species persistence in the Galápagos highlands: a 26,000-year paleoecological perspective.

    Science.gov (United States)

    Collins, Aaron F; Bush, Mark B; Sachs, Julian P

    2013-01-01

    The Galápagos Islands are known to have experienced significant drought during the Quaternary. The loss of mesophytic upland habitats has been suggested to underlie the relatively lower endemism of upland compared with lowland plant assemblages. A fossil pollen record spanning the last 26,000 years from an upland bog on Santa Cruz Island, revealed the persistent presence of highland pollen and spore types during the last glacial maximum and a millennial-scale series of droughts in the mid Holocene. The absence of lowland taxa and presence of mesic taxa led to the conclusion that the highland flora of the Galápagos persisted during both these periods. The resiliency of the highland flora of the Galápagos to long-term drought contradicts an earlier hypothesis that an extinction of highland taxa occurred during the last glacial maximum and that rapid Holocene speciation created the modern plant assemblage within the last 10,000 years. Based on the palynological data, we suggest that, even during the height of glacial and Holocene droughts, cool sea-surface temperatures and strong trade-wind activity would have promoted persistent ground level cloudiness that provided the necessary moisture inputs to maintain microrefugia for mesophytic plants. Although moist conditions were maintained, the lack of precipitation caused the loss of open water habitat during such events, and accounts for the known extinctions of species such as Azolla sp., and Elatine sp., while other moisture dependent taxa, i.e., Cyathea weatherbyana, persisted.

  19. Deciphering the factors associated with the colonization of rice plants by cyanobacteria.

    Science.gov (United States)

    Bidyarani, Ngangom; Prasanna, Radha; Chawla, Gautam; Babu, Santosh; Singh, Rajendra

    2015-04-01

    Cyanobacteria-rice plant interactions were analyzed using a hydroponics experiment. The activity of plant defense and pathogenesis-related enzymes, scanning electron microscopy, growth, nitrogen fixation (measured as ARA), and DNA fingerprinting assays proved useful in illustrating the nature of associations of cyanobacteria with rice plants. Microscopic analyses revealed the presence of short filaments and coiled masses of filaments of cyanobacteria near the epidermis and cortex of roots and shoot tissues. Among the six cyanobacterial strains employed, Calothrix sp. (RPC1), Anabaena laxa (RPAN8), and Anabaena azollae (C16) were the best performing strains, in terms of colonization in roots and stem. These strains also enhanced nitrogen fixation and stimulated the activity of plant defense/cell wall-degrading enzymes. A significantly high correlation was also recorded between the elicited plant enzymes, growth, and ARA. DNA fingerprinting using highly iterated palindromic sequences (HIP-TG) further helped in proving the establishment of inoculated organisms in the roots/shoots of rice plants. This study illustrated that the colonization of cyanobacteria in the plant tissues is facilitated by increased elicitation of plant enzymes, leading to improved plant growth, nutrient mobilization, and enhanced plant fitness. Such strains can be promising candidates for developing "cyanobacteria colonized-nitrogen-fixing rice plants" in the future.

  20. Management of fresh water weeds (macrophytes) by vermicomposting using Eisenia fetida.

    Science.gov (United States)

    Najar, Ishtiyaq Ahmed; Khan, Anisa B

    2013-09-01

    In the present study, potential of Eisenia fetida to recycle the different types of fresh water weeds (macrophytes) used as substrate in different reactors (Azolla pinnata reactor, Trapa natans reactor, Ceratophyllum demersum reactor, free-floating macrophytes mixture reactor, and submerged macrophytes mixture reactor) during 2 months experiment is investigated. E. fetida showed significant variation in number and weight among the reactors and during the different fortnights (P weeds) into three clusters-poor vermicompost substrates, moderate vermicompost substrate, and excellent vermicompost substrate. Two principal components (PCs) have been identified by factor analysis with a cumulative variance of 90.43 %. PC1 accounts for 47.17 % of the total variance represents "reproduction factor" and PC2 explaining 43.26 % variance representing "growth factor." Thus, the nature of macrophyte affects the growth and reproduction pattern of E. fetida among the different reactors, further the addition of A. pinnata in other macrophytes reactors can improve their recycling by E. fetida.

  1. Biodiversity and importance of floating weeds of Dara Ismail, Khan District of KPK, Pakistan.

    Science.gov (United States)

    Marwat, Sarfaraz Khan; Khan, Mir Ajab; Fazal-ur-Rehman; Ahmad, Mushtaq; Zafar, Muhammad

    2011-01-01

    The present paper is based on the results of taxonomic research work conducted in Dera Ismail Khan District of KPK, Pakistan, during 2005 - 2007. The area was extensively surveyed in order to collect floating aquatic weeds. From the study area 11 floating aquatic weed species belonging to 9 genera and 9 families were collected and identified in the light of available literature. These plants include Bryophytes: 1 species, Ricciocarpus natans (L.) Corda; Pteridophytes: 2 species, Azolla pinnata R.Br. and Marselia quadrifolia L., and Spermatophytes: 8 species, Lemna aequinoctialis Welw., L. gibba L., Marselia quadrifoliata L. Nelumbo nucifera Gaerth., Nymphoides cristata (Roxb.) O. Ketze. Nymphoides indica (L.) Kuntze:, Pistia stratiotes L. Potamogeton nodosus Poiret and Spirodela polyrrhiza (L.) Schleid. Floating weeds on one hand cause serious problems and on the other hand they are used for various purposes. Data inventory consists of botanical name, family, major group, habit and habitat, flowering period, availability, distribution in D.I.Khan, Pakistan and world, beneficial and harmful effects. Key to the floating aquatic species of the area was developed for easy and correct identification and differentiation.

  2. Heavy metal pollution in aquatic ecosystems and its phytoremediation using wetland plants: An ecosustainable approach

    Energy Technology Data Exchange (ETDEWEB)

    Rai, P.K. [Mizoram Central University, Tanhril (India). School for Earth Science & Natural Resource Management

    2008-07-01

    This review addresses the global problem of heavy metal pollution originating from increased industrialization and urbanization and its amelioration by using wetland plants both in a microcosm as well as natural/field condition. This review mentions salient features of wetland ecosystems, their vegetation component, and the pros and cons involved in heavy metal removal. Wetland plants are preferred over other bio-agents due to their low cost, frequent abundance in aquatic ecosystems, and easy handling. Constructed wetlands proved to be effective for the abatement of heavy metal pollution from acid mine drainage; landfill leachate; thermal power; and municipal, agricultural, refinery, and chlor-alkali effluent. the physicochemical properties of wetlands provide many positive attributes for remediating heavy metals. Typha, Phragmites, Eichhornia, Azolla, Lemna, and other aquatic macrophytes are some of the potent wetland plants for heavy metal removal. Biomass disposal problem and seasonal growth of aquatic macrophytes are some limitations in the transfer of phytoremediation technology from the laboratory to the field. However, the disposed biomass of macrophytes may be used for various fruitful applications. An ecosustainable model has been developed through the author's various works, which may ameliorate some of the limitations. The creation of more areas for phytoremediation may also aid in wetlands conservation. Genetic engineering and biodiversity prospecting of endangered wetland plants are important future prospects in this regard.

  3. Use of cyanobacterial diazotrophic technology in rice agriculture

    Energy Technology Data Exchange (ETDEWEB)

    Tiwari, D.N.; Kumar, A.; Mishra, A.K. [Banaras Hindu Univ., Varanasi (India)

    1991-12-31

    Diazotrophic cyanobacteria are photoautotrophic organisms that require sunlight as a sole energy source for the fixation of carbon and nitrogen. Therefore, they have great potential as biofertilizers, and their use will decrease fuel demand for fertilizer production. The agronomic potential of heterocystous cyanobacteria, either free-living or in symbiotic association with water fern Azolla, has long been recognized. This has led to the development of small scale biotechnology involving the use of paddy soils with appropriate cyanobacterial strains as biofertilizers in rice culture, as has been reported from China, Egypt, Philippines, and India. Besides increasing soil fertility and sustaining rice yield, these forms are also reported to benefit rice seedlings by producing growth-promoting substances, the nature of which is said to resemble gibberellins. Whereas the incorporation of nif genes into the rice plants by using tissue culture and modern genetic tools remain one of the ambitious research goals, the use of cyanobacterial diazotrophic technology in rice agriculture offers an immediate or even long-term alternative to synthetic nitrogen fertilizers, particularly in developing countries and the world as a whole. However, one of the weaknesses in this technology is the heavy application of several toxic agrochemicals, especially herbicides, which are reported in most cases as inhibitors of cyanobacterial diazotrophic growth, and in some cases as mutagenic. Naturally, a successful biotechnology requires the selection of suitable diazotrophic strains, as biofertilizers, that could tolerate the field-dose concentrations of herbicides and secrete ammonia.

  4. Concentrations of heavy metals and aquatic macrophytes of Govind Ballabh Pant Sagar an anthropogenic lake affected by coal mining effluent.

    Science.gov (United States)

    Mishra, Virendra Kumar; Upadhyay, Alka Rani; Pandey, Sudhir Kumar; Tripathi, B D

    2008-06-01

    Five heavy metals Cu, Cd, Mn, Pb and Hg were found in high concentration from three sampling sites located in Asia's largest anthropogenic lake Govind Ballabh Pant GBP Sagar. Concentrations of these heavy metals were measured in Water, bottom sediment and in different parts of the aquatic macrophytes collected from the reservoir. Plants collected from the lake were Eichhornia crassipes, Azolla pinnata, Lemna minor, Spirodela polyrrhiza, Potamogeton pectinatus, Marsilea quadrifolia, Pistia stratiotes, Ipomea aquqtica, Potamogeton crispus, Hydrilla verticillata and Aponogeton natans. These plants have shown the high concentrations of Cu, Cd, Mn, Pb and Hg in their different parts due to bioaccumulation. In general plant roots exhibited higher concentrations of heavy metals than corresponding sediments. A comparison between different morphological tissues of the sampled plants revealed the metal concentration in following order roots > leaves. Analyses of bottom sediment indicated the higher concentrations of Cd, Mn, Cu and Pb. Strong positive correlations were obtained between the metals in water and in plants as well as between metal in sediment and in plants. Indicating the potential of these plants for pollution monitoring of these metals.

  5. Heavy metals in water, sediments and wetland plants in an aquatic ecosystem of tropical industrial region, India.

    Science.gov (United States)

    Rai, Prabhat Kumar

    2009-11-01

    Concentrations of heavy metals (Cu, Cr, Fe, Pb, Zn, Hg, Ni, and Cd) and macronutrients (Mn) were measured in industrial effluents, water, bottom sediments, and wetland plants from a reservoir, Govind Ballabh (G.B.) Pant Sagar, in Singrauli Industrial region, India. The discharge point of a thermal power plant, a coal mine, and chlor-alkali effluent into the G.B. Pant Sagar were selected as sampling sites with one reference site in order to compare the findings. The concentrations of heavy metals in filtered water, sieved sediment samples (0.4-63 microm), and wetland plants were determined with particle-induced X-ray emission. The collected plants were Aponogeton natans, L. Engl. & Krause, Cyperus rotundus, L., Hydrilla verticillata, (L.f.) Royle, Ipomoea aquatica, Forssk., Marsilea quadrifolia, L., Potamogeton pectinatus, L., Eichhornia crassipes, (Mart.) Solms Monogr., Lemna minor, L., Spirodela polyrhiza (L.) Schleid. Linnaea, Azolla pinnata, R.Br., Vallisneria spiralis, L., and Polygonum amphibium, L. In general, metal concentration showed a significant positive correlation between industrial effluent, lake water, and lake sediment (p macrophytes for pollution monitoring.

  6. Estudio ambiental de criaderos de anopheles (n albimanus (diptera: culicidae en la provincia holguín. año 2009

    Directory of Open Access Journals (Sweden)

    Niurka Lien Torres-Rodríguez

    2012-01-01

    Full Text Available Se presenta el estudio de la incidencia y comportamiento del anopheles albimanus, (transmisor del paludismo o malaria en los 282 criaderos potenciales y habituales de culícidos de la provincia holguín durante el año 2009.a partir de la información semanal enviada a la unidad provincial de vigilancia y lucha antivectorial (upvla, se caracterizó el comportamiento de esta especie la que se encuentra ampliamente distribuida en la provincia. Se observó mayor incidencia en los municipios FranK País, Rafael Freyre y Mayarí, con predominio en zanjas, lagunas y arroyos. Se aprecia una mayor asociación con el culex quinquefasciatus y el mayor número de muestras larvarias fueron colectadas en octubre. Teniendo en cuenta los resultados obtenidos y el riesgo de introducción de esta enfermedad en el país se recomienda continuar los estudios de esta especie en la provincia.

  7. ESTUDIO DE LA BIODIVERSIDAD EN HUERTOS AGRÍCOLAS URBANOS DE DOS MUNICIPIOS DE CIUDAD DE LA HABANA. CARACTERIZACIÓN DE LAS ACCESIONES DEL GÉNERO VIGNA

    Directory of Open Access Journals (Sweden)

    R. Ortiz

    2001-01-01

    Full Text Available Se realizó un estudio de la biodiversidad agrícola en los huertos urbanos de ocho localidades en los municipios Boyeros y Arroyo Naranjo, con el objetivo de inventariar los cultivos agrícolas existentes. Entre los meses de abril a junio de 1997 se realizó la visita a 100 huertos, llevándose el registro de los datos pasaporte a través del formato que existe a nivel internacional, el cual fue ajustado a las condiciones de este trabajo. Finalmente en un género hortícola colectado fue eva- luada la biodiversidad encontrada en superficies del ISPETP durante los meses de abril a julio de 1998. La información obte- nida se analizó estadísticamente por métodos univariados y multivariados. Se determinó que en los huertos estudiados existe una biodiversidad agrícola satisfactoria, localizándose 262 accesiones entre las que predominan las viandas, frutales, hortalizas y leguminosas. Además, muchos de los cultivares se adaptan a sistemas de agricultura de bajos insumos. En los tipos de habichuelas colectadas se encontró diversidad para una gran cantidad de caracteres morfológicos y componentes del rendimiento.

  8. Lista de esponjas marinas asociadas al arrecife Tuxpan, Veracruz, México Checklist of marine sponges from Tuxpan Reef, Veracruz, Mexico

    Directory of Open Access Journals (Sweden)

    Carlos González-Gándara

    2009-04-01

    Full Text Available Se presenta la lista de esponjas marinas (Porifera: Demospongiae del arrecife Tuxpan, Veracruz, México, colectadas en 2004, 2005 y 2006 mediante buceo libre y con equipo autónomo SCUBA. Los resultados muestran la presencia de 18 especies pertenecientes a 13 géneros y 13 familias, 17 de estas especies son nuevos registros para los arrecifes coralinos del norte de Veracruz y una (Aplysina cauliformis Carter, 1882 para el estado. La información puede auxiliar para definir las estrategias de manejo, monitoreo y protección de estas formaciones arrecifales que recientemente han sido propuestas como área de protección de flora y fauna.A checklist of marine sponge species (Porifera: Demospongiae from Tuxpan reef, Veracruz, Mexico, collected during 2004, 2005 and 2006 by free and SCUBA diving equipment, is presented. The results show the presence of 18 species belonging to 13 genera and 13 families. 17 speices represent new records for the northern coral reefs of Veracruz, and the 18th species (Aplysina cauliformis Carter, 1882 is a new record for the state. This information may help to define appropriate management, monitoring and protection strategies for the coral reefs of the north of Veracruz, which have been proposed as a natural preserve area recently.

  9. REVISIÓN DE ESTOMATITIS ULCERATIVA EN OFIDIOS

    Directory of Open Access Journals (Sweden)

    S M Peñuela

    2007-01-01

    Full Text Available La estomatitis en ofidios es una condición de frecuente diagnóstico en la clínica de animales silvestres.Se relaciona principalmente con eventos estresantes como deficiencias medioambientales,nutricionales o una enfermedad subyacente, las cuales terminan favoreciendo el crecimientode gérmenes patógenos y, de esta forma, llevan a la muerte del animal. Los signos clínicos puedenpasar inadvertido s por un tiempo variable, por lo que se recomienda hacer revisiones periódicas alos ofidios en cautiverio. Debido a que es una entidad multifactorial, uno o varios agentes etiológicosse implican como causales y perpetuantes de la condición, por lo que es de gran importanciasometer las muestras colectadas a análisis específicos, para así poder identificarlos y garantizarun mayor éxito en el momento de instaurar un tratamiento. En casos avanzados el pronóstico casisiempre es malo debido a la posibilidad de una diseminación hematógena, con sus efectos secundarioscomo neumonía y osteomielitis, o por continuidad, causando gastroenteritis. Por ello, laprincipal herramienta de combate frente a la entidad es minimizar la exposición de los ofidios afactores predisponentes o estresantes, que sin lugar a dudas ponen en peligro la vida del ani;nal.

  10. Primer hallazgo de Aedes albopictus Skuse en el Gran Área Metropolitana de Costa Rica

    Directory of Open Access Journals (Sweden)

    Rodrigo Marín Rodríguez

    2014-06-01

    Full Text Available Objetivo: Informar sobre el primer hallazgo de Aedes albopictus en el Gran Área Metropolitana de Costa Rica. Métodos: Formas inmaduras de mosquitos colectadas en la Ciudadela La Carpio, Distrito Uruca, San José, como parte de una barrida epidemiológica fueron diagnosticadas preliminarmente como Ae. albopictus. Dicho material se fijó en alcohol al 70 %, se aclaró en lactofenol y se evaluó taxonómicamente mediante claves dicotómicas especializadas. Resultados: Las formas inmaduras evaluadas procedieron de dos criaderos, un tarro y un balde. Las características de las larvas y pupas permitieron identificarlas taxonómicamente como Ae. albopictus. Este es el primer reporte sobre la presencia de dicho vector en Costa Rica. Discusión: La presencia de Ae. albopictus en la Gran Área Metropolitana ocurre como parte del proceso de expansión que está teniendo dicho vector por el territorio nacional. Su presencia debe ser motivo de estudio para determinar su eventual papel en la transmisión del dengue. Por otro lado la presencia de este vector complica la gestión de la vigilancia entomológica de dengue que ha estado dirigida fundamentalmente a la identificación y control del Aedes aegypti.

  11. ESTUDIO BIOGEOQUÍMICO DEL EMBALSE SUATA, VENEZUELA, DE ACUERDO AL CONTENIDO METÁLICO DE SUS SEDIMENTOS DE FONDO, AGUAS Y PECES

    Directory of Open Access Journals (Sweden)

    María A. Álvarez

    2012-01-01

    Full Text Available Se realizó un estudio biogeoquímico mediante el análisis del contenido metálico en muestras de sedimentos de fondo, aguas y peces colectadas mensualmente durante un año. Los sedimentos se encontraron enriquecidos antrópicamente con COT, Zn y Cd, presentando un nivel de contaminación de moderado a fuerte, y según la fracción biodisponible, un riesgo muy alto de Zn y mediano de Ni, Cd, Cr y Co. Estas especies llegarían al embalse, principalmente, mediante la escorrentía superficial de desechos de industrias de producción animal ubicadas en los alrededores y aportes del Rio Aragua. Aunque la desorción de los metales desde los sedimentos es improbable dado el pH donde se encuentran (8-9 y la concentración de los metales en las aguas y peces fue menor que las máximas permitidas en las normativas, se encontraron indicios de bioacumulación de Hg y Ni en el hígado de los peces que sugieren mantener el monitoreo del embalse.

  12. común manejada por campesinos en Cuba

    Directory of Open Access Journals (Sweden)

    Sandra Miranda-Lorigados

    2006-01-01

    Full Text Available La variación genética de 27 accesiones locales de frijol común colectadas en la comunidad de El Tejar - La Jocuma, provincia Pinar del Río, Cuba, se evaluó utilizando marcadores moleculares RAPD (Polimorfismos de ADN Amplificados al Azar y caracteres morfológicos y agronómicos. En total se emplearon 15 cebadores RAPD que generaron 31 fragmentos polimórficos de ADN (un promedio de 2,03 fragmentos por cebador. Las distancias genéticas fueron calculadas utilizando el coeficiente de similitud de Sorensen-Dice, y representadas mediante un dendograma (método UPGMA. Se evaluaron una serie de caracteres morfológicos y agronómicos con los que se realizaron análisis multivariados que generaron un clúster (distancias euclidianas y un análisis de componentes principales. El análisis generado a partir de los marcadores RAPD y de los caracteres morfo agronómicos, reveló que las accesiones estudiadas generaron dos grupos principales que corresponden presumiblemente a los acervos Mesoamericano y Andino, considerando las distancias genéticas entre grupos y las diferencias en determinados caracteres morfológicos y agronómicos

  13. ESTIMACIÓN DE LA SUPERFICIE FOLIAR EN DOS VARIEDADES DE PAPA (Solanum tuberosum L. POR MÉTODOS NO DESTRUCTIVOS

    Directory of Open Access Journals (Sweden)

    Eduardo Jerez Mompie

    2014-01-01

    Full Text Available El trabajo se desarrolló en el Instituto Nacional de Ciencias Agrícolas con el objetivo de determinar una función matemática a partir de las medidas lineales de las hojas de papa para estimar la superficie foliar de la planta de manera no destructiva. Se utilizaron plantas de dos variedades de papa Call White y Santana colectadas a los 40, 60 y 70 días después de la plantación, para asegurar que existieran hojas de distintos tamaños. Una vez realizadas las medidas lineales de las hojas (largo y ancho se procedió a determinar la superficie foliar real de la hoja con el empleo de un integrador de superficie foliar AM300 y a partir de estas variables se establecieron las regresiones lineales correspondientes al área real de cada hoja con cada una de las longitudes obtenidas y el producto de ellas. Se tuvo en cuenta el resultado del coeficiente de correlación y de determinación para escoger la función lineal que con mayor exactitud estima la superficie foliar de la hoja. La ecuación obtenida a partir del producto del largo por el ancho resultó la de mayor coeficiente de determinación en ambas variedades.

  14. Caracterización bioquímica y fisiológica de algunos frutos amazónicos (Capsicum sp. Y Eugenia stipitata MC VAUGH

    Directory of Open Access Journals (Sweden)

    Hernández María Soledad

    2006-06-01

    Full Text Available Los niveles de la actividad poligalacturonasa (PG fueron cuantificados en diferentes estadios de madurez de frutos de cuatro especies de ají Capsicum chinense, Capsicum baccatum, Capsicum annuum y Capsicum frutescens. Las muestras fueron colectadas y almacenadas a -10º C. La determinación de la actividad poligalacturonasa fue medida por el método de azúcares reductores de Somogyi-Nelson y el contenido de proteínas por Bradford. El comportamiento de la actividad PG de la especie C. chinense es muy temprano y similar a C. frutescens, pero el rango de la actividad PG de C. chinense es inferior a la de C. frutescens (picos máximos de 1678,572 y
    3581,5080 nmoles*min-1*mg prot-1, respectivamente. C. frutescens presentó dos períodos de actividad; y al igual que C. annuum, C. baccatum es de actividad tardía. El pico climatérico del fruto de Arazá fue de 102,49 mgCO2/kg/h, mientras que el pico de etileno fue de 26,62 mgC2H4/kg/h coincidiendo con la máxima madurez del fruto.

  15. Revisión taxonómica del género Pimelodella, Eigenmann y Eigenmann, 1888 (pisces, siluriformes: heptapteridae de la región transandina de Colombia

    Directory of Open Access Journals (Sweden)

    Leiva Castaño Mauricio

    2005-07-01

    Full Text Available Las especies de Pimelodella Eigenmann (Heptapteridae, son siluriformes fácilmente identificables por el proceso occipital delgado que se conecta a la placa nucal, aleta adiposa larga y las franjas laterales negras a lo largo del cuerpo. El género se encuentra ampliamente distribuido en la zona tropical de América del sur hasta Costa Rica, muchas de las especies son comunes, pero muy pobremente conocidas. Dentro de los ejemplares revisados de la región transandina de Colombia,
    algunos se encontraron determinados hasta el género y otros mal determinados en la especie. De las siete especies que se encuentran reportadas para esta región (P. chagresi, P. odynea, P. eutaenia, P. grisea, P. modestus, P. reyesi y P. macrocephala se encontró que P. macrocephala no está colectada en los institutos visitados. En los resultados obtenidos se encontraron evidencias morfométricas y merísticas de cuatro grupos diferentes a los grupos reportados, dos hacen parte del sistema del río Magdalena, uno al sistema Caribe–Guajiro y uno al sistema del Pacífico (Colombia.

  16. Sinopsis de las hormigas dacetinas de los géneros daceton perty y acanthognathus mayr (formicidae: myrmicinae de Colombia

    Directory of Open Access Journals (Sweden)

    Fernández Fernando

    2007-04-01

    Full Text Available Los géneros Acanthognathus y Daceton son dos géneros de distribución neotropical que pertenecen a la tribu
    Dacetini (Formicidae: Myrmicinae. Esta tribu está compuesta por nueve géneros de los cuales cuatro son
    de distribución neotropical (Acanthognathus, Daceton, Pyramica y Strumigenys. Acanthognathus y Daceton son endémicos de esta región. Las especies reportadas para Colombia del género Acanthognathus eran dos (A.
    teledectus, A. ocellatus. Daceton es un género monotípico (D. armigerum reportado para Colombia. Se revisaron
    dos colecciones (IAvH, ICN, en las cuales se encontraban especies de estos dos géneros. Como resultado
    se obtuvo una nueva especie registrada para Colombia del género Acanthognathus (A. brevicornis y una nueva especie para la ciencia. En cuanto al género Daceton, este se encontró distribuido a varios departamentos de la Orinoquía y Amazonía colombianas (Caquetá, Meta, Guaviare, Vichada, Guanía. El uso intensivo de trampas especializadas (principalmente Winkler así como el continuo muestreo en áreas protegidas o de interés ha incrementado el número de especies de hormigas de hojarasca colectadas, entre las cuales se encuentran las de estos dos géneros.

  17. VÍNCULO E ACESSO NA ESTRATÉGIA SAÚDE DA FAMÍLIA: PERCEPÇÃO DE USUÁRIOS COM TUBERCULOSE

    Directory of Open Access Journals (Sweden)

    Jordana de Almeida Nogueira

    2012-01-01

    Full Text Available El estudio toma dos componentes de la Atención Primaria de Salud: "acceso" y "vínculo", con objetivo de analizar las acciones de control de la tuberculosis en los Equipos de Salud de la Familia. Estudio cualitativo, llevada a cabo en João Pessoa-PB, Brasil, en que participaron cinco personas con tuberculosis. Las declaraciones fueron colectadas a través de entrevista semiestructurada, y organizadas mediante análisis de contenido. Para obtener el diagnóstico de la tuberculosis se buscó, predominantemente, los servicios especializados. En las unidades de salud de la familia donde el acceso ha sido facilitado, se privilegió la promoción del vínculo entre los pacientes y sus familiares, especialmente de profesionales enfermeros y trabajadores comunitarios de salud. Hay necesidad de cambios en la planificación y/o una organización local para facilitar el acceso y fortalecer la relación entre equipo/usuario y así lograr atención integral.

  18. A participação do pai como acompanhante da mulher no parto

    Directory of Open Access Journals (Sweden)

    Fernanda Rosa Indriunas Perdomini

    2011-01-01

    Full Text Available Se trata de un estudio de caso, de carácter cualitativo, con el objetivo de conocer la participación del padre como acompañante de la mujer durante el parto. Participaron del estudio veinticuatro padres que estuvieron presentes durante el trabajo de parto y en el parto de sus compañeras, en el Hospital de Clínicas de Porto Alegre-RS. Las informaciones, colectadas por medio de observación participante y entrevista semi-estructurada, se examinaron a través del análisis de contenido temático. El tema encontrado: la experiencia de ser acompañante, se refiere a la presencia y el significado de la experiencia de vivir el nacimiento del hijo. Los hallazgos del estudio revelaron que los padres entienden que estar presente, dar cariño y usar palabras de apoyo hacen parte del rol de ser acompañante en ese momento. Los padres creen que la experiencia de vivir el nacimiento del su hijo, independiente del número de nacimientos ya acompañados por ellos, es una experiencia única, un momento inexplicable.

  19. Distribución geográfica de Boeckella y Neoboeckella (Calanoida: Centropagidae en el Perú

    Directory of Open Access Journals (Sweden)

    Iris Samanez

    2014-12-01

    Full Text Available El análisis de muestras de plancton colectadas en diferentes localidades a lo largo de los Andes peruanos, dieron como resultado el registro de siete especies de Boeckella (gracilis, gracilipes, calcaris, poopoensis, occidentalis, titicacae y palustris y dos de Neoboeckella (kinzeli y loffleri. Todas las especies citadas, exceptuando a las especies de Neoboeckella, fueron registradas en la cuenca del lago Titicaca (Puno. Además, B. palustris, B. gracilipes y B. calcaris fueron también reportadas en Moquegua, Apurímac y Pasco (Andes del sur y central. Boeckella titicacae parece estar restringida a la cuenca del lago Titicaca. Boeckella poopoensis ocurre en cuerpos de agua con elevada conductividad reportándose sólo en Las Salinas en Arequipa. Boeckella occidentalis fue la especie con mayor rango de distribución desde el sur en Puno hasta el norte en Cajamarca y se registra por primera vez para el país Neoboeckella loffleri. Las muestras están depositadas en la Colección de Plancton del Departamento de Limnología del Museo de Historia Natural de la Universidad Nacional Mayor de San Marcos, Lima-Perú.

  20. Especies de hongos formadores de Micorrizas Arbusculares: nuevas citas para la República Argentina Arbuscular mycorrhizal fungal species: new records for Argentina

    Directory of Open Access Journals (Sweden)

    G. Irrazabal

    2005-07-01

    Full Text Available Se investigó la presencia de hongos formadores de micorrizas arbusculares asociados a plantas colectadas en un agroecosistema y en un bosque nativo de tala, en la provincia de Buenos Aires. Las especies que constituyen un nuevo registro para la Argentina son: Scutellospora dipapillosa (Walker & Koske Walker & Sanders y Scutellospora fulgida Koske & Walker halladas en la rizósfera de Triticum aestivum L.; Scutellospora gilmorei (Trappe & Gerd. Walker & Sanders, en la rizósfera de Celtis tala Gill. Ex Planch., Scutia buxifolia Reiss. y plantas herbáceas; Acaulospora delicata Walker, Pfeiffer & Bloss. y Glomus clarum Nicolson & Schenck, halladas en ambos sitios. Estas especies son citadas, descriptas e ilustradas por primera vez para Argentina. Glomus etunicatum Becker & Gerdemann ha sido citada pero no descripta e ilustrada para nuestro país.The presence of arbuscular mycorrhizal fungi associated with plants from an agroecosystem and a native forest, in Buenos Aires province is studied. The species that correspond a new register for Argentina are: Scutellospora dipapillosa (Walker & Koske Walker & Sanders and Scutellospora fulgida Koske & Walker found in the rhizosphere of Triticum aestivum L.; Scutellospora gilmorei (Trappe & Gerd. Walker & Sanders, in the rhizosphere of Celtis tala Gill. Ex Planch., Scutia buxifolia Reiss. and herbaceous plants; Acaulospora delicata Walker, Pfeiffer & Bloss. and Glomus clarum Nicolson & Schenck, occurred in both sites. They are cited, described and illustrated for the first time from Argentina. Glomus etunicatum Becker & Gerdemann was previously cited although it was not described and illustrated from Argentina.

  1. Estudio preliminar de leptospirosis en roedores y canes en salitral, Piura-1999

    Directory of Open Access Journals (Sweden)

    Rosa Sacsaquispe C

    2003-03-01

    Full Text Available Objetivo: Determinar serológica y bacteriológicamente la presencia de Leptospira en muestras de suero y riñón de carnes y roedores, del distrito de Salitral, departamento de Piura (norte del Perú.Materiales y métodos: Estudio realizado en octubre de 1999. Se capturaron roedoresutilizando trampas tomahawk en las localidades de Salitral y Malacasi. Se utilizó la prueba de aglutinación microscópica (MAT para la detección de anticuerpos y el cultivo de tejido de riñón para el estudio bacteriológico. Asimismo, se evaluaron muestras de suero de canes de la localidad del Salitral.Resultados: 2 de 12 roedores identificados como Rattus rattus (16,6% reaccionaron con Leptospira serovar grypotyphosa a un título de 1/200 y 1/400, en tanto que una de las 3 muestras de suero de can colectadas reaccionó con Leptospira serovar canicola. De los 12 cultivos de las muestras de riñón de roedores ninguno fue positivo a Leptospira. Conclusiones: La detección de anticuerpos contra Leptospira en el distrito de Salitral sugiere ampliar los estudios de Leptospira en la zona.

  2. Efecto de inoculantes microbianos sobre la promoción de crecimiento de plántulas de mangle y plantas de Citrullus vulgaris San Andrés Isla, Colombia

    Directory of Open Access Journals (Sweden)

    Galindo-Castañeda T.

    2005-12-01

    Full Text Available Con el fin de probar la efectividad de dos inoculantes microbianos (producidos a partir de raicillas de mangle rojo y negro en el crecimiento y establecimiento de plántulas de mangle y de patilla, se realizaron cuatro pruebas en campo en San Andrés isla, Colombia. Se aplicaron dichos inoculantes
    en: propágulos de Avicennia germinans colectados en un área de manglar, plántulas de A. germinans y Rhizophora mangle colectadas en cercanía de árboles semilleros, plántulas de A. germinans y R. mangle sembradas y mantenidas en vivero y en semillas de patilla sembradas en un cultivo tradicional libre de fertilizantes químicos. Las variables tomadas como indicativo de crecimiento y desarrollo vegetal fueron: número de nodos, número de hojas y longitud del tallo. Se aislaron selectivamente microorganismos solubilizadores de fosfatos -MSF- y fijadores de nitrógeno -BFNescogiendo los de mayor eficiencia mediante métodos cuantitativos in vitro, para posterior fermentación
    bajo condiciones controladas. Los inoculantes obtenidos se aplicaron en el material vegetal mencionado, efectuando mediciones durante tres meses. Los resultados muestran un efecto positivo de estimulación de crecimiento medido en longitud del tallo en las plantas tratadas con los inoculantes, específicamente en patilla y propágulos de A. germinans mantenidos en vivero.

  3. EFECTO DE INOCULANTES MICROBIANOS SOBRE LA PROMOCIÓN DE CRECIMIENTO DE PLÁNTULAS DE MANGLE Y PLANTAS DE Citrullus vulgaris SAN ANDRÉS ISLA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    TANIA GALINDO

    2006-01-01

    Full Text Available Con el fin de probar la efectividad de dos inoculantes microbianos (aislados a partir de raicillas de mangle rojo y negro en el crecimiento y establecimiento de plántulas de mangle y de patilla, se realizaron cuatro pruebas en campo en San Andrés Isla, Colombia. Se aplicaron dichos inoculantes en: propágulos de Avicennia germinans colectados en un área de manglar y sembrados en macetas sobre sustrato solarizado (con el fin de disminuir la carga microbiana, plántulas de A. germinans y Rhizophora mangle colectadas en cercanía de árboles semilleros, plántulas de A. germinans y R. mangle sembradas y mantenidas en vivero y en semillas de patilla (Citrullus vulgaris sembradas en un cultivo libre de fertilizantes químicos. Las variables tomadas como indicativo de crecimiento y desarrollo vegetal fueron: número de nodos, número de hojas y longitud del tallo. Los inoculantes (microorganismos solubilizadores de fosfa- tos -MSF- y bacterias fijadoras de nitrógeno -BFN- se aplicaron en el material vegetal mencionado, efectuando mediciones durante tres meses. Los resultados muestran un efecto positivo de estimulación de crecimiento medido en longitud del tallo en las plantas tratadas con los inoculantes, específicamente en patilla y propágulos de A. germinans mantenidos en vivero.

  4. DESCRIPCIÓN MACROSCÓPICA DEL DESARROLLO LARVAL DEL COPORO (PROCHILODUS MARIAE

    Directory of Open Access Journals (Sweden)

    N. López

    2005-01-01

    Full Text Available El presente estudio fue realizado en la estación piscícola La Terraza, unidad perteneciente al Instituto Colombiano de Desarrollo Rural (INCODER y adscrita a la Facultad de Medicina Veterinaria y de Zootecnia de la Universidad Nacional de Colombia, localizada en la ciudad de Villavicencio (Meta. Fueron utilizadas larvas de coporo (Prochilodus mariae, obtenidas por reproducción inducida, que fueron colectadas desde la eclosión y cada 6 horas hasta la reabsorción del saco vitelino. Con la ayuda de una balanza de precisión y un estereoscopio con ocular micrométrico se registraron el peso, la longitud total y la longitud y altura del saco vitelino. Los resultados mostraron que las larvas midieron 3,11±0,42 mm y pesaron 0,43±0,15 mg en el momento de la eclosión y 5,94±0,23 mm y 0,95±0,13 mg al final del estudio. El volumen del saco vitelino fue de 0,655 mm3 en la eclosión y de 0,0074 mm3 a las 74 horas posteclosión (HPE. Las larvas completaron su desarrolloa las 84 HPE, presentaron abertura completa de la boca, llenado de la vejiga gaseosa y natación horizontal.

  5. DESCRIPCIÓN MACROSCÓPICA DEL DESARROLLO LARVAL DEL COPORO (Prochilodus mariae

    Directory of Open Access Journals (Sweden)

    Landines M.

    2005-11-01

    Full Text Available El presente estudio fue realizado en la estación piscícola La Terraza, unidad perteneciente al Instituto Colombiano de Desarrollo Rural (INCODER y adscrita a la Facultad de Medicina Veterinaria y de Zootecnia de la Universidad Nacional de Colombia, localizada en la ciudad de Villavicencio (Meta. Fueron utilizadas larvas de coporo (Prochilodus mariae, obteni¬das por reproducción inducida, que fueron colectadas desde la eclosión y cada 6 horas hasta la reabsorción del saco vitelino. Con la ayuda de una balanza de precisión y un estereoscopio con ocular micrométrico se registraron el peso, la longitud total y la longitud y altura del saco vitelino. Los resultados mostraron que las larvas midieron 3,11±0,42 mm y pesaron 0,43±0,15 mg en el momento de la eclosión y 5,94±0,23 mm y 0,95±0,13 mg al final del es¬tudio. El volumen del saco vitelino fue de 0,655 mm3 en la eclosión y de 0,0074 mm3 a las 74 horas posteclosión (HPE. Las larvas completaron su desarrollo a las 84 HPE, presentaron abertura completa de la boca, llenado de la vejiga gaseosa y natación horizontal.

  6. DISTRIBUCIÓN DE DOS INDICADORES BACTERIANOS DE CALIDAD DE AGUA EN EL GOLFO DE URABÁ, CARIBE COLOMBIANO

    Directory of Open Access Journals (Sweden)

    GÓMEZ VELÁSQUEZ. FELIPE ANDRÉS

    2010-05-01

    Full Text Available Entre el 13 de Junio de 2006 y el 16 de Junio de 2007, las bacterias indicadoras de calidad ambiental y sanitaria, Coliformes Totales (CT y Coliformes Fecales (CF, fueron determinadas en las aguas del Golfo de Urabá, Colombia, empleando el método del NMP, mediante la técnica de tubos múltiples. El estudio fue realizado para evaluar la distribución de estos indicadores microbianos a nivel vertical y horizontal y la relación con algunas variables fisicoquímicas de temperatura del agua, salinidad, oxígeno disuelto y pH; y para así poder definir la relevancia de estos indicadores en ecosistemas marinos. La mayoría de las muestras colectadas presentó concentraciones de los indicadores menores o iguales a la norma. Las áreas donde se determinó la mayor concentración de bacterias coniformes, correspondieron a los sitios ubicados cerca de la desembocadura de los ríos Atrato y León, donde las concentraciones salinas fueron bajas. El análisis estadístico muestra la salinidad como el principal factor ambiental responsable de la concentración y distribución de las bacterias CT y CF para las estaciones evaluadas en el Golfo de Urabá, evidenciando un efecto inhibidor sobre estos dos indicadores.

  7. MAMÍFEROS PEQUEÑOS EN LA DIETA DE LA LECHUZA TYTO ALBA (STRIGIFORMES: TYTONIDAE EN DOS LOCALIDADES DEL OCCIDENTE DE ECUADOR, CON AMPLIACIÓN DISTRIBUCIONAL DE ICHTHYOMYS HYDROBATES (RODENTIA: CRICETIDAE

    Directory of Open Access Journals (Sweden)

    JORGE BRITO M.

    2015-01-01

    Full Text Available En el presente estudio a partir de 107 egagrópilas de la lechuza, determinamos el consumo de 300 presas agrupadas en 21 especies, las egagrópilas fueron colectadas en dos localidades de diferente ambiente Los Santiagos y La Ciénaga, en las provincias de Chimborazo y Manabí, al occidente de Ecuador. Nuestros análisis revelaron una dieta compuesta mayoritariamente de mamíferos pequeños, sobre todo roedores, quienes constituyeron el 80%. Entre las presas más abundantes se encontró a Oligoryzomys sp. que representó el 38.7% de la dieta en las muestras de Los Santiagos y Sigmodon peruanus 33.6% en La Ciénaga, siendo el 22,5% y 41% respectivamente de la biomasa total consumida para cada sitio. La rata cangrejera Ichthyomys hydrobates es reportada por primera vez en la dieta de la lechuza y también en la localidad de Los Santiagos, ampliando el rango distribucional de este roedor para el centro-sur al occidente de Ecuador en aproximadamente 200 km.

  8. Protozoarios parásitos de importancia en salud pública transportados por Musca domestica Linnaeus en Lima, Perú

    Directory of Open Access Journals (Sweden)

    Martín Cárdenas

    2013-06-01

    Full Text Available El presente trabajo investiga los protozoarios parásitos de importancia para la salud pública transportados por Musca domestica. El estudio se llevó a cabo entre los meses de junio y diciembre de 1998, en los distritos de Comas y San Juan de Lurigancho de la provincia de Lima. Se estudiaron 3014 moscas colectadas en la basura acumulada en la vía pública de los pueblos jóvenes de los distritos mencionados. Las capturas se agruparon en lotes constituidos por un promedio de 30 moscas. Se estudiaron un total de 100 lotes. Las moscas fueron disecadas y procesadas con agua destilada estéril para obtener un macerado intestinal. Para la observación de los parásitos se utilizó el método directo simple y la coloración tricrómica de Gomori ácido resistente modificado. Se encontraron los siguientes protozoarios que parasitan al hombre: Blastocystis hominis (9,0%, Giardia lamblia (3,0%, Cryptosporidium sp. (2,0%, Cyclospora cayetanensis (1,0%, Iodamoeba bütschlii (17,0%, Endolimax nana (5,0% y Chilomastix mesnili (3,0%. Se reporta por primera vez para el Perú a B. hominis y Cyclospora cayetanensis en M. domestica.

  9. Separación e identificación de algunas toxinas del veneno de Centruroides margaritatus (Gervais,1841 (Scorpiones : Buthidae

    Directory of Open Access Journals (Sweden)

    Enrique Escobar

    2013-06-01

    Full Text Available Las proteínas del veneno del escorpión Centruroides margaritatus, fueron separadas mediante cromatografía de intercambio catiónico en CM-Sephadex C-25 con buffer acetato de amonio 0,05M a pH 7, a partir de 28,3 mg de veneno obtenidos de 52 ejemplares adultos capturados en la provincia de Zarumilla, Tumbes, norte del Perú. El perfil cromatográfico mostró la presencia de 9 picos de proteína y los ensayos de toxicidad han permitido identificar tres tipos de toxinas, cada una específica para crustáceos, insectos y roedores, respectivamente. Tanto en el veneno crudo como en las fracciones colectadas, no se encontró actividad de fosfolipasa ni actividad proteolítica. La PAGE-SDS del veneno crudo, muestra la presencia de una banda bastante notoria de aproximadamente 14 KDa, y otras dos muy tenues, de aproximadamente 45KDa, lo cual significa que la mayoría de proteínas de este veneno son de peso molecular igual o menor a 14KDa.

  10. Estudio bioquímico del veneno de Tityus kaderkai(Scorpiones: Buthidae con notas sobre su distribución y hábitat en el Perú

    Directory of Open Access Journals (Sweden)

    Enrique Escobar

    2013-12-01

    Full Text Available Se ha estudiado bioquímicamente el veneno del escorpión Tityus kaderkai Kovařik, 2005 del departamento de Madre de Dios. El veneno soluble contiene 47.6% de proteína y por PAGESDS muestra cinco bandas proteicas. Las proteínas del veneno fueron separadas, a partir de 12.9 mg de veneno, mediante cromatografía de intercambio catiónico en CM Sephadex C-25 con buffer acetato de amonio 0.05 M pH 7, obteniéndose 7 picos proteicos (I – VII. Los ensayos de toxicidad han permitido identificar tres toxinas que afectan a Mus musculus y que se encuentran asociadas a los picos IV, V y VII; asimismo, se ha detectado toxicidad sobre Gryllus sp. en los picos IV, V, VI y VII. Entre las actividades enzimáticas ensayadas, se ha encontrado actividad proteolítica sobre caseína en el pico I y actividad de hialuronidasa en el pico IV con una actividad específica de 205.6 μg/min/mg. Tanto en el veneno soluble como en las fracciones colectadas no se encontró actividad de fosfolipasa, anticoagulante ni hemolítica. El trabajo incluye notas sobre la distribución y el hábitat de la especie.

  11. Viabilidad y germinación de semillas de tres especies arbóreas nativas de la selva tropical, Chiapas, México

    Directory of Open Access Journals (Sweden)

    Carolina Orantes-García

    2015-08-01

    Full Text Available Se determinó la proporción de semillas viables y la pérdida de viabilidad debido al periodo de almacenamiento, así como el efecto de tratamientos pregerminativos que favorecen la germinación en semillas deCordia alliodora, Terminalia amazoniayBursera bipinnata, árboles nativos de la selva tropical, Chiapas, México. Se encontró que las semillas recién colectadas presentaron más del 90% de viabilidad, la cual fue disminuyendo hasta mostrar un 15% enB. bipinnata, 34% enC. alliodoray 18% enT. amazoniadespués de 12 meses de almacenamiento. De acuerdo con la germinación acumulada se encontraron diferencias significativas entre los tratamientos (pB. bipinnata63%,C. alliodora62% yT. amazonia54%. En conclusión, para poder obtener un mayor porcentaje de semillas germinadas en poco tiempo, es necesario dar un tratamiento previo a la siembra para las semillas de estas especies. El almacenamiento de las semillas durante un año provocó una declinación en la capacidad germinativa.

  12. Detección de anticuerpos contra Borrelia burgdorferi e identificación de garrapatas ixodidas en Piura Y Amazonas, Perú

    Directory of Open Access Journals (Sweden)

    Martha Glenny A

    2004-01-01

    Full Text Available Objetivos: Detectar anticuerpos IgG/IgM contra Borrelia burgdorferi en población general, procedentes de los departamentos de Piura y Amazonas e identificar especies de garrapatas probablemente incriminadas en la transmisión de la enfermedad de Lyme. Material y Métodos: Entre agosto del año 2001 y junio de 2002, se colectaron muestras de sangre de 232 pobladores procedentes de ocho localidades del Departamento de Piura y 12 del Departamento de Amazonas, para evaluar mediante ELISA Captia™ Lyme IgG/IgM (Trinity biotech la presencia de anticuerpos contra Borrelia burgdorferi. Además, se colectaron garrapatas en animales domésticos por búsqueda directa. Resultados: Se detectó seropositividad en 9,9 % de los sueros evaluados. Asimismo, de 433 garrapatas colectadas se identificaron los géneros: Ixodes (5,5%, Amblyomma (18,0%, Rhipicephalus (23,5%, Anocentor (31,1% y Boophilus (21,7%. Conclusiones: Existen personas seropositivas por Borrelia en Piura y Amazonas, coincidiendo con los hallazgos realizados en Sapillica en el año 1992, además se detectó la presencia de garrapatas del género Ixodes en Piura.

  13. El desarrollo temprano del calamar patagónico Loligo gahi D’Orbigny,1835 en aguas peruanas (Cephalopoda: Loliginidae

    Directory of Open Access Journals (Sweden)

    Franz Cardoso

    2013-05-01

    Full Text Available El desarrollo temprano del calamar patagónico, Loligo gahi D’Orbigny, 1835 fue estudiado en el campo y en el laboratorio. Las puestas colectadas en la Isla San Lorenzo, Perú, fueron transferidas al laboratorio, e incubadas en un sistema cerrado de agua marina. Las cápsulas midieron de 88 a 169 mm de longitud y cada cápsula contenía entre 56 y 114 huevos fertilizados. Los huevos midieron de 1,7 a 2,1 mm de longitud y la longitud del manto de los individuos eclosionados varió de 1,9 a 2,8 mm. El desarrollo de las paralarvas se logró a los 20 días, a una temperatura promedio de 19 ºC. El patrón de desarrollo embrionario es similar al observado en otras especies de Loligo. Las paralarvas sobrevivieron 45 días con una dieta de zooplancton (copepódos, micidáceos y larvas de poliquetos.

  14. Review: Biological fertilization and its effect on medicinal and aromatic plants

    Directory of Open Access Journals (Sweden)

    KHALID ALI KHALID

    2012-11-01

    Full Text Available Khalid KA. 2012. Review: Biological fertilization and its effect on medicinal and aromatic plants. Nusantara Bioscience 4: 124-133. The need of increase food production in the most of developing countries becomes an ultimate goal to meet the dramatic expansion of their population. However, this is also associated many cases with a reduction of the areas of arable land which leaves no opinion for farmers but to increase the yield per unit area through the use of improved the crop varieties, irrigation and fertilization. The major problem facing the farmer is that he cannot afford the cost of these goods, particularly that of chemical fertilizers. Moreover, in countries where fertilizer production relies on imported raw materials, the costs are even higher for farmer and for the country. Besides this, chemical fertilizers production and utilization are considered as air, soil and water polluting operations. The utilization of bio-fertilizers is considered today by many scientists as a promising alternative, particularly for developing countries. Bio-fertilization is generally based on altering the rhizosphere flora, by seed or soil inoculation with certain organisms, capable of inducing beneficial effects on a compatible host. Bio-fertilizers mainly comprise nitrogen fixes (Rhizobium, Azotobacter, Azospirellum, Azolla or blue green algae, phosphate dissolvers or vesicular-arbuscular mycorrhizas and silicate bacteria. These organisms may affect their host plant by one or more mechanisms such as nitrogen fixation, production of growth promoting substances or organic acids, enhancing nutrient uptake or protection against plant pathogens. Growth characters, yield, essential oil and its constituents, fixed oil, carbohydrates, soluble sugars and nutrients contents of medicinal and aromatic plants were significantly affected by adding the biological fertilizers compared with recommended chemical fertilizers.

  15. Diquat associated with copper sources for algae control: Efficacy and ecotoxicology.

    Science.gov (United States)

    Garlich, Nathalia; Da Cruz, Claudinei; Da Silva, Adilson F; Carraschi, Silvia P; Malaspina, Igor C; Pitelli, Robinson A; Bianco, Silvano

    2016-01-01

    The aims of this research were to evaluate the efficacy of copper oxychloride (CuCl2.3Cu(OH)2), copper hydroxide (Cu(OH)2) and diquat (1.1'-ethylene-2.2'-bipyridyldiylium dibromide), isolated and in association with 0.1% of both copper sources, in the control of the unicellular algae Ankistrodesmus gracilis and the filamentous algae Pithophora kewesis, and to determine the acute toxicity of the tested chemicals in Hyphressobrycon eques, Pomacea canaliculata, Lemna minor and Azolla caroliniana. The efficacy was estimated by the methods of chlorophyll a and pheophytin a readings, changed into growth inhibition percentage. Both algae were exposed to the following concentrations: 0.2; 0.4; 0.8; 1.2 mg L(-1) of diquat and its association with the copper sources; and 0.1; 0.3; 0.5; 0.7; 1.0 and 1.5 mg L(-1) in the isolated applications of copper hydroxide and copper oxychloride. An untreated control was kept. The acute toxicity was estimatedby 50% lethal concentration (LC50). The copper sources were effective for A. gracilis control, at rates as high as 0.1 mg L(-1) (>95% efficacy). Isolated diquat and its association with copper hydroxide were both effective at rates as high as 0.4 mg L(-1), with 95 and 88% control efficacy, respectively. The copper oxychloride was effective at 0.2 mg L(-1), with 93% efficacy. None of the tested chemicals and associations was effective on P. kewesis control. The most sensitive non target organism to the tested chemicals was L. minor; the less sensitive was H. eques.

  16. Interactions of gold nanoparticles with freshwater aquatic macrophytes are size and species dependent.

    Science.gov (United States)

    Glenn, J Brad; White, Sarah A; Klaine, Stephen J

    2012-01-01

    The partitioning of 4- and 18-nm gold nanoparticles (AuNPs) to aquatic macrophytes was investigated in vivo with exposure suspension in well water. Three morphologically distinct aquatic macrophytes were studied. Myriophyllum simulans Orch. and Egeria densa Planch. are submerged aquatic vascular plants, whereas Azolla caroliniana Willd. is a free-floating aquatic fern. Because aquatic plants absorb the majority of their nutrients from the water column, it is logical to hypothesize that they may absorb nanomaterials in suspension, potentially facilitating trophic transfer. Each plant was exposed to two different-sized gold nanospheres at a nominal concentration of 250 µg/L AuNPs for 24 h. Macrophytes were harvested at six time points (1, 3, 6, 12, 18, and 24 h), dried, and then analyzed for gold concentration via inductively coupled plasma-mass spectrometry. Concentrations were normalized to whole-plant dry tissue mass. The present study shows that absorption of AuNPs through root uptake was size and species dependent. Electron microscopy revealed that 4- and 18-nm AuNPs adsorbed to the roots of each species. Root tissue was sectioned, and transmission electron microscopy indicated that 4-nm and 18-nm AuNPs were absorbed by A. caroliniana, whereas only 4-nm AuNPs were absorbed by M. simulans. Egeria densa did not absorb AuNPs of either size. Gold nanoparticles were confirmed in tissue by using energy-dispersive X-ray spectroscopy. Absorption of AuNPs by plants may be a function of the salinity tolerance of each species.

  17. Multiple Modes of Cell Death Discovered in a Prokaryotic (Cyanobacterial Endosymbiont.

    Directory of Open Access Journals (Sweden)

    Weiwen Zheng

    Full Text Available Programmed cell death (PCD is a genetically-based cell death mechanism with vital roles in eukaryotes. Although there is limited consensus on similar death mode programs in prokaryotes, emerging evidence suggest that PCD events are operative. Here we present cell death events in a cyanobacterium living endophytically in the fern Azolla microphylla, suggestive of PCD. This symbiosis is characterized by some unique traits such as a synchronized development, a vertical transfer of the cyanobacterium between plant generations, and a highly eroding cyanobacterial genome. A combination of methods was used to identify cell death modes in the cyanobacterium. Light- and electron microscopy analyses showed that the proportion of cells undergoing cell death peaked at 53.6% (average 20% of the total cell population, depending on the cell type and host developmental stage. Biochemical markers used for early and late programmed cell death events related to apoptosis (Annexin V-EGFP and TUNEL staining assays, together with visualization of cytoskeleton alterations (FITC-phalloidin staining, showed that all cyanobacterial cell categories were affected by cell death. Transmission electron microscopy revealed four modes of cell death: apoptotic-like, autophagic-like, necrotic-like and autolytic-like. Abiotic stresses further enhanced cell death in a dose and time dependent manner. The data also suggest that dynamic changes in the peptidoglycan cell wall layer and in the cytoskeleton distribution patterns may act as markers for the various cell death modes. The presence of a metacaspase homolog (domain p20 further suggests that the death modes are genetically programmed. It is therefore concluded that multiple, likely genetically programmed, cell death modes exist in cyanobacteria, a finding that may be connected with the evolution of cell death in the plant kingdom.

  18. Distribution patterns and changes of aquatic plant communities in Napahai Wetland in northwestern Yunnan Plateau,China

    Institute of Scientific and Technical Information of China (English)

    Derong XIAO; Kun TIAN; Hua YUAN; Yuming YANG; Ningyun LI; Shouguo XU

    2008-01-01

    Using GPS technology and community research methods for plant communities,we investigated the distribution patterns of aquatic plant communities in the high plateaus of the Napahai Wetlands,Yunnan,China,as well as the species changes of plant communities compared with that of 24 years ago since 2005.We found that the types and numbers of aquatic plant communities have changed.Some pollution-tolerant,nutrient-loving plant communities such as Scirpus tabernaemontani,Zizania caduciflora,Myriophyllum spicatum,and Azolla imbricata flourished,while the primary aquatic plant com-munities were reduced or even disappeared.The number of aquatic plant communities were increased from nine to 12 with the addition of two new emergent plant com-munities and one new floating-leaved plant community.The increase in emergent plant communities was signifi-cant.From east to west and from south to north,various types of plant communities were continuously distributed,including floating-leaved plant communities,emergent plant communities and submerged plant communities.The composition of the communities became more com-plicated and the number of accompanying species increased,while the percentage ratio of dominant plant species declined.In 2005,the coverage of emergent plant communities was the largest (528.42 hm2) followed by submerged plant communities (362.50 hm2) and the float-ing-leaf plant communities was the smallest (70.23 hm2).The variations in the distribution of aquatic plant com-munities in the Napahai Wetlands reflect the natural responses to the change of the wetland ecological envir-onment.This study indicates that human disturbances have led to an inward movement of the wetland shoreline,a decrease in water quality and a reduction in wetland habitat.

  19. Towards an agro-ecological village at the Flora Community : reducing greenhouse gas emissions through organic based farming and energy self reliance

    Energy Technology Data Exchange (ETDEWEB)

    Samson, R.; Mulkins, L. [Resource Efficient Agricultural Production-Canada, Ste. Anne de Bellevue, PQ (Canada); Amongo, L.; Yap, E. [MASIPAG, Los Banos, Laguna (Philippines); Mendoza, T. [Univ. of the Philippines Los Banos, Laguna (Philippines). Dept of Agronomy

    2000-07-01

    A former haciendero owned sugarcane plantation in Negros Occidental, Philippines was transformed into a diversified, self-reliant, agro-ecological village, and its transition is documented in this paper. In 1995, through the Comprehensive Agrarian Reform Program, the Philippine Government awarded 87 hectares of land to 76 hacienda workers. Community organizing, farm planning, training in organic farming, and loan support from a number of social welfare agencies were all areas where the community received assistance. The sugarcane production has been reduced at Flora since the land transition, and the community diversified into the growing of organic rice, corn and vegetables. Through its transition into an agro-ecological village, the Flora community has become more self-reliant in the areas of food and energy. Most individual farms and communally farmed areas have adopted organic based farming practices. The main products sold off the farm are sugarcane and high value vegetables. The MASIPAG rice farming system is being adhered to in the production of rice, the community's staple food. Nitrogen fixed during straw decomposition and the use of azolla, a nitrogen-fixing plant, represent some of the sources of nitrogen for the rice production. Other nutrient sources used are the mudpress from sugarcane processing and rice hull ash. To encourage nitrogen fixation and soil carbon accumulation from cane litter, a system of continuous trash farming was implemented for the production of sugarcane. In excess of 140 water buffaloes (carabaos) are employed for tillage and on-farm hauling, which minimizes the requirements for fossil fuels. Liquid propane gas (LPG), kerosene and wood fuel use in home cooking are being minimized by the efficient rice hull cookers. The local environmental impacts and greenhouse gas emissions are minimized, and the Flora community largely meets its requirements in terms of food security, on-farm energy and income. refs., 1 tab., 12 figs.

  20. Oxygen uptake from aquatic macrophyte decomposition from Piraju Reservoir (Piraju, SP, Brazil

    Directory of Open Access Journals (Sweden)

    I. Bianchini Jr.

    Full Text Available The kinetics of oxygen consumption related to mineralisation of 18 taxa of aquatic macrophytes (Cyperus sp, Azolla caroliniana, Echinodorus macrophyllus, Eichhornia azurea, Eichhornia crassipes, Eleocharis sp1, Eleocharis sp2, Hetereanthera multiflora, Hydrocotyle raniculoides, Ludwigia sp, Myriophyllum aquaticum, Nymphaea elegans, Oxycaryum cubense, Ricciocarpus natans, Rynchospora corymbosa, Salvinia auriculata, Typha domingensis and Utricularia foliosa from the reservoir of Piraju Hydroelectric Power Plant (São Paulo state, Brazil were described. For each species, two incubations were prepared with ca. 300.0 mg of plant (DW and 1.0 L of reservoir water sample. The incubations were maintained in the dark and at 20 ºC. Periodically the dissolved oxygen (DO concentrations were measured; the accumulated DO values were fitted to 1st order kinetic model and the results showed that: i high oxygen consumption was observed for Ludwigia sp (533 mg g-1 DW, while the lowest was registered for Eleocharis sp1 (205 mg g-1 DW mineralisation; ii the higher deoxygenation rate constants were verified in the mineralisation of A. caroliniana (0.052 day-1, H. raniculoides (0.050 day-1 and U. foliosa (0.049 day-1. The oxygen consumption rate constants of Ludwigia sp and Eleocharis sp2 mineralisation (0.027 day-1 were the lowest. The half-time of oxygen consumption varied from 9 to 26 days. In the short term, the detritus of E. macrophyllus, H. raniculoides, Ludwigia sp, N. elegans and U. foliosa were the critical resources to the reservoir oxygen demand; while in the long term, A. caroliniana, H. multiflora and T. domingensis were the resources that can potentially contribute to the benthic oxygen demand of this reservoir.

  1. Microrefugia and species persistence in the Galápagos highlands: A 26,000-year paleoecological perspective.

    Directory of Open Access Journals (Sweden)

    Aaron F Collins

    2013-12-01

    Full Text Available The Galápagos Islands are known to have experienced significant drought during the Quaternary. The loss of mesophytic upland habitats has been suggested to underlie the relatively lower endemism of upland compared with lowland plant assemblages. A fossil pollen record spanning the last 26,000 years from an upland bog on Santa Cruz Island, revealed the persistent presence of highland pollen and spore types during the last glacial maximum and a millennial-scale series of droughts in the mid Holocene. The absence of lowland taxa and presence of mesic taxa led to the conclusion that the highland flora of the Galápagos persisted during both these periods. The resiliency of the highland flora of the Galápagos to long-term drought contradicts an earlier hypothesis that an extinction of highland taxa occurred during the last glacial maximum and that rapid Holocene speciation created the modern plant assemblage within the last 10,000 years. Based on the palynological data, we suggest that, even during the height of glacial and Holocene droughts, cool sea-surface temperatures and strong trade-wind activity would have promoted persistent ground level cloudiness that provided the necessary moisture inputs to maintain microrefugia for mesophytic plants. Although moist conditions were maintained, the lack of precipitation caused the loss of open water habitat during such events, and accounts for the known extinctions of species such as Azolla sp., and Elatine sp., while other moisture dependent taxa, i.e. Cyathea weatherbyana, persisted.

  2. Sensitivity of aquatic organisms to ethanol and its potential use as bioindicators

    Directory of Open Access Journals (Sweden)

    Adilson Ferreira Silva

    2016-12-01

    Full Text Available The aim of this research was to evaluate the feasibility for the use of the organisms Lemna minor, Azolla caroliniana, Hyphessobrycon eques, Pomacea canaliculata and Daphnia magna as exposure bioindicators for ethanol (lethal and effective concentration 50% - LC50(I/EC50(I. Thus, the following concentrations were used 5.0; 10.0; 20.0; 30.0; 40.0 and 50.0 mg L-1 ethanol on L. minor; 25.0; 50.0; 75.0; 100.0; 150.0 and 200.0 mg L-1 on A. caroliniana; 0.3; 0.5; 1.0; 2.0 and 3.0 mg L-1 on H. eques; 0.05; 0.10; 0.20; 0.40 and 0.80 mg L-1 on P. canaliculata; and 40.0; 60.0; 80.0; 100.0; 120.0 and 140.0 mg L-1 on D. magna. An untreated control was also kept for all organisms, with three repetitions. The increase in the ethanol concentration elevated the electrical conductivity and decreased the water dissolved oxygen and pH. The ethanol LC50 for L. minor and A. caroliniana were 12.78 and 73.11 mg L-1, respectively, and was classified as slightly toxic; 1.22 mg L-1 for H. eques (moderately toxic; 0.39 mg L-1 for P. canaliculata (highly toxic and 98.85 mg L-1 for D. magna (slightly toxic. Thus, H. eques and P. canaliculata have showed good potential for the use as ethanol exposure bioindicators on water bodies.

  3. Palynoflora from Deccan volcano-sedimentary sequence (Cretaceous-Palaeogene transition) of central India: implications for spatio-temporal correlation

    Indian Academy of Sciences (India)

    B Samant; D M Mohabey

    2009-11-01

    The sedimentary beds associated with Deccan Continental Flood Basalt (DCFB) sequences exposed in the volcanic subprovinces of Jabalpur-Mandla-Chhindwara (JMC) regions of Madhya Pradesh and Nand-Dongargaon (N-D) basin and the adjoining areas to the west in Yeotmal-Nanded in Maharashtra were studied for their palynofloral analysis. The sediments were characterized palynologically and changes in the palynoflora are observed at different stratigraphic levels in a number of sections including several new intertrappean localities recorded in recent years. For the purpose of effective correlation of different subprovinces, palynofloras of some of the previously studied intertrappeans are also reviewed. Our studies suggest that before the start of the Deccan volcanic activity, the palynoflora found in the Lameta sediments, was dominated by gymnosperms-angiosperm association. The plant canopy consisted mainly of gymnosperms (Conifers and Podocarpaceae) whereas, the understory members were mostly of palms and herbs (Poaceae and Asteraceae). The eruption of Deccan volcanic flows severely affected the existing floral association and proved fatal for the well established plant community. The immediately overlying sediments associated with the earliest volcanic flows are dominated by pteridophytes and angiosperm taxa (Azolla cretacea, Aquilapollenites bengalensis, Ariadnaesporites sp., Gabonisporis vigourouxii and Triporoletes reticulatus). Higher up in the stratigraphic sequence, similar forms continued with simultaneous appearance of new taxa including Scabrastephanocolpites spp. At still higher stratigraphic levels, abundance of fungi especially the mycorrhizal fungi, concurrent with sharp decline in pollen/spore recovery was observed. In the culminating phase (i.e. Palaeocene) of Deccan volcanic history a new palynofloral assemblage of typical Palaeocene taxa (Dandotiaspora dilata, D. pseudoauriculata, D. plicata, Spinizonocolpites echinatus, Matanomadhiasulcites sp., and

  4. Oxygen uptake from aquatic macrophyte decomposition from Piraju Reservoir (Piraju, SP, Brazil).

    Science.gov (United States)

    Bianchini Jr, I; Cunha-Santino, M B; Panhota, R S

    2011-02-01

    The kinetics of oxygen consumption related to mineralisation of 18 taxa of aquatic macrophytes (Cyperus sp, Azolla caroliniana, Echinodorus macrophyllus, Eichhornia azurea, Eichhornia crassipes, Eleocharis sp1, Eleocharis sp2, Hetereanthera multiflora, Hydrocotyle raniculoides, Ludwigia sp, Myriophyllum aquaticum, Nymphaea elegans, Oxycaryum cubense, Ricciocarpus natans, Rynchospora corymbosa, Salvinia auriculata, Typha domingensis and Utricularia foliosa) from the reservoir of Piraju Hydroelectric Power Plant (São Paulo state, Brazil) were described. For each species, two incubations were prepared with ca. 300.0 mg of plant (DW) and 1.0 L of reservoir water sample. The incubations were maintained in the dark and at 20 ºC. Periodically the dissolved oxygen (DO) concentrations were measured; the accumulated DO values were fitted to 1st order kinetic model and the results showed that: i) high oxygen consumption was observed for Ludwigia sp (533 mg g-1 DW), while the lowest was registered for Eleocharis sp1 (205 mg g-1 DW) mineralisation; ii) the higher deoxygenation rate constants were verified in the mineralisation of A. caroliniana (0.052 day-1), H. raniculoides (0.050 day-1) and U. foliosa (0.049 day-1). The oxygen consumption rate constants of Ludwigia sp and Eleocharis sp2 mineralisation (0.027 day-1) were the lowest. The half-time of oxygen consumption varied from 9 to 26 days. In the short term, the detritus of E. macrophyllus, H. raniculoides, Ludwigia sp, N. elegans and U. foliosa were the critical resources to the reservoir oxygen demand; while in the long term, A. caroliniana, H. multiflora and T. domingensis were the resources that can potentially contribute to the benthic oxygen demand of this reservoir.

  5. Effect of Anionic Surfactant Linear Alkylbenzene Sulfonate(LAS) on Physiological and Biochemical Characteristics of Aquatic Plants%阴离子型表面活性剂(LAS)对水生植物生理生化特性的影响

    Institute of Scientific and Technical Information of China (English)

    刘红玉; 周朴华; 杨仁斌; 廖柏寒; 鲁双庆; 余苹中

    2001-01-01

    采用室内培养实验方法, 以植物的生长量、过氧化氢酶(CAT)和过氧化物酶(POD)活性变化作为观测指标,研究了直链烷基苯磺酸钠(LAS)对稀脉浮萍(Lemna paucicostata L.)、满江红(Azolla imbricata(Roxb.) Nakai)、水网藻(Hydrodictyon sp.)生理生化特性的影响. 结果表明,当 LAS浓度超过 1 mg@ L-1时,稀脉浮萍的生长受到严重抑制,在 10、100 mg@ L-1下,出现负增长. CAT、POD活性变化与细胞受伤程度直接相关,可作为植物分子生态毒理学指标. LAS浓度在 0-10 mg@ L-1范围内,随着浓度升高,酶活性增加,清除细胞中由于 LAS产生的过氧化物伤害; 当浓度超过 10 mg@ L-1时,植物受到明显损伤,甚至死亡. 同时发现, CAT、POD活性水平与植物的类群直接相关, 被子植物稀脉浮萍的酶活性比蕨类植物满江红的高,藻类植物水网藻酶活性最低.

  6. Contaminantes orgánicos persistentes (COPs en leche materna de centros urbanos de la provincia de Buenos Aires

    Directory of Open Access Journals (Sweden)

    Lara Sofia Della Ceca

    2013-01-01

    Full Text Available Los contaminantes orgánicos persistentes (COPs se acumulan en matrices ricas en materia grasa como la leche materna, que es un buen indicador de sus niveles en poblaciones humanas debido a su fácil y no invasiva extracción. Con el objeto de evaluar la exposición a COPs en la provincia de Buenos Aires y compararla con otras  áreas, se analizaron bifenilos policlorados (PCBs, diclorodifeniltricloroetano (DDT y sus metabolitos (DDT, TDE, hexaclorociclohexanos (?, ? y ?-HCH y clordanos (CHLDs: heptaclor y su epóxido, trans y cis clordanos y nonaclors en muestras de leche materna colectadas durante 2010 y 2011 en Punta Lara, Ensenada, Florencio Varela y Capital Federal.Las  muestras fueron colectadas con sacaleches manuales, centrifugadas para separar la crema que fue liofilizada y extraída con éter de petróleo y ultrasonido. Los extractos previamente tratados con ácido para eliminación parcial de lípidos, fueron purificados por cromatografía en gel de sílice y analizados por cromatografía gaseosa.Las concentraciones de COPs en ng.g-1 lípido decrecieron en el orden DDTs (76±91 ? PCBs (67±64 > HCHs (33±36 ³ CHLDs (22±24.  Los DDTs oscilaron entre 7.7-510 ng.g-1 lípido y  los PCBs entre 5-247 ng.g-1 lípido, estos valores son comparables al rango más bajo reportado en la literatura (DDTs Noruega: 39-292 ng.g-1 lípido; PCBs Vietnam: 26-210 ng.g-1, Japón: 23-370 ng.g-1. En cambio, las concentraciones de HCHs y CHLDs, que oscilaron entre 5.8-197 ng.g-1 lípido y  1.3-124 ng.g-1 lípido respectivamente, corresponden al rango medio reportado para otras áreas (HCHs Indonesia 1.6-120 ng.g-1; CHLDs 3.4-92 ng.g-1. La composición de residuos en la leche materna es relativamente conservativa para cada clase de COPs, así se observa uniforme predominancia de productos de degradación (p.ej. DDE: 90±17% de SDDTs; epóxido de heptaclor: 50±18% y t-nonaclordano: 34±13% de SCHLDs y los isómeros y congéneres más persistentes (?-HCH

  7. Composición y distribución espacio-temporal de las comunidades de arañas (Arachnida: Araneae en el sistema de cultivo maíz-soya de la altillanura plana colombiana, municipio de Puerto López, Meta

    Directory of Open Access Journals (Sweden)

    Flórez Daza Eduardo

    2004-12-01

    Full Text Available Actualmente la región de los Llanos Orientales de Colombia, la cual pertenece al sistema de importancia mundial de Sabanas Tropicales, ha sido escenario de la expansión agrícola en las últimas décadas debido al desarrollo de plantas genéticamente modificadas tolerantes al aluminio y a la política del Ministerio de Agricultura de suplir las necesidades internas de maíz y soya con producción nacional. Con los cambios que se están generando en esta zona y por la evidencia que la araneofauna puede actuar como reguladora de las poblaciones de insectos plaga, se planteó el presente trabajo cuyo objetivo principal fue determinar la composición
    y dinámica espacio-temporal de la fauna de arañas en el sistema de cultivo maíz-soya en el municipio de Puerto López, departamento del Meta. Para lo anterior se seleccionó una finca con producción comercial maíz-soya donde se efectuaron seis muestreos en diferentes épocas: soya-desarrollo vegetativo, soya-precosecha, maíz-fructificación, maíz-precosecha y soya-fructificación, entre octubre de 2001 y diciembre de 2002. Para efectuar los muestreos se diseñó una cuadrícula con un total de 70 sitios de lectura, distanciados entre si 175 m; estos
    puntos fueron georreferenciados respecto a un origen arbitrario en los lotes. La cuadrícula se centró en los cultivos de interés (maíz-soya e incorporó lecturas en los siguientes ecosistemas aledaños: bosque de sabana, morichal, sabana nativa y sabana introducida. Los métodos
    de captura empleados fueron trampas de caída (Pitfall y aspirador entomológico (Dvac. Se estimó la abundancia, diversidad (Shannon-Weaver y Simpson y riqueza en cada una de las etapas del cultivo y en cada uno de los ecosistemas. Además, esta información fue analizada
    por medio de técnicas geoestadísticas, con las que se evaluó la dinámica espacio-temporal de los gremios de la araneofauna colectada. En total se colectaron 1.653 ara

  8. Metal pollution (Pb, Zn, Ni and Cr) in air, road and soil sediment in a high traffic area; Contaminacion por metales (Pb, Zn, Ni y Cr) en aire, sedimentos viales y suelo en una zona de alto trafico vehicular

    Energy Technology Data Exchange (ETDEWEB)

    Manchado, Anali; Garcia, Neyma; Garcia, Cezar; Acosta, Lorena; Cordova, Alberto; Linares, Maria; Giraldoth, Debora [Centro de Investigaciones CEDEGAS, Facultad de Ingenieria, Universidad del Zulia, Maracaibo (Venezuela)]. E-mail: analimachado@yahoo.com; amachadop@luz.edu.ve; Velasquez, Harvi [Facultad Experimental de Ciencias, Universidad del Zulia, Maracaibo (Venezuela)

    2008-11-15

    Due to the important health effects of inhalable particles (PM10) and its associated metals, levels of four trace metals (Pb, Ni, Zn, Cr) generated by mobile sources with variable toxicity incorporated to PM10 atmospheric samples in a high density traffic area were evaluated. Samples were collected at two different sites (being considered as emission and dispersion areas) during a dry-wet season period, using a low volume air sampler equipped with quartz fiber filters; after an acid extraction, samples were analyzed by atomic absorption spectrometry. PM10 concentrations were two times higher in the emission area than in the dispersion area for both climatic regimens, but exhibited a better correlation between sites during the dry season. All the elements showed statistically significant differences between monitoring sites. On the other hand, when the total sampling period for PM10 is compared for all the tested metals, significant differences between sites and between meteorological seasons can be appreciated. The Venezuelan air quality standard for Pb was not exceeded, but a mean concentration of 1.13 {mu}g/m{sup 3} -very close to Venezuelan and USEPA standard- was obtained at the emission site. Nevertheless, Pb and Ni reported levels for both locations were above the Organizacion Mundial de la Salud (OMS) allowed limit during the whole sampling period. Further, the statistical analysis demonstrated the selection of the monitoring areas was adequate, confirming that motor vehicles are the main emission source of these atmospheric pollutants. [Spanish] Debido a la importancia del efecto sobre la salud de las particulas inhalables PM10 y los metales asociados a ellas, se evaluaron los niveles de cuatro metales traza (Pb, Ni, Zn y Cr) generados por fuentes moviles de dichas particulas, en sedimentos viales y suelo en una zona de alta densidad vehicular. Las muestras fueron colectadas en los sitios considerados como de emision y dispersion durante las epocas de

  9. Establecimiento simbiótico para la propagación y conservación de Orquídeas en condiciones ex citu en el Jardín Botánico de Boyacá, Colombia

    Directory of Open Access Journals (Sweden)

    Zamora N. Samantha E.

    2005-12-01

    Full Text Available La familia Orchidaceae es la productora de flores más grande del reino vegetal y se estima que el número de miembros oscila entre 17.000 y 35.000 especies agrupadas en 650.900 géneros (Rivera Coto G 1998. Las orquídeas pueden establecer asociaciones de diversa naturaleza, clasificados desde el punto de vista humano en neutrales, mutualistas y antagonistas. Las asociaciones de los más importantes dentro de las orquídeas son las micorrizas con hongos micromicetes,
    capaces de establecer asociaciones simbióticas con orquídeas a nivel de la raíz (Alexopoulos, 1986. Se analizaron 326 ejemplares de orquídeas colectadas en el Cañón de Arcabuco, Boyacá, Colombia y mantenidas en el sustrato anterior como un mecanismo para la evaluación y conservación ex citu, 30 días después de la siembra, se analizó la población encontrándose nueve en estado de inflorescencia del genero Oncidium sp., Stellis sp. y las especies Masdevallia cumniculata, M. amisomorfa, Epidendrum secundum,  Odontoglosum coronarium, Miltonia warscewiczii, Eleantus cinnabarium. Al hacer el respectivo análisis del tipo de sustrato utilizado se determinó que es viable para el cultivo y propagación de las orquídeas en condiciones ex citu.

  10. CARACTERÍSTICAS FITOQUÍMICAS DE MUESTRAS COMERCIALES DE MACA EN TRES REGIONES DE PERÚ

    Directory of Open Access Journals (Sweden)

    Edgardo Palma-Gutiérrez

    2012-01-01

    Full Text Available Objetivo: Determinar las características fitoquímicas de productos comerciales denominados maca, procedente de centros de expendios formales e infor- males de las provincias de Lima, Callao y Junín, Perú. Metodología: Se estudiaron productos de harina de maca colectadas por conveniencia. Fueron en total ocho muestras: tres muestras de venta formal con registro sanitario (RS y cuatro muestras de venta informal (sin RS, y otra muestra fue clasificada taxonómicamente por el método de Cerrate E., como Lepidium peruvianum, la cual se colectó en la Meseta de Bombón (Junín. La marcha fitoquímica se realizó según el método de colorimetría descrito por Lock et al, que catalogó cualitativamente la presencia del fitoquímico en “+++” (abundante, “++” (moderado, “+” (leve y “-” (ausencia. Se indagaron los siguientes metabolitos: alcaloides, lactonas y cumarinas, triterpenos/esteroides, catequinas, resinas, azúcares reductores, saponinas, fenoles, taninos, aminoácidos libres, quinonas, flavonoides y antocianidinas. Resultados: Los fitoquímicos se presentaron de forma heterogénea entre las 8 muestras. Resalta la presencia de alcaloides (+++ en una muestra tanto de venta formal como de informal, frente a (+ de Lepidium peruvianum. Asimismo, se evidenció flavonoides en dos muestra de venta informal (++ y en Lepidumperuvianum (+. Igualmente, se observó esteroides en una muestra de venta formal (++, en dos de venta informal (+++ y en Lepidium peruvianum (++. Conclusiones: Se evidenció la presencia de todos los fitoquímicos indagados, con excepción de las saponinas.

  11. Reproductive and lifestyle factors associated with early menopause in Mexican women Factores reproductivos y de estilos de vida asociados con menopausia temprana en mujeres mexicanas

    Directory of Open Access Journals (Sweden)

    Paola A. Ortega-Ceballos

    2006-08-01

    Full Text Available OBJECTIVE: The purpose of this study was to evaluate the relationship between certain reproductive and lifestyle factors and the occurrence of early natural menopause. MATERIAL AND METHODS: A case/control study was conducted on a basal population of 2 510 women participating in the "Mexican Institute of Social Security health workers cohort study". Cases were defined as those women for whom natural menopause presented by age 47. Information was obtained through a self-administered questionnaire. RESULTS: The risk of early menopause is associated with short menstrual cycles [15 cigarettes/day, OR=2.7 (IC 95% 1.00-7.30], and birth cohorts [>1950, OR=4.09 (IC 95% 2.62-6.39]. COCLUSIONS: The findings of this study suggest that both reproductive and lifestyle factors are significant elements in the occurrence of early menopause in Mexican women.OBJETIVO : Evaluar la relación entre factores reproductivos, estilo de vida y la ocurrencia de menopausia natural temprana. MATERIAL Y MÉTODOS : Un estudio de casos y controles fue conducido en una población basal de 2 510 mujeres participantes en la "Cohorte de trabajadores IMSS". Los casos fueron definidos como aquellas mujeres que presentaron la menopausia natural a los 47 años o menos. La información fue colectada a través de cuestionarios autoapicables. RESULTADOS: El riesgo de menopausia temprana está asociado con ciclos menstruales cortos [15 cigarros/día, RM=2.7 (IC 95% 1.00-7.30], y cohorte de nacimiento [>1950, RM=4.09 (IC 95% 2.62-6.39]. CONCLUSIONES: Los hallazgos sugieren que tanto factores reproductivos como de estilo de vida son elementos significantes en la ocurrencia de la menopausia a edad temprana en mujeres mexicanas.

  12. Antibacterial effect of Costus spiralis leaves extract on pathogenic strains of Vibrio cholerae

    Directory of Open Access Journals (Sweden)

    Celso Pérez

    2008-01-01

    pueden ser extraídos y purificados a partir de plantas para el desarrollo de nuevos medicamentos. Entre las diversas enfermedades que históricamente han afectado al hombre, el cólera ha sido potencialmente epidémico y una de las más sobresalientes. La bacteria Vibrio cholerae, el agente causal, puede ser eliminado mediante antibióticos, de modo que además del tratamiento tradicional de la enfermedad de rehidratación vía oral o intravenosa, comúnmente son aplicados antibióticos tales como la tetraciclina, ciprofloxacina, norfloxacina o azitromicina. El efecto antimicrobiano in vitro de extractos de hojas de Costus spiralis (Roscoe sobre varias cepas patógenas de Vibrio cholerae fue ensayado mediante la técnica de difusión en placas de agar. Hojas verdes de la plantas fueron colectadas, secadas en horno a 50 ºC durante 48 h, molidas y finalmente, sometidas a extracción con etanol. Luego de secado, el material residual fue resuspendido en agua destilada a 100 mg/mL (p/v y realizados los ensayos de actividad antimicrobiana. Aparentemente, las cepas patógenas que representan las pandemias del siglo xx: C7258 (O1, El Tor, Ogawa, C6706 (O1, El Tor, Inaba, O395 (O1, Clásica, Ogawa, CRC266 (O139 y 569B (O1, Clásica, Inaba fueron matadas, a juzgar por la presencia de halos de inhibición de crecimiento en los ensayos. Adicionalmente, se eterminaron las concentraciones mínimas inhibitorias de los extractos para las diferentes cepas. Los resultados anteriores fueron similares a los de la Ampicillina, lo que sugiere que Costus spiralis pude utilizarse como fuente de principios activos contra Vibrio cholerae.

  13. CARACTERÍSTICAS FITOQUÍMICAS DE MUESTRAS COMERCIALES DE MACA EN TRES REGIONES DE PERÚ

    Directory of Open Access Journals (Sweden)

    Edgardo Palma-Gutiérrez

    2013-08-01

    Full Text Available Objetivo: Determinar las características fitoquímicas de productos comerciales denominados maca, procedente de centros de expendios formales e informales de las provincias de Lima, Callao y Junín, Perú. Metodología: Se estudiaron productos de harina de maca colectadas por conveniencia. Fueron en total ocho muestras: tres muestras de venta formal con registro sanitario (RS y cuatro muestras de venta informal (sin RS, y otra muestra fue clasificada taxonómicamente por el método de Cerrate E., como Lepidium peruvianum, la cual se colectó en la Meseta de Bombón (Junín. La marcha fitoquímica se realizó según el método de colorimetría descrito por Lock et al, que catalogó cualitativamente la presencia del fitoquímico en “+++” (abundante, “++” (moderado, “+” (leve y “-” (ausencia. Se indagaron los siguientes metabolitos: alcaloides, lactonas y cumarinas, triterpenos/esteroides, catequinas, resinas, azúcares reductores, saponinas, fenoles, taninos, aminoácidos libres, quinonas, flavonoides y antocianidinas. Resultados: Los fitoquímicos se presentaron de forma heterogénea entre las 8 muestras. Resalta la presencia de alcaloides (+++ en una muestra tanto de venta formal como de informal, frente a (+ de Lepidium peruvianum. Asimismo, se evidenció flavonoides en dos muestra de venta informal (++ y en Lepidumperuvianum (+. Igualmente, se observó esteroides en una muestra de venta formal (++, en dos de venta informal (+++ y en Lepidium peruvianum (++. Conclusiones: Se evidenció la presencia de todos los fitoquímicos indagados, con excepción de las saponinas.

  14. Cambio climático y amenazas ambientales en el Área Metropolitana de Tucumán

    Directory of Open Access Journals (Sweden)

    José M Sayago

    2010-06-01

    Full Text Available La variabilidad espacial y temporal de los efectos del calentamiento global aconseja aplicar la perspectiva regional en la predicción de sus impactos sobre el paisaje natural y las comunidades. En este trabajo se presenta una aproximación metodológica preliminar, cuyos fundamentos son: a la reconstrucción paleoclimática regional y la determinación de escenarios extremos de cambio climático; b la evaluación de amenazas ambientales generadas en cada escenario; c el desarrollo de planes de alerta temprana y prevención de riesgos. Mediante la reconstrucción paleoclimática regional en tres escalas temporales (centenal, milenaria y el Holoceno se identificaron dos escenarios extremos de cambio climático (húmedo y seco. La perioricidad de ENSO (El Niño/La Niña en la región, sumado a la influencia de los cambios paleoclimáticos de los últimos milenios en la dinámica ocupacional de las comunidades agroalfareras permitio una aproximación a los posibles impactos futuros. Se dividió el área metropolitana de Tucumán en unidades de relieve, subdivididas en unidades menores según el uso del suelo (urbano, suburbano y rural. En cada escenario de cambio climático, unidad de relieve y uso del suelo se evaluaron las principales amenazas generadas por los extremos de variabilidad climática. Para cada amenaza ambiental, es posible desarrollar planes alerta temprana, protección o mitigación. Esta primera aproximación espacial podrá ser mejorada cuando la complejidad de la información colectada permita una valoración cuantitativa, a mayor escala, mediante información satelitaria y los sistemas de información geográfica.

  15. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Betty Stefany Lozada

    2012-04-01

    Full Text Available Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aislado M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibición del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. origanoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno, g-terpineno, acetato de timilo, carvacrol, b-mirceno, trans-b-cariofileno. Diferencias significativas (P < 0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en general más susceptible el aislado M2 que la cepa ATCC. Los AEs de L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.

  16. Flora y vegetación de suelos crioturbados y hábitats asociados en la Cordillera Blanca, Ancash, Perú

    Directory of Open Access Journals (Sweden)

    Asunción Cano

    2011-05-01

    Full Text Available Entre los años 2006 y 2008, se llevaron a cabo estudios florístico y de vegetación de los suelos crioturbados y hábitats asociados en cuatro localidades de la Cordillera Blanca (Ancash, Perú localizadas por encima de los 4500 m. Se realizaron recolectas botánicas además de transectos de intersección-línea, en los cuales se midió el espacio (en cm ocupado por cada especie. Fueron determinadas 136 especies de plantas vasculares, agrupadas en 65 géneros y 26 familias. Las Magnoliópsida (dicotiledóneas fueron las más diversas con 97 especies, seguidas de las Liliópsidas (Monocotiledóneas con 36. La mayor diversidad está concentrada en las familias Asteraceae y Poaceae (40,63%. Los géneros con mayor riqueza de especies fueron Senecio (18 y Calamagrostis (12. Se registraron 76 especies (54,82% en suelos crioturbados y hábitats asociados; mientras que 60 especies (44,11% fueron colectadas en la vegetación adyacente. El 95,56% de las especies reportadas fueron hierbas perennes. Se caracterizaron cuatro tipos de comunidades vegetales: a comunidad de suelos crioturbados propiamente dicha, b comunidad de suelos crioturbados asociada a pajonal, c comunidad de suelos crioturbados asociada a roquedal seco y d comunidad de suelos crioturbados asociadas a roquedal húmedo. Se indícan las especies características de cada comunidad.

  17. CONDICIONES DE CULTIVO DE LA PLANTA MATRIZ Y USO DEL ÁCIDO INDOLBUTÍRICO EN LA PROPAGACIÓN DEL MANDARINO ‘SUNKI’ BAJO ESTAQUILLA

    Directory of Open Access Journals (Sweden)

    ANDRÉS IVÁN PRATO SARMIENTO

    2016-01-01

    Full Text Available RESUMEN Los patrones se obtienen tradicionalmente en la citricultura a partir de semillas, seleccionándose las plantas de origen apomíctica. Sin embargo, hay riesgo de no realizarse la selección correcta, debido a la baja apomixis y la alta heterocigocidad en algunas especies o cultivares, como el mandarino ‘Sunki’. La obtención de los mismos por estaquillas solucionaría el problema. El objetivo de este trabajo fue evaluar el potencial de enraizamiento de estaquillas del mandarino ‘Sunki’ (Citrus sunki Hort. ex Tan., colectadas de matrices cultivadas en el campo o en ambiente protegido, utilizándose diferentes concentraciones del ácido indolbutírico (AIB. Las estaquillas se colectaron en el final de la primavera y se mantuvieron por 90 días en cámara de nebulización intermitente. Se adoptó el diseño experimental de bloques completos al azar, con cuatro repeticiones, en arreglo factorial 2 x 4, referente a dos condiciones de cultivo (matrices cultivadas en campo y en ambiente protegido y cuatro concentraciones del AIB (0, 750, 1.500 y 3.000 mg L-1. El enraizamiento del mandarino ‘Sunki’ fue elevado, alcanzando el 96% en las dos condiciones. La brotación (54% y la supervivencia (95% de las estacas presentaron valores satisfactorios, independientemente del AIB. El empleo del AIB solamente es necesario en estacas provenientes de plantas mantenidas en el ambiente protegido, puesto que mejora su enraizamiento y el número de raíces.

  18. Química y Funcionalidad Biológica de Mollinedia racemosa (Monimiaceae Chemical and Biological Functionality of Mollinedia racemosa (Monimiaceae

    Directory of Open Access Journals (Sweden)

    Elizabeth Murillo

    2011-01-01

    Full Text Available En este trabajo se caracterizó la especie Mollinedia racemosa, colectada en Yopal-Casanare-Colombia, desde el punto de vista del perfil fitoquímico, cuantificación de algunos de sus metabolitos secundarios, potencial antioxidante, composición y perfil químico del aceite esencial, de su actividad antimicrobiana y de su toxicidad aguda. Con ello se busca dar soporte científico al conocimiento empírico de comunidades indígenas y campesinas colombianas y para aportar al mejor conocimiento de esta familia vegetal en Colombia. El extracto etanólico de la planta posee un alto contenido de constituyentes fenólicos, en tanto que en los volátiles obtenidos de sus hojas es notable el contenido en sesquiterpenos. La bioactividad revelada por la planta podría estar asociada tanto a los fitofenoles, a sus alcaloides y a los constituyentes de su aceite esencial.Mollinedia racemosa, a species collected in Yopal-Casanare-Colombia, has been characterized from the point of view of its phytochemical profile, quantification of some of its secondary metabolites, antioxidant potential, composition and chemical profile of essential oil, antimicrobial activity and acute toxicity. The objective was giving scientific support to the empirical knowledge from Colombian indigenous and peasant communities and to contribute to better understanding of this type of plant in Colombia. The ethanolic extract of the plant has a high content of phenolic constituents, while volátiles compounds obtained from its leaves have high content of sesquiterpenes. The bioactivity revealed by the plant could be associated to phytophenols, alkaloids and essential oil constituents.

  19. PARASITISMO SOBRE Eurysacca melanocampta Meyrick (LEPIDOPTERA: GELECHIIDAE EN DOS LOCALIDADES DE CUSCO, PERÚ PARASITISM ON Eurysacca melanocampta Meyrick (LEPIDOPTERA: GELECHIIDAE IN TWO LOCALITIES AT CUSCO, PERÚ

    Directory of Open Access Journals (Sweden)

    Juan F. Costa

    2009-06-01

    Full Text Available El cultivo de quinua (Chenopodium quinoa es una importante actividad económica en Cusco. La polilla Eurysacca melanocampta (Lepidoptera: Gelechiidae es la principal plaga registrada en este cultivo y presenta varios controladores biológicos. Se registran parasitoides y porcentajes de larvas parasitadas de la polilla de la quinua provenientes de dos localidades de Cusco: Izcuchaca (3400 msnm y Quiquijana (3100 msnm. Las larvas colectadas se criaron en laboratorio hasta la emergencia de los parasitoides adultos. Phytomyptera sp (Diptera: Tachinidae fue la principal especie parasitoide con 19,8% de parasitismo de larvas provenientes de ambas localidades. Braconidae (Hymenoptera, incluyendo Apanteles sp y Earinus sp, representó el 27,8% y Diadegma spp (Hymenoptera: Ichneumonidae el 5,6%. Braconidae presentó mayor porcentaje de parasitismo en Quiquijana que en Izcuchaca. Se discute el efecto de la diversidad de plantas asociadas, cultivadas y silvestres, sobre las poblaciones de insectos parasitoides.Quinoa crop (Chenopodium quinoa is an important economic activity at Cusco. The quinoa moth: Eurysacca melanocampta (Lepidoptera: Gelechiidae is the main insect pest recorded from Cusco in quinoa fields and it has a complex of natural enemies. This research reports parasitoid insects and percentage of parasitized larvae of quinoa moth from two localities of Cusco: Izcuchaca (3400 masl and Quiquijana (3100 masl. Collected larvae were reared at room conditions up to emergence of adult parasitoids. Phytomyptera sp (Diptera: Tachinidae was the main parasitoid with 19,8% of parasitized larvae from both localities. Braconidae (Hymenoptera, including Apanteles sp y Earinus sp, accounted for 27,8% and Diadegma spp (Hymenoptera: Ichneumonidae the 5,6%. Braconidae showed a greater percentage of parasitism at Quiquijana than Izcuchaca. We discuss if diversity of associated plants, both cultivated and wild plants, influence parasitoid populations.

  20. La etnomatemática en la educación indígena: así se concibe, así se pone en práctica

    Directory of Open Access Journals (Sweden)

    Alicia Ávila

    2014-01-01

    Full Text Available En este artículo se exponen los resultados de una investigación realizada en México cuyo objetivo fue conocer cómo los profesores de las escuelas indígenas conciben la etnomatemática y la integran en sus clases de matemáticas Para reunir la información, se visitaron nueve escuelas primarias indígenas con distintas características lingüísticas, de aislamiento y de organización escolar en los estados de Chiapas, Michoacán y Puebla, los cuales tienen amplia presencia indígena. En el artículo se muestran las formas en que los profesores de las nueve escuelas visitadas conciben la etnomatemática y los saberes previos de sus alumnos y cómo esto es integrado en sus clases de matemáticas. El saber más visible a los profesores es el vinculado con las unidades y formas de medición. Las formas locales de conteo y ubicación en el espacio, si existen, no son identificadas por los docentes. La investigación se realizó en el marco de un programa de formación profesional que promueve que los profesores recuperen los saberes propios de la comunidad para enseñar, a partir de ellos, matemáticas a sus alumnos. El análisis de la información colectada permite analizar los alcances de las propuestas educativas que toman como eje la etnomatemática y discutir la formación que reciben los docentes de niños indígenas para enseñar matemáticas desde esta perspectiva.

  1. Marine diatoms from Buenos Aires coastal waters (Argentina: II. Thalassionemataceae and Rhaphoneidaceae Diatomeas marinas de aguas costeras de la Provincia de Buenos Aires (Argentina: II. Thalassionemataceae y Rhaphoneidaceae

    Directory of Open Access Journals (Sweden)

    EUGENIA A SAR

    2007-03-01

    Full Text Available This study describes the diversity of the species belonging to the diatom families Thalassionemataceae Round and Rhaphoneidaceae Forti frequently found in the temperate marine coastal waters of Buenos Aires Province, Argentina, from October 1994 to September 2000. It comprises morphological, taxonomic and distributional analysis of species found in planktonic samples collected at San Clemente del Tuyú, Santa Teresita, La Lucila del Mar, Mar de Ajó, Nueva Atlantis, Pinamar and Villa Gesell. Raw and cleaned samples were analysed with light and scanning electron microscopy. Four taxa of the genus Thalassionema Grunow ex Mereschkowsky amend. Hallegraeff, one of the genus Lioloma Hasle, two of the genus Delphineis Andrews and one of the genus Rhaphoneis Ehrenberg, were identified. Thalassionema pseudonitzschioides (Schuette & Schrader Hasle, Thalassionema synedriforme (Greville Hasle and Lioloma pacificum (Cupp Hasle in Hasle & Syvertsen are new records for ArgentinaEste estudio describe la diversidad de especies de diatomeas pertenecientes a las familias Thalassionemataceae Round and Rhaphoneidaceae Forti encontradas frecuentemente en aguas costeras marinas de la Provincia de Buenos Aires, Argentina, entre octubre de 1994 y septiembre de 2000. En él se lleva a cabo el estudio morfológico, taxonómico y distribucional de las especies halladas en muestras planctónicas colectadas en San Clemente del Tuyú, Santa Teresita, La Lucila del Mar, Mar de Ajó, Nueva Atlantis, Pinamar y Villa Gesell. Material sin tratar y tratado fue analizado con microscopio óptico y microscopio electrónico de barrido. Cuatro taxa de Thalassionema Grunow ex Mereschkowsky amend. Hallegraeff, uno de Lioloma Hasle, dos de Delphineis Andrews y uno de Rhaphoneis Ehrenberg, fueron identificados. Thalassionema pseudonitzschioides (Schuette & Schrader Hasle, Thalassionema synedriforme (Greville Hasle y Lioloma pacificum (Cupp Hasle in Hasle & Syvertsen son reportadas por

  2. La etnomatemática en la educación indígena: así se concibe, así se pone en práctica

    Directory of Open Access Journals (Sweden)

    Alicia Ávila

    2014-04-01

    Full Text Available En este artículo se exponen los resultados de una investigación realizada en México cuyo objetivo fue conocer cómo los profesores de las escuelas indígenas conciben la etnomatemática y la integran en sus clases de matemáticas Para reunir la información, se visitaron nueve escuelas primarias indígenas con distintas características lingüísticas, de aislamiento y de organización escolar en los estados de Chiapas, Michoacán y Puebla, los cuales tienen amplia presencia indígena. En el artículo se muestran las formas en que los profesores de las nueve escuelas visitadas conciben la etnomatemática y los saberes previos de sus alumnos y cómo esto es integrado en sus clases de matemáticas. El saber más visible a los profesores es el vinculado con las unidades y formas de medición. Las formas locales de conteo y ubicación en el espacio, si existen, no son identificadas por los docentes. La investigación se realizó en el marco de un programa de formación profesional que promueve que los profesores recuperen los saberes propios de la comunidad para enseñar, a partir de ellos, matemáticas a sus alumnos. El análisis de la información colectada permite analizar los alcances de las propuestas educativas que toman como eje la etnomatemática y discutir la formación que reciben los docentes de niños indígenas para enseñar matemáticas desde esta perspectiva

  3. Coeficientes de digestibilidad aparente de harina de pescado peruana y maíz amarillo duro para Colossoma macropomum (Actinopterygii, Characidae

    Directory of Open Access Journals (Sweden)

    Felix Walter Gutierrez

    2008-12-01

    Full Text Available Los Coeficientes de Digestibilidad Aparente (CDA de la materia seca (MS, proteína cruda (PC, lípido crudo(LC y energía bruta (EB de los ingredientes alimenticios harina de pescado peruana (HPP y de maíz amarillo duro (MAD fueron determinados en juveniles de Colossoma macropomum (150,0 ± 25,5 g. En el experimento la dieta de referencia se mezcló con cada uno de los ingredientes prueba en una relación de 70:30. El óxido crómico se usó como indicador inerte. La dieta de referencia y las dietas prueba fueron suministradas a C. macropomum, criada a 27 ºC, 7 mg/L de oxígeno disuelto y pH entre 7,5. Las muestras fecales fueron colectadas por sifoneo. Los CDA para MS, PC, LC y EB de la HPP fueron de 88,06 ± 0,83%, 87,08 ± 1,34%, 85,87 ± 2,69 y 87,29 ± 1,57% respectivamente. Igualmente los CDA para MS, PC, LC y EB del MAD fueron de 82,38 ± 1,02%, 75,46 ± 1,53%, 76,17 ± 2,43% y 75,04 ± 1,80% respectivamente. La energía digestible aparente calculada fue de 3950 Kcal/kg para la HPP y 2830 kcal/kg para el MAD. Se concluye que C. macropomum digiere mejor las fracciones proteicas y energéticas de la HPP. Al mismo tiempo muestra que digiere también la fracción energética del MAD, proveniente de los carbohidratos solubles.

  4. POPULATION GENETICS OF Atta sexdens rubropilosa (HYMENOPTERA: FORMICIDAE

    Directory of Open Access Journals (Sweden)

    LIRIANA BELIZÁRIO CANTAGALLI

    2013-01-01

    Full Text Available La variabilidad genética de las hormigas Atta sexdens rubropilosa colectadas en cinco lugares distintos de Brasil fueron evaluados por la técnica PCR-RAPD. Un total de 15 primers produjeron 148 fragmentos, de los cuales 123 fueron polimórficos, lo que corresponden al 83,11 %. La estimación de la diversidad genética por el índice de Shannon fue 0,3836 y el desviación estándar fue de ± 0,2335. Estos valores demuestran una alta diversidad genética. El valor de GST fue 0,2372 y ΦPT = 0,184 lo que indica que las poblaciones están moderadamente diferenciadas y que el 82 % de la variación obtenida se produce dentro de las poblaciones. Aunque la prueba de Mantel ha demostrado una correlación entre la distancia genética y geográfica se observó que Ivatuba e Itambé (33,8 km tiene una pequeña distancia geográfica y la mayor distancia genética. La distancia inferior genética fue estimada para Maringá e Ivatuba pero estas localidades cuentan con una distancia geográfica pequeña (42,3 km, lo que indica que no hay barreras para el apareamiento entre los reproductores en estas poblaciones. El alto valor de polimorfismo (83,11 % y la capacidad de emparejamiento entre las poblaciones presentes en las regiones estu- diadas, indican que esta especie de hormiga cortadora está bien adaptada a la región, y deben ser desarrollados programas integrados de control si se convierten en plagas.

  5. Frecuencia de enteroparásitos en niños y niñas del primer ciclo de la educación escolar básica de Escuelas Públicas de Ciudad del Este, Paraguay

    Directory of Open Access Journals (Sweden)

    Gloria Elena Cardozo Ocampos

    2015-04-01

    Full Text Available Las enfermedades parasitarias tienen amplia distribución mundial, y a pesar de los esfuerzos de los organismos de salud, siguen siendo un problema especialmente en los países en vias de desarrollo como el nuestro. El objetivo del presente trabajo, debidamente evaluado por la Comisión Nacional para el Desarrollo de la Bioética en Paraguay, fue la de determinar la tasa de frecuencia de enteroparásitos en niños y niñas del primer ciclo de la Educación Escolar Básica de Ciudad del Este (Paraguay. En el periodo de setiembre a diciembre del año 2006, fueron visitadas 48 escuelas públicas, durante el cual se recolectó muestras de materia fecal de 388 niños y niñas, entre 7 a 9 años, escogidos aleatoriamente. Las muestras colectadas fueron examinadas por cuatro métodos para la búsqueda de enteroparásitos, el Directo en fresco, Faust, Ritchie and Lutz. El porcentaje de las muestras positivas fue de 94,23%, donde fueron identificados siete tipos de protozoarios y cinco tipos de helmintos. La frecuencia de los enteroparasitos hallados en la población estudiada de la forma en la que sigue: Giardia duodenalis 67%; Entamoeba coli 52%; Blastocystis hominis 45%; Endolimax nana 31%; Chilomastix mesnili 8 %; Iodamoeba butschilii 3% ; Entamoeba histolytica 2% ; Hymenolepis nana 12%; Enterobius vermicularis 1%; Strongyloides stercoralis 2%; Ascaris lumbricoides 1% ; Uncinarias 2%.

  6. Concentración nutrimental en hojas de aguacate 'Hass' con síntoma de moteado Nutrimental concentration in 'Hass' avocado leaves with mottled symptom

    Directory of Open Access Journals (Sweden)

    Edgardo Federico Hernández-Valdés

    2012-06-01

    Full Text Available El llamado "moteado de las hojas" en el cultivo de aguacate está ampliamente distribuido en las zonas de producción más importante de México, y se desconoce los factores involucrados en la aparición de este síntoma foliar. Por ello, se contrastó el contenido nutrimental en hojas de aguacate 'Hass' colectadas de árboles sin la presencia del moteado (tratamiento A, contra hojas que tampoco manifestaran el síntoma pero provenientes de árboles con el daño foliar (tratamiento B y hojas con la presencia del síntoma (Tratamiento C. Se encontró que, aquellas hojas con "moteados" intervenales tuvieron menor concentración de N, P, K, y Mn, respecto a las que no presentaron el síntoma, mientras que las concentraciones de Ca, Mg, Fe, Zn, Cu y B hojas con y sin moteado fueron similares.The problem called as "mottled leaves" in avocado crop is widely spread in the most important production zones from Mexico, and it is unknown which factors are involved in this foliar symptom appearance. By this reason, the nutrimental content in 'Hass' avocado foils collected from trees without mottled presence (treatment A was collated against leaves that either showed the symptom although coming from trees with foliar damage (treatment b and leaves with symptom presence (Treatment C. It was found that those leaves with interveinal "mottled" had least N, P, K, and Mn concentration with regards the ones that show no symptom, while Ca, Mg, Fe, Zn, Cu and B concentrations in leaves with and without mottling were similar.

  7. Identificación y tipificación de biotipos y serotipos de Yersinia enterocolitica

    Directory of Open Access Journals (Sweden)

    Elizalde Castañeda Paulino

    2001-01-01

    Full Text Available OBJETIVO: Conocer la existencia de Yersinia enterocolitica en suínos visiblemente sanos y sacrificados para el consumo humano. MÉTODOS: Fueron estudiadas 100 muestras de tejido linfático obtenidas en el momento del sacrifício, en un matadero del Estado de México. Fueron realizados muestreos pilotos de 20 casos, de los cuales 20% fueron positivos, permitiendo obtener una muestra estudiada (n=100. Las muestras colectadas de tejido linfático fueron acondicionadas para el aislamiento de Yersinia enterocolitica en caldo de Rappaport y en medio de cultivo de Salmonella-Shigella y MacConkey. Las identificaciones fueron efectuadas por medio de pruebas bioquímicas y serológicas, utilizándose en el caso los antisueros O:3, O:8 y O:9 para la biotipificación correspondiente. RESULTADOS: Fueron obtenidos 22 aislamientos tipificándose 8 serotipos pertenecientes al O:3 y 8 al O:9 correspondientes al biotipo 1; y, en 6 muestras no fue posible la serotipificación. No se encontró en el total de los aislados el serotipo O:8. CONCLUSIONES: En base en la metodología, se registró la presencia de Y. enterocolitica y sus serogrupos en tejido linfático de porcinos por la primera vez en México; esto es importante porque el patógeno y sus serotipos aislados están comprometidos con mayor frecuencia con problemas de salud pública.

  8. Identificación y tipificación de biotipos y serotipos de Yersinia enterocolitica

    Directory of Open Access Journals (Sweden)

    Paulino Elizalde Castañeda

    2001-08-01

    Full Text Available OBJETIVO: Conocer la existencia de Yersinia enterocolitica en suínos visiblemente sanos y sacrificados para el consumo humano. MÉTODOS: Fueron estudiadas 100 muestras de tejido linfático obtenidas en el momento del sacrifício, en un matadero del Estado de México. Fueron realizados muestreos pilotos de 20 casos, de los cuales 20% fueron positivos, permitiendo obtener una muestra estudiada (n=100. Las muestras colectadas de tejido linfático fueron acondicionadas para el aislamiento de Yersinia enterocolitica en caldo de Rappaport y en medio de cultivo de Salmonella-Shigella y MacConkey. Las identificaciones fueron efectuadas por medio de pruebas bioquímicas y serológicas, utilizándose en el caso los antisueros O:3, O:8 y O:9 para la biotipificación correspondiente. RESULTADOS: Fueron obtenidos 22 aislamientos tipificándose 8 serotipos pertenecientes al O:3 y 8 al O:9 correspondientes al biotipo 1; y, en 6 muestras no fue posible la serotipificación. No se encontró en el total de los aislados el serotipo O:8. CONCLUSIONES: En base en la metodología, se registró la presencia de Y. enterocolitica y sus serogrupos en tejido linfático de porcinos por la primera vez en México; esto es importante porque el patógeno y sus serotipos aislados están comprometidos con mayor frecuencia con problemas de salud pública.

  9. Caracterización morfológica de accesiones silvestres de guayaba

    Directory of Open Access Journals (Sweden)

    Muñoz florez Jaime Eduardo

    2009-06-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.

  10. DIETA DE LA NUTRIA NEOTROPICAL Lontra longicaudis (CARNÍVORA, MUSTELIDAE EN EL RÍO ROBLE, ALTO CAUCA, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Botero-Botero Alvaro

    2010-04-01

    Full Text Available Se estudio la dieta de la nutria neotropical en el río Roble, sistema del río La Vieja, alto Cauca, Colombia. Desde agosto de 2006 hasta marzo de 2007 dos veces por mes fueron colectadas heces de la nutria en bolsas plásticas en la zona baja del río Roble, en laboratorio las muestras fueron lavadas, tamizadas y comparadas con una colección de referencia.Se reconocieron 14 categorías alimenticias, dentro los cuales los peces de la Familia Loricariidae, presentaron el mayor porcentaje de frecuencia, particularmente la especie Chetostoma sp. (22,6%, seguida de Hypostomus sp.  (9,55% y  Ancistrus sp.  (8,54%;  otras especies de peces aprovechadas por la nutria en menor proporción son: Apteronotus sp. (11,6%, Brycon henni  (9,86%, Lebiasina sp. (0,70%, y Rhamdia sp. (9,15%. Los insectos fueron el siguiente grupo en importancia, con la especie Corydalus sp. (9% (Familia Corydalidae, y en menor presencia los reptiles de la Familia Corytophanidae, especie Basiliscus sp. Se encontró diferencias significativa, entre los ítems consumidos por temporada climática (Rs = 0,429; n= 11 p= 0.00001.

  11. Overcoming DNA extraction problems from carnivorous plants

    Directory of Open Access Journals (Sweden)

    Fleischmann, Andreas

    2009-12-01

    Full Text Available We tested previously published protocols for DNA isolation from plants with high contents of polyphenols and polysaccharides for several taxa of carnivorous plants. However, we did not get satisfying results with fresh or silica dried leaf tissue obtained from field collected or greenhouse grown plants, nor from herbarium specimens. Therefore, we have developed a simple modified protocol of the commercially available Macherey- Nagel NucleoSpin® Plant kit for rapid, effective and reproducible isolation of high quality genomic DNA suitable for PCR reactions. DNA extraction can be conducted from both fresh and dried leaf tissue of various carnivorous plant taxa, irrespective of high contents of polysaccharides, phenolic compounds and other secondary plant metabolites that interfere with DNA isolation and amplification.

    Probamos algunos protocolos publicados previamente para el aislamiento del ADN de plantas con alto contenido de polifenoles y polisacáridos para varios táxones de plantas carnívoras. Sin embargo, no conseguimos muy buenos resultados ni con tejidos de hojas frescas, ni con tejidos de hojas secadas en gel de sílice obtenidas de plantas colectadas en el campo o cultivadas en los invernaderos, ni de especímenes de herbario. Por lo tanto, hemos desarrollado un protocolo sencillo, modificado del Macherey- Nagel NucleoSpin® Plant kit disponible en el mercado para el aislamiento rápido, eficaz y reproducible de ADN genómico de alta calidad conveniente para la reacción en cadena de la polimerasa. La extracción del ADN se puede realizar en tejidos de hojas frescas o secas de varios táxones de plantas carnívoras, sin importar el grado de contenido de polisacáridos, compuestos fenólicos u otros metabolitos secundarios que interfieren con el aislamiento y la amplificación del ADN.

  12. Micorrizas arbusculares asociadas al pasto angleton (Dichathium aristatum Benth en fincas ganaderas del municipio de Tolú, Sucre-Colombia

    Directory of Open Access Journals (Sweden)

    Alexander Pérez C.

    2013-03-01

    Full Text Available Objetivo. El presente estudio consistió en caracterizar el porcentaje de colonización de hongos formadores de micorrizas arbusculares (HMA; asociados a la rizósfera del pasto Angleton (Dichanthium aristatum Benth de fincas ganaderas del municipio de Tolú, departamento de Sucre, Colombia. Materiales y métodos. Se muestrearon en total 35 fincas ganaderas, de las cuales se tomaron 10 muestras de suelo con raíces por finca a una profundidad de 20 cm. De cada muestra se aislaron esporas de HMA, se hizo separación de morfotipos y su respectiva identificación a través de claves taxonómicas. De las raíces colectadas se determinó el porcentaje de colonización utilizando métodos de coloración. Resultados. Los ANAVA multifactorial entre las variables densidad de esporas/100 g de suelo y porcentaje de colonización en función a zonas y corregimiento mostraron diferencias altamente significativas. Los resultados obtenidos indican que el 92% de las especies encontradas corresponden a características de hongos HMA similares al género Glomus, el 4% al género Gigaspora y el 4% restante a Paraglomus. Conclusiones. Este estudio preliminar realizado en el Caribe colombiano muestra la diversidad, densidad poblacional y el porcentaje de colonización de HMA asociadas al pasto Angleton en condiciones de siete corregimientos pertenecientes a dos zonas agrológicas del municipio de Tolú, departamento de Sucre.

  13. PREVALÊNCIA DA ADEQUAÇÃO À ALIMENTAÇÃO SAUDÁVEL DE IDOSOS RESIDENTES EM ZONA RURAL

    Directory of Open Access Journals (Sweden)

    Sara Franco Diniz Heitor

    2013-01-01

    Full Text Available Las preferencias alimentarias desempeñan un papel importante a lo largo de la vida y en caso sean basadas en elecciones inadecuadas pueden desencadenar enfermedades. Este estudio ha objetivado determinar la prevalencia de la adecuación a la Guía "10 pasos para una alimentación saludable para la persona anciana", además de caracterizar el perfil sociodemográfico económico y antropométrico de 850 ancianos de una zona rural de Uberaba-MG. Inquérito domiciliar, transversal y observacional. La prevalencia de los pasos ha sido colectada con cuestionario de frecuencia y consumo alimentario. El análisis de datos consistió en la distribución de frecuencia simple. La mayoría era del sexo masculino, hasta 70 años, casada, vivía con el cónyuge, baja escolaridad, renta de un sueldo mínimo y eutróficos. Ningún anciano seguía todos los pasos. El paso 8, ingestión de sal, se mostró como el más seguido, por el contrario, el paso 5, consumo de carnes magras y leche, presentó la menor adhesión. Conocer la población y sus hábitos es importante en la implementación de estrategias que mejoren la calidad de vida.

  14. EVALUACIÓN DE COMUNIDADES DE MACROINVERTEBRADOS ASOCIADOS A TRES ESPECIES DE MACRÓFITAS ACUÁTICAS EN LA LAGUNA DE MORONACOCHA, IQUITOS

    Directory of Open Access Journals (Sweden)

    Zoila Perea Saavedra

    2011-12-01

    Full Text Available El objetivo fue evaluar la riqueza y abundancia de macroinvertebrados acuáticos asociados a tres especies de macrófitas acuáticas del Lago Moronacocha. Los muestreos se realizaron entre los meses de mayo y julio del 2009; se realizaron colectas mensuales de 27 muestras de cada macrófita, tomándose adicionalmente medidas de parámetros fisicoquímicos: temperatura, oxígeno y pH. Las muestras de Pistia stratiotes (huama y Echinocloa crassipes (putu putu, fueron colectadas con una red de bentos (20 x 30 cm y 180 µm de abertura de malla, mientras que los ejemplares de Echinocloa polystachya (gramalote fueron colectados manualmente.No se encontraron diferencias estadísticas significativas en cuanto la riqueza y abundancia entre las tres macrófitas  evaluadas (P>0.05. Se encontró una abundancia de 1538 individuos, siendo las familias más abundantes en la colecta: Chironomidae, Noteridae y Haplotaxidae, siendo además Hydrophilidae, Elmidae y Planorbidae abundantes solo para Pistia stratiotes. De las 31 familias reportadas en este estudio, 17 estuvieron presentes en las tres macrófitas evaluadas.  Los valores promedio de T° (26,4 °C y pH (6,7 registrados se encontraron dentro de los límites adecuados. Concluyendo que la composición de macroinvertebrados acuáticos en el Lago Moronacocha, no está influenciada por el tipo de macrófita que existe en ella.

  15. Normalización del UMELISA TSH NEONATAL® a discos de 3 mm

    Directory of Open Access Journals (Sweden)

    Darlenis Herrera Vallejera

    2006-01-01

    Full Text Available El hipotiroidismo congénito (HC, reconocido como la causa más frecuente de retraso mental evitable en la infancia, es una enfermedad heredo metabólica con una incidencia mundial de 1 : 4 000. La detección precoz y el inicio de una terapia temprana evita el retardo en el crecimiento y en la maduración ósea, lográndose un desarrollo psicomotor normal en los niños. La disponibilidad de ensayos para la determinación de las hormonas T4 y de estimulaci ón de la tiroides (HET ha permitido el establecimiento de programas de pesquisa neonatal del HC. En el Centro de Inmunoensayo se desarrolló el UMELISA TSH NEONATAL®, ensayo para la determinación de la HET en muestras de sangre seca sobre papel de filtro de recién nacidos. En este ensayo, se emplean discos de 5 mm de las muestras, calibradores y un control. Con el incremento del número de enfermedades a diagnosticar en los programas de pesquisa, es necesario aprovechar al máximo las muestras de sangre colectadas en papel de filtro. En este trabajo, se describen las modificaciones realizadas al UMELISA TSH NEONATAL® que permiten el empleo de discos de 3 mm . Se obtuvieron perfiles de precisión entre 7,0 y 10,4 % y una exactitud relativa del 96,3 %. El límite de detección es de 1 mUI/L . El ensayo modificado mostró una buena correlación lineal con el UMELISA TSH NEONATAL® (r = 0,9. Las modificaciones realizadas al ensayo no afectan su sensibilidad, precisión y exactitud, por lo que puede ser empleado en la pesquisa neonatal del hipotiroidismo congénito.

  16. Visitantes florales nocturnos del girasol (Helianthus annuus, Asterales: Asteraceae en la Argentina

    Directory of Open Access Journals (Sweden)

    Juan P TORRETTA

    2009-01-01

    Full Text Available El girasol (Helianthus annuus es un cultivo oleaginoso, polinizado por Apis mellifera L. y otras abejas en distintas regiones del mundo. Sin embargo, sus flores también son visitadas por insectos de actividad nocturna. Durante tres campañas agrícolas, se determinó la diversidad de los visitantes nocturnos de capítulos de girasol, en cinco sitios de Argentina. También se estudió el comportamiento de forrajeo de los principales visitantes y la variación de la receptividad estigmática a lo largo del día, con el fin de establecer si estos visitantes contribuyen a la polinización. Al menos 67 especies o morfoespecies pertenecientes a cuatro órdenes de visitantes nocturnos fueron colectadas. El orden más rico y abundante fue Lepidoptera (44 especies o morfoespecies, cinco familias, seguido por Coleoptera (18 especies o morfoespecies, nueve familias, Orthoptera (tres morfoespecies, una familia y Blattaria (dos especies, una familia. Los lepidópteros forrajearon exclusivamente por néctar, mientras que los individuos de los demás órdenes consumieron polen y/o partes florales. El estigma se encontró receptivo durante las horas de luz, con una receptividad máxima al mediodía (12:00 - 14:00. Llamativamente, las flores del girasol son visitadas por mayor número de polillas que de abejas. Debido a que las polillas consumen néctar y potencialmente transportan polen entre flores, en un momento del día en que los estigmas se encuentran menos receptivos, es improbable que polinicen efectivamente el cultivo.

  17. Nuevo Liolaemus (Iguania: Liolaemidae perteneciente al grupo boulengeri de la provincia de Neuquén, Argentina

    Directory of Open Access Journals (Sweden)

    Abdala, Cristian

    2002-08-01

    Full Text Available Se describe una nueva especie del género Liolaemus, grupo boulengeri colectada en tres localidades del centro norte de la provincia de Neuquén, entre 500 y 650 msnm. Tanto machos como hembras se caracterizan por presentar 4 - 6 escamas en contacto con la mental y una fila de escamas loreolabiales, esta combinación de caracteres la comparte únicamente con L. cuyanus. La especie que aquí se describe presenta un patrón de coloración dorsal único, caracterizado por la presencia de manchas pre- y postescapulares bien marcadas, un arco antehumeral negro bien marcado y 2 - 4 series longitudinales de tenues manchas oscuras sobre un color de fondo llamativo, en donde se destacan el verde y celeste. Ventralmente se acentúa el color melánico en la región gular. Este patrón de coloración y caracteres de lepidosis lo diferencia principalmente de L. cuyanus y del resto de las especies del grupo boulengeri. A new species of the genus Liolaemus belonging to the boulengeri group is described. The new species is known from three localities in north central Province of Neuquén, between 500-650 m elev. Both males and females are characterized by having 4 - 6 scales in contact with the mental and a row of lorilabial scales, a combination of characters only shared with L. cuyanus among members of the boulengeri group. The species here described also has a unique pattern of dorsal coloration, characterized by conspicuous pre - postscapulars spots, a prehumeral arch, and 2 - 4 longitudinal rows of lighter spots over a background of predominantly green and light blue. Ventrally, melanism is accentuated in the throat region. This pattern of coloration and characters of lepidosis differ from L. cuyanus and the other members of the boulengeri group.

  18. Estudio bacteriológico de leche cruda por el sistema Diralec en un municipio de la región oriental del país (Bacteriological study of crude milk by the system Diralec in a municipality of the oriental region of the country

    Directory of Open Access Journals (Sweden)

    Espinosa, Y. N; Rodríguez, Y. V.

    2008-07-01

    Full Text Available Se desarrolló un trabajo para determinar la calidad bacteriológica de la leche cruda por el sistema Diralec en tres sectores de un municipio, los cuales se dedican a la producción de leche, con bovinos mestizos; en su totalidad se encuentran bajo el mismo régimen de manejo y alimentación. Se acopiaron 90 muestras, de ellas 30, procedentes de UBPC, 30 de CAI arroceros y 30 del sector campesino. Las muestras se tomaron después del ordeño de los recipientes colectores, previa homogeneización de la leche,se envasaron en frascos estériles y se trasladaron al laboratorio con hielo para su conservación; fueron procesadas antes de las 6 horas de ser colectadas. Las muestras se clasificaron de acuerdo al número de microorganismo (ufc/ml en: Excelentes, buenas, regular y malas; todas trabajadas por duplicado y siguiendo la metodología propuesta para el análisis de leche cruda en el Diralec. Además de la calidad bacteriológica se les determinó el contenido de grasa por el método GERBER, según ISO 2446:1976; la densidad a través del lactodensímetro de Quevenne a una temperatura de 15 °c, según NC 119:2001. Del total de muestras trabajadas el 37% fueron calificadas de excelente, el 21% fueron buenas, 17% regulares y el 25% de mal aproximadamente. Las muestras procedentes de la entidad particular tuvieron un mayor conteo de unidades formadoras de colonia que el resto. Se concluye que la calidad de la leche en las entidades investigadas en general es no buena y que el equipo Diralec constituye una opción rápida y fiable para su calificación.

  19. CARACTERIZACIÓN SEROLÓGICA Y MOLECULAR DE POTYVIRUS ASOCIADOS A LA VIROSIS DEL TOMATE DE ÁRBOL EN ANTIOQUIA (COLOMBIA

    Directory of Open Access Journals (Sweden)

    MARILUZ AYALA VÁSQUEZ

    2010-01-01

    Full Text Available El tomate de árbol (Solanum betaceum es una fruta andina altamente nutritiva, con propiedades organolépticas únicas para el procesamiento industrial y el mercado in- ternacional. En Antioquia, Colombia, este cultivo presenta diferentes problemas fitosa- nitarios, siendo especialmente limitante la Virosis, causada por un complejo viral del que hacen parte entre otras, especies del género Potyvirus. En este trabajo se evaluaron mediante pruebas de ELISA los niveles de incidencia de este grupo viral en cultivos de siete zonas del departamento de Antioquia y se determinó la identidad taxonómica de dos de los potyvirus asociados al cultivo. Las pruebas serológicas muestran la presen- cia de potyvirus en seis de las siete zonas evaluadas, alcanzando niveles superiores al 80% de incidencia, siendo la excepción los cultivos del municipio de Jardín (8%. Pruebas serológicas con anticuerpos específicos para PVY, identificaron a este virus como uno de los presentes en algunas de las muestras sintomáticas colectadas; mientras que análisis de secuencias de amplicones obtenidos mediante RT-PCR, detectaron un nuevo potyvirus, para el que se propone el nombre Tamarillo Leaf Malformation Virus (TaLMV, aunque es necesario completar la secuencia de su genoma para confirmar la validez de esta hipótesis taxonómica. Esta investigación representa un avance importante en el co- nocimiento que se tiene en Colombia sobre los agentes causales virales del tomate de árbol. Sin embargo, es necesario profundizar en aspectos como los mecanismos de trans- misión de estos virus y los efectos individuales y de su interacción sobre las variedades de este cultivo en el país.

  20. CARACTERIZACIÓN SEROLÓGICA Y MOLECULAR DE POTYVIRUS ASOCIADOS A LA VIROSIS DEL TOMATE DE ARBOL EN ANTIOQUIA (COLOMBIA

    Directory of Open Access Journals (Sweden)

    González Jaimes Elena Paola

    2010-12-01

    Full Text Available El tomate de árbol (Solanum betaceum es una fruta andina altamente nutritiva, con propiedades organolépticas únicas para el procesamiento industrial y el mercado internacional. En Antioquia, este cultivo presenta diferentes problemas fitosanitarios, siendo especialmente limitante la Virosis, causada por un complejo viral del que hacen parte entre otras, especies del género Potyvirus. En este trabajo se evaluaron mediante pruebas de ELISA los niveles de incidencia de este grupo viral en cultivos de siete zonas del departamento de Antioquia (Colombia y se determinó la identidad taxonómica de dos de los potyvirus asociados al cultivo. Las pruebas serológicas muestran la presencia de potyvirus en seis de las siete zonas evaluadas, alcanzando niveles superiores al 80% de incidencia, siendo la excepción los cultivos del municipio de Jardín (8%. Pruebas serológicas con anticuerpos específicos para PVY, identificaron a este virus como uno de los presentes en algunas de las muestras sintomáticas colectadas; mientras que análisis de secuencias de amplicones obtenidos mediante RT-PCR, detectaron un nuevo potyvirus, para el que se propone el nombre Tamarillo Leaf Malformation Virus (TaLMV, aunque es necesario completar la secuencia de su genoma para confirmar la validez de esta hipótesis taxonómica. Esta investigación representa un avance importante en el conocimiento que se tiene en Colombia sobre los agentes causales virales del tomate de árbol. Sin embargo, es necesario profundizar en aspectos como los mecanismos de transmisión de estos virus y los efectos individuales y de su interacción sobre las variedades de este cultivo en el país.

  1. Diversidad y aspectos biológicos de abejas silvestres de un ambiente urbano y otro natural de la región central de Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Milagros DALMAZZO

    2010-01-01

    Full Text Available El objetivo del presente trabajo fue relevar el elenco de abejas silvestres en la región central de Santa Fe y comparar la diversidad de especies y aspectos biológicos en dos ambientes de una misma región. Las abejas fueron colectadas en el estrato herbáceo de la Reserva Universitaria “Escuela Granja” de la localidad Esperanza, y en la zona urbana de la localidad Susana, ambas ubicadas dentro de la Provincia Fitogeográfica del Espinal. La colecta se realizó en octubre, noviembre y diciembre de 2004 y en enero, febrero y marzo de 2005, registrando las especies vegetales sobre las que se capturaron. Se colectaron 277 ejemplares en total, de los cuales se identificaron 62 especies (27 géneros en 5 familias. Las curvas de rarefacción indican una tasa de acumulación de especies mayor para la Reserva Ecológica, los índices de diversidad de Shannon son 3,25 para la Reserva Ecológica y 2,64 para la Zona Urbana. Para la comparación de las comunidades en ambos sitios, las abejas fueron clasificadas en tres categorías según la especialización en el uso del recurso floral, sustrato de nidificación y comportamiento social. Se observó una asociación entre los grupos especialistas y de nidificación en el suelo con el ambiente natural, y por otro lado, las especies generalistas y de nidificación en cavidades con el ambiente urbano. No se identificaron diferencias, en cuanto al tipo de comportamiento social de las especies, entre ambos sitios.

  2. SISTEMA DE INFORMACIÓN GEOGRÁFICA Y TELEDETECCIÓN. DETERMINACIÓN DE VULNERABILIDAD URBANA. CASO ESTADO VARGAS-VENEZUELA

    Directory of Open Access Journals (Sweden)

    Rafael Batista

    2009-01-01

    Full Text Available En una zona de alto crecimiento poblacional como el estado Vargas, levantar información con el propósito de elaborar escenarios de riesgo ambiental, se hace aplicar al geotecnologías que garanticen la validez y ubicación de los datos recuperados en campo. En este contexto, se desarrolló un estudio en las cuencas La Zorra, Tacagua y Mamo, las más densamente pobladas en el litoral central. Se construyó un sistema de información geográfica para gestionar datos del área de estudio a objeto de producir análisis espaciales que lleven a la generación de un mapa de vulnerabilidad urbana. Para ello se realizó una detección de cambios con imágenes Landsat de distintos años a fin de identificar áreas con cambios significativos. Posteriormente, la cartografía digital de coberturas urbanas se superpuso a los datos del satélite IKONOS y se combinaron con el mapa de amenaza hidrometeorológica para seleccionar áreas críticas. La información colectada de las estructuras dentro de las áreas críticas fue localizada utilizando sistemas de posicionamiento global (GPS. Finalmente, este procedimiento permitió identificar los niveles de daños que podrían sufrir las edificaciones a la hora de un evento extraordinario (aludes torrenciales así como establecer áreas con distintos grados de vulnerabilidad.

  3. ENSEÑANZA DEL CONCEPTO DIVERSIDAD VEGETAL A PARTIR DE LA IMPLEMENTACIÓN DE UN HERBARIO VIRTUAL EN UNA INSTITUCIÓN EDUCATIVA OFICIAL DE LA CIUDAD DE NEIVA – HUILA

    Directory of Open Access Journals (Sweden)

    Jeison Herley Rosero Toro

    2014-05-01

    Full Text Available A continuación presentamos los resultados del  desarrollo de práctica pedagógica I al interior del Programa de Licenciatura en Educación Básica con Énfasis en Ciencias Naturales y Educación Ambiental de la Universidad Surcolombiana (Neiva-Colombia llevada a cabo en una institución educativa oficial de la ciudad de Neiva.El proyecto se ejecutó en un periodo de 8 meses, con un  grupo de trabajo conformado por veintiún estudiantes de sexto y cuatro de décimo grado cuyas edades oscilan entre 11 y 16 años  y de estrato socio-económico 1. Para el caso de esta ponencia nos referimos particularmente a la aproximación acerca del concepto de diversidad que tienen los estudiantes y cómo estos son reflejados en su vida cotidiana. La metodología está enmarcada en una perspectiva participativa, empleando actividades de campo, laboratorio y uso de las Tecnología de la Información y la Comunicación  (TIC´S. Los resultados obtenidos se enmarcan en un herbario virtual, el cual cuenta con 33 especies colectadas; ésta herramienta tecnológica fue diseñada como apoyo docente y de consulta por los estudiantes para explicar la diversidad de especies  y el reconocimiento de la flora que cuenta la institución a partir de un enfoque científico e investigativo. Finalmente, mostramos una forma diferente de llevar al aula el concepto de diversidad y la importancia de conocer nuestro entorno vinculando la labor investigativa en el aprendizaje del educando.

  4. A inclusão escolar do ponto de vista dos professores: o processo de constituição de um discurso

    Directory of Open Access Journals (Sweden)

    Hildete Pereira dos Anjos

    2009-01-01

    Full Text Available El artículo analiza, en las pláticas de los profesores de la red pública, las referencias a la inclusión de alumnos con deficiencia. Tales pláticas fueron colectadas en entrevistas no estructuradas, interpretadas siguiendo los principios del análisis de discurso y organizadas en tres grupos de sentido: concepciones de base, o lugar de sí y el lugar del otro. Aparece, en el discurso, una naturalización de las temáticas de la deficiencia y de la normalidad. El hablante se describe como parte del proceso inclusivo, mismo relatando sentimientos como impotencia, frustración y desorganización. Esa participación se limita a la sala de clase, evidenciando cierta pasividad con relación a las carencias de la educación. Se distingue del restante, el mundo donde el profesor tiene función de dirección (a sala de clase. Las relaciones entre gobierno, padres, atendimiento especializado y la acción pedagógica aparecen fragmentadas. Los factores apuntados como desfavorables a la inclusión son naturalizados. Esa distinción entre el mundo pedagógico y lo restante, refuerza una concepción de inclusión como producto acabado, naturalizándola y separando el proceso inclusivo de las relaciones entre inclusión y exclusión.

  5. PARTIAL PURIFICATION AND CHARACTERIZATION OF LECTIN-LIKE ACTIVITIES FROM Lupinus albus SEEDS

    Directory of Open Access Journals (Sweden)

    A. B. Falcón

    2000-01-01

    Full Text Available En un trabajo anterior los autores estudiaron la actividad hemaglutinante presente en semillas de tres espe- cies de Lupinus; a partir de esos resultados se decidió purifi- car las actividades lectínicas presentes en semillas de Lupinus albus, tomando en cuenta las mayores especificidades encon- tradas previamente en los extractos. En este trabajo se prepa- raron tres columnas apropiadas de afinidad, con el fin de puri- ficar la actividad hemaglutinante de L. albus. El pellet colecta- do por centrifugación a partir del extracto previamente satura- do con 80 % de sulfato de amonio, fue aplicado respectivamante en tres columnas de afinidad: Mucina-Sepharosa, Fetuina- Sepharosa y Galactosa-Agarosa. Aunque fue purificada, a través de las columnas de Fetuina y Mucina, una actividad lectínica equivalente al 5 % aproximado del total de proteína encontra- do en el extracto, la actividad hemaglutinante pasó a través de la columna sin aparentemente interactuar con las proteínas fijadas en cada una de las columnas probadas. Las proteínas colectadas en los picos de elusión de las corridas cromatográficas fueron parcialmente caracterizadas mediante electroforesis en poliacrilamida y filtración en gel a través de una columna de Superosa 12, con el fin de conocer acerca de su composición monomérica y oligomérica y sus pesos moleculares. Se analizó, además, la posible estructura secundaria de la proteína a partir de un espectro de dicroismo circular realizado a la muestra.

  6. Vascularización, morfología e histología del ovario en el armadillo Euphractus sexcinctus (Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    LC Rezende

    2013-01-01

    Full Text Available El Euphractus sexcinctus es un armadillo de América del Sur y su anatomía reproductiva ha sido poco estudiada. Cinco hembras adultas fueron colectadas conforme normas del Instituto Brasilero del Medio Ambiente y de los Recursos Naturales Renovables (IBAMA. Los ovarios fueron disecados por mesoscopía y procesados por microscopía de luz (coloración: hematoxilina-eosina. La forma de los ovarios fue ovalada, midiendo 7,9 mm de longitud y 4,4 mm de ancho. Al contrario de lo descrito en otras especies de armadillos, no observamos una concavidad central en dicha estructura. Los ovarios estaban recubiertos por un epitelio escamoso simple y con tejido conjuntivo rico en fibras colágenas. La región cortical presento folículos en varias etapas de su desarrollo, siendo que los folículos primordiales tendían a agruparse en clusters. La región medular contenía vasos sanguíneos y células intersticiales y cordones sexuales tal como ha sido descrito en otras especies de armadillos. El ovocito del folículo terciario midió 183 ± 18 μm de diámetro, con núcleo esférico y cromatina dispersa. La zona pelúcida fue homogénea y acelular alrededor del ovocito. Folículos con grupos de ovocitos no fueron identificados. Este estudio demostró que la morfología ovárica del E. sexcinctus fue semejante a la de otros mamíferos, pero diferente al de otras especies de armadillos descritos en otros artículos.

  7. Tipificación molecular del virus dengue 3 durante el brote epidémico de dengue clásico en Lima, Perú, 2005

    Directory of Open Access Journals (Sweden)

    Enrique Mamani Z

    2005-07-01

    Full Text Available Objetivos: Identificar mediante trascripción reversa-reacción en cadena de la polimerasa (RT-PCR y sitios específicos de restricción - reacción en cadena de la polimerasa (RSS-PCR al agente causal del brote epidémico presentado en el distrito de Comas, Lima en abril del año 2005. Materiales y métodos: veinte muestras de suero colectadas durante el brote de dengue fueron procesados por RT-PCR para determinar el serotipo, esta técnica se realizó en un solo paso. Luego se aplicó la técnica RSS-PCR para la identificación del genotipo circulante y se corroboraron los resultados posteriormente con aislamiento viral y secuenciamiento. Resultados: El análisis del RTPCR del ARN extraído de las muestras presentó un producto amplificado de 290pb que corresponden al dengue serotipo 3 (DEN 3. El análisis de los productos de RSS-PCR del ARN extraído a partir de aislamientos de DEN 3 correspondió al patrón C, incluido en el genotipo III. Los aislamientos de los virus dengue 3 en líneas celulares C6/36, tipificadas por IFI y el secuenciamiento genético confirmaron los resultados obtenidos por las pruebas previamente descritas. Conclusión: Durante el brote epidémico de dengue clásico en Lima, circuló el genotipo III del virus DEN 3.

  8. Evaluación de la mutagenicidad causada por metales pesados presentes en agua del río Cauca en la ciudad de Cali, Colombia

    Directory of Open Access Journals (Sweden)

    Aura H. Vivas

    2014-05-01

    Full Text Available Se evaluó la mutagenicidad del agua del río Cauca debida a la presencia de metales pesados en la zona urbana de la Ciudad de Santiago de Cali, a partir de muestras tomadas en la temporada seca y lluviosa en el año 2013. Los metales se extrajeron pasando el agua por la resina Amberlite XAD-16. Las concentraciones de los metales pesados se midieron por absorción atómica y la mutagenicidad se evaluó por medio del test de Ames, con las cepas TA98 y TA100 de Salmonella typhimurium con y sin activador enzimático S9. Los resultados mostraron índices de mutagenicidad (IM positivos (IM > 2,0 para muestras colectadas en temporada lluviosa en tres de los cinco puntos evaluados: puente El Hormiguero (IM = 3,6, desembocadura del Canal Colector Sur (IM = 2,9 y desembocadura del río Cali (IM = 2,7, todos con la cepa TA98 sin S9. Estos sitios presentaron a su vez las mayores concentraciones totales de metales pesados en sus extractos. El análisis de la variación espacio-temporal del índice mutagénico se realizó haciendo un análisis de varianza multifactorial del IM. Los resultados encontrados indican que la época de muestreo contribuye significativamente a la variabilidad del IM, mientras que los puntos de muestreo no.

  9. Caracterización morfológica de accesiones silvestres de guayaba

    Directory of Open Access Journals (Sweden)

    Liliana Jiménez Lozano

    2009-04-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.

  10. Heavy metal pollution in aquatic ecosystems and its phytoremediation using wetland plants: an ecosustainable approach.

    Science.gov (United States)

    Rai, Prabhat Kumar

    2008-01-01

    This review addresses the global problem of heavymetal pollution originating from increased industrialization and urbanization and its amelioration by using wetland plants both in a microcosm as well as natural/field condition. Heavymetal contamination in aquatic ecosystems due to discharge of industrial effluents may pose a serious threat to human health. Alkaline precipitation, ion exchange columns, electrochemical removal, filtration, and membrane technologies are the currently available technologies for heavy metal removal. These conventional technologies are not economical and may produce adverse impacts on aquatic ecosystems. Phytoremediation of metals is a cost-effective "green" technology based on the use of specially selected metal-accumulating plants to remove toxic metals from soils and water. Wetland plants are important tools for heavy metal removal. The Ramsar convention, one of the earlier modern global conservation treaties, was adopted at Ramsar, Iran, in 1971 and became effective in 1975. This convention emphasized the wise use of wetlands and their resources. This review mentions salient features of wetland ecosystems, their vegetation component, and the pros and cons involved in heavy metal removal. Wetland plants are preferred over other bio-agents due to their low cost, frequent abundance in aquatic ecosystems, and easy handling. The extensive rhizosphere of wetland plants provides an enriched culture zone for the microbes involved in degradation. The wetland sediment zone provides reducing conditions that are conducive to the metal removal pathway. Constructed wetlands proved to be effective for the abatement of heavymetal pollution from acid mine drainage; landfill leachate; thermal power; and municipal, agricultural, refinery, and chlor-alkali effluent. the physicochemical properties of wetlands provide many positive attributes for remediating heavy metals. Typha, Phragmites, Eichhornia, Azolla, Lemna, and other aquatic macrophytes are some

  11. ACEX: A First Look at Arctic Ocean Cenozoic History

    Science.gov (United States)

    Moran, K.; Backman, J.

    2004-12-01

    The first Integrated Ocean Drilling Program mission specificplatform expedition (ACEX - Arctic Coring Expedition) drilled and recovered core from five holes at four sites through Cenozoic sediments draping the crest of the Lomonosov Ridge in the central Arctic Ocean. Coring continued into the underlying Cretaceous sedimentary bedrock. Sites are located only a few nautical miles apart along a single seismic line (AWI-91090), showing an identical and coherent Cenozoic seismostratigraphy. Preliminary results from shipboard investigations of core-catcher-based bio- and lithostratigraphy, pore water analyses and core logger data describe a thick (~160 m) middle Miocene through Pleistocene sequence that shows large amplitude, cyclic variability in the density, magnetic susceptibility and acoustic velocity of the sediments. Sediments are largely carbonate free. Pleistocene sedimentation rates are close to 3 cm/ka, whereas Pliocene sediments are by-and-large missing. A sharp change in physical properties at ~200 m defines the transition into a 200+ m thick Paleogene sequence that is initially dominated by large numbers of dinoflagellate cysts. The early Miocene, Oligocene and late Eocene appear to be largely missing in a hiatus. However, a 32 m thick interval separates the overlying middle Miocene from the underlying middle Eocene and presumably preserves some of the early Neogene and late Paleogene sections. Dinoflagellate cysts, diatoms, ebridians and silicoflagellates are common to abundant in the middle Eocene section, which bottoms in a spectacular layer showing massive occurrences of glochidia and massulae (megaspores) of the freshwater hydropterid fern Azolla (duckweed) at the early/middle Eocene boundary (~306 m), suggesting strongly reduced surface water salinity or perhaps even a brief episode of fresh water conditions at the surface. Biosilica is not present prior to the late early Eocene (~320 m). The (sub-) tropical dinoflagellate species Apectodinium augustum

  12. Identificación de ácaros del polvo casero en colchones y almohadas de niños alérgicos de Santa Marta, Colombia

    Directory of Open Access Journals (Sweden)

    Jainy Meza Navarro

    2013-10-01

    Full Text Available ResumenLa prevalencia elevada de alergias en Colombia hace necesario investigar los factores que influye sobre su etiología. El objetivo de este estudio fue identificar la fauna de ácaros presente en los hogares de niños alérgicos de Santa Marta. Un total de 70 muestras de polvo fueron colectadas desde 42 casas por medio de la aspiración de colchones y almohadas, durante los meses de Julio a Octubre de 2007. Los ácaros fueron identificados bajo la luz de un microscopio usando claves taxonómicas, contados y expresados como ácaros por gramo de polvo. Los ácaros de la familia Pyroglyphidae fueron los más predominantes (84,58%, teniendo a Dermatophagoides farinae (23,85% como la especie más abundante, seguido por Dermatophagoides pteronyssinus (7,31%. Otros ácaros prevalentes fueron Cheyletus spp, Euroglyphus maynei y Blomia tropicales, con niveles superiores a los 500 ácaros/ gramo, considerado como de alto riesgo para sensibilización alérgica. Estos resultados contribuyen al conocimiento de la fauna de ácaros del polvo casero de Santa Marta, importante para el diagnóstico y terapia de las alergias. (Duazary 2008; 1: 24 - 31.AbstractThe increasing prevalence of allergic diseases in Colombia makes necessary to research about factors that influence their etiology. The aim of this study was to investigate the mite fauna present in homes of allergic child from Santa Marta. A total of 70 samples were collected from 42 houses through vacuuming mattresses and pillows, during the months of July to October 2007. Mites were identified under light microscopy using taxonomic keys, count and expressed as mites per gram of dust. The prevalent mite family was Pyroglyphidae (84.58%, having Dermatophagoides farinae as the major specie (23.85%, followed by D. pteronyssinus. Other mites prevalent were Cheyletus spp, Euroglyphus maynei and Blomia tropicalis, with levels up to 500 mites/ gram, considered like of high risk for the allergic sensitization

  13. Desarrollo de cronologías de ancho de anillos para alerce (Fitzroya cupressoides en Contao y Mirador, Chile Development of tree-ring chronologies for alerce (Fitzroya Cupressoides in Contao and Mirador, Chile

    Directory of Open Access Journals (Sweden)

    EDUARDO NEIRA

    2000-12-01

    Full Text Available Se desarrollaron dos cronologías de ancho de anillos de crecimiento a partir de muestras de alerce (Fitzroya cupressoides (Molina Johnston, colectadas en dos sitios: Contao, Cordillera de los Andes (41º 33'S, 72º 38'W, y Mirador, en la Cordillera de la Costa (40º 10'S, 73º 42'W. En la elaboración de las cronologías se utilizó el programa COFECHA para verificar el cofechado y se desarrolló para cada sitio una cronología utilizando el programa computacional ARSTAN. Se compararon las cronologías Contao y Mirador, con otras existentes para alerce encontrándose una alta similitud de la cronología Contao con la desarrollada para Lenca (41º 33'S, 72º 36' W. Contao presentó los valores más altos en los estadígrafos analizados con relación a las demás cronologías. Se observaron diferencias entre las cronologías provenientes de la Cordillera de la Costa y de los Andes en los últimos 150 años, probablemente producto de explotaciones humanas e incendios ocurridos en la cordillera de la Costa. La correlación con variables climáticas fue similar en su tendencia a la de otros estudios previos, documentando una correlación negativa con las temperaturas y positiva con las precipitaciones del verano anterior al período de crecimientoTwo ring-width chronologies were developed using samples from alerce (Fitzroya cupressoides (Molina Johnston. These were collected from two different sites; Contao, in the Andean Range and Mirador, in the Coastal Range. The series from the each site were cross-dated and COFECHA program was used to verify this process. Once correctly cross-dated, ARSTAN program was used to build up a chronology for each site (Contao and Mirador. These chronologies were compared with other existing chronologies. Contao presented the best statistics when compared to the other chronologies. Differences between chronologies from the Coastal and Andes Ranges were detected mainly during the last 150 years. Before this period

  14. Disponibilidad de cinc, cobre, hierro y manganeso extraíble con DTPA en suelos de córdoba (Argentina y variables edáficas que la condicionan Availability of DTPA extractable zinc, copper, iron and manganese in Córdoba (Argentina soils and its relationship with other properties

    Directory of Open Access Journals (Sweden)

    Eduardo Volmer Buffa

    2005-12-01

    Full Text Available Se midió el contenido en suelo de Cu, Zn, Fe y Mn extraíbles con DTPA y se relacionó con la materia orgánica, pH, tenor salino y cantidad de carbonatos en Molisoles, Entisoles y Alfisoles de la llanura chaco-pampeana, en la provincia de Córdoba, Argentina. Las muestras de suelo, colectadas en 48 situaciones, correspondientes a distintas condiciones texturales (desde franco limoso a franco arenoso, de acidez (débil acidez a alta alcalinidad y con salinidad baja a media, fueron contrastadas con valores de suficiencia para microelementos, obtenidos de la bibliografía. Se encontraron valores muy bajos de Cu en suelos arenosos (0,1-1 mg kg-1 y los mayores correspondieron a Argiudoles (PO (1,5 -2,5 mg kg-1. El Zn estuvo por debajo de 1 mg kg-1 en la mayoría de los sitios. El Mn presentó un rango de 23 a 85 mg kg-1 y el Fe de 21 a 68 mg kg-1, valores superiores a los considerados críticos y con los máximos en Argiudoles (PO. Las variables acidez y carbonatos se asociaron con el Cu, la materia orgánica y la salinidad con el Zn, todas con signo positivo.Cu, Zn, Fe and Mn DTPA extractable content and it relationship with organic matter, pH, salinity and lime were studied in 48 soils (Mollisol, Entisol and Alfisol from some geomorphic regions of the Chaco-Pampean plain of Cordoba (Argentina. Soils ranged from silty loam to loamy sandy texture, weak acidity to strong alcalinity, and low to medium salinity, they were sampled from 0 to 60 cm depth. Copper were at its critical range (0,1-1 mg.kg-1 only in sandy soils, with the highest contents (1.5 -2.5 mg kg-1 in Argiudolls. Zinc was below 1 mg kg-1 in most regions. Manganese (23-85 mg kg-1 and Fe (21-68 mg kg-1 were above their respective critical content in all regions, with highest contents in Argiudolls for both micronutrients. Zn, Cu and Mn distribution in depth profile, was associated with organic matter content. Soil variables lime and pH for Cu, and OM and salinity for Zn, were positively

  15. Volatile aromatic compounds in Mexico City atmosphere: levels and source apportionment

    Energy Technology Data Exchange (ETDEWEB)

    Mugica, V. [Universidad Autonoma Metropolitana - Unidad Azcapotzalco, Mexico, D.F. (Mexico); Ruiz, M.E. [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico); Watson, J.; Chow, J. [Desert Research Institute, Reno, Nevada (United States)

    2003-01-01

    Samples of ambient air were simultaneously collected at three different sites of Mexico City in March of 1997 in order to quantify the most abundant volatile aromatic compounds and estimate the source contributions by application of the chemical mass balance model (CMB). Volatile aromatic compounds were around 20% of the total of non-methane hydrocarbons present in morning air samples. The most abundant volatile aromatic species in urban air were toluene and xylenes followed by 1, 2, 4 trimethylbenzene, benzene, ethylbenzene, metaethyltoluene, 1, 3, 5 trimethylbenzene, styrene, n propylbenzene, and isopropylbenzene. Sampling campaigns were carried out at crossroads, a bus station, a parking place, and areas where solvents and petroleum distillates are used, with the objective of determining people's exposure to volatile aromatic compounds. The CMB was applied for estimating the contribution of different sources to the presence of each one of the most abundant aromatic compounds. Motor vehicle exhaust was the main source of all aromatic compounds, especially gasoline exhaust, although diesel exhausts and asphalt operations also accounted for toluene, xylenes, ethylbenzene, propylbenzenes, and styrene. Graphic arts and paint applications had an important impact on the presence of toluene. [Spanish] Se colectaron simultaneamente muestras de aire ambiente en tres sitios de la Ciudad de Mexico durante el mes de marzo de 1997 con el fin de conocer las concentraciones y el origen de compuestos aromaticos utilizando el modelo de balance de masa de especies quimicas (CMB). Los compuestos aromaticos volatiles representaron alrededor del 20% del total de hidrocarburos no metalicos presentes en las muestras matutinas colectadas. Las especies aromaticas volatiles mas abundantes en el ambiente fueron el tolueno y los xilenos, seguidos por 1, 2, 4 trimetilbenceno, benceno, etilbenceno, metaetiltolueno, nporpilbenceno, isopropilbenceno, 1, 3, 5 trimetilbenceno y estireno. Se

  16. DIETA DE LA NUTRIA NEOTROPICAL Lontra longicaudis (CARNÍVORA, MUSTELIDAE EN EL RÍO ROBLE, ALTO CAUCA, COLOMBIA DIET OF THE NEOTROPICAL OTTER Lontra Longicaudis (Carnivora, Mustelidae IN THE ROBLE RIVER, UPPER CAUCA BASIN, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Rosemary Mayor-Victoria

    Full Text Available Se estudio la dieta de la nutria neotropical en el río Roble, sistema del río La Vieja , alto Cauca, Colombia. Desde agosto de 2006 hasta marzo de 2007 dos veces por mes fueron colectadas heces de la nutria en bolsas plásticas en la zona baja del río Roble. En el laboratorio las muestras fueron lavadas, tamizadas y comparadas con una colección de referencia. Se reconocieron 14 categorías alimenticias, dentro los cuales los peces de la Familia Loricariidae , presentaron el mayor porcentaje de frecuencia, particularmente la especie Chetostoma sp. (22,6%, seguida de Hypostomus sp. (9,55% y Ancistrus sp. (8,54%; otras especies de peces aprovechadas por la nutria en menor proporción son: Apteronotus sp. (11,6%, Brycon henni (9,86%, Lebiasina sp. (0,70%, y Rhamdia sp. (9,15%. Los insectos fueron el siguiente grupo en importancia, con la especie Corydalus sp. (9% (Familia Corydalidae, y en menor presencia los reptiles de la Familia Corytophanidae , especie Basiliscus sp. Se encontró diferencias significativa, entre los ítems consumidos por temporada climática (Rs = 0,429; n= 11 p= 0.00001.The diet of Neotropical otters was studied at Roble river, a tributary of La Vieja river, Upper Cauca basin, Colombia . From August 2006 to March 2007 otter scats were collected twice per month using plastic bags, from the lower stretch of the Roble river. In the laboratory, the scats were washed, sieved and items were identified by comparing them with a reference collection. Fourteen food categories were recognized. Ranked by frequency of occurrence, benthic sucker-mouthed catfish were the favored food items, especially Chaetostoma sp (22,6 % followed by Hypostomus sp. (9,55% and Ancistrus sp. (8,54%. Other species of fish eaten by the otters are: Apteronotus sp. (11,6 %, Brycon henni (9,86 %, Lebiasina sp. (0,70%, y Rhamdia sp. (9,15 %; (Family Loricariidae., followed by insects Corydalus sp (9% (Family Corydalidae. The lowest frequency observed was for

  17. Coeficientes de digestibilidad total y de proteínas en alimentos experimentales para juveniles de Oplegnathus insignis (Kner, 1867 (Perciformes, Oplegnathidae

    Directory of Open Access Journals (Sweden)

    Avelino Muñoz

    2015-05-01

    Full Text Available Los alimentos para peces están formulados con diversos ingredientes, donde la harina de pescado es la principal fuente de proteína. Sin embargo, este insumo tiene un alto costo que lleva a la necesidad de evaluar nuevas fuentes de proteínas y probarlas en especies marinas. Oplegnathus insignis (San Pedro, Pacific beakfish es una especie omnívora en su etapa intermareal y carnívora en su etapa submareal, que ha sido cultivada de manera experimental, siendo necesario incorporar dietas formuladas. Este estudio reporta la experiencia en alimentación y nutrición, de juveniles de O. insignis alimentados con dietas formuladas con distintas fuentes de proteína. Se efectuó una experiencia con juveniles de O. insignis provenientes de un cultivo experimental. Se formularon cuatro alimentos, uno en base de harina de pescado (referencia y tres modificando la fuente de proteína del alimento de referencia, intercambiando un 30% de harina de pescado, por harina de soya, harina de moluscos y harina de quinoa. Se experimentó con 180 ind de 295,6 g y de 450 días post-eclosión, distribuidos en 12 estanques rectangulares de 1,6 m³. La alimentación fue a saciedad. Se efectuaron análisis próximales de los alimentos experimentales de las heces colectadas. Se determinó los coeficientes de digestibilidad total y proteína. El alimento con mayor contenido de proteína fue el que contenía harina de moluscos. El mayor coeficiente de digestibilidad total lo tienen los alimentos con harina de pescado (68,0% y harina de moluscos (67,1%, mientras que en los alimentos en base a harinas vegetales, la digestibilidad total para la harina de soya fue de 62,7% y para harina de quinoa de 64,1%. Estos resultados indican que es factible reemplazar un 30% de la harina de pescado por harinas de origen vegetal.

  18. Genetic Variability of the Tomato Leaf Miner (Tuta absoluta Meirick; Lepidoptera: Gelechiidae, in Tunisia, Inferred from RAPD-PCR Variabilidad Genética del Minador de Hojas de Tomate (Tuta absoluta Meyrick; Lepidoptera: Gelechiidae en Túnez desde RAPD-PCR

    Directory of Open Access Journals (Sweden)

    Asma Bettaibi

    2012-06-01

    Full Text Available The tomato leaf miner Tuta absoluta Meyrick has invaded tomato (Solanum lycopersicum L. crop in Tunisia since 2008 and is representing today a major threat to the production of this crop. In this study, we used the Randomly Amplified Polymorphic DNA-Polymerase Chain Reaction (RAPD-PCR technology to assess the genetic variability within and among seven populations of T. absoluta, collected on tomato from different regions in Tunisia. Using five RAPD-PCR primers and 108 individuals, 140 polymorphic fragments were recorded. From 335 different RAPD phenotypes generated, 71 were redundant and 264 unique to a specific population. The genetic structure of T. absoluta was investigated using analysis of molecular variance (AMOVA, genetic distances (Fst and multidimensional scaling (MDS. We detected a high genetic diversity within and among populations in conjunction with a significant differentiation between populations, suggesting that different founder genotypes would have been responsible of the introduction of T. absoluta in Tunisia. The presence of overlapping phenotypes probably indicates migration events between populations, mainly through infested plant material carried by humans.El minador de hojas de tomate Tuta absoluta Meyrick ha invadido el cultivo del tomate (Solanum lycopersicum L. en Túnez desde 2008 y actualmente representa una importante amenaza para su producción. En este estudio usamos la tecnología de ADN polimórfico amplificado al azar-reacción de cadena polimerasa (RAPD-PCR para evaluar la variabilidad genética dentro y entre siete poblaciones de T. absoluta, colectadas desde tomate en diferentes regiones de Túnez. Usando cinco primers RAPD-PCR y 108 individuos, se registraron 140 fragmentos polimórficos. Se generaron 335 fenotipos RAPD diferentes, entre los cuales 71 fueron redundantes y 264 únicos para una población específica. La estructura genética de T. absoluta se investigó usando análisis de varianza molecular

  19. Crecimiento y mortalidad de la Yalua (Cyphocharax Magdalenae Steindachner, 1978 en el rió Sinú, Colombia

    Directory of Open Access Journals (Sweden)

    Harold Blanco V

    2005-05-01

    Full Text Available Para estimar los parámetros de crecimiento y mortalidad de la Yalúa ( Cyphocharax magdalenae Steindachner,1878 se aplicó el análisis de frecuencia de tallas (ELEFAN a la información colectada entre enero ydiciembre 2000. Se midió longitud total (LT, longitud horquilla (LH y longitud estándar (LS en centímetrosy el peso total (WT en gramos. El intervalo de clase fue de 0.5 cm, la temperatura media anual fue 28 °Cy se estimaron límites de confianza al 95%. La distribución de frecuencias se asimila a una curva normal.Los valores estimados para L¥, K y t0 fueron 22.7 (± 0.14 cm LT, 0.28 (+ 0.01 año-1, y -0.64 años,respectivamente, por lo que se considera un pez de longevidad y tasa de crecimiento medios. La mortalidadtotal (Z fue estimada en 1.97 ( 0.13 año-1, la mortalidad natural (M en 0.84 año –1, la mortalidad porcaptura (F en 1.13 año–1 y la tasa de explotación (E = F/Z fue 0.57. La talla con que la Yalúa esreclutada totalmente a la pesquería (Lc es 14.4 cm LT y la talla media de captura (TMC es de 15.5 cm LT.El 42% de la captura se efectuó por debajo de la talla mínima recomendada para la cuenca del Río Sinú,la captura y la talla media de captura (TMC de la Yalúa estimadas por el INPA ha oscilado desde añosanteriores, en la época seca del año en estudio se pescaron individuos muy pequeños consumidos comopesca de subsistencia, en Lorica se comercializaron individuos con tallas semejantes en el 2001 y 2002, lo quepermite inferir que se esté convirtiendo en especie reemplazo de las tradicionalmente comercializadas, que haysobrepesca sobre el recurso, por lo se infiere que la dinámica poblacional de la especie en estudio ha sidoafectada. Por lo tanto, se debe introducir el ordenamiento de su pesquería en el mediano plazo teniendoen cuenta que la Yalúa es la cuarta especie en importancia comercial en la cuenca del Río Sinú.

  20. Growth and extracellular laccase production in liquid cultures of Minimidochium parvum LPSC # 548 Strain Crecimiento y producción de lacasa extracelular en cultivos líquidos de Minimidochium parvum cepa LPSC # 548

    Directory of Open Access Journals (Sweden)

    Mario C. N. Saparrat

    2007-07-01

    Full Text Available Minimidochium parvum LPSC # 548, a fungus isolated from litter floating on waters of Río Santiago (Provincia de Buenos Aires, Argentina polluted with industrial effluents and crude-oil, was grown as a shaking culture on a C-limited medium to evaluate its ability to produce extracellular laccase. The effect of anthracene, CuSO4 · 5H2O, ethanol, guaiacol, humic acids, Kraft lignin, MnSO4· H2O, Tween 20 and veratryl alcohol on its growth and extracellular laccase activity levels was also analyzed. The cultures grown on basal medium produced maximum biomass (over 420 mg/100 ml and maximum extracellular laccase activity (351.7 ±53.3 pkat/ml after 5 days of incubation. Among the different factors tested, only the humic acids at 0.1 % (w/v were found to stimulate the growth of M. parvum . However, Tween 20 (0.1 %, v/v was the only one that produced an increase of laccase activity levels up to 2.5-fold compared to the control.Minimidochium parvum LPSC # 548, un hongo aislado de materia orgánica colectada en aguas de Río Santiago (Provincia de Buenos Aires, Argentina contaminadas con efluentes industriales y crudo de petróleo, se cultivó en un medio líquido limitante en carbono bajo agitación para evaluar su habilidad para producir lacasa extracelular. Se analizó también el efecto de ácidos húmicos, alcohol veratrílico, antraceno, CuSO4 · 5H2O, etanol, guaiacol, lignina Kraft, MnSO4· H2O y Tween 20 sobre el crecimiento fúngico y los niveles de actividad lacasa extracelular. Los cultivos sobre medio basal produjeron máximos niveles de biomasa (superior a 420 mg/100 ml y actividad lacasa extracelular (351,7 ±53,3 pkat/ml después de 5 días de incubación. Entre los diferentes agentes químicos testeados, sólo los ácidos húmicos al 0,1 % (p/v estimularon el crecimiento de M. parvum . No obstante, sólo el Tween 20 (0,1 %, v/v produjo un incremento de los niveles de actividad lacasa (2,5 veces comparado a cultivos control.

  1. Diversidad genética de Dioscorea trifida “sachapapa” de cinco cuencas hidrográficas de la amazonía peruana

    Directory of Open Access Journals (Sweden)

    Jhonatan Pérez Arévalo

    2013-12-01

    Full Text Available Dioscorea trifida “sachapapa” es una de las especies promisorias amazónicas que podemos considerarla huérfana de la ciencia, por las escasas investigaciones que hay sobre esta especie. El objetivo de esta investigación fue determinar la diversidad genética intra e interpoblacional de D. trifida de cinco cuencas hidrográficas de la amazonía peruana. Las hojas fueron colectadas de una colección de germoplasma y purificó el ADN con métodos estándares. El polimorfismo genético se evaluó con la técnica RAPD y los parámetros de genética poblacional fueron estimados con el programa POPGENE. Los análisis espectrofotométrico (A260/A280=1,7±0,1 y electroforético (bandas de ADN íntegras mostraron que el ADN purificado fue de alta calidad. Asimismo, la cantidad obtenida fue apropiada para estudios de diversidad genética (rendimiento promedio = 582±248 mg ADN/mg hojas. La diversidad genética intrapoblacional más alta se encontró en la cuenca del Itaya (h = 0,24±0,11 y la más baja en la cuenca del Marañón (h = 0,10±0,04. Adicionalmente, la diversidad genética interpoblacional más alta se registró entre las poblaciones de Itaya vs Ucayali (GST = 1,00, mientras que la más baja entre las poblaciones de Nanay vs Tapiche (GST = 0,07. En conclusión, D. trifida muestra variación en su diversidad genética intra e interpoblacional en las cinco cuencas hidrográficas de la amazonía peruana, siendo la cuenca del Itaya la que presenta mayor diversidad genética intrapoblacional y las poblaciones de Itaya vs Ucayali las que presentan mayor diversidad genética interpoblacional, que en parte se atribuyen al flujo de genes diferencial entre las poblaciones analizadas.

  2. INFLUENCIA DE LA FASE LUNAR EN LAS TASAS DE CAPTURA DE Selar crumenophthalmus (CARANGIDAE EN EL CARIBE DE COLOMBIA. UNA APROXIMACIÓN POR MODELOS LINEALES GENERALIZADOS Moon Phase Influence on Catch Rates of Selar crumenophthalmus (Carangidae in the Caribbean Sea off Colombia. A Generalized Linear Models Approach

    Directory of Open Access Journals (Sweden)

    JAIRO ALTAMAR

    Full Text Available Las tasas de captura de Selar crumenophthalmus provenientes de los desembarcos registrados en el norte del mar Caribe de Colombia fueron analizadas y estandarizadas mediante Modelos Lineales Generalizados (MLG. Se utilizó información colectada entre 1994 y 2001. Los factores que se utilizaron como predictores lineales fueron: año, mes, código lunar, sector geográfico, y estrato de profundidad. Las mayores tasas de captura fueron detectadas durante los dos días de luna nueva máxima en el sector del Parque Nacional Natural Tayrona, lo cual indica que la mayor disponibilidad del recurso, dado su hábito nocturno y fototaxis positiva, está muy localizada en el tiempo. Esta condición ha de incorporarse en los esquemas de ordenamiento, una vez que facilita la implementación de mecanismos de control pesquero. Se registró una disminución de la tasa de captura en los últimos dos años del periodo examinado, tendencia que sugiere el deterioro de la abundancia poblacional de este recurso, hasta ahora considerado fuera de riesgo de sobreexplotación. En pesquerías multiespecíficas, explicar la abundancia poblacional con tasas de captura estimadas incluyendo solo datos de lances que registren la especie analizada, puede derivar en una conclusión conceptual y cuantitativamente incorrecta.Catch rates of Selar crumenophthalmus in the landings belonging from the north of the Caribbean Sea off Colombia were analyzed and standardized with Generalized Lineal Models (GLM. Information collected between 1994 and 2001 was used. The factors used as lineal predictors were: year, month, Moon phases, geographic sector, and depth. The highest catch rates were detected during the two days 100% New Moon in the Tayrona National Natural Park, which indicates that the availability of the resource, because its nocturne habit and positive phototaxis, is located in the time. This condition should be incorporates in management schemes, since facilitates the

  3. CUANTIFICACIÓN DEL CARBÓN MINERAL EN LAS PLAYAS DEL CARIBE COLOMBIANO (DEPARTAMENTO DEL MAGDALENA

    Directory of Open Access Journals (Sweden)

    JULIÁN ANDRÉS GARCÍA MURCIA

    2014-01-01

    Full Text Available Con el fin de cuantificar el porcentaje de carbón mineral en playas del departamento del Magdalena, (Colombia se llevó a cabo un procedimiento sencillo para separar el sedimento en fracciones sedimentológicas de acuerdo a su densidad. Se utilizaron sedimentos provenientes de seis playas del departamento colectadas de dos niveles mareales en noviembre de 2012 y febrero de 2013, antes y después de un derrame de una barcaza de carbón, que ocurrió el 12 de enero de 2013. Los sedimentos fueron secados, suspendidos en una solución de sodio politungstato (densidad: 2,0 g·cm-3 y centrifugados. Ya que el carbón tiene una densidad menor (1,2-1,9 g·cm-3 que otros minerales inorgánicos, cualquier partícula de carbón presente en una muestra se concentró en la fracción ligera, mientras que las partículas más densas se sedimentaron. Para eliminar materia orgánica no correspondiente a carbón mineral, se sometió la fracción ligera después a una oxidación leve con peróxido de hidrógeno. Adicionalmente, para estimar un límite máximo del contenido de carbón mineral, se determinó la pérdida de peso de sedimentos enteros a partir de combustión a 550 °C. En las seis playas evaluadas, la pérdida máxima de peso por combustión fue de 2,4 % y el porcentaje máximo de la fracción ligera (densidad 3 g·cm-3 y que constituyen entre 10 y 70 % del peso seco total de las muestras.

  4. Cuatro nuevas especies del género Liolaemus (Iguania: Liolaemidae, pertenecientes al grupo boulengeri, de la Patagonia, Argentina

    Directory of Open Access Journals (Sweden)

    Abdala, Cristian Simón

    2003-12-01

    Full Text Available Se describen cuatro nuevas especies del género Liolaemus, pertenecientes al grupo boulengeri, caracterizado por la presencia de un parche femoral de escamas agrandadas en la parte posterior del fémur. Una especie fue colectada en el sur de la provincia de Neuquén y las otras tres en el suroeste, centro y este de la provincia de Río Negro, en la Patagonia Argentina. Dentro del grupo las nuevas especies están relacionadas fenéticamente a Liolaemus boulengeri. Se estudiaron 98 caracteres morfológicos externos, referidos principalmente a caracteres de lepidosis, patrón de coloración y proporciones corporales, corrientemente estudiados en Liolaemus. Las diferencias más significativas entre estas especies y Liolaemus boulengeri se dan principalmente en el patrón de coloración y en algunos caracteres de escamación. Estas especies ocupan parte de las tres regiones patagónicas que se diferencian con base en la orografía y vegetación asociada. Las nuevas especies del centro y suroeste de la provincia de Río Negro, soportan grandes diferencias de temperatura diarias y estacionales. Las cuatro especies que se describen aquí se alimentan principalmente de insectos. Four new species of Liolaemus are described from the Patagonia region of southern Argentina. One species was collected in southern Neuquén Province and the other three are from Río Negro Province. Each of the new species has a patch of enlarged scales on the posterior surface of the thighs, indicating their relationship to members of the boulengeri group. Within this group, the four new species are morphologically most similar, and may be most closely related to, Liolaemus boulengeri. A total of 98 external morphological characters, principally squamation, color pattern, and body proportions, were recorded for these new members of the boulengeri group and compared with those for Liolaemus boulengeri. Significant differences between the new species and Liolaemus boulengeri were

  5. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Lozada Betty Stefany

    2012-11-01

    Full Text Available

    Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aisla- do M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibi- ción del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. ori- ganoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno,

    y-terpineno, acetato de timilo, carvacrol, 1-mirceno, trans-1ccariofileno. Diferencias significativas (P <

    0.05 sobre la susceptibilidad se observaron entre las dos cepas fúngicas estudiadas, siendo en gene- ral más susceptible el aislado M2 que la cepa ATCC. Los AEs de L. origanoides son candidatos para ser usados como posibles biofungicidas en el control de la moniliasis. Son necesarios estudios futuros orientados a determinar la actividad in vivo antifúngica de estos AEs y sus principales componentes.

  6. [In Process Citation].

    Science.gov (United States)

    Castillo-Castañeda, Patricia Carolina; Gaxiola-Robles, Ramón; Méndez-Rodríguez, Lía Celina; Labrada-Martagón, Vanessa; Zenteno-Savín, Tania

    2016-03-25

    Introducción: los plaguicidas organoclorados (POC) pueden incrementar la producción de especies reactivas de oxígeno (ERO). Tales efectos pueden ser contrarrestados por el sistema antioxidante, el cual se encuentra también en la leche materna. Objetivo: evaluar los indicadores de estrés oxidativo en leche materna asociados a la presencia de POC y su relación con la ingesta de alimentos marinos. Métodos: la leche materna fue colectada de 108 mujeres lactantes. Los indicadores de estrés oxidativo (actividad enzimática antioxidante, concentración de glutatión, producción de radical superóxido [O 2•- ], concentración de peroxidación de lípidos y carbonilos proteicos) se analizaron por espectrofotometría. Las concentraciones de POC se midieron por cromatografía de gases. Resultados y discusión: la producción de O 2•- no presentó relación significativa con las concentraciones de POC. Se encontraron correlaciones significativas entre las concentraciones de POC y la actividad de las enzimas antioxidantes (actividad de glutatión reductasa [GR] y concentración de aldrín [r = - 0,5], actividad de superóxido dismutasa [SOD] y concentración de α-HCH [r = 0,45]). El daño oxidativo mostró baja correlación con el contenido de POC (r < 0,30, p < 0,05). Es posible que los niveles de POC no sean suficientes para incrementar la producción de O 2•- , ya sea que el incremento en la producción de ERO se deba a especies reactivas diferentes a O 2•- o debido a que la capacidad antioxidante es suficiente para evitar el daño oxidativo en leche materna. Conclusión: los resultados de este estudio sugieren que la dieta marina no es un factor determinante en el nivel de contaminación por POC, ni en el daño oxidativo presente en leche materna.

  7. Caracterización de Klebsiella pneumoniae productora de la beta-lactamasa SHV-5, en una unidad de cuidados intensivos Characterization of SHV-5 beta-lactamase-producing Klebsiella pneumoniae in an intensive care unit

    Directory of Open Access Journals (Sweden)

    Verónica Andrade

    2004-12-01

    Full Text Available OBJETIVO: Caracterizar molecularmente los aislamientos de Klebsiella pneumoniae obtenidos de pacientes pediátricos y del personal de salud en la unidad de cuidados intensivos de un hospital de tercer nivel de atención en la Ciudad de México, Distrito Federal. MATERIAL Y MÉTODOS: Se analizaron 15 aislamientos de Klebsiella pneumoniae colectadas de un brote durante el mes de junio de 1996, ocho de pacientes y siete de personal del Hospital Infantil de México. Los aislamientos fueron caracterizados por electroforesis en gel de campos pulsados (EGCP, amplificación azarosa del polimorfismo de ADN por reacción en cadena de la polimerasa (AAPD-PCR, y serotipificación, isoelectroenfoque de beta-lactamasas y secuenciación nucleotídica de productos de la reacción en cadena de la polimerasa. RESULTADOS: El serotipo predominante fue el 61 y correlacionó con los perfiles de AAPD-PCR y EGCP en 11 de los 15 aislamientos. Se identificó una clona predominante productora de SHV-5 con una alta letalidad. CONCLUSIONES: Las técnicas de biología molecular fueron herramientas muy útiles en la caracterización de la clona de K. pneumoniae identificada en pacientes y el personal hospitalario, que sugirieron una posible transmisión cruzada. Estos resultados ilustran que se debe apoyar el fortalecimiento de los programas de control para evitar la diseminación de infecciones nosocomiales en esa unidad en estudio.OBJECTIVE: To perform the molecular characterization of Klebsiella pneumoniae isolates from pediatric patients and health care workers at the intensive care unit of a tertiary care hospital in Mexico City. MATERIAL AND METHODS: Fifteen Klebsiella pneumoniae isolates collected during an outbreak in June 1996 were analyzed; eight were from patients and seven from health care workers of Mexico's Children's Hospital. Characterization of isolates was carried out by pulsed field gel electrophoresis (PFGE, random amplified polymorphic DNA polymerase

  8. A preliminary study of trace metals and porphyrins in excreta of Gentoo penguins (Pygoscelis papua at two locations of the Antarctic Peninsula Estudio preliminar de metales traza y porfirinas en heces de pingüinos Papua (Pygoscelis papua en dos localidades de la península Antártica

    Directory of Open Access Journals (Sweden)

    J Celis

    2012-01-01

    Full Text Available Even though concentrations of most chemical elements in Antarctic ecosystems are very low as compared to other world's areas, their increasing time trends, as a consequence of the strong population growth and industrial development in countries of the Southern Hemisphere, could be affecting some vulnerable endemic species such as penguins. Concentrations (dry weight of arsenic (As, cadmium (Cd, mercury (Hg and lead (Pb and porphyrins (copro-, uro- and proto- were determined in feces of Gentoo penguins (Pygoscelis papua, collected at two locations of the Antarctic Peninsula (O'Higgins and Videla. We found higher (pAunque las concentraciones de la mayoría de los elementos químicos en la Antártica son bajas en comparación con otras áreas del planeta, éstas se han ido incrementando con el tiempo debido al gran crecimiento de la población y desarrollo industrial de los países del Hemisferio Sur, lo cual podría estar afectando a especies vulnerables como los pingüinos. Se determinaron las concentraciones (peso seco de arsénico (As, cadmio (Cd, mercurio (Hg y plomo (Pb y porfirinas (copro-, uro- y proto- en heces de colonias de pingüinos Papua (Pygoscelis papua, colectadas en dos lugares de la península Antártica (O'Higgins y Videla. Se encontraron mayores (P < 0,05 niveles de Hg (7,55 ± 1,28 μg g-1 en las heces de colonias de pingüinos en O'Higgins, mientras que las colonias de pingüinos en Videla exhibieron mayores concentraciones de Cd (1,68 ± 0,71 μg g-1. Los pingüinos Papua de O'Higgins mostraron mayores (P < 0,05 niveles de copro- (1,81 ± 0,61 nmol g-1, uro- (1,74 ± 0,72 nmol g-1 y protoporfirinas (1,24 ± 0,46 nmol g-1, en directa relación con los mayores niveles de Hg y Pb medidos. Esto podría implicar que algunas colonias de pingüinos Papua de la península Antártica están propensas a desarrollar algunos efectos bioquímicos asociados a contaminación por metales traza. Estos resultados preliminares levantan

  9. PLASTICIDAD FENOTÍPICA EN Lippia alba Y Lippia origanoides (VERBENACEAE: RESPUESTA A LA DISPONIBILIDAD DE NITRÓGENO

    Directory of Open Access Journals (Sweden)

    RODRÍGUEZ-LÓPEZ NELSON

    2008-04-01

    Full Text Available Este trabajo comparó la plasticidad fenotípica (PF a través de la etapa vegetativa de dos especies del genero Lippia (Verbenaceae que presentan amplitud ecológica contrastante con respecto a la disponibilidad de nitrógeno. Lippia alba, especie distribuida en suelos de alta a baja disponibilidad de nitrógeno y Lippia origanoides distribuida en suelos con baja disponibilidad de nitrógeno. Nuestra hipótesis de trabajo planteó que la magnitud de la plasticidad fenotípica en estas especies podría correlacionarse con su amplitud ecológica. Treinta y cinco clones de Lippia alba y Lippia origanoides fueron asignado aleatoriamente en tres tratamientos que variaron en la disponibilidad de nitrógeno en el suelo así: 0,5; 2,5 y 5 mM. A los 25, 35, 50 y 70 días cinco clones de cada especie por tratamiento fueron colectadas. Se evaluó el numero de hojas, área foliar, fracción masa de las hojas, fracción masa de la raíz, razón raíz/parte aérea, volumen de la raíz, longitud de la raíz, masa seca total y tasa de crecimiento relativo. Los resultados indican que ambas plantas presentan una alta PF a la disponibilidad de nitrógeno; sin embargo, las normas de reacción de los caracteres estimados variaron dependiendo de la especie y la edad de la planta. Contrario a nuestra hipótesis no encontramos una correlación entre la PF y la distribución ecológica de estas especies.

  10. Tamización para hipotiroidismo congénito en Cali y constitución de un centro piloto de referencia para la identificación temprana de la enfermedad.

    Directory of Open Access Journals (Sweden)

    Matilde de Bernal

    2009-11-01

    Full Text Available El diagnóstico precoz y el tratamiento del hipotiroidismo congénito (HC son esenciales para la maduración neurocognitiva adecuada del recién nacido. Se diseñó y se desarrolló un programa de tamizaje para este defecto congénito en el Laboratorio de Endocrinología, Facultad de Salud, Universidad del Valle y con la colaboración de la Secretaria Municipal de Cali se implementó desde octubre de 2001 en 6 instituciones prestadoras del servicio de salud (IPS de la Red de Salud de Cali, el Hospital Universitario del Valle y el Hospital San Juan de Dios. Este informe describe el funcionamiento del programa, los inconvenientes encontrados en su implementación y los resultados del mismo. Se recibieron 15.588 muestras secas colectadas de sangre del cordón umbilical en papel de filtro donde 69.4% provenían de los hospitales mencionados. En estas muestras se cuantificó la hormona estimulante del tiroides (TSH neonatal y los resultados >20 µU/ml fueron seguidos de determinaciones de T4 (tiroxina y TSH en suero para confirmación. Del total de muestras remitidas en papel, sólo se procesaron 15.236 (97.7% consideradas como muestras técnicamente adecuadas. De estas, 116 (0.76% bebés tuvieron tamizaje positivo pero tan sólo se pudieron localizar para confirmación 89 (76.7%. El diagnóstico se estableció en 5 niños con valores de TSH en suero entre 7.2-16 µU/ml y T4 entre 9.5 y 20.5 µg/dl. Además de las 352 muestras mal tomadas se recuperaron 184 obtenidas por venopunción en las cuales se procesó TSH y T4 en suero encontrándose 3 bebés con TSH entre 9.4 y 10.1 µU/ml y T4 entre 7.6 y 15.4 µg/dl. De los 8 bebés con TSH sérico elevado en 3, el TSH se normalizó espontáneamente. Hay 4 bebés hipotiroideos provenientes de Cali y uno de fuera de la ciudad, que están en seguimiento y tratamiento.

  11. Eficacia de la solución de hidróxido de calcio a 20% en la reducción de microorganismos asociados a la cárie de dentina

    Directory of Open Access Journals (Sweden)

    IVA Pinheiro

    Full Text Available Objetivo: Evaluar la eficácia da solución de hidróxido de calcio a 20% en la reducción de microorganismos asociados a la carie de dentina. Metodología:Treinta preparos cavitários fueron realizados en molares permanentes de 30 indivíduos entre las edades de 9 a 18 años. Solución salina reductora fue utilizada como líquido de colecta para la recuperación de microorganismos, antes y después del lavado cavitário. Las muestras fueron colocadas en placas de agar sangre de carnero e incubadas en anaerobiosis por 48 horas a 37ºC. Después Del crecimiento bacteriano, se realizo un análisis semi cuantitativo y cualitativo de las bacterias, a través de hibridización DNA-DNA para 23 tipos de bacterias. Resultados: Una reducción significativa de la cantidad de microorganismos en las muestras colectadas después del lavado de la cavidad con solución de hidróxido de calcio fue observada cuando comparado con el momento anterior al lavado. Del total de muestras que presentaron microorganismos en la cavidad recién preparada, 46,15% presentaron eliminación de éstos microorganismos después del lavado con agua de cal y 53,84% presentaron reducción significativa del número de microorganismos. El teste t pareado de Student mostró una diferencia extremamente significativa (p=0,0007 entre el momento anterior y posterior al lavado. Con relación al tipo de bacterias encontradas después Del lavado de la cavidad con solución de hidróxido de calcio, se observó reducción considerable de S. anginosus, S. mitis y S. sobrinus, así como de S. aureus y S. epidermidis, a pesar de no ser significativa (p>0,05. Conclusión: La solución de hidróxido de calcio parece ser un método de limpieza cavitária eficaz en la reducción de la microbiota asociada a la carie de dentina.

  12. Diatomeas marinas de aguas costeras de la provincia de Buenos Aires (Argentina.: III Géneros potencialmente nocivos Asterionellopsis, Cerataulina, Ceratoneis y Leptocylindrus Marine diatoms from Buenos Aires coastal waters (Argentina: Ill Potentially harmful genus Asterionellopsis,Cerataulina, Ceratoneis y Leptocylindrus

    Directory of Open Access Journals (Sweden)

    INÉS SUNESEN

    2007-12-01

    Full Text Available El presente trabajo está abocado al estudio morfológico, taxonómico y distribucional de las especies de diatomeas pertenecientes a los géneros Asterionellopsis, Cerataulina, Ceratoneis y Leptocylindrus halladas en aguas costeras marinas de la provincia de Buenos Aires, Argentina. Las muestras planctónicas fueron colectadas en San Clemente del Tuyú, Santa Teresita, La Lucila del Mar, Mar de Ajó, Nueva Atlantis, Pinamar y Villa Gesell, entre noviembre de 1994 y septiembre de 2000. Material sin tratar y tratado fue analizado con microscopio óptico y microscopio electrónico de barrido. Seis taxa correspondientes a los géneros mencionados fueron determinados, de los cuales Cerataulina dentata es citada por primera vez para Argentina y Leptocylindrus minimus es citada por primera vez para el área costera de la provincia de Buenos Aires. Todas las especies reportadas como nocivas no toxígenas para otras áreas geográficas fueron encontradas. Cerataulina pelágica, Ceratoneis closterium y Leptocylindrus minimus, componentes ocasionales del plancton del área siempre en bajas densidades, no fueron nunca asociadas a episodios de floración. Asterionellopsis glacialis, componente habitual del plancton, fue causante de discoloraciones nocivas para el turismo y las actividades recreacionalesThe present work is devoted to the morphological, taxonomic, and distributional study of the diatom species belonging to the genera Asterionellopsis, Cerataulina, Ceratoneis and Leptocylindrus found in the marine coastal waters of Buenos Aires Province, Argentina. Planktonic samples were collected from November 1994 to September 2000 at San Clemente del Tuyú, Santa Teresita, La Lucila del Mar, Mar de Ajó, Nueva Atlantis, Pinamar and Villa Gesell. Raw and cleaned samples were analysed with light and scanning electron microscopy. Six taxa of the mentioned genera were determined, of which Cerataulina dentata is reported for the first time for Argentina and

  13. Seasonal and vertical distribution of medusae in Aysén region, southern Chile Distribución estacional y vertical de medusas en la región de Aysén, sur de Chile

    Directory of Open Access Journals (Sweden)

    Viviana Bravo

    2011-07-01

    Full Text Available Medusae collected in winter and spring 2007 were analyzed in a longitudinal transect made between the Boca de Guafo and Elefantes Fjord, southern Chile. A total of 30 species were identified, Hydromedusae (29 and Scyphozoa (1, where Bougainvillia macloviana, Hybocodon chilensis, Hydractinia tenuis, Laodicea pulcra, L. undulada, Modeeria rotunda and Chrysaora plocamia represent new records for the area. A significant increase in the jellyfish abundance was higher in spring than in winter (fourteen times higher, with 68% of common species in both seasons. The specific diversity was slightly higher in winter (3.4 bits than spring (3.2 bits, the species richness instead was higher in spring than in winter, with a mean of 5 and 12 species, respectively. The vertical distribution showed the presence of surface (H. borealis, deep (A. apicata, C. peregrina and R. velatum and wide bathymetric distribution (B. muscoides and B. muscus species. Results from the area were compared with previous results (2002-2003 thus proving that most species identified are common in southern Chilean fjords and channels.Se analizaron las medusas colectadas en invierno y primavera de 2007, en una transecta longitudinal efectuada entre la boca del Guafo y fiordo Elefantes, sur de Chile. Se identificó un total de 30 especies, Hydromedusae (29 y Scyphozoa (1, de las cuales Bougainvillia macloviana, Hybocodon chilensis, Hydractinia tenuis, Laodicea pulcra, L. undulada, Modeeria rotunda y Chrysaora plocamia constituyen nuevos registros para esta área. Se determinó un fuerte incremento en la abundancia de medusas en primavera respecto a invierno y (14 veces mayor, con un 68% de especies comunes en ambas estaciones. La diversidad específica fue levemente mayor en invierno (3.4 bits que primavera (3.2 bits, en cambio la riqueza de especies fue mayor en primavera que en invierno, con una media de 5 y 12 especies, respectivamente. La distribución vertical mostró en ambas

  14. Garrapatas (Acari: Ixodidae asociadas a perros en diferentes ambientes de la provincia de Corrientes, Argentina Ticks (Acari: Ixodidae of dogs in different environments of the Corrientes Province, Argentina

    Directory of Open Access Journals (Sweden)

    V.N. Debárbora

    2011-06-01

    Full Text Available Se estudiaron las garrapatas (Acari: Ixodidae de perros en ambientes urbanos, periurbanos y rurales de la provincia de Corrientes por medio de colecciones mensuales durante un año en siete sitios diferentes. De los 138 perros examinados, en 87 (63,04% se determinaron tres especies de garrapatas: Amblyomma tigrinum (n=35, Amblyomma ovale (n=2 y Rhipicephalus sanguineus sensu lato (n=523. Las mayores prevalencias para A. tigrinum y R. sanguineus s.l. fueron halladas en ambientes rurales. Especímenes de R. sanguineus s.l. fueron detectados a lo largo de todo el año, con picos de abundancia en primavera y verano, A. tigrinum fue encontrada en otoño, invierno y primavera con un pico en esta última estación, mientras que A. ovale fue colectada sólo en primavera. Rhipicephalus sanguineus s.l. y A. tigrinum fueron halladas en todos los ambientes muestreados, pero el primer taxón fue siempre el más abundante. Teniendo en cuenta que las especies del complejo R. sanguineus son potenciales vectores de microorganismos patógenos para los perros y humanos, y debido a la alta prevalencia registrada en este estudio, queda en evidencia la relevancia de aplicar métodos para su control en las áreas incluidas en este estudio.Ticks (Acari: Ixodidae of dogs in urban, peri-urban and rural areas from the Corrientes Province, Argentina, were studied. They were monthly collected during one year at 7 different sites. A total of 138 dogs were examined, and 87 (63.04% of them were infested; and three species were determined: Amblyomma tigrinum (n=35, Amblyomma ovale (n=2 and Rhipicephalus sanguineus sensu lato (n=523. Both A. tigrinum and R. sanguineus s.l. had the highest prevalence in rural areas. Specimens of R. sanguineus s.l. were collected in the four seasons, but the peaks of abundance were detected in spring and summer. Amblyomma tigrinum was found in autumn, winter and spring, with the peak of abundance in spring, and the two specimens of A. ovale were

  15. In Vitro propagation of enterolobium cyclocarpum (guanacaste from nodal explants of axenic seedlings

    Directory of Open Access Journals (Sweden)

    Araceli Rodríguez Sahagún

    2007-01-01

    Full Text Available Enterolobium cyclocarpum (Jacq. Griseb. es un árbol leguminoso de uso múltiple, el cual es considerado una especie amenazada, resultado de la sobreexplotación y las bajas tasas de propagación natural debidas a las características intrínsecas del árbol. Una alternativa para superar este problema es el establecimiento de sistemas para su propagación masiva en tiempos cortos. En este trabajo, se investigó un protocolo para la propagación in vitro de E. cyclocarpum utilizando los segmentos nodales axénicos obtenidos de plántulas germinadas in vitro. Las semillas colectadas en dos comunidades mexicanas fueron germinadas tanto ex vitro como in vitro, y se evaluó el efecto de un pre-tratamiento de escarificación térmica. Para los experimentos de propagación se seleccionaron semillas provenientes de sólo una de las comunidades, debido a que presentaban una menor variabilidad genética de acuerdo con marcadores RAPD y a que existía una gran variación en las respuestas observadas en lotes de semillas mezclados. Esta variación fisiológica presente en semillas mezcladas, probablemente refleja un efecto del genotipo.Los segmentos nodales obtenidos de las plántulas fueron cultivados en medio basal MS suplementado con 30 g/L de sacarosa en presencia de distintas concentraciones de ácido 1-naftalenacético (ANA en combinación con benziladenina (BA o kinetina (KIN. La mayor tasa de multiplicación (de 4.75 brotes por explante en promedio se obtuvo cuando el medio MS fue suplementado con 2.2 µM BA y 10.7 µM ANA. Los brotes obtenidos fueron enraizados en medio MS con la mitad de concentración de sales y sin reguladores de crecimiento. Las plántulas micropropagadas fueron aclimatadas y transferidas exitosamente a suelo con una tasa de sobrevivencia del 90%. Estas plantas eran morfológicamente similares a la planta madre y no se detectó variación entre ellas por el uso de marcadores RAPD, lo cual hace posible el uso de este

  16. Rearing five species of Diptera (Calliphoridae of forensic importance in Colombia in semicontrolled field conditions

    Directory of Open Access Journals (Sweden)

    María C. Vélez

    2008-01-01

    Full Text Available The family Calliphoridae is widely known to lead the colonization of corpses and their development rates are frequently used to estimate the postmortem interval. This study presents the larval growth of five forensically important species of Calliphoridae in Colombia. Rearing took place in semicontrolled field conditions where the egg masses were collected. We show curves of larval growth, larval length and time intervals to reach all immature stages for Lucilia eximia and Cochliomyia macellaria at two sites with different climatic conditions and for Chrysomya albiceps, Chrysomya megacephala and Calliphora nigribasis at one site. Overall, high temperatures speeded up the development of the species reared at two different sites, whereas low temperatures for C. nigribasis, lengthened the total development time. Differences between this study and others can be explained by the experimental conditions in the field without the possibility of strict laboratory rearing controls.La familia Calliphoridae es ampliamente conocida por liderar la colonización de los cadáveres y sus tasas de desarrollo son frecuentemente utilizadas para estimar el intervalo postmortem. Este estudio presenta el crecimiento larval de cinco especies de Calliphoridae de importancia forense en Colombia, considerando que la cría se dio en condiciones de campo semicontroladas en los lugares donde las masas de huevos fueron colectadas. Mostramos también, los intervalos de longitud y el tiempo empleado en alcanzar todos los estadios inmaduros para Lucilia eximia y Cochliomyia macellaria en dos lugares con diferentes condiciones climáticas y Chrysomya albiceps, Chrysomya megacephala y Calliphora nigribasis, en un solo lugar. En general, las altas temperaturas producen una aceleración en el desarrollo de las especies criadas en dos sitios diferentes, mientras que bajas temperaturas para C. nigribasis, alargaron el tiempo utilizado para completar el desarrollo. Las diferencias

  17. Identificación y tipificación de biotipos y serotipos de Yersinia enterocolitica Identification and typing of Yersinia enterocolitica biotypes and serotypes isolated

    Directory of Open Access Journals (Sweden)

    Paulino Elizalde Castañeda

    2001-08-01

    Full Text Available OBJETIVO: Conocer la existencia de Yersinia enterocolitica en suínos visiblemente sanos y sacrificados para el consumo humano. MÉTODOS: Fueron estudiadas 100 muestras de tejido linfático obtenidas en el momento del sacrifício, en un matadero del Estado de México. Fueron realizados muestreos pilotos de 20 casos, de los cuales 20% fueron positivos, permitiendo obtener una muestra estudiada (n=100. Las muestras colectadas de tejido linfático fueron acondicionadas para el aislamiento de Yersinia enterocolitica en caldo de Rappaport y en medio de cultivo de Salmonella-Shigella y MacConkey. Las identificaciones fueron efectuadas por medio de pruebas bioquímicas y serológicas, utilizándose en el caso los antisueros O:3, O:8 y O:9 para la biotipificación correspondiente. RESULTADOS: Fueron obtenidos 22 aislamientos tipificándose 8 serotipos pertenecientes al O:3 y 8 al O:9 correspondientes al biotipo 1; y, en 6 muestras no fue posible la serotipificación. No se encontró en el total de los aislados el serotipo O:8. CONCLUSIONES: En base en la metodología, se registró la presencia de Y. enterocolitica y sus serogrupos en tejido linfático de porcinos por la primera vez en México; esto es importante porque el patógeno y sus serotipos aislados están comprometidos con mayor frecuencia con problemas de salud pública.OBJECTIVE: To assess the presence of Yersinia enterocolitica in otherwise healthy pigs slaughtered for human consumption. METHODS: One hundred pharyngeal tonsils were sampled in a slaughterhouse in the state of Mexico. The minimum sample size (n=100 was calculated based on a preliminary sample of 20 cases, which had 20% positive cases. The collected tonsil samples were inoculated in Rappaport broth, and Salmonella-Shigella and McConkey media. The biotyping identification process was based on biochemical and serological tests using O:3, O:8 and O:9 antisera. RESULTS: Twenty-two isolates were obtained. Most were biotype 1 (8 cases

  18. REVISIÓN DE ESTOMATITIS ULCERATIVA EN OFIDIOS A REVIEW OF ULCERATIVE STOMATITIS IN SNAKES

    Directory of Open Access Journals (Sweden)

    Brieva Rico Claudia Isabel

    2007-11-01

    Full Text Available La estomatitis en ofidios es una condición de frecuente diagnóstico en la clínica de animales silvestres. Se relaciona principalmente con eventos estresantes como deficiencias medioambientales, nutricionales o una enfermedad subyacente, las cuales terminan favoreciendo el crecimiento de gérmenes patógenos y, de esta forma, llevan a la muerte del animal. Los signos clínicos pueden pasar inadvertidos por un tiempo variable, por lo que se recomienda hacer revisiones periódicas a los ofidios en cautiverio. Debido a que es una entidad multifactorial, uno o varios agentes etiológicos se implican como causales y perpetuantes de la condición, por lo que es de gran importancia someter las muestras colectadas a análisis específicos, para así poder identificarlos y garantizar un mayor éxito en el momento de instaurar un tratamiento. En casos avanzados el pronóstico casi siempre es malo debido a la posibilidad de una diseminación hematógena, con sus efectos secundarios como neumonía y osteomielitis, o por continuidad, causando gastroenteritis. Por ello, la principal herramienta de combate frente a la entidad es minimizar la exposición de los ofidios a factores predisponentes o estresantes, que sin lugar a dudas ponen en peligro la vida del animal.Infectious stomatitis in ophidians is a frequent clinical condition in the management of wild animals in captivity. It is mainly associated with stress, environmental and nutritional deficiencies or with other diseases that increases the risk of growing pathogenic organisms, causing the death of the animal. Clinical signs could not be easy to detect and therefore it is recommended to carry out periodic monitoring of snakes in captivity. Due to the multi-factorial condition, one or several etiologic agents can cause or perpetuate the disease, being very important the continuous collection of mouth smear to perform specific analysis such as cultures and antibiograms, in order to guarantee a

  19. Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    2010-08-01

    Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.

  20. Estudio histológico, inmuno-histoquímico y de cultivo celular de mamas humana y canina normal y cancerosa

    Directory of Open Access Journals (Sweden)

    Carine Fernandes B.

    2012-08-01

    Full Text Available Objetivo. Comparar las características morfológicas de células normales y cancerosas derivadas de glándulas mamarias de las especies humana y canina. Materiales y métodos. Fueron colectadas 10 muestras de parénquima mamario normal y 14 de parénquima tumoral de la especie canina, así como seis muestras de parénquima mamario normal y tres de parénquima tumoral de la especie humana. Para el cultivo de células fue utilizada la técnica de cultivo de células de mamíferos y para la histoquímica la técnica de la avidina- biotina- peroxidasa, con utilización del anticuerpo monoclonal 32-2B (anti-desmogléina-1. Resultados. A los estudios histológicos y morfológicos las células de la glándula mamaria normal humana demostraron semejanzas con las células de la glándula mamaria normal canina. Se observó adhesión y proliferación de células normales en ambas especies por aproximadamente tres meses de cultivo. Las células normales de las especies humana y canina mostraron baja actividad de proliferación cuando se compararon con las cancerosas de las especies en estudio. Los grupos de células epiteloides que se adhirieron al sustrato de los dos cultivos tuvieron dependencia de las células estromales, porque en la medida que las células fibroblastoides se retiraron, las células epiteloides detuvieron su crecimiento. Conclusiones. Comparando los resultados obtenidos por medio de análisis inmuno-histoquímico de células normales de mujeres y perras fue posible observar cambios en el patrón de coloración en células cancerosas en ambas especies, demostrando que las estructuras relacionadas con la adhesión celular (desmosomas pueden estar alteradas.

  1. First report of diarrheic shellfish toxins in mollusks from Buenos Aires province (Argentina associated with dinophysis spp.: evidence of okadaic acid, dinophysistoxin-1 and their acylderivatives

    Directory of Open Access Journals (Sweden)

    Eugenia A Sar

    2012-06-01

    Full Text Available In January 2010, the toxin-producing dinoflagellates Dinophysis acuminata and D. caudata (10³ cells·l-1 were detected in Mar Azul during routine plankton monitoring in Buenos Aires Province coastal waters, Argentina. Wild clams Mesodesma mactroides and Donax hanleyanus from Mar Azul intertidal beach, which are part of the diet for local inhabitants and tourists, tested positive with the offcial lipophilic mouse bioassay. This paper focuses on the detection of Diarrhetic Shellfsh Poison (DSP toxins in these samples using a HPLC-FLD pre column derivatization procedure. The data showed that shellfish were contaminated with complex DSP toxin profiles composed of Okadaic Acid (OA, Dinophysistoxin-1 (DTX-1, Acyl-Dinophysistoxin-1 (Acyl-DTX-1 and Acyl-Okadaic Acid (Acyl-OA. The DSP toxins found in this study produce diarrhea symptoms consistent with those experienced by patients who had ingested cooked shellfish in January. This is the first report of Acyl-derivatives in South American Atlantic shellfish samples and of OA in Argentinean shellfish samples.Primer reporte de toxinas diarreicas de moluscos en bivalvos de la Provincia de Buenos Aires (Argentina asociado con Dinophysis spp.: evidencia de Ácido Okadaico, Dinophysistoxina-1 y sus acyl-derivados. En enero de 2010, los dinoflagelados productores de toxinas Dinophysis acuminata y D. caudata (10³ cells·l-1 fueron detectados en Mar Azul durante un monitoreo rutinario de fitoplancton realizado en aguas costeras de la Provincia de Buenos Aires, Argentina. Mesodesma mactroides (almeja amarilla y Donax hanleyanus (berberecho del intermareal de Mar Azul, que son parte de la dieta de los habitantes del lugar y de turistas, dieron resultado positivo para toxinas lipofílicas mediante bioensayo ratón. Este trabajo está focalizado en la detección de Toxinas Diarreicas de Moluscos (DSP en muestras colectadas durante el evento de toxicidad usando un HPLC-FLD con procedimiento de derivatizaci

  2. EFECTO DE INOCULANTES MICROBIANOS SOBRE LA PROMOCIÓN DE CRECIMIENTO DE PLÁNTULAS DE MANGLE Y PLANTAS DE Citrullus vulgaris SAN ANDRÉS ISLA, COLOMBIA Microbial Inoculantes Effects on Growth Promotion of Mangrove and Citrullus vulgaris San Andrés Isla, Colombia

    Directory of Open Access Journals (Sweden)

    TANIA GALINDO

    2006-06-01

    Full Text Available Con el fin de probar la efectividad de dos inoculantes microbianos (aislados a partir de raicillas de mangle rojo y negro en el crecimiento y establecimiento de plántulas de mangle y de patilla, se realizaron cuatro pruebas en campo en San Andrés Isla, Colombia. Se aplicaron dichos inoculantes en: propágulos de Avicennia germinans colectados en un área de manglar y sembrados en macetas sobre sustrato solarizado (con el fin de disminuir la carga microbiana, plántulas de A. germinans y Rhizophora mangle colectadas en cercanía de árboles semilleros, plántulas de A. germinans y R. mangle sembradas y mantenidas en vivero y en semillas de patilla (Citrullus vulgaris sembradas en un cultivo libre de fertilizantes químicos. Las variables tomadas como indicativo de crecimiento y desarrollo vegetal fueron: número de nodos, número de hojas y longitud del tallo. Los inoculantes (microorganismos solubilizadores de fosfatos -MSF- y bacterias fijadoras de nitrógeno -BFN- se aplicaron en el material vegetal mencionado, efectuando mediciones durante tres meses. Los resultados muestran un efecto positivo de estimulación de crecimiento medido en longitud del tallo en las plantas tratadas con los inoculantes, específicamente en patilla y propágulos de A. germinans mantenidos en vivero.In order to test the effect of two microbial inoculants (obtained from red and black mangrove roots on the growth and stability of mangrove and watermelon plants, four treatments were carried out in San Andres Island, Colombia. The treatments consisted in the application of the inoculants in: A. germinans propagules collected in a mangrove area, and then individually planted in gavels with sun-pasteurized soil (in order to decrease the microbial load, A. germinans and R. mangle plants collected in the proximity of nursery trees, A. germinans and R. mangle planted and maintained in nursery, and in Citrullus vulgaris seeds planted in a traditional cultivar without

  3. Microbial Inoculantes Effects on Growth Promotion of Mangrove and Citrullus vulgaris San Andrés Isla, Colombia Efecto de los inoculantes microbianos sobre la promoción de crecimiento de plantulas de mangle y plantas de Citrullus vulgaris San Andrés Isla, Colombia

    Directory of Open Access Journals (Sweden)

    Galindo Tania

    2006-06-01

    Full Text Available In order to test the effect of two microbial inoculants (obtained from red and black mangrove roots on the growth and stability of mangrove and watermelon plants, four treatments were carried out in San Andres Island, Colombia. The treatments consisted in the application of the inoculants in: A. germinans propagules collected in a mangrove area, and then individually planted in gavels with sun-pasteurized soil (in order to decrease the microbial load, A. germinans and R. mangle plants collected in the proximity of nursery trees, A. germinans and R. mangle planted and maintained in nursery, and in Citrullus vulgaris seeds planted in a traditional cultivar without chemical fertilizers. The growth and vegetative development variables were: number of nodes, number of leaves and steam length. The inoculants (phosphate solubilizing microorganisms -PSM- and nitrogen fixing bacteria -NFB- were applied in the mentioned vegetable material, doing measures during three months. The results show a positive effect on growth measured by steam length in plants treated specifically with the inoculants in C. vulgaris and A. germinans seedlings maintained in nursery.Con el fin de probar la efectividad de dos inoculantes microbianos (aislados a partir de raicillas de mangle rojo y negro en el crecimiento y establecimiento de plántulas de mangle y de patilla, se realizaron cuatro pruebas en campo en San Andrés Isla, Colombia. Se aplicaron dichos inoculantes en: propágulos de Avicennia germinans colectados en un área de manglar y sembrados en macetas sobre sustrato solarizado (con el fin de disminuir la carga microbiana, plántulas de A. germinans y Rhizophora mangle colectadas en cercanía de árboles semilleros, plántulas de A. germinans y R. mangle sembradas y mantenidas en vivero y en semillas de patilla (Citrullus vulgaris sembradas en un cultivo libre de fertilizantes químicos. Las variables tomadas como indicativo de crecimiento y desarrollo vegetal

  4. Desarrollo de técnicas para determinar mutaciones del gen K- ras de pacientes con cáncer de pulmón

    Directory of Open Access Journals (Sweden)

    Moreno Pablo

    2004-12-01

    Full Text Available Se desarrolló un protocolo de procesamiento y extracción de ADN para cada uno de los tipos de muestras analizadas: Lavados broncoalveolares (BAL, Biopsias y Tejidos incluidos en parafina (TEPs colectadas de pacientes con cáncer de pulmón de célula no pequeña tipo adenocarcinoma o carcinoma escamocelular. La amplificación de los fragmentos del codón 12 de Kras se realizó utilizando la técnica de “PCR enriquecida”. Se obtuvo un porcentaje de amplificación del 84,6% para biopsias, 70% para BAL y 73,2% para TEPs para un total de 70 muestras, distribuidas en 11 biopsias, siete BAL y 52 TEPs. Se detectaron 18 (25.3% mutaciones en las 70 muestras analizadas: cinco biopsias, tres BAL y diez TEPs. De las 18 mutaciones detectadas, 15 fueron encontradas en hombres fumadores con edad promedio de 68 años. Las restantes tres
    mutaciones fueron encontradas en mujeres no fumadoras con edad promedio de 66 años. 77,7% (14 de las 18 muestras con mutaciones corresponden a tumores de tipo adenocarcinoma mientras solo el 37,5% (3 corresponden a tumores de tipo escamocelular. Todas las muestras con mutación corresponden a tumores de estados avanzados del cáncer. Los resultados hallados corresponden a un reporte preliminar del estado de la mutación K-ras codón 12 en
    tumores de cáncer de pulmón, sin embargo los datos no coinciden con los reportes de la literatura mundial, principalmente debido a variaciones poblacionales, sensibilidad del método de detección y cantidad y tipo de muestra analizada. Además, estos datos describen algunas de las
    características propias de la población portadora de la mutación.

  5. Temporal variation on the diet of the South American Tern (Sterna hirundinacea, Charadriiformes: Laridae on its wintering grounds Variación temporal en la dieta del Gaviotín Sudamericano (Sterna hirundinacea, Charadriiformes: Laridae en los sitios de invernada

    Directory of Open Access Journals (Sweden)

    MATILDE ALFARO

    2011-09-01

    dos de las muestras (grupos de bolos colectadas durante el período de estudio. A pesar de esta variación temporal en la dieta la Anchoíta Argentina fue la presa principal durante las dos temporadas de estudio. Este resultado apoya la hipótesis planteada de que la anchoíta es el principal recurso alimenticio del Gaviotín Sudamericano.

  6. Reporte histórico: Primer Aislamiento de Vibrio cholera serogrupo O1 biovar El Tor serovar Inaba durante la epidemia de cólera en el Perú ‑ 1991 Historical report: first isolation of Vibrio cholera serogroup O1 biovar El Tor serovar Inaba during the cholerae epidemic in Perú ‑ 1991

    Directory of Open Access Journals (Sweden)

    Nora Bravo Cruz

    2011-03-01

    Full Text Available Hace 20 años apareció una enfermedad diarreica nueva en el Perú y el Laboratorio de Referencia de Enteropatógenos del Instituto Nacional de Salud, cumplió una labor destacada en el aislamiento e identificación rápida y oportuna del Vibrio cholerae. La enfermedad del cólera no se había presentado anteriormente, pero en la última semana de enero de 1991 se detectó un brote epidémico de diarrea aguda con deshidratación intensa y algunos casos de fallecidos. La epidemia afectó, al comienzo, varias localidades del litoral peruano. Equipos de trabajo de la Oficina General de Epidemiología y de los laboratorios del Instituto Nacional de Salud obtuvieron muestras fecales de pacientes con diarrea aguda procedentes de las ciudades de Chancay, Chimbote, Piura y algunos hospitales de Lima. Las muestras colectadas en el medio de transporte de Cary y Blair fueron procesadas en el Laboratorio Nacional de Referencia de Enteropatógenos (LANARE del Instituto Nacional de Salud. De todas las muestras se aisló e identificó Vibrio cholerae serogrupo O1 biovar El Tor serovar Inaba que mostró ser sensible a la tetraciclina y a otros antibióticos. Esta investigación confirmó el primer brote epidémico de cólera en el Perú.20 years ago, a new diarrheal disease was introduced in Peru and the Enteropathogens Reference Laboratory of the Instituto Nacional de Salud had an outstanding role in the isolation and rapid and timely identification of Vibrio cholerae. Cholera had not been seen before, but during the last week of January 1991 an outbreak of acute diarrhea was detected, presenting intense dehydration and some deaths. The epidemic affected, in the beginning, many locations of the peruvian coast. Some working teams of the General Office of Epidemiology and of the Instituto Nacional de Salud obtained fecal samples from patients with acute diarrhea coming from the cities of Chancay, Chimbote, Piura and some hospitals in Lima. The collected samples

  7. Producción de hojarasca y retorno potencial de nutrientes en tres sitios del estado de Nuevo León, México

    Directory of Open Access Journals (Sweden)

    Jaun Manuel López-Hernández

    2015-08-01

    Full Text Available Los objetivos de este estudio fueron estimar y cuantificar la dinámica mensual (enero a diciembre 2009 de la deposición de la hojarasca y macro (Ca, K, Mg, N y P y micro-minerales (Cu, Fe, Mn, y Zn de las hojas de la hojarasca en los municipios Los Ramones, China y Linares, del estado de Nuevo León, México. La vegetación está caracterizada como matorral espinoso tamaulipeco. La deposición anual total de hojarasca fue de 321.5 (Los Ramones, 431.6 (China y 462.9 (Linares g/m2/año. Las hojas representaron el mayor componente (154.4 a 304.5 g/m2/año del total de hojarasca depositada. La deposición de ramas varió de 48.25 a 75.16 g/m2/año y la de estructuras reproductivas de 58.4 a 98.9 g/m2/año. La de otros componentes (material vegetal no identifi cado, cuerpos y heces de insecto varió de 19.9 a 29.2 g/m2/año. La deposición anual de Ca en los tres sitios fluctuó de 3.4 a 8.1; K de 1.4 a 3.2; Mg de 0.76 a 1.6; N de 3.0 a 5.5 y P de 0.05 a 0.11 g/m2/año. El Cu fluctuó de 0.84 a 2.8; Fe de 14.7 a 21.7; Mn de 5.5 a 11.8 y Zn de 3.3 a 5.2 mg/m2/año. En invierno se depositó la mayor cantidad de minerales. Además, en Linares se depositó la mayor cantidad de minerales y en Los Ramones la menor. Hubo diferencias espaciales y temporales en cantidad de hojarasca colectada y retorno de minerales, mas no así en la calidad foliar entre los sitios de estudio.

  8. Establecimiento de un método eficiente de germinación in vitro y micropropagación del cirimo (Tilia mexicana Schlecht. (Tiliaceae

    Directory of Open Access Journals (Sweden)

    Wendy Zurita-Valencia

    2015-07-01

    Full Text Available Para obtener un método efi ciente de germinación y la micropropagación deTilia mexicanaSchlecht. (cirimo, se establecieron cultivos in vitro con la siembra de semillas recién colectadas en época de fructificación, mismas que fueron sometidas a desinfección superficial y a diferentes métodos de escarificación previo al cultivo in vitro en el medio nutritivo de Murashige y Skoog (MS con 30 g/L de sacarosa, 8 g/L de agar y 0.05 mg/L de benciladenina (BA. Después de 60 días del cultivo, el mayor porcentaje de germinación fue de un 74% en semillas tratadas con HCl 10% durante cinco minutos, lo que permitió un óptimo desarrollo y mayor número de plántulas. A los 90 días del cultivo, las plántulas alcanzaron 4.5 cm de altura, con hojas y raíces bien desarrolladas, mismas que fueron utilizadas para los protocolos de micropropagación. La multiplicación de brotes se obtuvo mediante la siembra de yemas axilares en medio MS con diferentes concentraciones de auxina/citocinina (ANA/BA. El mayor número de brotes (7.75 brotes/explante se logró con la adición de ácido naftalenacético (ANA (0.25 mg/L en combinación con BA (1.0 mg/L a los 60 días del cultivo. Los brotes regenerados fueron cultivados en medio MS con ácido indolbutírico (AIB, mostrando un 100% de enraizamientocon 5.0 mg/L, a los 45 días del cultivo. Las plántulas micropropagadas deT. mexicana, presentaron en promedio una altura de 4.51 cm, produciendo 3.3 raíces/plántula de 2.27 cm de longitud, las que fueron trasplantadas y aclimatadas en condiciones de cámara de crecimiento, para posteriormente ser cultivadas en invernadero. Después de 90 días de cultivo en invernadero, se observó un 70% de supervivencia.

  9. Diversidad genética de germoplasma colombiano de zapallo (Cucurbita moschata Dúchesne Exp. Prior

    Directory of Open Access Journals (Sweden)

    Vallejo C. F. A.

    2004-12-01

    Full Text Available Se colectaron, caracterizaron morfológicamente y evaluaron agronómicamente 133 accesiones de Cucurbita moschata en Colombia (departamentos del Cauca, Valle del Cauca, Risaralda, Quindío, Caldas, Antioquia, Bolívar, Magdalena y Atlántico, las cuales presentaron alta diversidad en tamaño, forma y color de fruto. Los descriptores pubescencia de la hoja, color mancha de la hoja, días a floración masculina, días a floración femenina, espesor de pulpa, tamaño de semilla, forma de margen de semilla, ancho de fruto y peso promedio de fruto permitieron la diferenciación de grupos. Se encontró un índice de diversidad de 62% entre las accesiones colectadas en los departamentos de la región andina con las de la Costa Atlántica. Ninguno de los grupos presentó índices de similaridad del 100%. ABSTRACT This study was carried at Candelaria (Colombia, from August 2001 to July 2003. This study aimed at evaluating, by multivariate analyses techniques, the genetic diversity of 133 accesions, collected from distinct areas of regions of Colombia. The experimental design was of randomized complete blocks with four replications. The data (average were collected from three plants per plot. Thirteen nine traits were evaluated, 9 vegetatives, 24 reproductives and 1 related to susceptibility to stress. The data were analysed using the herarquical method of WARD and were transformed into a complete disjunctive table, where the modalities of each character is a new variable. The analysis revealed five cluster, with to R2 = 97% and diversity index 62%. The most important characteristics to explain the variability were: days to first female and male flower, fruit width, fruit weight, flesh thickness, leaf pubescence dorsal and ventral surface, colour of leaf spots and seed size. The 5, 7, 47 , 109 and 28 accesion might be recommended for breeding programs. Keywords: Cucurbita moschata, Germplasm, Genetic resources, plant breeding, Morphology

  10. Incidencia y sintomatología de cinco virus en parcelas comerciales de chile seco en Aguascalientes, San Luis Potosí y Zacatecas, México Incidence and symptomatology of five viruses in commercial dry chili pepper fields in Aguascalientes, San Luis Potosí, and Zacatecas, Mexico

    Directory of Open Access Journals (Sweden)

    Rodolfo Velásquez-Valle

    2012-04-01

    Full Text Available A nivel mundial el cultivo de chile es afectado por más de 60 enfermedades virales; sin embargo, poco se conoce acerca de ellas en el área productora de chile seco del norte centro de México por lo que el objetivo del presente trabajo consistió en detectar la presencia y sintomatología de cinco virus en parcelas comerciales de chile seco en los estados mencionados. Plantas de chile de los tipos mirasol y ancho fueron muestreadas y se anotó la presencia de síntomas como enanismo, clorosis, deformación de hojas, defoliación, necrosis vascular y ramas unidas. Las muestras fueron analizadas mediante la técnica DAS-ELISA empleando los antisueros para el virus del mosaico del tabaco (Tobacco mosaic virus: TMV, mosaico del pepino (Cucumber mosaic virus: CMV, Y de la papa (Potato virus Y: PVY, moteado del chile (Pepper mottle virus: PepMoV y jaspeado del tabaco (Tobacco etch virus: TEV. Esos virus fueron identificados en plantas de chile colectadas en las parcelas comerciales de chile seco de los tres estados antes mencionados.World-wide the chili pepper crop is affected by more than 60 viral diseases, although very little is known about them in the area of dry pepper plantation in northern-central Mexico. Consequently, the aims of this work were to identify the presence of the virus and the associated symptoms in commercial dry pepper fields of the states of Zacatecas, San Luis Potosí, and Aguascalientes, Mexico. Mirasol and ancho pepper plants were sampled and the presence of symptoms such as dwarfing, chlorosis, leaf deformation, defoliation, vascular necrosis and joined branches, were recorded. Samples were analyzed using DAS-ELISA with the antisera of the tobacco mosaic virus (Tobacco mosaic virus: TMV, cucumber mosaic virus (Cucumber mosaic virus: CMV, potato virus Y (Potato virus Y: PVY, pepper mottle virus (Pepper mottle virus: PepMoV, and tobacco etch virus (Tobacco etch virus: TEV. These viruses were identified in pepper plants

  11. Residuos de plaguicidas organoclorados en leche pasteurizada comercializada en Ciudad de México Organochlorine pesticide residues in commercial pasteurised milk in Mexico City

    Directory of Open Access Journals (Sweden)

    G PRADO

    1998-01-01

    Full Text Available Los residuos de algunos plaguicidas organo-clorados presentes en lasmuestras de leche pasteurizada analizadas representan un riesgo para lasalud de los consumidores. Se determinó el contenido de plaguicidas organoclorados en 96 muestras de leche pasteurizada, por cromatografía gas líquido. Las muestras fueron colectadas quincenalmente y durante un año en la Ciudad de México, de cuatro marcas comerciales.En las muestras analizadas se determinó el valor promedio X en µg/gbase grasa, la razón X/LMR y el porcentaje de muestras que sobrepasó el valor LMR. Los valores encontrados fueron los siguientes, respectivamente:(a + b-HCH, 0.22 µg/g, 2.21 y 47.9%, Lindano, 0.07 µg/g, 0.38 y 8.3%, Aldrín + Dieldrín,0.25 µg/g, 1.67 y 39.5%, Heptacloro + heptacloroepóxido, 0.15µg/g, 1.00 y 23.9%, Endrín, 0.05 µg/g, 2.70 y 37.5% y DDT + metabolitos, 0.12 µg/g, 0.10 y 0.0%. Es altamente recomendable mantener un seguimiento en el control de algunos pesticidas organoclorados presentes en la leche pasteurizada de la Ciudad de México.Milk products are frequently contaminated with toxic organochlorine pesticides.The level of organochlorine pesticide residues of 96 pasteurised milk sampleswas determined by gas-liquid chromatography. The samples were collectedfrom four milk industries in Mexico City. The pesticides found in the pasteurisedmilk samples, their average values, the average value/MRL ratio, and samplepercentages exceeding the Maximum Residue Limits (MRL were respectively:(a+b-HCH, 0.22 µg/g, 2.21, (47.9%, Lindane,0.07 µg/g, 0.38, (8.3%, Aldrin + Dieldrin, 0.25 µg/g, 1.67,(39.5%, Heptachlor + Heptachlor epoxide, 0.15 µg/g, 1.00, (23.9%,Endrin, 0.05 µg/g 2.70, (37.5%, DDT and metabolites, 0.12 µg/g,0.10, (0.0%. A follow up study in the control of organochlorine pesticides presentin Mexican pasteurised milk is recommended

  12. Riesgo de enfermedades infecciosas transmitidas por transfusión en el Valle del Cauca, Colombia.

    Directory of Open Access Journals (Sweden)

    Armando Cortés B.

    2009-10-01

    Full Text Available Se informa el potencial de riesgo para enfermedades infecciosas obtenidas a través de transfusión en el Valle del Cauca en 1997. Todas de las unidades de sangre colectadas en este departamento se tamizaron para los siguientes marcadores de infección: anticuerpos contra el virus de la inmunodeficiencia humana (anti-VIH-1,2, anticuerpos contra el virus de la hepatitis C (anti-VHC, antígeno de superficie de la hepatitis B (AgHBs y anticuerpos contra Trypanosoma cruzi (anti-Tc, y parcialmente para anticuerpos no treponémicos (VDRL/RPR, anticuerpos contra el virus linfotrópico de células T (anti-HTLV-I/II y anticuerpos totales contra el "core" de la hepatitis B (anti-HBc. El riesgo de adquirir VIH y hepatitis B fue más bajo que para hepatitis C, HTLV y T. cruzi debido al completo tamizaje serológico y reducida prevalencia. El índice calculado de diseminación para cada enfermedad infecciosa fue mayor valor obtenido para bancos de sangre de Cali y tipo de donación coactiva con 12 y 16 infecciones/10,000 transfusiones, respectivamente. El índice fue más bajo en bancos de sangre situados fuera de Cali y con la donación voluntaria correspondiendo a 10 y 7 infecciones/10,000 transfusiones, respectivamente. A pesar de que el número de unidades potencialmente infectadas o personas infectadas es probablemente más bajo que nuestras estimaciones por los falsos positivos y receptores ya infectados, estos datos refuerzan la necesidad de mantener esta información para evaluar el nivel de tamizaje de enfermedades infecciosas en la sangre disponible para la comunidad. Estos datos también le permite a los médicos usuarios y ordenadores de las transfusiones conocer el riesgo aproximado de inducir iatrogénicamente una infección por transfusión en el Valle del Cauca, elemento útil para considerar en la toma de decisiones y a los epidemiológos y encargados de vigilar la salud, el impacto de las transfusiones en la diseminación de ciertas

  13. Variabilidad espacial de los atributos físico-hídricos del suelo y de la productividad del cultivo de fréjol (Phaseolus vulgaris L irrigado bajo un sistema de siembra directa Spatial variability of soil physical and hydrological characteristics in re­lation to the productivity of bean (Phaseolus vulgaris L irrigated under no-tillage system

    Directory of Open Access Journals (Sweden)

    R. M. Mestas

    2010-01-01

    Full Text Available Se estudió la variabilidad espacial del sue-lo con una producción de fréjol irrigado ba­jo un sistema de siembra directa, el objetivo fue evaluar la dependencia espacial de los atributos físico-hídricos del suelo relacio­nándolos con la variabilidad espacial de la producción del fréjol. Fue sembrada una parcela y demarcados 60 puntos muéstrales en una malla de 3 x 3 m. Fueron colectadas muestras sin disturbar para determinación de la densidad del suelo, en el campo se de­terminaron la resistencia del suelo a la pe­netración y la conductividad hidráulica satu­rada. La dependencia espacial fue evaluada por el método geoestatístico del krigeado puntual. Los resultados obtenidos mostraron que las regresiones obtenidas entre mapas fueron significativas, siendo que la densidad del suelo y la resistencia del suelo a la pene­tración se correlacionaron negativamente con la producción y la conductividad hidráulica saturada se correlacionó positi­vamente.The spatial variability of a soil used for bean production under an irrigated no-tillage system was studied. This study aimed to evaluate the spatial dependence of soil physical and hydrological characteristics in relation to the spatial variability of the irri­gated bean yield. For that reason, 60 sam­pling points were planted and demarcated in a 3 x 3 m grid. Disturbed samples were col­lected for determining soil density. In the field, soil resistance to penetration and satu­rated hydraulic conductivity were deter­mined. The spatial dependence was ana­lyzed by geostatistics using punctual kriging. According to the results, it is possi­ble to observe that the obtained regressions among maps were significant; soil density and resistance to penetration were nega­tively related to the yield, while the saturated hydraulic conductivity was related positively.

  14. Arsénico edáfico y su distribución en el distrito de riego 017: uso de métodos de interpolación

    Directory of Open Access Journals (Sweden)

    Norma E. Rodríguez Garrido

    2017-01-01

    Full Text Available Los constituyentes del suelo (arcillas, carbonatos, materia orgánica y óxidos e hidróxidos, intervienen en la movilidad del arsénico (As y determinan su variación espacial; por lo cual, su cartografía puede contribuir al entendimiento de la presencia de este metaloide en el suelo. Los objetivos de esta investigación fueron determinar la concentración de As en los suelos del Distrito de Riego 017 (DR017 de México y establecer su distribución espacial, utilizando dos métodos de interpolación. Cuatro etapas fueron realizadas; la primera consistió en trabajo de gabinete y campo, en la que 33 sitios de muestreo fueron localizados en un polígono del DR017, posteriormente en cada sitio, muestras simples de suelo (0-30 cm de profundidad fueron colectadas. La segunda y tercera se llevaron a cabo en laboratorio, en las cuales, a cada muestra se determinó la concentración de As disponible, contenidos de arcilla, carbonatos de calcio y fósforo disponible y su regresión. La cuarta etapa tuvo dos partes, la elaboración de dos mapas con dos métodos de interpolación (Interpolador Ponderación Inversa de la Distancia, IDW en sus siglas en inglés y Kriging ordinario, KO, así como la verificación de la precisión de cada mapa. Los resultados mostraron que, la distribución del As en el DR017 no es uniforme y está asociada con el contenido de arcilla y CaCO3. De tal manera que, las concentraciones de As fluctuaron de 0.07 a 1.89 mg kg-1, donde las mayores concentraciones de este metaloide (1.39-1.89 mg kg‑1 se relacionaron positivamente (R2 = 0.9058 con altos contenidos de arcilla (39.44 a 43.44%. El mapa de distribución espacial de As obtenido con KO, tuvo la mayor precisión (75.7%, en el cual se muestra que la concentración aumenta en un sentido sur-norte, donde el área de mayor concentración está en la parte norte del distrito.

  15. Crecimiento del maíz en vertisoles con alto aluminio en la Baixada Maranhense pre-Amazonia, Brasil.

    Directory of Open Access Journals (Sweden)

    Alessandro Costa-da Silva

    2014-07-01

    Full Text Available El objetivo de este trabajo fue evaluar el crecimiento del maíz en suelos con alto contenido de aluminio. Se midió el efecto del Al3+ en raíces y la cantidad de materia seca (raíz, hoja y tallo de maíz. Se efectuó la caracterización físico-química de cuatro muestras de suelo con alto aluminio colectadas del horizonte Ap, en tres municipios de la región conocida como Baixada Maranhense (Pre-Amazonia, Brasil: Santa Rita (SR, Arari (AR y Vitoria do Mearim (VM y un testigo colectado en el municipio de São Luís, Área del Núcleo de Tecnología Rural (T. El estudio, ejecutado en 2009, se llevó a cabo en invernadero y se utilizó 2 dm3 de suelo por maceta. Asimismo las muestras fueron divididas en muestras con y sin fertilización. La variación en la longitud de la raíz y de materia seca de las hojas difirió significativamente entre tratados con y sin fertilizante, excepto en la muestra de la localidad T. La producción de materia seca de raíz, tallo y hoja fue mayor en todos los suelos cuando se fertilizó. El suelo testigo también superó a todos los demás en cuanto a producción de materia seca en la raíz, posiblemente como resultado de una menor cantidad de Al3+ (1,2 cmolc/dm3 en comparación con los suelos SR, AR y VM (6,8; 8,0 y 7,0 cmolc/dm3 respectivamente. Se concluye la fertilización reduce el efecto detrimental del aluminio en la producción de maíz en la Baixada Maranhense.

  16. Crecimiento y habilidad decolorante potencial de Hyphomycetes (Deuteromycetes de Río Santiago sobre medio agarizado suplementado con cromóforos sintéticos Growth and potential decolorizing ability of Hyphomycetes (Deuteromycetes from Río Santiago on agar medium supplemented with synthetic chromophores

    Directory of Open Access Journals (Sweden)

    Romina Liberto

    2005-12-01

    Full Text Available Se analizó la capacidad de Dictyosporium triramosum, Minimidochium parvum y Tetraploa aristata, aisladas de materia orgánica colectada en Río Santiago (Provincia de Buenos Aires, Argentina, para crecer y decolorar medios agarizados y suplementados con diferentes cromóforos sintéticos al 0,01 % (p v-1. Cristal violeta y verde brillante redujeron el crecimiento de las 3 cepas revelando los mayores porcentajes de inhibición. Mientras que eosina y rosa de bengala no afectaron a D. triramosum, valores superiores al 50 % de inhibición se observaron en M. parvum y T. aristata. Rojo congo y rojo neutral redujeron a D. triramosum y M. parvum en un 12-17 %, pero no a T. aristata. D. triramosum y T. aristata no resultaron afectados por azul de toluidina, mientras M. parvum fue inhibido por el colorante. Rojo de metilo sólo inhibió a M. parvum y T. aristata. Las 3 cepas probadas revelaron capacidad para decolorar el medio suplementado con azul de toluidina y rojo de metilo. D. triramosum decoloró además el medio suplementado con cristal violeta y rojo congo, y T. aristata el medio con cristal violeta y rojo neutral. Ninguno de los hongos estudiados decoloró los medios con eosina, rosa de bengala y verde brillante.The ability of Dictyosporium triramosum, Minimidochium parvum and Tetraploa aristata, isolated from organic matter collected in Río Santiago (Buenos Aires Province, Argentina, to grow and decolorize agar media supplemented with different synthetic chromophores at 0.01% (w v-1 was analyzed. Crystal violet and brilliant green reduced the growth of the three strains showing the highest inhibition percentages. While eosin and rose bengal did not affect D. triramosum, growth inhibition values superior to 50 % were observed for M. parvum and T. aristata. Congo red and neutral red inhibited growth of both D. triramosum and M. parvum in a 12-17%, but those dyes did not reduced T. aristata growth. D. triramosum and T. aristata were not affected

  17. Aspectos de biología reproductiva de la almeja de sifón Panopea globosa (Dall 1898 en el Golfo de California Aspects of reproductive biology of the geoduck clam Panopea globosa (Dall 1898 in the Gulf of California

    Directory of Open Access Journals (Sweden)

    Edna María Arambula-Pujol

    2008-08-01

    Full Text Available Este trabajo describe aspectos básicos de la biología reproductiva de la almeja de sifón Panopea globosa para una población de la porción centro-oriental del Golfo de California. Las almejas de sifón fueron colectadas mensualmente durante un periodo anual (octubre de 2004 a octubre de 2005 Se usó el índice gonadosomático y la técnica de crecimiento de ovocitos para determinar el periodo de reproducción. El periodo reproductivo se relacionó con la temperatura in situ además de la temperatura superficial del mar, tomada de la base de datos COADS. Las fases reproductivas fueron similares a las de las almejas de sifón presentes en Nueva Zelanda y Canadá. La gametogénesis inicia en otoño y el desove se presenta en enero-febrero (invierno cuando la temperatura está más fría (~18 ºC. Se encontró que P. globosa desova a temperaturas semejantes a las que lo hace P. zelandica en el Hemisferio Sur, pero que la estrategia reproductiva de P. globosa es más similar a la de P. abrupta (Hemisferio Norte, ya que el desove se presenta cuando la temperatura empieza a incrementarse. Los resultados del presente estudio pueden ser la base de futuras investigaciones sobre la biología, ecología y potencial pesquero de la almeja de sifón del Golfo de California.This paper describes basic aspect of reproductive biology of the geoduck clam Panopea globosa from a population in the east central Gulf of California. Geoduck clams were collected monthly for a year (October 2004-October 2005, The gonadosomatic index and ovocyte growing (oocyte diameters techniques were used to determine the spawning timing. Reproductive period was related with in situ temperature and seawater surface temperatures (SST from the Comprehensive Oceanic and Atmospheric Data Set. Reproduction phases were similar to other geoduck clams in New Zealand and Canada. Gametogenesis begins in autumn and spawning occurred between January and February (winter, when SST were at their

  18. MICROBIOLOGICAL ASSESSMENT OF LETTUCE SALADS AND ANTIMICROBIAL RESISTANCE OF STAPHYLOCOCCUS SPP.

    Science.gov (United States)

    Guimarães César, Josi; Madruga Peres, Andriele; Pereira das Neves, Caroline; Tupiniquim Freitas de Abreu, Érica; Fagundes de Mello, Jozi; Nunes Moreira, Ângela; Lameiro Rodrigues, Kelly

    2015-11-01

    Introducción: la procura por estabelecimientos que ofrecen alimentos prontos para consumo ha aumentado, sin embrago, los alimentos disponibles en estos locales pueden estar contaminados con microorganismos patogénicos, pudiendo causar enfermedades transmitidas por alimentos. Objetivos: evaluar la calidad microbiológica de las ensaladas de lechuga en los restaurantes de Pelotas RS Brasil, a través de los recuentos de coliformes termotolerantes, Escherichia coli, Staphylococcus spp. y la detección de Salmonella spp. Resistencia a los antimicrobianos de Staphylococcus spp. también se evalúan. Métodos: fueron colectadas 36 muestras de ensaladas de lechuga en nueve restaurantes y realizada la cuantificación de coliformes termotolerantes, Escherichia coli y Staphylococcus spp. e investigación de Salmonella spp., siguiendo la metodología del Bacteriological Analytical Manual. Los aislados de Staphylococcus spp. fueron sometidos al examen de resistencia a antimicrobianos por el método de difusión con discos. Resultados y discusión: de las 36 muestras de ensalada de lechuga, 61,1% presentaron cuantificación de coliformes termotolerantes superiores a lo permitido por la legislación brasileña, y hubo confirmación de E. coli en 5,6% de las muestras. La cuantificación de Staphylococcus coagulasa positiva representó 5,6% de los aislados y Staphylococcus coagulasa negativa representó 77,8%. Todas las muestras presentaron ausencia de Salmonella spp. De los 30 aislados de Staphylococcus spp. examinados, 56,7% fueron resistentes a penicilina, 46,7% a oxacilina, 26,7% a eritromicina y 23,3% fueron multirresistentes. Conclusión: la calidad microbiológica de las ensaladas de lechuga se mostró inadecuada debido a la presencia de microorganismos patogénicos, y los aislados de Staphylococcus spp. presentaron elevado porcentaje de resistencia antimicrobiana.

  19. Diversidad de frutos que consumen tres especies de murciélagos (Chiroptera: Phyllostomidae en la selva lacandona, Chiapas, México Diversity of fruits consumed by three species of bats (Chiroptera:Phyllostomidae in the Lacandona rainforest, Chiapas, Mexico

    Directory of Open Access Journals (Sweden)

    Alinka Olea-Wagner

    2007-06-01

    Full Text Available Este estudio amplía el conocimiento de los hábitos alimentarios de 3 especies de murciélagos frugívoros como dispersores de semillas en 2 localidades de la selva alta perennifolia en la zona sur de la Reserva de la Biosfera de Montes Azules (REBIMA, y dentro del Ejido Playón de la Gloria (PDLG. Se estimó la abundancia relativa de Artibeus lituratus, Carollia perspicillata y Sturnira lilium, así como la diversidad y categoría sucesional de los frutos que consumen estas 3 especies en ambas localidades, mediante la identificación de semillas en las excretas. La división de especies vegetales por categoría sucesional mostró que A. lituratus y C. perspicillata consumen frutos tanto de especies pioneras como de especies persistentes, mientras que S. lilium únicamente se alimenta de especies pioneras. Durante la época seca A. lituratus y C. perspicillata presentaron una mayor diversidad y riqueza de especies consumidas dentro de la REBIMA, en tanto que en la época de lluvia mostraron mayor diversidad y riqueza dentro de PDLG; es decir, la diversidad de semillas colectadas por ambos dispersores responde a la época anual. S. lilium presentó mayor riqueza y diversidad dentro de PDLG a lo largo del muestreo indicando preferencia por frutos establecidos en estadios tempranos en la sucesión vegetal.This study examined the feeding habits of three species of frugivorous bats in relation to their role as seed dispersers in two localities, one in a Neotropical rainforest area in the southern part of the Montes Azules Biosphere Reserve (REBIMA, and the other in Ejido Playón de la Gloria (PDLG. We estimated the relative abundance of Artibeus lituratus, Carollia perspicillata and Sturnira lilium. We determined the diversity and the successional category of fruits consumed by these species in both localities through the identification of seeds in their feces. The plant species diversity based on successional category showed that A. lituratus and C

  20. Efecto del contenido de azufre sobre la meteorización del carbón: comparación de dos mantos en Hato de la Virgen (Fm. Carbonera, Venezuela

    Directory of Open Access Journals (Sweden)

    Galarraga, F.

    2000-08-01

    Full Text Available Ten bituminous coal samples, showing several weathering levels, were collected at different depths into two subsurface galleries: G-l1, where coalbed 20 is mining, with a sulfur content ≻ 5 %; and G-24, where coalbed 24 is present, with a sulfur content less than 1.5 %. Both mines are located in Hato de la Virgen, State of Táchira, Venezuela. The aim of this work is to evaluate the effect of sulfur on the weathering extent in coal. For comparative purposes, fresh samples were collected from cored intervals of four different wells near of the galleries. The following analysis were done: proximate (moisture, volatile matter, fixed carbon, ash, calorific power, free swelling index (FSI elemental analysis (C, H, N, O total and different sulfur species (pyritic, sulfate and organic sulfur, FT-IR infrared spectroscopy, and major composition of ash (Si, Al, Ca, Mg, Mn, Fe, K, Na, Cl, P. Only coal samples from core wells are absolutely fresh: those collected within galleries show evidence of low or remarkable oxidation, detected by several parameters (moisture, calorific power, elemental and ash composition and by infrared spectroscopy (appearance of carbonyl signal, decrease in C-H strength absorption. Sulfur content in a high proportion does not modify the style or extension of the oxidation in the organic matrix of coal. However, sulfur is responsible of an important variation in the alteration style of the inorganic matrix of coal, modifying the scheme of leaching in some elements (mainly Fe, and in lesser extent, Si, K, P. These elements are preferentially removed from coal, immobilizing other species (Ca, Mg, Mn by precipitation as insoluble sulfates.Diez muestras de carbón bituminoso, presentando diferentes niveles de meteorización, fueron colectadas a diferentes profundidades de dos minas subterráneas ubicadas en la localidad de Hato de la Virgen, Estado Táchira, Venezuela: la galería G-ll, donde se explota el manto 20, con un

  1. DIVERSIDAD DE ABEJAS (HYMENOPTERA: APOIDEA EN ESTADOS SUCESIONALES DEL BOSQUE HÚMEDO TROPICAL Bee Diversity (Hymenoptera: Apoidea in a Tropical Rainforest Succession

    Directory of Open Access Journals (Sweden)

    ALLAN SMITH PARDO

    2007-06-01

    Full Text Available Los objetivos principales de este trabajo fueron entender cómo la diversidad de abejas cambia durante la sucesión en un bosque húmedo neotropical, y comparar la eficiencia de los cuatro métodos de captura usados. La diversidad y riqueza de abejas fueron estudiadas al nororiente de Medellín (Antioquia, Colombia; 9001.100 m durante seis meses en cuatro estados sucesionales (pastizal, rastrojo bajo, rastrojo alto y bosque. Las abejas fueron intensiva y sistemáticamente capturadas usando los siguientes métodos: red entomológica, Malaise, metil salicilato para abejas euglosinas (Apidae, Euglossini y trampa Van Somer con pescado de agua dulce en descomposición. En total se capturaron 15.356 especímenes pertenecientes a cuatro familias y 287 especies de abejas. Esto corresponde al 62% del número total de especies de abejas conocidas para Colombia. Aproximadamente el 50% de todos los individuos fueron abejas sociales sin aguijón (Apidae, Meliponini. Trigona (Trigona fulviventris fue la especie más abundante (~10% en todo el muestreo. Augochlora y Megachile fueron los géneros con mayor número de especies. El pastizal y rastrojo alto presentaron los mayores índices de diversidad y riqueza de abejas y fueron significativamente más altos que los del bosque y rastrojo bajo. En todos los estados sucesionales, excepto por el bosque, el número de especies nuevas por muestra tendió a cero, y las curvas de acumulación de especies tendieron a normalizarse con el tiempo y aumento en el área de muestreo. La red entomológica fue el método más eficiente en todos los estados sucesionales, excepto en el bosque, donde el mayor número de especies e individuos fueron capturados con la trampa Van Somer. Sin embargo, en todos los estados sucesionales un mayor porcentaje (50% de especies raras fueron colectadas con Malaise. El número de especies nuevas colectadas en cada muestra y las curvas de acumulación de especies sugieren que el muestreo fue

  2. Estratégias de ensino do cuidado em enfermagem: um olhar sobre as tendências pedagógicas Estrategias de enseñanza del cuidado en enfermería: una mirada sobre las tendencias pedagógicas Teaching strategies of nursing care: a look on pedagogical trends

    Directory of Open Access Journals (Sweden)

    Daniele Delacanal Lazzari

    2011-12-01

    Full Text Available Determinar estratégias de ensino para os conteúdos e conceitos imbricados no cuidado, configura-se em um desafio para educadores na área da enfermagem. Este estudo é de caráter qualitativo, descritivo-exploratório, cujo objetivo foi conhecer as estratégias empregadas para ensinar o cuidado em enfermagem, utilizadas por dez enfermeiros professores do curso de Enfermagem de uma universidade na região metropolitana de Porto Alegre, Rio Grande do Sul. As informações foram coletadas pela técnica de Grupo Focal, no período de junho de 2004 a março de 2005. Da análise temática dos dados resultou a categoria Estratégias de Ensino do Cuidado, com as subcategorias demonstração, exposição, observação e discussão. As evidências apontam para tentativas de substituir a proposta tradicional de transmissão de conteúdos, sem, apresentarem, efetivamente, outra tendência pedagógica que não a tradicional. Conclui-se que a competência técnica ainda é privilegiada, desconsiderando o aprendizado voltado para o desenvolvimento de postura crítica e reflexiva.Determinar estrategias de enseñanza para los contenidos y conceptos imbricados en el cuidado, se configura en un desafío para educadores en el área de la enfermería. Estudio cualitativo se caracteriza por ser descriptivo-exploratorio cuyo objetivo fue conocer las estrategias empleadas para enseñar el cuidado en enfermería, utilizadas por diez enfermeros maestros del curso de enfermería de una universidad en la región metropolitana de Porto Alegre, Rio Grande del Sur, Brasil. Las informaciones fueron colectadas por la técnica del Grupo Focal, en el periodo de Junio de 2004 a Marzo de 2005. Del análisis temático de los datos resultó la categoría Estrategias de Enseñanza del Cuidado, con las sub categorías demostración, exposición, observación y discusión. Las evidencias apuntan hacia intentos por sustituir la propuesta tradicional de transmisión de contenidos, sin

  3. PROMOCIÓN DEL CRECIMIENTO DE Baccharis macrantha (ASTERACEAE CON BACTERIAS SOLUBILIZADORAS DE FOSFATOS ASOCIADAS A SU RIZOSFERA

    Directory of Open Access Journals (Sweden)

    Luz Marina LIZARAZO FORERO

    2015-07-01

    Full Text Available El objetivo de esta investigación fue aislar y caracterizar bacterias solubilizadoras de fosfatos (BSF asociadas a la rizosfera de Baccharis macrantha y Viburnum triphyllum, y evaluar su capacidad para solubilizar fosfatos en condiciones in vitro. Además se determinó el efecto de la inoculaciónde las cepas de BSF más eficientes sobre el crecimiento de B. macrantha. Las muestras de suelo rizosférico de B. macrantha y V. triphyllum fueron colectadas en los meses de mayo-período de lluvia y septiembre-período seco del 2012. Para la cuantificación de bacterias heterótrofas cultivables y BSF se empleó el método de recuento en placa en los medios Agar Tripticasa de Soya y Pikovskaya (PVK respectivamente. La capacidad de solubilización de fosfatos de las cepas aisladas se estimó a partir del diámetro de los halos formados alrededor de las colonias en el medio de cultivo PVK después de 7 días de incubación a 28 °C. Los ensayos de inoculación en B. macrantha se realizaron con las BSF más eficientes. La inoculación de las BSF B. firmus y P. fluorescens de forma individual y como inoculante combinado mostro un efecto benéfico, incrementando significativamente el porcentaje de germinación de semillas, la altura de la plántula, la longitud de la raíz y el peso seco de B. macrantha. La inoculación de BSF podría ser considerada una estrategia para mejorar el crecimiento y establecimiento de B. macrantha en pastizales abandonados.Growth Promotion of Baccharis macrantha (Asteraceae by Phosphate Solubilizing Rhizosphere Bacteria     The objectives of this research was to isolate and characterize phosphate solubilizing bacteria (BSF associated to the rhizosphere of Baccharis macrantha and Viburnum triphyllum, and to assess their ability to solubilize phosphate under conditions in vitro. Furthermore to determine the effect of inoculation of the strains BSF more efficient on the growth of B. macrantha. Rhizosphere soil samples of B

  4. Obtención de secuencias microsatelitales especie especificas para Plagioscion magdalenae (Pisces:Sciaenidae

    Directory of Open Access Journals (Sweden)

    Bayona-Vásquez Natalia Juliana

    2007-12-01

    Full Text Available Plagioscion magdalenae pertenece a los sciaenidae, ésta familia es ampliamente reconocida por ser un recurso
    pesquero importante a nivel mundial, principalmente de especies marinas o estuarinas. P. magdalenae es una
    especie de importancia económica, dada su frecuencia de captura y comestibilidad de su carne, que se encuentra
    en la parte baja de la cuenca del río Magdalena y en la cuenca del río San Jorge, Colombia, en donde cada vez su comercialización cobra fuerza debido al desplazamiento y disminución en los volúmenes de captura de otras especies como el bagre rayado y bocachico. Lo cual ha llevado a la comúnmente llamada pacora a catalogarse en estado de vulnerabilidad en las cuencas colombianas. Lo anterior, hace necesario la generación de información que sirva de sustento a programas de conservación y uso sostenible de la especie. Una primera aproximación a las poblaciones de P. magdalenae puede ser hecha a través de marcadores moleculares microsatelitales, útiles en trabajos de genética de poblaciones, conservación y manejo de recursos biológicos. Sin embargo, la principal dificultad de los microsatélites es que deben ser aislados de novo para aquellas especies que van a ser evaluadas por primera vez, lo que lleva a la necesidad de obtener primers para la especie. En este trabajo, inicialmente se obtuvo un ADN de buena calidad útil para amplificaciones a partir de muestras de músculo colectadas en cuatro puntos de la cuenca del río San Jorge; posteriormente, se aislaron primers microsatelitales especie-específicos para P. magdalenae mediante amplificación cruzada con primers de otras especies de peces lejanas, entre las cuales se encuentra: Pseudoplatystoma corruscans, Pimelodella chagressi, Prochilodus argenteus y Prochilodus costatus. Para lo anterior, fue necesario modificar y estandarizar protocolos de amplificación mediante cambios en temperatura de alineamiento y concentración de reactivos; y

  5. Farmacocinética comparada de metformina, en forma sólida y en formulación extemporánea líquida para pediatría, en voluntarios adultos sanos

    Directory of Open Access Journals (Sweden)

    L Rivera-Espinosa

    2016-06-01

    Full Text Available ANTECEDENTES: fraccionar o pulverizar tabletas de metformina para ajustar dosis pediátricas dificulta su administración, genera inestabilidad del fármaco (oxidación/fotosensibilidad y relativiza su biodisponibilidad. Se propone como alternativa de ajuste de dosis y de uniformidad de contenido una formulación extemporánea líquida a partir de tabletas de marca comercial. OBJETIVO: determinar la biodisponibilidad de metformina en formulación líquida, en voluntarios adultos sanos, para demostrar que su comportamiento farmacocinético permanece inalterado. MATERIALES Y MÉTODOS: estudio clínico, aleatorio, cruzado y longitudinal, en adultos sanos voluntarios (n=12, 7 varones y 5 mujeres, de 24.3 ± 1.8 años, con índice de masa corporal = 24.9 ± 2.5 kg/m2. Se obtuvieron muestras sanguíneas en gotas, colectadas en tarjetas Whatman 903®, a las 0.25, 0.5, 1, 2, 4, 8 y 12 horas de ingerir 250 mg del fármaco. Se extrajo el fármaco a partir de 5 discos de papel filtro con sangre impregnada (16 μL, por precipitación directa, con acetonitrilo (ACN y metanol.  La detección fue en una columna AcQuity UPLC BEH HILIC (2.1 × 100mm, 1.7 μm por espectrometría de masas en tándem. Fase móvil: acetato de amonio 5 mM y ACN (80:20; v/v, a 0.25 mL/min isocráticamente. La farmacocinética se determinó mediante el programa Win Nonlin Pro 3.1 y las diferencias se evaluaron por ANOVA de una vía (p ≤ 0.05. RESULTADOS: el método fue exacto, preciso, selectivo y lineal entre 50 y 1000 ng/mL, coeficiente de determinación (r de 0.9982. Las muestras extraídas y almacenadas a 4°C fueron estables por 17 horas y hasta 2 meses a -80°C. La metformina en tableta tuvo una Cmáx de 553.4 ng/mL y de 692.2 ng/mL con la formulación líquida. El Tmáx fue menor con la solución edulcorada (1.6 h que con la tableta (1.8 h. La ke fue menor con la forma líquida (0.29 vs. 0.32 h-1, lo que sugiere que se eliminó más rápidamente. El AUC0-12 fue

  6. Motivos que levam mulheres a não retornarem para receber o resultado de exame Papanicolau Motivos que llevan a las mujeres a no regresar para recibir el resultado del examen de Papanicolau Motives which lead women not to return to receive the results of their pap smear test

    Directory of Open Access Journals (Sweden)

    Suzana de Azevedo Greenwood

    2006-08-01

    Full Text Available O papanicolau é um eficiente método de prevenção do câncer de colo uterino. Para a efetividade desta prevenção, é imprescindível que a mulher receba o resultado do exame e conclua o tratamento. O presente estudo tem o objetivo de identificar motivos que levam mulheres a não retornarem para o recebimento do resultado do papanicolau. Trata-se de uma pesquisa descritiva, com abordagem qualitativa, realizada em uma unidade de saúde em Fortaleza. Os sujeitos do estudo foram 21 mulheres que colheram seus exames de papanicolau e não retornaram para buscar o resultado. O instrumento de coleta de dados foi constituído por entrevista semi-estruturada, realizada por telefone, nos meses de setembro a novembro de 2004. Os resultados evidenciaram motivos relacionados à mulher, ao profissional que realiza o atendimento e ao serviço.El Papanicolau es un eficiente método de prevención de cáncer cervical, bastante utilizado por las mujeres. Para la efectividad de esta prevención, es imprescindible que la paciente reciba el resultado del examen y concluya el tratamiento. El presente estudio tiene como objetivo identificar los motivos que llevan a las mujeres a no volver para recibir el resultado del Papanicolau. Se trata de una investigación descriptiva con aproximación cualitativa, realizada en una unidad de Salud Pública en Fortaleza. Los sujetos de estudio fueron 21 mujeres, cujas muestras fueron colectadas para Papanicolau y que no retornaron para buscar el resultado. El instrumento de recopilación de datos fue una entrevista semi-estructurada, realizada por teléfono entre los meses de septiembre y noviembre del 2004. Los resultados evidenciaron motivos relacionados a la paciente, al profesional que realiza la atención y al servicio.The Pap smear test is an efficient method of uterine cervical cancer prevention. For this prevention method to be effective, it is essential that the patient receives her results and satisfactorily

  7. Evaluacion del comportamiento leucocitario en ovejas a pastoreo como un criterio para determinar la susceptibilidad a la infección con estróngilos digestivos (Evaluation to use the white blood cells in grazing sheep as a criteria for determine susceptibility to infection with strongilyds parasites

    Directory of Open Access Journals (Sweden)

    Espartaco, Sandoval

    2007-09-01

    Full Text Available ResumenA objeto de determinar la posibilidad de emplear el comportamiento celular leucocitario, como criterio de selección en ovejas tropicales infectadas naturalmente con estróngilos digestivos, 40 animales hembras fueron seleccionados al azar de un rebaño de ovejas mestizas West African. Muestras de heces fueron colectadas cada 15 días durante 04 meses y procesadas por la técnica de Mc Master. Niveles de infección individual, fueron determinados en base a los resultados de la coproscopia. Durante el tercer muestreo muestras de sangre fueron tomadas para determinación del indicador hematocrito, número total de leucocitos, recuento diferencial y eosinófilos absolutos. La misma evaluación fue realizada al final del ensayo. Para determinar la influencia de la infección parasitaria sobre las variables, los animales fueron sometidos a tratamiento antihelmíntico, durante el cuarto muestreo, concomitantemente se aplico un antianémico/anabolizante. Los altos contajes de eosinófilos determinados durante el periodo pretratamiento sugieren que este tipo de células están asociadas con la respuesta protectiva de tipo inmune, ya que una vez disminuido el estimulo antigénico de las poblaciones de parásitos estos disminuyen, así como su relación inversa con los niveles de infección. El aumento en el contaje total de leucocitos, se corresponde a la eosinófilia observada. Las variaciones en el hemograma relacionadas a elevados contajes de hpg, sugieren que este criterio puede ser usado como indicador patológico para determinar condición de resistencia o susceptibilidad al parasitismo, al asociar estas respuestas con el grado de reacción inmune. SummaryThe aims of this work was to evaluate the possibility to use the dynamic of blood white cells as a criteria of selection approach in tropical sheep infected under natural conditions with gastrointestinal nematodes. A total of 40 female sheep were selected at random within a crossbred West

  8. Variación espacial de larvas de lutjánidos y serránidos en la Plataforma de Yucatán Spatial variation of Snapper and Grouper larvae in Yucatan Shelf

    Directory of Open Access Journals (Sweden)

    Elsa Falfán-Vázquez

    2008-08-01

    Full Text Available El objetivo fue analizar la abundancia y distribución de los serránidos y lutjánidos en la Península de Yucatán. Se analizaron 45 muestras de ictioplancton colectadas durante una campaña oceanográfica (Yucatán03-A en el mes de septiembre del 2003, los arrastres fueron superficiales con una red tipo Bongo. Un total de 3,963 organismos fueron colectados, pertenecientes a 50 familias, tres (Carangidae, Gobiidae y Clupeidae representaron más del 50% de la densidad. Las familias Lutjanidae y Serranidae estuvieron dentro de las nueve más abundantes con una densidad total de 713.8 ±60 org./100 m³. Serranidae estuvo representada por especies de los géneros Anthias, Diplectrum, Liopropoma, Serranus y Epinephelus fulvus, mientras que Lutjanidae por Lutjanus analis, L. campechanus, L. griseus y L. synagris. La especie con mayor densidad fue L. synagris, representando el 28.9% del material revisado, seguida de E. fulvus, L. analis y L. campechanus. El análisis de agrupación de las estaciones permitió identificar tres zonas oceanográficas a nivel horizontal: Oeste, Centro y Surgencia (en el este. Las larvas de serránidos se distribuyeron principalmente en la zona Centro, mientras que las de los lutjánidos en el este de la plataforma de Yucatán, sugiriéndose que los desoves de peces de estas familias ocurren en distintas zonas de la plataforma, evitando así la competencia por el alimento en sus primeras etapas larvarias. La corriente de Yucatán provoca un transporte de Ekman que produce un afloramiento que genera un incremento de fitoplancton, zooplancton e ictioplancton que favorece el reclutamiento de los peces, un rápido crecimiento y disminución de su estadio larval.The objective was to analyze the abundance and distribution of snappers and groupers in the Yucatan shelf. We analyzed forty-five samples of ichthyoplankton that were taken from oceanographic research (Yucatan03-A during September 2003. Superficial tows were made with

  9. Anatomia de la madera de nueve leguminosas de Venezuela

    Directory of Open Access Journals (Sweden)

    Argélia Silva

    1988-01-01

    Full Text Available Se estudió la estructura microscópica del leño de especies de las tres sub-famílias de leguminosas, con el fin de determinar caracteres distintivos de cada uno de estos taxa. Las observaciones se realizaron en: Acacia macracantha, Bauhinia aculeata, Calliandra gracillis, Cassia speclabilis, Coursetia arborea, Erythrina poeppigiana, Leucaena trichodes, Lonchocarpus violaceus, Pithecellobium saman, las cuales fueron colectadas en bosques, deciduos de dos localidades: Colinas del Jardín Botánico de Caracas (900 m.s.n.m. y cercanías de la población de Charallave, Estado Miranda (500 m.s.n.m.. La metología seguida fue la usual en estudios anatómicos de madera. Con respecto a la terminologia, se siguió la propuesta por la IAWA y la citada por Braun (1970 referente a los tipos histológicos y el parénquima axial. Para cada una delas muestras se analizaron los siguientes aspectos:anillos de crecimiento, número de vasos por mm² y longitud de los elementos; diámetro tangencial y radial de los vasos y patrón de distribuición; tipo de perforación; fibras, su naturaleza y distribución; de punteaduras; tipo de parénquima axial y número de células por serie parenquimatosa; tipo y dimensiones de los radios vasculares; estructura estratificada; tipo histológico; tílides y cristales. De las especies analizadas, las Papilionoideae muestran mayor uniformidad mientras que las Caesalpinioideae y Mimosoideae exhiben mayor variación. Entre los caracteres útiles para diferenciar las Papilionoideae se reportam estructura estratificada y punteaduras ornadas. Se notó um predominio de caracteres avanzados, especialmente en las Papilionoideae, pero também se observaron caracteres poco especializados no solamente en las Caesalpinioideae considerada tradicionalmente el grupo más primitivo, sino também en representantes de las otras dos subfamilias.Estudou-se a estrutura microscópica do lenho de algumas espécies das três subfamilias das

  10. Increasing leptin level in abstaining alcohol-dependent women Niveles elevados de leptina en las mujeres alcohólicas abstinentes

    Directory of Open Access Journals (Sweden)

    M. Cardoso Fernandes Toffolo

    2012-06-01

    calcular el IMC. Muestras de sangre fueron colectadas para la medición de la leptina. Resultados: Los niveles medios de leptina, la leptina/ IMC, leptina/%GC, fueron mayores entre las mujeres. Las mujeres abstinentes (A2, también presentaron mayor nivel de leptina, la leptina/IMC y leptina/%GC, de que las mujeres bebedoras activas (p = 0,039, p = 0,023, p = 0,023. Las diferencias estadísticas también se muestran entre las mujeres abstinentes A2 y A3. Se observó una asociación positiva significativa entre niveles de lep-tina y el IMC y leptina y la CC en las mujeres alcohólicas activas (leptina x IMC: r = 0,91, p < 0,01; leptina x CC: r = 0,87, p = 0,001. Sin embargo, una asociación significativa no se muestra entre estos resultados en las mujeres abstinentes (leptina x IMC: r = 0,28, p = 0,37/leptina x CC: r = -0,32, p = 0,92. Conclusión: Nuestros resultados sugieren que los niveles de la leptina parecen aumentar sólo en las mujeres que se abstienen. Este resultado puede estar relacionado con la duración de la abstinencia.

  11. Morphometric differences in two calanoid sibling species, Boeckella gracilipes and B. titicacae (Crustacea, Copepoda Diferencias morfométricas en dos especies hermanas Boeckella gracilipes y Boeckella titicacae (Crustacea, Copepoda

    Directory of Open Access Journals (Sweden)

    Patricio De los Ríos Escalante

    2012-12-01

    . titicacae colectado en el lago Titicaca y B. gracilipes colectado en el lago Riñihue, ambos son ambientes estables, con una tercera población colectada en lagunas superficiales en el Salar de Surire. Estas lagunas tienen condiciones ambientales extremas debido a alta exposición a la radiación solar y altos niveles de salinidad. Los resultados del presente estudio encontraron diferencias entre las tres poblaciones. Estos resultados concordarían con las descripciones sistemáticas en la literatura sobre las diferencias de las poblaciones de los lagos Titicaca y Riñihue, y la población del salar de Surire tuvo leves diferencias respecto a las dos poblaciones anteriores. Es probable que las diferencias entre la población del Salar de Surire y las otras dos se deban a alta exposición a la radiación solar, salinidad y condiciones extremas de temperatura que acelera las diferencias genéticas las que se expresan en diferencias morfológicas.

  12. Relação equipe de enfermagem e acompanhantes de clientes hospitalizados: implicações para o cuidado La relación entre el equipo de enfermería y la familia del paciente: implicaciones para el cuidado The relation between the nursing team and patient's family: implications for care

    Directory of Open Access Journals (Sweden)

    Nilcéia Dadalto Squassante

    2009-02-01

    Full Text Available Estudo de natureza qualitativa, desenvolvido junto à equipe de enfermagem e familiares acompanhantes de clientes internados em hospital público de Vitória/ES. Os objetivos foram descrever as bases que sustentam a relação entre esses sujeitos; analisar a dinâmica dessa relação; e discutir suas implicações para o cuidado de enfermagem. O referencial teórico vinculou-se aos estudos das relações de poder no espaço disciplinado hospitalar e na concepção de cuidado em uma perspectiva humanizada. Os dados foram coletados através da observação participante e entrevista semi-estruturada. Os resultados apontaram que essas relações não ocorrem linearmente. Ao tempo em que emergem experiências conflitantes, há outras cuja posição de um e outro sujeito revela sensibilidade e solidariedade que implicam diretamente no cuidado prestado ao cliente hospitalizado.Estúdio de la naturaleza cualitativa, desarrollada junto al equipo de enfermería y junto de los familiares acompñantes de los clientes internados en el hospital público de la ciudad de Vitória/ES. Los objetivos fueron para describir las bases que sostienenlarelación entre esos sujetos; analisar la dinámica de esa relación; y debatir sus implicaciones para el cuidado de la enfermería. El referencial teórico vinculouse en los estúdios en las relaciones del poder en el espacio disciplinado del hospital y en la concepción del cuidado en una uma perspectiva humanizada. Las informaciones fueron colectadas por médio de observación del participe y entrevista semiestructurada. Los resultados apuntaron que esas relaciones no ocurren linearmente. Al tiempo em que emergen lãs experiências conflictantes, hay otras posicione de uno y outro sujeto que revelan sensibilidad y solidariedade y implican directamente em el cuidado prestado para el cliente hospitalizado.Study of qualitative nature, developed along with the nursing team and the accompanying relatives of interned

  13. Patterns of treatment for childhood malaria among caregivers and health care providers in Turbo, Colombia = Pautas de tratamiento para la malaria infantil entre los cuidadores y profesionales de la salud en Turbo, Colombia

    Directory of Open Access Journals (Sweden)

    López de Mesa, Ysabel Polanco

    2012-04-01

    narrativas de enfermedad colectadas en el curso del estudio indicó que los cuidadores de los niños, que en su mayoría son las madres, reconocen la fiebre y la tratan prontamente. Los cuidadores identificaron la fiebre, los escalofríos, los dolores de cabeza, el vómito y la debilidad como los síntomas más frecuentes de la malaria. Los análisis sincrónico y diacrónico mostraron que la mayoría de los tratamientos comienzan en la casa. Los tratamientos caseros más comunes incluyen baños con hierbas y el uso de medicamentos antipiréticos. Ni los cuidadores ni los sanadores tradicionales conceptualizaron la malaria como una enfermedad que involucre asuntos espirituales. Los cuidadores describieron una mezcla de biomedicina, tratamientos en casa y medicina tradicional. Este enfoque pluralista ayuda a explicar, en parte, el proceso de toma de decisiones de los cuidadores. Adicionalmente, desde la perspectiva biomédica, esta mezcla compleja de conocimientos puede conducir al tratamiento inadecuado de los niños con malaria.

  14. Fatores de risco para doença arterial coronariana em idosos: análise por enfermeiros utilizando ferramenta computacional Factores de riesgo para enfermedad arterial coronaria en ancianos: análisis por enfermeras utilizando herramienta computacional Risk factors for coronary artery disease in the elderly: analysis by nurses using computational tool

    Directory of Open Access Journals (Sweden)

    Silvia Sidnéia da Silva

    2010-12-01

    Full Text Available Este trabalho objetivou analisar a ocorrência dos fatores de risco para doença arterial coronariana em população idosa participante de uma ação comunitária utilizando ferramenta computacional por enfermeiros. Para o desenvolvimento do trabalho utilizou-se uma base de dados coletada em um evento comunitário. As informações se referem a fatores de risco, dados antropométricos, aferição de valores de glicemia, colesterol e pressão arterial, ocorrência de doença cardíaca e outras. A estrutura multidimensional foi elaborada e gerenciada pela ferramenta Analysis Services. A população idosa correspondeu a 40,4% do total, um terço dessa população estava com valores alterados de pressão arterial sistêmica, 53,8% apresentavam índice de massa corporal acima de 25 Kg/m², 40,3% referiram hipertensão e 20,3%, diabetes mellitus. Conclui-se que o controle de fatores de risco para DAC em clientes idosos é essencial e que a tecnologia da informação pode apoiar na tomada de decisões estratégicas de promoção de saúde.Este trabajo tuvo como objetivo analizar la ocurrencia de los factores de riesgo para enfermedad arterial coronaria en la población anciana participante de una acción comunitaria con una herramienta computacional para las enfermeras. Para el desarrollo del trabajo se utilizó una base de datos colectada en un evento comunitario. Las informaciones se refieren a factores de riesgo, datos antropométricos, contraste de valores de glucemia, colesterol y presión arterial, ocurrencia de enfermedad cardiaca y otras. La estructura multidimensional fue elaborada y administrada por la herramienta Analysis Services. La población anciana correspondió a 40,4% del total, un tercio de esta población estaba con valores alterados de presión arterial sistémica, 53,8% presentaban índice de masa corporal arriba de 25Kg/m², 40,4% se referían a hipertensión y 20,3% diabetes mellitus. Se concluye que el control de factores de

  15. Efecto in vitro de aceites esenciales de tres especies de Lippia sobre Moniliophthora roreri (Cif. y Par. Evans et al., agente causante de la moniliasis del cacao (Theobroma cacao L. In vitro effect of essential oils of three Lippia species on Moniliophthora roreri (Cif. and Par. Evans et al., causative agent of moniliasis of cocoa (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    Betty Stefany Lozada

    2012-04-01

    Full Text Available Se evaluó el efecto antifúngico in vitro de cinco aceites esenciales (AEs (AE1, AE2, AE3, AE4 y AE5 extraídos de Lippia origanoides, L. citriodora y L. alba sobre aislados de monilia (Moniliophthora roreri obtenidos de frutos de cacao infectados provenientes de San Vicente de Chucurí, Santander, Colombia. Las plantas de Lippia fueron colectadas en cinco localidades colombianas. Los aislados de monilia (M1, M2, M3, M4 y M5 fueron caracterizados por su morfología, germinación y crecimiento en medios de cultivo. La actividad antifúngica de diferentes concentraciones de los AEs fue evaluada contra el aislado M2 y la cepa de M. roreri (ATCC 64239, para determinar su efecto sobre la germinación y la inhibición del crecimiento micelial. Los AEs estudiados inhibieron 100% de la germinación y del crecimiento micelial cuando fueron utilizados en concentraciones de 800 - 1000 µg/ml. Concentraciones de 200 µg/ml también mostraron efecto sobre los aislamientos fúngicos, siendo los AEs obtenidos de L. origanoides (AE2 y AE3 los más activos. Estos estaban compuestos principalmente por timol, p-cimeno, g-terpineno, acetato de timilo, carvacrol, b-mirceno, trans-b-cariofileno. Diferencias significativas (P The in vitro antifungal effect of five essential oils (EOs (EO1, EO2, EO3, EO4 and EO5 extracted from Lippia origanoides, L. citriodora and L. alba on isolates of Monilia (Moniliophthora roreri was evaluated. Lippia plants were collected at five locations in Colombia, and monilia isolates were obtained from infected cocoa fruits collected in San Vicente de Chucurí, Santander, Colombia. The fungi strains (M1, M2, M3, M4 and M5 were characterized by morphology, germination and growth in culture media. Antifungal activity of different concentrations of EOs was evaluated against the M2 and the isolated strain of M. roreri (ATCC 64239 determining their effect on germination and mycelial growth inhibition. The five essential oils studied inhibited

  16. Comparative leaf anatomy in argentine Galactia species Anatomía comparada de hoja en especies argentinas de Galactia

    Directory of Open Access Journals (Sweden)

    G. M. Tourn

    2009-07-01

    individuos de 10 especies (en negrita colectadas en su área de distribución y en cultivo. Las Secciones están definidas por caracteres reproductivos, básicamente y algunos pocos caracteres vegetativos (exomorfológicos. En este trabajo se describen los caracteres anatómicos foliares de las especies argentinas del género Galactia. Algunos de ellos podrían ser de valor diagnóstico en estudios taxonómicos. Se puso especialénfasis en el significado para la sistemática de algunos de ellos tal como la estructura del nervio medio. El objeto del presente trabajo es: proveer mayor información sobre la estructura anatómica foliar de las especies del género Galactia y evaluar la relevancia sistemática y/o ecológica de dicha información.

  17. Cambio climático y amenazas ambientales en el Área Metropolitana de Tucumán Climate change and environmental hazard at the Metropolitan Area of Tucumán

    Directory of Open Access Journals (Sweden)

    José M Sayago

    2010-06-01

    Full Text Available La variabilidad espacial y temporal de los efectos del calentamiento global aconseja aplicar la perspectiva regional en la predicción de sus impactos sobre el paisaje natural y las comunidades. En este trabajo se presenta una aproximación metodológica preliminar, cuyos fundamentos son: a la reconstrucción paleoclimática regional y la determinación de escenarios extremos de cambio climático; b la evaluación de amenazas ambientales generadas en cada escenario; c el desarrollo de planes de alerta temprana y prevención de riesgos. Mediante la reconstrucción paleoclimática regional en tres escalas temporales (centenal, milenaria y el Holoceno se identificaron dos escenarios extremos de cambio climático (húmedo y seco. La perioricidad de ENSO (El Niño/La Niña en la región, sumado a la influencia de los cambios paleoclimáticos de los últimos milenios en la dinámica ocupacional de las comunidades agroalfareras permitio una aproximación a los posibles impactos futuros. Se dividió el área metropolitana de Tucumán en unidades de relieve, subdivididas en unidades menores según el uso del suelo (urbano, suburbano y rural. En cada escenario de cambio climático, unidad de relieve y uso del suelo se evaluaron las principales amenazas generadas por los extremos de variabilidad climática. Para cada amenaza ambiental, es posible desarrollar planes alerta temprana, protección o mitigación. Esta primera aproximación espacial podrá ser mejorada cuando la complejidad de la información colectada permita una valoración cuantitativa, a mayor escala, mediante información satelitaria y los sistemas de información geográfica.The present paper discusses the type and intensity of environmental hazards affecting the urban conglomerate of Greater San Miguel de Tucumán in the presence of future climatic changes. The steps required for making regional predictions as regards their impact on superficial geodynamics are described on the basis of

  18. DIVERSIDAD DE HONGOS MICORRIZÓGENOS ARBUSCULARES DE UNA CRONO-SECUENCIA DE SUELOS ALUVIALES DEGRADADOS POR ACTIVIDAD MINERA EN EL BAJO CAUCA ANTIOQUEÑO, COLOMBIA DIVERSITY OF ARBUSCULAR MYCORRHIZAL FUNGI IN A CHRONO-SEQUENCE OF ALLUVIAL AND DEGRADED SOILS DUE TO MINING PROCESSES IN BAJO CAUCA ANTIOQUEÑO, COLOMBIA

    Directory of Open Access Journals (Sweden)

    Marisol Medina Sierra

    2009-06-01

    Full Text Available Se evaluó la presencia de hongos micorrizógenos arbusculares (HMA en suelos de zonas alteradas y no alteradas por minería de aluvión de los subgrupos Tropic Fluvaquent, Typic Dystropept y Typic Paleudult de terrazas Baja, Media, y Alta, respectivamente, del río Cauca a la altura del municipio de Tarazá (Antioquia, Colombia. La multiplicación de propágulos de HMA se realizó en jarras de Leonard en invernadero, utilizando sustrato estéril, solución Hoagland's modificada y como inóculo diferentes fracciones de suelo correspondientes al tamaño de las esporas. Se realizó un primer ensayo en maíz (Zea mays en el cual se logró colonización de las raíces pero no esporulación; en un segundo ensayo en kudzú (Pueraria phaseoloides se logró colonización y esporulación en los tratamientos provenientes de suelo de terraza alta y suelo disturbado y efecto significativo en el rendimiento del kudzú (P≤0,001 respecto a los demás tratamientos. Las esporas de suelos disturbados y no disturbados por minería de aluvión en el Bajo Cauca antioqueño (Colombia mostraron baja capacidad infectiva; sin embargo, en cultivos trampa fue posible multiplicar HMA que produjeron esporas de cuatro morfotipos diferentes, uno de los cuales se identificó como G. microagregatum. El polimorfismo de los morfotipos obtenidos mediante la técnica de RAPD's permitió diferenciarlos con el cebador OPA2 y el agrupamiento por UPGMA con todos los cebadores mostró similitud mayor al 38% entre ellos. Los resultados moleculares y morfológicos, permitieron ubicar los cuatro morfotipos en el género Glomus pero posiblemente pertenecen a especies diferentes. Los resultados obtenidos son promisorios en la diferenciación de cepas nativas con bajo número de esporas colectadas a partir de muestras de suelos en proceso de rehabilitación, de los cuales no se conoce su composición de HMA.Arbuscular mycorrhizal fungi (AMF presence and diversity were evaluated in

  19. Entomological aspects of Chagas' disease transmission in the domestic habitat, Argentina Aspectos entomológicos de la transmisión de la Enfermedad de Chagas en Argentina

    Directory of Open Access Journals (Sweden)

    SS Catalá

    2004-04-01

    de los moradores. RESULTADOS: Las casas infestadas mostraron un rango amplio de valores de riesgo (0 a 5 picadas riesgosas/ humano. Se observó un gran número de viviendas con bajos valores de riesgo y pocas viviendas con valores elevados. El 44% de las Triatoma infestans colectadas estaban alimentadas sobre ser humano y el 27% sobre perro o gallina. Las viviendas donde perros y/o gallinas compartían la habitación humana, tuvieron valores de riesgo más elevados. Las viviendas ordenadas y limpias exhibieron bajos valores, debido a un escaso número de T. infestans. Se comprobó un 24.3% de correlación entre el tiempo transcurrido luego de aplicar insecticidas y el número de vectores en la vivienda. Sin embargo, no hubo correlación entre el tiempo post-rociado y la infectividad de T. infestans. Se observó correlación entre los valores del indicador entomológico y la seroprevalencia en niños. CONCLUSIONES: El riesgo de transmisión de T. cruzi en cada vivienda, medido a través de un indicador entomológico, se correlaciona positivamente con la prevalencia de seropositividad en niños y con hábitos de los moradores.

  20. Eficacia de la solución de hidróxido de calcio a 20% en la reducción de microorganismos asociados a la cárie de dentina Efficacy of 20% calcium hydroxide solution for reduction of microorganisms in carious dentin

    Directory of Open Access Journals (Sweden)

    IVA Pinheiro

    2005-06-01

    Full Text Available Objetivo: Evaluar la eficácia da solución de hidróxido de calcio a 20% en la reducción de microorganismos asociados a la carie de dentina. Metodología:Treinta preparos cavitários fueron realizados en molares permanentes de 30 indivíduos entre las edades de 9 a 18 años. Solución salina reductora fue utilizada como líquido de colecta para la recuperación de microorganismos, antes y después del lavado cavitário. Las muestras fueron colocadas en placas de agar sangre de carnero e incubadas en anaerobiosis por 48 horas a 37ºC. Después Del crecimiento bacteriano, se realizo un análisis semi cuantitativo y cualitativo de las bacterias, a través de hibridización DNA-DNA para 23 tipos de bacterias. Resultados: Una reducción significativa de la cantidad de microorganismos en las muestras colectadas después del lavado de la cavidad con solución de hidróxido de calcio fue observada cuando comparado con el momento anterior al lavado. Del total de muestras que presentaron microorganismos en la cavidad recién preparada, 46,15% presentaron eliminación de éstos microorganismos después del lavado con agua de cal y 53,84% presentaron reducción significativa del número de microorganismos. El teste t pareado de Student mostró una diferencia extremamente significativa (p=0,0007 entre el momento anterior y posterior al lavado. Con relación al tipo de bacterias encontradas después Del lavado de la cavidad con solución de hidróxido de calcio, se observó reducción considerable de S. anginosus, S. mitis y S. sobrinus, así como de S. aureus y S. epidermidis, a pesar de no ser significativa (p>0,05. Conclusión: La solución de hidróxido de calcio parece ser un método de limpieza cavitária eficaz en la reducción de la microbiota asociada a la carie de dentina.Objective: This study aimed to test the effectiveness of the cavity cleansing solution (calcium hydroxide 20% in the elimination or reduction of microorganisms associated to

  1. Anoplocephala perfoliata en el noroccidente de Colombia Anaplocephala perfoliata in the Northwest of Colombia

    Directory of Open Access Journals (Sweden)

    JA Benavides

    2008-01-01

    Full Text Available Diferentes estudios han sido desarrollados en relación al diagnóstico y prevalencia de Anoplocephala perfoliata, sin embargo en países tropicales como Colombia existen pocos reportes en la industria equina. En esta comunicación se describe la presencia de A. perfoliata en tres municipios del noroccidente de Colombia por métodos de sedimentación/ flotación en 135 équidos: 105 equinos, 2 asnales y 28 mulares. Tres caballos positivos a A. perfoliata fueron examinados por necropsia para determinar la carga parasitaria. Como resultado, el 31,7% de los animales resultaron positivos en los correspondientes municipios, 15% Marmato, 13% Marquetalia, 3,7% Supía. Mediante coprologías no se encontró relación significativa de tipo estadístico (P > 0,05 entre la presencia de A. perfoliata y variables como edad, sexo, especie, aptitud, manejo, tratamiento terapéutico y problemas de cólico. En las necropsias parasitarias fue colectada una alta cantidad de endoparásitos en ciego y válvula ileocecal entre 412 a 1.500 por animal. Los resultados coprológicos indicaron significativas diferencias (P Different studies have been developed in relation to the diagnostic and prevalence of Anoplocephala perfoliata, however, in tropical countries such as Colombia there are few descriptions of this in the equine industry. The aim of this study is to describe the presence of this parasite in the Northwest regions of Colombia by using methods of sedimentation/flotation in 135 equids: 105 horses, 2 ass and 28 mules. A total of 31.7% animals resulted positive: 15% in Marmato, 13% in Marquetalia and 3.7% in Supía. There was no statistically significant relation (P > 0,05 between the presence of A. perfoliata and variables such as age, sex, specie, aptitude, manage, therapeutic treatment and colic problems. In the parasitic necropsies a high quantity of endoparasites in the caecum and ileocaecal valve, among 412 to 1,500 per animal, were collected. The coprology

  2. Stress proteins and auxiliary anti-stress compounds in intertidal macroalgae Proteínas de estrés y compuestos anti-estrés auxiliares en algas marinas intermareales

    Directory of Open Access Journals (Sweden)

    Edgardo Cruces

    2012-11-01

    és (HSPs han sido consideradas como potenciales agentes protectores en respuesta a condiciones estresantes, especialmente durante la acción de elevada temperatura y alta radiación solar. Considerando que las macroalgas marinas no han sido usadas comúnmente como modelos de estudio para analizar estas moléculas, el presente trabajo compila la información existente sobre la inducción de proteínas de estrés en algas intermareales en el contexto de los principales factores hasta ahora reportados como inductores, e.g. temperatura, alta radiación solar, contaminantes, etc. Adicionalmente, mediante un estudio de caso usando dos especies del intermareal superior, Ulva sp. y Porphyra columbina colectadas en el sur de Chile, se examina si la inducción de proteínas de estrés ocurre de forma complementaria con otras respuestas anti-stress. Para ello, dos mecanismos bien conocidos, fotoinhibición de fotosíntesis y actividad antioxidante, fueron medidos en paralelo. Los resultados indicaron que, aunque hubo expresión de proteínas de estrés dentro de un periodo experimental entre 3 y 24 h, estas respuestas no fueron correlacionadas con cambios en fotosíntesis o actividad antioxidante. En general, el estudio perfila un potencial rol de estas moléculas en algunas respuestas ecofisiológicas desarrolladas para contrarrestar los efectos negativos de las altas temperaturas y la radiación solar. Por otro lado, otros ajustes metabólicos de acción rápida (e.g. fotoinhibición y actividad antioxidante, distintas biomoléculas (micosporinas, fenoles, poliaminas, etc., además de las adecuaciones morfo-funcionales a la vida intermareal (e.g. pequeno tamano, alta proporción área/volumen son importantes para explicar la fisiología de estos organismos.

  3. Estimating species richness of arthropods in azorean pastures: the adequacy of suction sampling and pitfall trapping

    Directory of Open Access Journals (Sweden)

    Borges, P. A. V.

    2003-12-01

    Full Text Available Se han investigado las ventajas del uso combinado de técnicas de succión (Vortis y trampas de caída, a la hora de estimar la riqueza de especies de artrópodos en pastizales antrópicos y seminaturales de tres islas oceánicas de las Azores de origen geológico reciente. Se ha comprobado, además, la capacidad de las trampas de caída y de succión para describir la composición faunística y la riqueza de especies según distintos grupos taxonómicos y ecológicos. Teniendo en cuenta el porcentaje de especies colectado sobre el total estimado, ambas técnicas de muestreo resultaron fiables en lo que se refiere a su eficacia, ofreciendo buenas estimas de la riqueza de especies de artrópodos. Usando los dos métodos a la vez, se obtuvieron valores de eficacia cercanos al 90% para algunos grupos taxonómicos. Las técnicas de succión o de caída por separado fueron fiables para estimar la riqueza de especies de artrópodos predadores (todas las especies y arañas. Sin embargo, ambas técnicas son necesarias para conseguir estimaciones fiables en el caso de los grupos herbívoros. En términos de presencia-ausencia, los grupos que se alimentan de savia, los chupadores y los herbívoros masticadores mostraron diferentes patrones, con una proporción de colecta más alta en los primeros mediante las técnicas de succión, mientras que la mayoría de las especies masticadoras se pudieron colectar mediante las trampas de caída. Un patrón similar fue obtenido en el caso de las arañas, en donde las especies tejedoras fueron colectadas solo gracias a las técnicas de succión, mientras que la mayoría del resto de las especies se capturaron gracias al uso de trampas de caída. Se concluye que estos dos métodos de colecta deben considerarse complementarios y no alternativos. Por tanto, en estudios realizados en pastizales y sistemas agrícolas, se recomienda el uso simultáneo de ambas técnicas a fin de obtener estimas fiables de la riqueza de

  4. Genética de poplaciones de Atta sexdens rubropilosa (Hymenoptera: Formicidae POPULATION GENETICS OF Atta sexdens rubropilosa (HYMENOPTERA: FORMICIDAE

    Directory of Open Access Journals (Sweden)

    LIRIANA BELIZÁRIO CANTAGALLI

    2013-04-01

    Full Text Available La variabilidad genética de las hormigas Atta sexdens rubropilosa colectadas en cinco lugares distintos de Brasil fueron evaluados por la técnica PCR-RAPD. Un total de 15 primers produjeron 148 fragmentos, de los cuales 123 fueron polimórficos, lo que corresponden al 83,11 %. La estimación de la diversidad genética por el índice de Shannon fue 0,3836 y el desviación estándar fue de ± 0,2335. Estos valores demuestran una alta diversidad genética. El valor de G ST fue 0,2372 y ΦPT = 0,184 lo que indica que las poblaciones están moderadamente diferenciadas y que el 82 % de la variación obtenida se produce dentro de las poblaciones. Aunque la prueba de Mantel ha demostrado una correlación entre la distancia genética y geográfica se observó que Ivatuba e Itambé (33,8 km tiene una pequeña distancia geográfica y la mayor distancia genética. La distancia inferior genética fue estimada para Maringá e Ivatuba pero estas localidades cuentan con una distancia geográfica pequeña (42,3 km, lo que indica que no hay barreras para el apareamiento entre los reproductores en estas poblaciones. El alto valor de polimorfismo (83,11 % y la capacidad de emparejamiento entre las poblaciones presentes en las regiones estudiadas, indican que esta especie de hormiga cortadora está bien adaptada a la región, y deben ser desarrollados programas integrados de control si se convierten en plagas.The genetic variability of Atta sexdens rubropilosa leaf-cutting ants collected from five brazilian localities was evaluated with PCR-RAPD technique. We used 15 primers producing 148 fragments of which 123 (83.11 % contained polymorphisms. The estimated Shannon index was 0.3836 ± 0.2335 showing that these ants possess high genetic diversity. The G ST value was 0.2372 and ΦPT = 0.184, indicating that the analyzed populations are moderately differentiated and 82 % of the variation obtained occur within populations. Although Mantel's test had shown correlation

  5. Prevalence of hepatitis C virus and HIV infection among injection drug users in two Mexican cities bordering the U.S Prevalencia de los virus de la hepatitis C y de la inmunodeficiencia humana entre usuarios de drogas intravenosas, en dos ciudades mexicanas fronterizas con los Estados Unidos de America

    Directory of Open Access Journals (Sweden)

    Emily Faye White

    2007-06-01

    muestra de sangre venosa fue colectada de cada individuo, para determinar la presencia de anticuerpos contra VIH y VHC mediante técnicas inmunoenzimáticas. En el caso del VIH la técnica de "Western blot" se aplicó con fines de confirmación. La prevalencia final de anticuerpos contra VHC se hizo mediante un cálculo ajustado, que empleó un estimador poblacional del RDS. RESULTADOS: Las seroprevalencias globales de VHC y VIH, fueron 96% y 2.8%, respectivamente. Estas frecuencias fueron similares entre las muestras de ambas ciudades. La gran mayoría de los UDI (87.5% manifestó haber transferido a otros sus equipos de inyección usados y a su vez 85.9% de los participantes declaró haber recibido equipos usados de otros. CONCLUSIONES: La seroprevalencia encontrada de VIH fue relativamente alta dada la prevalencia de VIH en la población general y la de VHC fue extremadamente alta entre los UDI estudiados en Tijuana y en Ciudad Juárez. Las prácticas frecuentes de compartimiento de equipo señalan hacia un alto potencial que favorece la transmisión de ambas infecciones investigadas. Por tanto, son necesarias actividades de consejería y pruebas de laboratorio para VHC dirigidas a UDI en México y asimismo intervenciones para reducir el uso compartido de equipos de inyección.

  6. Susceptibilidad y mecanismos de resistencia a insecticidas en Anopheles albimanus del sur de la Península de Yucatán, México Susceptibility and inseticide resistance mechanisms in Anopheles albimanus from the southern Yucatan Peninsula, Mexico

    Directory of Open Access Journals (Sweden)

    Felipe A. Dzul

    2007-08-01

    Full Text Available OBJETIVOS: Diagnosticar la resistencia a insecticidas y sus mecanismos en Anopheles albimanus del sur de la Península de Yucatán (PY, México. MATERIAL Y MÉTODOS: La F1 de An. albimanus colectados durante noviembre-diciembre de 2005 en seis localidades de los municipios Othón P. Blanco en Quintana Roo y Calakmul en Campeche, fue sometida a pruebas de susceptibilidad con deltametrina, DDT, pirimifos metil y bendiocarb, y a pruebas bioquímicas para calcular los niveles de las enzimas involucradas en la resistencia. RESULTADOS: An. albimanus fue resistente al DDT y a deltametrina en las seis localidades con niveles elevados de glutatión S-transferasas (GSTs, monooxigenasas y esterasas, y a pirimifos metil en La Unión con una alta frecuencia de la acetilcolinesterasa (AChE alterada. CONCLUSIÓN: Las poblaciones de An. albimanus colectadas al sur de la PY son resistentes al DDT y deltametrina, y en La Unión además al pirimifos metil, con mecanismos basados en la AChE alterada para el pirimifos metil, GST para DDT, y monooxigenasas y esterasas para piretroides. Los resultados del presente estudio tienen importantes consecuencias prácticas para el control químico de An. albimanus en el sur de la PY.OBJECTIVE: To diagnose susceptibility levels and insecticide resistance mechanisms in Anopheles albimanus from the southern Yucatan Peninsula (YP, Mexico. MATERIAL AND METHODS: F1 generation of An. albimanus females, collected from November to December 2005 in six villages in the Othon P. Blanco municipality in Quintana Roo and the Calakmul municipality in Campeche, were exposed to deltamethrin, DDT, pirimiphos-methyl and bendiocarb in susceptibility tests, as well as to biochemical assays in order to calculate the enzyme levels related to insecticide resistance. RESULTS: High levels of DDT and deltamethrin resistance were found in An. albimanus collected from the six villages, and a high resistance to pirimiphos-methyl was found in those from La

  7. Caracterización morfológica de accesiones silvestres de guayaba Morphologic characterization of wild accesions of guava

    Directory of Open Access Journals (Sweden)

    Liliana Jiménez Lozano

    2009-04-01

    Full Text Available Se realizó la caracterización morfológica de 22 accesiones silvestres de guayaba Psidium guajava L. 14 colectadas en el municipio de Restrepo (Valle del Cauca, seis en Armenia (Quindío y dos en Pereira (Risaralda. Se utilizaron 12 descriptores cuantitativos y 10 cualitativos de tallo, hojas y frutos; el análisis de agrupamiento se hizo mediante el coeficiente de Dice-Nei-Li y el promedio aritmético no ponderado (UPGMA. La mayor variabilidad se halló en los descriptores peso de la pulpa (CV = 55.92%, peso (CV = 45.23%, y acidez del fruto (CV = 44.75%. El análisis de agrupamientos con base en caracteres cuantitativos permitió establecer cuatro grupos: las accesiones del grupo A (Armenia, presentaron valores promedio de los descriptores de la calidad del fruto (grados Brix, acidez del fruto y relación grados Brix/acidez y valores altos de contenido de pulpa. La mayoría de accesiones del grupo C (Restrepo tuvieron altos valores de calidad del fruto y bajo contenido de pulpa. El grupo B, constituido por accesiones de Armenia y Pereira, se diferenció por valores bajos en los descriptores de rendimiento del fruto (peso del fruto, de la pulpa y diámetro de la cavidad seminal. Las accesiones del grupo D (Restrepo mostraron valores promedios en calidad y rendimiento del fruto. Los descriptores cuantitativos se reunieron en tres variables sintéticas para rendimiento y calidad del fruto que representaron 76.86% de la variabilidad total.Quantitative and qualitative morphologic characterization of 22 wild accessions of guava Psidium guajava L. collected in Restrepo (Valle del Cauca, Armenia (Quindío and Pereira (Risaralda was done. Twelve (12 quantitative and ten (10 qualitative descriptors of stem, leaves and fruits were used. The Dice- Nei Li coefficient and the UPGMA was used for the cluster analysis. Dendrograms and principal components analysis were used. The highest variability was associated with fruit descriptors, pulp weight (CV = 55

  8. Colect and Morphologic characterization of samples of blacberry Rubus spp of the producing zones of Valley, Cauca and Nariño departaments. Caracterización morfológica de mora en los departamentos del Valle del Cauca, Cauca y Nariño

    Directory of Open Access Journals (Sweden)

    Muñoz Flores Jaime Eduardo

    2007-06-01

    Full Text Available 36 materials of blackberry were collected belonging to three species: Rubus glaucus, Rubus urticifolius and Rubus robustus. The qualitative morphologic characterization identified the three collected species and the describers were generated that allowed to identify in leaves: form, type, margin, apex, color of leaf, and in steam presence of antocianinas and serosity.    The quantitative morphologic characterization allowed to identify characteristic of commercial importance in two materials of the Collection: 3 and 31, with a high fruit weight, few thorns in the stem and high Brix degrees, characters that give them potential so much for the market in fresh as frozen. In the multivaried analysis of the quantitative characters of steam and fruit 5 groups were obtained, mainly the variability of them was get for entrenudos distance, length of pedicels in male branch, length of petioles in female and male branch, wide of leaf, fruit weight, length of the heart of the fruit and number of drupes. The morphologic and molecular characterization was complementary for the study of the present variability in the Collection of Rubus spp. 

    Se colectaron 36 materiales de mora pertenecientes a tres especies: Rubus glaucus, Rubus urticifolius y Rubus robustus. La caracterización morfológica cualitativa identificó las 3 especies colectadas y se generaron los descriptores que permitieron identificar en hojas: forma, tipo, margen, ápice, color del envés, y en tallo presencia de antocianinas y serosidad. Molecular biology, a tool for bioprospection of plants secondary metabolism in Colombia Biología molecular, una herramienta para la bioprospección del metabolismo secundario de plantas en Colombia Ejemplo práctico en plantas colombianas de interés medicinal

    Directory of Open Access Journals (Sweden)

    Burtin Daniel

    2004-12-01

    ético, es aún limitado. Dentro de las estrategias de bioprospección de la diversidad de muchos países tropicales como Colombia, la exploración y explotación del metabolismo secundario de plantas constituye un reglón importante. En el presente trabajo se reporta una metodología experimental basada en el aislamiento de ADN genómico de plantas colectadas en campo, y el uso de cebadores degenerados empleados en la amplificación en cadena de la polimerasa (PCR para identificar genes que codifican enzimas decarboxilasas dependientes de piridoxal. Estas enzimas están involucradas en la vía metabólica para la síntesis de alcaloides. Basados en la homología de secuencias reportadas en las bases de datos, se diseñaron cebadores degenerados para amplificar secuencias conservadas de estas enzimas en 18 familias de plantas diferentes. Se obtuvieron seis secuencias obtenidas de plantas del género Piper sp. Este reporte demuestra el potencial uso de ésta y otras metodologías actuales para aumentar el conocimiento, entendimiento y exploración del metabolismo secundario de las plantas de Colombia. Palabras clave: bioprospección, metabolismo secundario, cebadores degenerados, microarreglos, decarboxilasas dependientes de piridoxal.

  9. Urban contamination with zoonotic parasites in the central region of Argentina Contaminación urbana con parásitos zoonóticos en la región central de la Argentina

    Directory of Open Access Journals (Sweden)

    Ubaldo O. Martín

    2008-10-01

    Full Text Available Adult worms develop in dogs and their eggs are shed in the feces. Non-embryonated eggs of Toxocara canis become infectious after about 2-6 weeks in the soil and the likelihood of their transmission to humans is through ingestion. In 2004 studies were carried out in the areas of urban recreation in the central region of Argentina. A total of 393 dog excrement samples were collected in eight different cities: 59.3 per cent were positive for parasites. These areas of urban recreation are contaminated with zoonotic parasites in the cities of Paraná (19 of 24 areas, Santa Fe (20 of 26, and Santo Tomé (14 of 18. Eggs of T. canis were present in 101 of 393 (25.7% of the excrement samples, and eggs could be found in 53 of the 68 (77.9% areas of urban recreation studied in these cities. This contamination is greater in areas of lower socio-economic conditions. The object of this paper is to discuss markers of parasitic contamination with the aim of triggering the necessary control measures.Uno de los parásitos de cánidos de riesgo para la salud de los niños es el Toxocara canis. Las formas adultas y sus huevos no embrionados son liberados con las heces al medio ambiente. Después de aproximadamente dos semanas en el suelo, los huevos se transforman en infectivos y su ingestión por el ser humano puede provocar una infección parasitaria. En primavera y otoño de 2004, se llevaron a cabo estudios en áreas urbanas de recreación en una amplia zona geográfica de la Región Centro de la Argentina. Un total de 393 muestras de heces de canes fueron colectadas y analizadas en ocho ciudades; 59.3% de esas muestras fueron positivas para otros parásitos, además del T. canis. Las áreas de recreación pública de las ciudades demográficamente más importantes mostraron resultados positivos para parásitos zoonóticos en 19 de 24 áreas en Paraná, 20 de 26 en Santa Fe y 14 de 18 en Santo Tomé, es decir 53 de 68 (77.9%. Se encontraron huevos de T. canis

  10. Contaminación fecal canina en plazas y veredas de Buenos Aires, 1991-2006 Dog fouling and helminth contamination in parks and sidewalks of Buenos Aires City, 1991-2006

    Directory of Open Access Journals (Sweden)

    Diana Rubel

    2010-08-01

    Full Text Available El objetivo del trabajo fue presentar y analizar los datos de contaminación fecal canina y parasitaria en plazas y veredas de Buenos Aires obtenidos entre 1991 y 2006 por la Cátedra Parasitología General (Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires. Se censaron las heces en varias plazas cada año en un único día entre 1991-2006. A partir del año 2000 se censaron heces en veredas circundantes. En cada plaza se seleccionaron al azar 30 heces frescas que se conservaron en formol 5% para su análisis parasitológico por el método de flotación de Willis con solución saturada de ClNa. Los 51 censos presentaron una mediana de heces de 288; un 82% de las heces se observaron en los canteros de tierra o pasto. La contaminación fecal en las plazas fue mayor en el período 2000-06 que en el anterior (p = 0.0000. La contaminación fecal de las plazas aumentó con la densidad humana en las manzanas lindantes (p = 0.0076. Las veredas mostraron un patrón inverso, ya que la contaminación fecal fue mayor en las áreas menos densamente pobladas (p = 0.0000. Se detectaron parásitos en un número variable de las heces colectadas en todas las plazas. Los géneros más frecuentes fueron Ancylostoma (20.47%, Trichuris (2.59% y Toxocara (1.70%. Nuestros resultados indican un aumento en la contaminación fecal de las plazas, posiblemente asociado con el aumento del número de perros en la ciudad combinado con las deficiencias en la implementación y el seguimiento de las medidas de control.The aim of this study was to provide data on canine fecal and helminthic contamination from parks and sidewalks in Buenos Aires City, collected by the Laboratory of General Parasitology, School of Sciences, University of Buenos Aires. A census of dog feces was performed in 1-11 parks per year between 1991 and 2006, a single day each year. In the period 2000-2006, the census included feces on sidewalks surrounding the park. Thirty fresh fecal

  11. Estudio comparativo de la frecuencia de micronúcleos y anormalidades nucleares en eritrocitos de tres especies ícticas Comparative studies of the frequency of micronuclei and nuclear abnormalities in erythrocytes of three species fishes

    Directory of Open Access Journals (Sweden)

    Favio E Pollo

    2012-12-01

    Full Text Available Los ecosistemas acuáticos cercanos a las zonas urbanas sufren un deterioro constante ocasionado por diversos factores físico-químicos relacionados con la actividad antrópica, representando un riesgo para los organismos que los habitan, en especial los peces. Estos efectos pueden ser biomonitoreados mediante técnicas de amplia utilización, como el Test de Micronúcleos (Mn y el de Anormalidades nucleares (AN, entre otros. El objetivo de este trabajo fue verifcar y comparar la frecuencia de micronúcleos y anormalidades nucleares en tres especies ícticas colectadas en un lago urbano, Cyprinus carpio, Astyanax eigenmanniorum y Cheirodon interruptus. Luego de la captura y anestesia de los peces, se extrajo de cada individuo una muestra de sangre y se registró el peso y la longitud total. Las muestras fueron fjadas y luego teñidas con Giemsa al 10%, posteriormente se las analizó con microscopio (1000X y se les tomaron fotografías con cámara digital. Se calculó, además, el índice de condición corporal (K para cada uno de los ejemplares capturados. Se aplicó un análisis de correlación de rangos de Spearman (rs entre frecuencia de Mn y AN vs K para cada especie. La prueba de Kruskal-Wallis se aplicó para evaluar diferencias de Mn y AN entre las especies. Los resultados no mostraron una correlación estadísticamente signifcativa (P> 0,05 entre las frecuencias de Mn y AN vs K. Las frecuencias de Mn entre las diferentes especies no arrojaron diferencias signifcativas (P> 0,05, mientras que las AN sí (PAquatic ecosystems near urban areas suffer a steady deterioration caused by physical and chemical factors related to human activity, representing a danger to organisms that inhabit them, especially the fsh. These effects may be biomonitored by widely used techniques, such as the Micronucleus Test (Mn and Nuclear Abnormalities (NA, among others. The aim of this study was to verify and compare the frequency of micronuclei and nuclear

  12. Efecto de la heparina en la capacidad fecundante in vitro de espermatozoides caprinos Effect of heparin on the in vitro fertilizing ability of goat spermatozoa as assessed by heterologous solubilized zona pellucidae

    Directory of Open Access Journals (Sweden)

    J.F. COX

    1997-01-01

    Full Text Available El presente estudio está destinado a establecer la etapa del proceso de fecundación en que la heparina ejerce el efecto estimulatorio de la fecundación en caprinos. Oocitos bovinos fueron madurados en medio 199 y alternativamente utilizados para la producción de zonas pelúcidas solubilizadas o para estudios de fecundación. Las zonas pelúcidas, colectadas eliminando mecánicamente al oocito, fueron solubilizadas en ácido acético, liofilizadas y almacenadas a -20° C, hasta su reconstitución. Los espermatozoides fueron colectados con vagina artificial, lavados y capacitados por incubación en medio Talp con suero y heparina. En el Experimento 1, los espermatozoides fueron suspendidos en Talp más heparina, Talp más heparina y zonas pelúcidas o en condiciones no capacitantes y fueron incubados por 90 min a 39° C y 5% de CO2 en aire. En el Experimento 2, los espermatozoides agrupados como en el experimento anterior fueron coincubados por 18 h con oocitos. En el Experimento 3, los espermatozoides fueron suspendidos en plasma seminal y Talp con y sin heparina e incubados por 90 min a los 0, 45 y 90 min, muestras de suspensión fueron expuestas a zonas solubilizadas e incubadas por otros 30 min. En los experimentos 1 y 3, el daño acrosomal fue evaluado usando la tinción PI/PSA y en el Experimento 2, la fecundación fue verificada por la presencia de pronúcleos y cola espermática en el oocito. Los resultados en el Experimento 1 muestran que a los 90 min de incubación el daño acrosomal aumenta en los espermios tratados con zonas en relación a los controles (PHeparin has been shown to improve the fertilizing ability of goat spermatozoa in a dose-dependent manner. The present study assessed the mechanism involved in the stimulatory effect by using solubilized zona pellucidae from bovines. Bovine cumulus-oocyte complexes were matured in 199 plus serum and insuline. Thereafter, oocytes were denuded from granulosa cells and used either to

  13. A trajetória de uma enfermeira: Neuza Aparecida Ramos La trayectoria de una enfemrera: Neuza Aprecida Ramos The trajectory of a nurse: Neuza Aparecida Ramos

    Directory of Open Access Journals (Sweden)

    Juliana Rodrigues

    2009-06-01

    Full Text Available Estudo histórico-social com os objetivos de: contribuir para o banco de dados do Centro Histórico-Cultural da Enfermagem Ibero-Americana, incorporando ao acervo mais uma entrevista gravada com enfermeira; recuperar parte da História da Enfermagem do Paraná; e, ajudar na sua divulgação. Utilizou a história oral de vida, o qual possibilitou, por meio de entrevista, captar a experiência de vida e de trabalho da enfermeira Neuza Aparecida Ramos. Os dados foram classificados nas seguintes categorias: Trajetória profissional, O trabalho em Curitiba, Atividades desenvolvidas, Desafios, Atribuições recebidas e sua visão pessoal sobre o futuro da profissão. Este trabalho possibilitou resgatar a história de vida de uma testemunha ocular de fatos importantes da História da Enfermagem Brasileira e do Paraná.Se trata de un estudio histórico-social con los objetivos de: contribuir para el banco de datos del Centro Histórico-Cultural de la Enfermería Ibero-Americana, incorporando más una entrevista grabada con enfermera; recuperar parte de la Historia de la Enfermería del Paraná, y; ayudar su divulgación. Se utilizó la Historia oral de vida, que posibilita conocer la trayectoria seguida por la licenciada enfermera Neuza Aparecida Ramos, como persona y como profesional. La Historia oral de vida de este personaje fue colectada por medio de entrevista para obtener su experiencia de vida, de trabajo como enfermera y en el liderazgo ejercido en el campo educacional. Los datos colectados fueron clasificados en las siguientes categorías: trayectoria profesional, el trabajo en Curitiba, actividades desempeñadas, desafíos, atribuciones recibidas y su visión personal sobre el futuro de la profesión. Este trabajo posibilitó rescatar la historia de vida de una testigo ocular de hechos importantes de la Historia de la Enfermería Brasileña y del Paraná.This historical-social study aims at: contributing to the Data bank of the Historical

  14. Asymptomatic infections by diarrheagenic Escherichia coli in children from Misiones, Argentina, during the first twenty months of their lives Infecções assintomáticas por Escherichia coli causadoras de diarréias em crianças de Misiones, Argentina durante os primeiros vinte meses de vida

    Directory of Open Access Journals (Sweden)

    Marina QUIROGA

    2000-02-01

    Full Text Available Diarrheagenics Escherichia coli are the major agents involved in diarrheal disease in developing countries. The aim of this study was to evaluate the time of appearance of the first asymptomatic infection by the different categories of diarrheagenic E. coli in 44 children since their birth and during the first 20 months of their lives. In all of the children studied, we detected at least one category of diarrheagenic E. coli through the 20 months of the study. 510 diarrheagenic E. coli (33.5% were obtained from the 1,524 samples collected from the 44 children during the time of the study (31.4% EAggEC, 28.8% EPEC, 27.1% DAEC, and 12.7% ETEC. Neither EHEC nor EIEC were identified. The median age for diarrheagenic E. coli colonization was 7.5 months. The mean weaning period was 12.8 months and the mean age for introduction of mixed feeding (breast fed supplemented was 3.8 months. A significantly lower incidence of diarrheal disease and asymptomatic infections was recorded among the exclusively breast-fed rather than in the supplemented and non breast-fed infants. For ETEC, EPEC and EAggEC the introduction of weaning foods and complete termination of breast-feeding were associated with an increase of asymptomatic infections.E. coli é o principal agente envolvido na produção de diarréias nos países em desenvolvimento. O objetivo deste estudo foi avaliar o tempo de aparição da primeira infecção assintomática pelas diferentes categorias de E. coli causadoras de diarréias em 44 crianças desde o nascimento e durante os primeiros 20 meses de vida. Em todas as crianças estudadas foram detectadas algumas categorias de E. coli causadoras de diarréia ao longo dos 20 meses do estudo. Durante o estudo foram obtidas 510 E. coli causadoras de diarréia (33,5% a partir das 1524 amostras colectadas das 44 crianças (31,4% EAggEC, 28,8% EPEC, 27,1%DAEC e 12,7% ETEC. Não foram detectadas nem EHEC e nem EIEC. A idade média para a colonização pelas E

  15. Actividad molusquicida del Piquerol A aislado de Piqueria trinervia (compositae sobre ocho especies de caracoles pulmonados The molluscicide activity of Piquerol A isolated from Piqueria trinervia (Compositae against eight species of pulmonate snails

    Directory of Open Access Journals (Sweden)

    Alejandro Cruz-Reys

    1989-03-01

    Full Text Available De las partes aéreas de la planta Piqueria trinervia (Compositae colectada en diveresas áereas de México, se aisló el Piquerol A. Este compuesto se probó como agente molusquicida contra ocho especies de caracoles pulmonados: Fossaria (Fossaria humilis, F. (Bakerilymnae sp., Pseudosuccinea columella, Stagnicola attenuata, de México; F. (B. cubensis y Physacubensis, de Cuba; P. Columella y Biomphalaria glabrata, de Brasil; B glabrata, de Puerto Rico; S. elodes, de Estados Unidos. Se utilizaron tres concentraciones 50, 25 y 5 ppm para cada una de las especies y 2 períodos de exposición, 6 y 24 horas, a 20-22ºC. En 50 ppm, después de 6 horas, y 25 ppm, después de 24 horas los ejemplares de todas las especies murieron. En 5 ppm después de 24 horas, se observaron mortalidades de 60 a 100%. En ningún caso se observó recuperación después de la exposición por 24 horas. El piquerol A es un terpeno biodegradable que presenta otras actividades biológicas. No se han hecho pruebas de toxicidad en otros animales ni pruebas de campo. Sin embargo, es una substacia con alto potencial de uso como molusquicida en zonas de transmisión focal. Es la primera que en México se hacen estudios sistemáticos sobre molusquicidas de origen vegetal.In laboratory trials an aqueous solution of Piquerol A from Piqueria trinervia, collected in several regions of Mexico, showed a molluscicide action on the adults of eight different pulmonates snails species. Fossaria (Fossaria humilis, F. (Bakerilymnaea sp., Pseudosuccinea columella and Stagnicola attenuata from Mexico; F. (B. cubensis and Physa cubensis from Cuba; P. columella and Biomphalaria glabrata from Brazil; B. glabrata from Puerto Rico; and S. elodes from USA. The solution was tested at 50, 25 and 5 ppm concentration, for two periods of 6 and 24 hours, at room temperature (20-22ºC. A 100% mortality was obtained for all species at 50 ppm concentration after 6 hours of exposure; the same percentage at 25

  16. Condensed Tannin Concentrations of Three Lotus Species Grown in Different Environments Contenido de Taninos Condensados en Germoplasma de Tres Especies del Género Lotus en Diferentes Ambientes

    Directory of Open Access Journals (Sweden)

    Hernán Acuña

    2008-03-01

    tenuis Waldst. & Kit. ex Willd. (Lt y 22 accesiones de Lotus uliginosus Schkuhr. (Lu, colectadas en Chile entre los 32° y 38° lat. S, y 36° y 46° lat. S, respectivamente. Los experimentos, en un diseño de bloques completos al azar con dos repeticiones, fueron establecidos en otoño de 1998 en cinco diferentes ambientes en la zona centro sur de Chile (suelo arcilloso, suelo arenoso y tres suelos volcánicos con diferentes niveles de humedad disponible. El muestreo se hizo en primavera-verano de 1999-2000, cuando las plantas estaban en plena floración. Se encontraron diferencias significativas entre cultivares o accesiones, dentro de cada localidad, en concentración de TC totales y/o en sus fracciones extractables o ligados a la proteína o a la fibra. Se encontró alta variabilidad entre genotipos de Lc (rango 4,7-8,7% de TC totales, media 6,1% y de Lu (rango 6,3-11,0% de TC totales, media 8,2%. En Lt la variabilidad entre accesiones fue muy baja y la media fue 4,8% de TC totales, más alta que lo informado por la literatura. Estos resultados contribuirán a la selección de genotipos para programas de mejoramiento genético de estas especies

  17. Flora asociada a la actividad melífera en apiarios al sur del departamento del Huila, macizo colombiano

    Directory of Open Access Journals (Sweden)

    Rudas Lleras Agustín

    2006-12-01

    Full Text Available Este trabajo hace parte del proyecto “Diversificación de zonas de ladera con productos de alto valor: mieles
    especieles”, desarrollado por el Instituto Humboldt, el Centro Internacional de Agricultura Tropical, la Universidad Nacional de Colombia y la Corporación Autónoma Regional del Alto Magdalena, que pretende fortalecer cadenas productivas alternativas para el sustento de los campesinos de zonas cafeteras del Macizo
    Colombiano. Se caracterizó la flora aledaña a cuatro apiarios localizados en los municipios La Argentina,
    Palestina y Pitalito del sur del departamento del Huila y se establecieron los elementos florísticos más importantes
    para la actividad melífera. El reconocimiento florístico se realizó en el radio de un kilómetro, alrededor de los apiarios y mediante colecciones botánicas en todas las coberturas vegetales y ambientes hallados. En total se visitaron 44 sitios entre septiembre y noviembre de 2005. Se colectaron 1.091 especímenes correspondientes
    a 657 especies y 112 familias. La familias con mayor número de especies fueron Asteraceae, seguida por Fabaceae s l y Poaceae; se encontró una riqueza alta a nivel de familia y especie, lo que se relacionó con la
    existencia de numerosos tipos y manejos de cobertura vegetal, usos del suelo y una frecuente intervención
    humana. Se encontraron especies de rara distribución en Colombia y otras poco colectadas, lo que soporta la
    idea de la baja exploración frente a la alta riqueza que actualmente presenta la flora del Macizo Colombiano.
    Se determinaron 135 de las especies como melíferas, la mayoría pertenecientes a las familias Asteraceae, Fabaceae s l y Lamiaceae. Se hallaron 87 especies melíferas en La Argentina, 57 en Palestina y 43 en Pitalito. Seis de las especies melíferas encontradas se establecieron como las más importantes por presentar los mayores índices de importancia ecológica (Saurauia aromatica, Cuphea

  18. Botanical Composition of Alpaca (Lama pacos Linn. Diet in a Central Mediterranean Range of Chile Composición Botánica de la Dieta de Alpaca (Lama pacos Linn. en un Pastizal del Secano Mediterráneo de la Zona Central de Chile

    Directory of Open Access Journals (Sweden)

    G Castellaro

    2008-06-01

    composición botánica de la dieta fue estimada mediante la técnica microhistológica, utilizando muestras de fecas colectadas directamente del recto de los animales. Las especies más consumidas en el período vegetativo fueron las poáceas anuales y perennes. En el período reproductivo, las especies leñosas, poáceas anuales y dicotiledóneas herbáceas fueron los componentes más importantes de la dieta. En el período seco, la dieta estuvo constituida en un alto porcentaje por especies leñosas.

  19. Visitantes florales nocturnos del girasol (Helianthus annuus, Asterales: Asteraceae en la Argentina Nocturnal floral visitors of sunflower (Helianthus annuus, Asterales: Asteraceae in Argentina

    Directory of Open Access Journals (Sweden)

    Juan P Torretta

    2009-12-01

    Full Text Available El girasol (Helianthus annuus es un cultivo oleaginoso, polinizado por Apis mellifera L. y otras abejas en distintas regiones del mundo. Sin embargo, sus flores también son visitadas por insectos de actividad nocturna. Durante tres campañas agrícolas, se determinó la diversidad de los visitantes nocturnos de capítulos de girasol, en cinco sitios de Argentina. También se estudió el comportamiento de forrajeo de los principales visitantes y la variación de la receptividad estigmática a lo largo del día, con el fin de establecer si estos visitantes contribuyen a la polinización. Al menos 67 especies o morfoespecies pertenecientes a cuatro órdenes de visitantes nocturnos fueron colectadas. El orden más rico y abundante fue Lepidoptera (44 especies o morfoespecies, cinco familias, seguido por Coleoptera (18 especies o morfoespecies, nueve familias, Orthoptera (tres morfoespecies, una familia y Blattaria (dos especies, una familia. Los lepidópteros forrajearon exclusivamente por néctar, mientras que los individuos de los demás órdenes consumieron polen y/o partes florales. El estigma se encontró receptivo durante las horas de luz, con una receptividad máxima al mediodía (12:00 - 14:00. Llamativamente, las flores del girasol son visitadas por mayor número de polillas que de abejas. Debido a que las polillas consumen néctar y potencialmente transportan polen entre flores, en un momento del día en que los estigmas se encuentran menos receptivos, es improbable que polinicen efectivamente el cultivo.Sunflower (Helianthus annuus is an oilseed crop pollinated by Apis mellifera L. and other diurnal bees in different regions of the world. However, their flowers are also visited by insects active at night. During three agricultural years, the diversity of nocturnal visitors to sunflower heads was assessed in five different sites in Argentina. The foraging behavior of the main visitors as well as the stigmatic receptivity variations along

  1. Promoção da saúde no cenário religioso: possibilidades para o cuidado de enfermagem Promoción de la salud en un ambiente religioso: posibilidades para el cuidado de enfermería Health promotion in the religious scenario: opportunities for nursing care

    Directory of Open Access Journals (Sweden)

    Adriana Gomes Nogueira Ferreira

    2011-12-01

    Full Text Available Estudo qualitativo, do tipo documental, desenvolvido no primeiro semestre de 2008, objetivando descrever as práticas de promoção da saúde desenvolvidas no cenário religioso católico em município do interior do Ceará. As informações foram coletadas por meio de entrevistas áudio-gravadas, junto ao sacerdote responsável pela paróquia e a três coordenadores de projetos vinculados à Igreja Católica, selecionados a partir da identificação dos projetos com o pároco. Os resultados apontam que a promoção e educação em saúde estão presentes nas atividades desenvolvidas por voluntários no cenário religioso. A Igreja busca a mudança de atitude e adoção de comportamento saudável dos indivíduos, por meio de ações individuais e coletivas. Urge necessidade da inserção de profissionais de saúde para atuar neste cenário, fortalecendo-o como rede social de apoio, reduzindo gradativamente atividades assistenciais e intensificando aquelas voltadas à promoção da saúde, com apoio da Enfermagem, com vistas a aprimorar o cuidado à saúde neste cenário.Estudio cualitativo, de tipo documental, desarrollado en el primer semestre de 2008, con el objetivo de describir las prácticas de promoción de la salud desarrolladas en un ambiente religioso en municipio del interior de Ceará, Brasil. Las informaciones fueron colectadas por medio de entrevistas audio-grabadas, junto al sacerdote de la parroquia y tres coordinadores de proyectos. Los resultados indican que la promoción y educación en salud están presentes en las actividades desarrolladas por voluntarios en un ambiente religioso. La iglesia busca un cambio de actitud y la adopción de comportamientos saludables de los individuos, por medio de acciones individuales y colectivas. Urge la necesidad de inserción de profesionales de salud para actuar en este ambiente fortaleciéndolo como red social de apoyo, reduciendo actividades asistenciales e intensificando la promoción de

  2. CARACTERIZACIÓN SEROLÓGICA Y MOLECULAR DE POTYVIRUS ASOCIADOS A LA VIROSIS DEL TOMATE DE ÁRBOL EN ANTIOQUIA (COLOMBIA Serological and Molecular Characterization of Potyvirus Associated to the Viral Disease of Tamarillo in Antioquia (Colombia

    Directory of Open Access Journals (Sweden)

    MARILUZ AYALA VÁSQUEZ

    Full Text Available El tomate de árbol (Solanum betaceum es una fruta andina altamente nutritiva, con propiedades organolépticas únicas para el procesamiento industrial y el mercado internacional. En Antioquia, Colombia, este cultivo presenta diferentes problemas fitosanitarios, siendo especialmente limitante la Virosis, causada por un complejo viral del que hacen parte entre otras, especies del género Potyvirus. En este trabajo se evaluaron mediante pruebas de ELISA los niveles de incidencia de este grupo viral en cultivos de siete zonas del departamento de Antioquia y se determinó la identidad taxonómica de dos de los potyvirus asociados al cultivo. Las pruebas serológicas muestran la presencia de potyvirus en seis de las siete zonas evaluadas, alcanzando niveles superiores al 80% de incidencia, siendo la excepción los cultivos del municipio de Jardín (8%. Pruebas serológicas con anticuerpos específicos para PVY, identificaron a este virus como uno de los presentes en algunas de las muestras sintomáticas colectadas; mientras que análisis de secuencias de amplicones obtenidos mediante RT-PCR, detectaron un nuevo potyvirus, para el que se propone el nombre Tamarillo Leaf Malformation Virus (TaLMV, aunque es necesario completar la secuencia de su genoma para confirmar la validez de esta hipótesis taxonómica. Esta investigación representa un avance importante en el conocimiento que se tiene en Colombia sobre los agentes causales virales del tomate de árbol. Sin embargo, es necesario profundizar en aspectos como los mecanismos de transmisión de estos virus y los efectos individuales y de su interacción sobre las variedades de este cultivo en el país.Tomato tree (Solanum betaceum is an andean fruit which, due to its high nutricious value and unique organoleptic properties, has very good potential for industrial processing and international marketing. In Antioquia, Colombia, this crop faces several phytosanitary problems, of which viral infections by

  3. Epilithic diatoms (Bacillariophyceae as indicators of water quality in the Upper Lerma River, Mexico Diatomeas epilíticas como indicadores de la calidad del agua en la cuenca alta del río Lerma, México

    Directory of Open Access Journals (Sweden)

    Virginia Segura-García

    2012-04-01

    tratamiento de las aguas residuales, trae como consecuencia una elevada contaminación. Este trabajo abordó el estudio taxonómico y ecológico de diatomeas epilíticas colectadas en 11 localidades de ésta cuenca, entre los años 2003-2005. Se trata del primer estudio con una orientación ambiental que se realiza sobre diatomeas de la cuenca alta de este río, y la información generada permitirá proponer en el corto plazo un índice diatomológico para el Río Lerma (IDL, que posibilite emprender programas de monitoreo de la calidad del agua. Se reconocieron 178 especies, de las cuales 112 taxones (63 % fueron de amplia distribución. Los géneros con mayor número de especies fueron Nitzschia (34, Navicula (19, Gomphonema (15 y Pinnularia (11. Las especies dominantes en las localidades de estudio y en las épocas de recolecta fueron Eolimna subminuscula (Manguin Moser, Lange-Bertalot et Metzeltin, Gomphonema parvulum (Kützing Kützing, Navicula veneta Kützing, Nitzschia capitellata Hustedt, N. sublinearis Hustedt, N. umbonata (Ehrenberg Lange-Bertalot y Sellaphora pupula (Kützing Mereschkowsky, que se caracterizan por ser tolerantes a condiciones α-mesosapróbicas a polisapróbicas con alto contenido de nitrógeno. La distribución de las especies de diatomeas fueron explicadas por las variaciones en parámetros como profundidad, conductividad, pH, temperatura y sólidos disueltos totales.

  4. Chemical and isotopic study of thermal springs and gas discharges from Sierra de Chiapas, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Nencetti, A; Tassi, F; Vaselli, O [Department of Earth Sciences, Florence (Italy); Macias, J. L [Instituto de Geofisica, Universidad Nacional Autonoma de Mexico, D.F. (Mexico); Magro, G [CNR-Institute of Geosciences and Earth Resources, Pisa (Italy); Capaccioni, B [Institute of Volcanology and Geochemistry, Urbino (Italy); Minissale, A [CNR-Institute of Geosciences and Earth Resources, Florence (Italy); Mora, J. C [Instituto de Geofisica, Universidad Nacional Autonoma de Mexico, D.F. (Mexico)

    2005-01-15

    (SDT <250mg/L). La mayoria de estas aguas estan asociadas con descargas de gas compuestas por N{sub 2} (hasta 93 % en vol.), CO{sub 2} (2.4-31.2 % en vol.) y Ar (hasta 1.25 % en vol.) con origen predominantemente meteorico. H{sub 2}S aparece unicamente en las muestras de gas colectadas en El Azufre (hasta 1.1 % en vol.). Los valores de {delta}{sup 1}3C-CO{sub 2} comunmente inferiores a -9.7% (PDB) sugieren un origen parcialmente biogenico del CO{sub 2}. Los parametros quimicos e isotopicos de los manantiales indican que la circulacion de fluidos en la Sierra de Chiapas se regula principalmente por la infiltracion de aguas meteoricas en rocas carbonatadas del Cretacico medio-tardio hasta las formaciones evaporiticas del Jurasico tardio-Cretacico temprano. Estas ultimas representan la fuente principal de las especies en solucion de las aguas. No se encontraron evidencias de la presencia de sistemas con entalpias medias a altas por debajo de la Sierra de Chiapas.

  5. Diversidad y aspectos biológicos de abejas silvestres de un ambiente urbano y otro natural de la región central de Santa Fe, Argentina Diversity and biological aspects of wild bees in an urban and a natural environment in the central region of Santa Fe, Argentina

    Directory of Open Access Journals (Sweden)

    Milagros Dalmazzo

    2010-06-01

    Full Text Available El objetivo del presente trabajo fue relevar el elenco de abejas silvestres en la región central de Santa Fe y comparar la diversidad de especies y aspectos biológicos en dos ambientes de una misma región. Las abejas fueron colectadas en el estrato herbáceo de la Reserva Universitaria "Escuela Granja" de la localidad Esperanza, y en la zona urbana de la localidad Susana, ambas ubicadas dentro de la Provincia Fitogeográfica del Espinal. La colecta se realizó en octubre, noviembre y diciembre de 2004 y en enero, febrero y marzo de 2005, registrando las especies vegetales sobre las que se capturaron. Se colectaron 277 ejemplares en total, de los cuales se identificaron 62 especies (27 géneros en 5 familias. Las curvas de rarefacción indican una tasa de acumulación de especies mayor para la Reserva Ecológica, los índices de diversidad de Shannon son 3,25 para la Reserva Ecológica y 2,64 para la Zona Urbana. Para la comparación de las comunidades en ambos sitios, las abejas fueron clasificadas en tres categorías según la especialización en el uso del recurso floral, sustrato de nidificación y comportamiento social. Se observó una asociación entre los grupos especialistas y de nidificación en el suelo con el ambiente natural, y por otro lado, las especies generalistas y de nidificación en cavidades con el ambiente urbano. No se identificaron diferencias, en cuanto a la sociabilidad de las especies, entre ambos sitios.The purpose of this contribution is to present a survey of wild bees in the central region of Santa Fe, and to compare the diversity and biological aspects of the bee communities at two different environments of the same region. Bees were surveyed at the ecological reserve Reserva Universitaria "Escuela Granja" in the locality of Esperanza, and at an urban area in the locality of Susana, both in the Espinal Phytogeographic Province. Bees were sampled from October to December 2004 and from January to March 2005

  6. Variación en la calidad del agua de riego en un huerto de cítricos The variation in the water quality in an orchard of citrus

    Directory of Open Access Journals (Sweden)

    Otávio A. de Almeida

    2006-03-01

    Full Text Available Con el objetivo de evaluar la variación en la calidad del agua de riego por goteo en un huerto de cítricos y sus consecuencias sobre el suelo y las plantas se realizó un ensayo en la finca "El Saladar", situada en la población de Sueca, Valencia, España. Durante toda la temporada del estudio se muestreó periódicamente las aguas de la A. R. del Júcar, del canal de conducción para el riego de arroz, y la utilizada para el riego de cítricos en la finca, en el sitio destinado a la captación, para determinar su calidad y su variación. También se hizo muestreo con la misma periodicidad del agua de drenaje, colectada en pozos de observaciones instalados en cada cuadrante del área del experimento. Considerando los resultados obtenidos, se puede concluir que la mezcla de las aguas de drenaje con el agua de la A. R. del Júcar, en general es clasificada como C3S1 y, según las directrices de la FAO, no presenta ningún grado de restricción de uso; Es posible la utilización de la mezcla de agua de buena calidad (P. ej. CE entre 1,18-1,43 dS m-1, RAS y RASº entre 1,37-1,81 y 1,74-2,43 (mmol c L-1½, con una agua de calidad dudosa (P. ej. CE entre 3,05-4,21 dS m-1, RAS y RASº entre 2,83-4,00 y 3,41-4,84 (mmol c L-1½, durante un largo periodo de tiempo, sin salinizar ni sodificar el suelo; La mezcla de agua utilizada en el riego de cítricos no influenció en el desarrollo de la planta.An experiment was carried out with the objective of evaluating the variation in the water quality in drip irrigation in an orchard of citrus and their consequences on the soil and plants at the farm "El Saladar", located in the population of "Sueca", Valencia, Spain. During the whole season of the study, the water of the A. R. of the Júcar used for citrus irrigation, were sampled from conveyance conduction channel for rice irrigation in order to determine water quality and its variation. Also the drainage water was sampled from observation wells installed in

  7. Control of San Jose Scale Nymphs, Diaspidiotus perniciosus (Comstock, on Almond and Apple Orchards with Pyriproxyfen, Phenoxycarb, Chlorpyrifos, and Mineral Oil Control de Ninfas de la Escama de San José, Diaspidiotus perniciosus (Comstock, en Almendros y Manzanos con Piriproxifen, Fenoxicarb, Clorpirifos y Aceite Mineral

    Directory of Open Access Journals (Sweden)

    Luis Sazo

    2008-09-01

    15 días después, y se las comparó con una aplicación de clorpirifos 0,08% en el biofix. Además, se evaluaron una y dos aplicaciones de aceite mineral 1%, la primera 7 días después del biofix y la segunda 15 días después de la primera aplicación. La evaluación se hizo en laboratorio al concluir el movimiento de ninfas de la primera generación, el 27 y 28 de diciembre en almendros y manzanos respectivamente, considerando el número de ninfas fijadas por metro lineal de nuevas ramillas colectadas desde sectores infestados, el porcentaje de manzanas infestadas y el número de escamas fijadas por fruto. Los resultados se sometieron a análisis de varianza y pruebas de rango múltiple de Duncan. Bajo condiciones de baja infestación, una aplicación de piriproxifen 0,07%, fenoxicarb 0,05%, o aceite mineral 1,0% en primavera redujo significativamente (P≤0,05 el número de ninfas fijadas en ramillas, en un efecto similar al de un tratamiento tradicional de clorpirifos 0,08%. Sin embargo, bajo infestaciones mayores, una aplicación de piriproxifen o aceite mineral en primavera fue insuficiente para el control de la ESJ.

  8. Efecto de las variantes genéticas sobre los parámetros enzimáticos de la butirilcolinesterasa humana

    Directory of Open Access Journals (Sweden)

    Jennifer Castro

    2016-06-01

    Full Text Available Introducción: Las enzimas colinesterasas humanas – acetilcolinesterasa (AChE y la butirilcolinesterasa (BChE – se presentan a lo largo de la mayoría de los principales sistemas de órganos en una variedad de seres vivos. La BChE es una alfa glicoproteína que hidroliza ésteres de colina, compuestos alifáticos y algunos fármacos. Esta enzima presenta gran cantidad de variantes genéticas – más de 100 variantes han sido identificadas, entre las más estudiadas se encuentra la variante Kalow (K, la cual es la más frecuentemente encontrada en varias poblaciones humanas. La actividad de la BChE se puede medir por diferentes métodos: colorimétricos, potenciométricos, entre otros. Uno de los  métodos más sencillos y económicos para medir la actividad colinesterasa es el potenciométrico de Michel. Este estudio busca identificar el efecto del polimorfismo rs1803274 (variante-K en los parámetros enzimáticos de la butirilcolinesterasa humana mediante el método potenciométrico de Michel. Objetivo: Determinar si la presencia del polimorfismo genético rs1803274 (BChE modifica los parámetros enzimáticos Vmax y Km de la butirilcolinesterasa humana. Materiales y Métodos: Se utilizaros 9 muestras de sangre de personas portadoras de la variante K (homocigotos y heterocigotos. Las muestras de sangre fueron colectadas en tubos de heparina. Para las determinaciones enzimáticas se empleó el método potenciométrico de Michel y se variaron las condiciones de reacción (pH, temperatura, concentración de sustrato y efecto de un inhibidor. Resultados: Se encontró una actividad enzimática menor cuando la variante-K estaba presente en la BChE en comparación con la enzima no polimórfica. Esta diferencia iba en aumento a medida que se incrementaba la temperatura del medio. Conclusiones: La disminución de la actividad enzimática portadora de la variante-K se correlacionó con los cambios de temperatura. Esto sugiere que la disminución de

  9. Genetic Relationships of Common Bean (Phaseolus vulgaris L. Race Chile with Wild Andean and Mesoamerican Germplasm Relaciones Genéticas entre el Germoplasma de Poroto (Phaseolus vulgaris L. Raza Chile y Silvestres Andinos y Mesoamericanos

    Directory of Open Access Journals (Sweden)

    Viviana Becerra V

    2011-03-01

    xico, Ecuador, Perú, Bolivia y Argentina y accesiones chilenas cultivadas pertenecientes a las principales clases comerciales chilenas (endémicas como son: Tórtola, Coscorrón, Sapito, Cuyano y otras clases comerciales (naturalizadas que se cultivan en el país como Frutilla, Bayo, Manteca, y Blanco Grande. Los resultados obtenidos indican la presencia un bajo nivel de polimorfísmo en ADNcp (23% y en ADNmt (24% en las accesiones silvestres y cultivadas chilenas. Algunas combinaciones de partidores-enzimas resultaron más eficientes que otras en detectar polimorfismo, lo mismo ocurrió con algunas enzimas específicas. Los materiales chilenos se presentaron estrechamente relacionados con las accesiones silvestres colectadas en Argentina, Bolivia y Perú indicando su origen andino. Las accesiones silvestres ecuatorianas se ubicaron en una posición intermedia entre las accesiones mesoamericanas y andinas analizadas.

  10. QUANTIFICATION OF COAL IN THE COLOMBIAN CARIBBEAN BEACHES (DEPARTMENT OF MAGDALENA

    Directory of Open Access Journals (Sweden)

    Julián Andrés García

    2013-11-01

    Full Text Available ABSTRACT To quantify the percentage of unburnt coal in beach sediments from the department of Magdalena,(Colombia a simple procedure was devised to separate the sediment mineral phases according to their density. Sediments were collected from six beaches, at two tidal heights, in November 2012 and February 2013, before and after a spill from a coal barge that occurred on 12 January 2013. Sediments were dried, suspended in an aqueous solution of sodium polytungstate (density: 2.0 g•cm-3 and centrifuged. Because coal has a lower density (1.2-1.9 g•cm-3 than other inorganic minerals and rocks, any coal particle present in a sample concentrated in the suspended fraction, whereas more dense particles settled. To remove organic matter not corresponding to coal, the light fraction was subsequently subjected to a weak oxidation with hydrogen peroxide. To estimate an upper limit for any coal present, weight loss on ignition at 550 °C was determined for whole sediments. For the six beaches examined, the maximum weight loss on ignition was 2.4 % and the weight percentage of the light fraction (with a density 3 g•cm-3, which comprise between 10-70 % of the total sediment dry weight. RESUMEN Con el fin de cuantificar el porcentaje de carbón mineral en playas del departamento del Magdalena, (Colombia se llevó a cabo un procedimiento sencillo para separar el sedimento en fracciones sedimentológicas de acuerdo a su densidad. Se utilizaron sedimentos provenientes de seis playas del departamento colectadas de dos niveles mareales en noviembre de 2012 y febrero de 2013, antes y después de un derrame de una barcaza de carbón, que ocurrió el 12 de enero de 2013. Los sedimentos fueron secados, suspendidos en una solución de sodio politungstato (densidad: 2,0 g·cm-3 y centrifugados. Ya que el carbón tiene una densidad menor (1,2-1,9 g·cm-3 que otros minerales inorgánicos, cualquier partícula de carbón presente en una muestra se concentró en la

  11. Resistencia a la flexión de la guadua Agustifolia kunt a escala natural.

    Directory of Open Access Journals (Sweden)

    González C Eugenia

    2002-12-01

    Full Text Available En los laboratorios de productos forestales y en el de construcciones rurales de la Universidad Nacional de Colombia Sede Medellín, se realizaron dieciocho (18 ensayos de flexión estática a escala natural con luces entre 2,50 y 3,50 metros de la sobrebasa del elemento, las cuales son las más utilizadas y recomendadas para este tipo de esfuerzo, donde el material seleccionado corresponde a la especie Guadua (Angustifolia kunth, colectada en la Finca Cotové ubicada en Santafé de Antioquia y cuya zona de vida corresponde a un bosque seco tropical (bs-t. Las pruebas fueron realizadas basadas en las Normas COPANT 455 (1972 para selección y colección de muestras de madera, 459 acondicionamiento de maderas destinadas a ensayos físicos y mecánicos y 460 para la determinación del contenido de humedad y las normas de la American Society for Testing and Materials, 1975. Estas normas son empleadas para maderas macizas, por lo tanto debieron ser ajustadas a las condiciones particulares de la guadua circular hueca de acuerdo a la metodología utilizada por González y Díaz 1992. Este trabajo presenta los resultados de las ecuaciones de diseños para elementos de guadua sometidos a flexión estática, los valores de esfuerzos unitarios en el límite proporcional (RLP, módulo de elasticidad (MOE y el esfuerzo de rotura (MOR, los cuales fueron comparados con los valores obtenidos por González y Días, 1.992, cuyos ensayos fueron hechos bajo probetas, obteniéndose variaciones menores del 7% entre estos, y a la vez se hallaron unos coeficientes de varianza con rangos entre el 20 y el 30% para los parámetros establecidos los cuales fueron considerados aceptables. Para la obtención de los parámetros anteriores se tuvieron en cuenta aspectos como la longitud, diámetro promedio, espesor de las paredes medidas en los extremos, el contenido de humedad en base seca y la carga de falla del elemento. Finalmente, se recomienda utilizar las ecuaciones de

  12. Variación estacional y potencial enzimático de microhongos asociados con la descomposición de hojarasca de Nothofagus pumilio Seasonal variation and enzymatic potential of microfungi associated with the decomposition of Nothofagus pumilio leaf litter

    Directory of Open Access Journals (Sweden)

    EDUARDO VALENZUELA

    2001-12-01

    Full Text Available Se estudió la variación estacional y el potencial enzimático de microhongos aislados desde el follaje y hojarasca de Nothofagus pumilio sometida a degradación natural durante 1 año. La investigación se realizó en un bosque de N. pumilio ubicado en una microcuenca del Valle de Antillanca, Parque Nacional Puyehue (40° 47' S, 72° 12' O, 1.120 m de altitud. Hojas senescentes colectadas desde árboles de N. pumilio se depositaron en bolsas de malla de nylon ("litter bags" y se sometieron a degradación natural en el piso del bosque durante 1 año (marzo 1997-marzo 1998, realizando muestreos trimestrales. Para el aislamiento de microhongos desde las hojas se utilizó el método de las diluciones, con agar extracto de malta al 2 % como medio de cultivo. Para determinar los potenciales degradativos de los aislamientos, se analizaron in vitro las actividades de amilasa, celulasa, pectinasa, proteasa, lacasa, oxidasa extracelular, peroxidasa, citocromo oxidasa, fosfatasa, esterasa y tirosinasa. Las principales especies aisladas en las hojas senescentes fueron Alternaria alternata, Cladosporium cladosporioides, Epicoccum nigrum, Phialophora grupo hoffmannii y Rhodotorula aurantiaca. Las especies dominantes en la hojarasca fueron Hormonema prunorum, Mortierella ramanniana var. angulispora, Penicillium para-herquei y Trichoderma polysporum. El mayor potencial enzimático lo exhibieron Moniliales y micelios estériles, mientras el menor Sphaeropsidales y levaduras. Las especies más activas fueron Alternaria alternata, Cladosporium cladosporioides, Hormonema prunorum y Phialophora malorum. Las actividades de celulasa y amilasa fueron las más importantes. De las enzimas ligninolíticas, oxidasa extracelular y peroxidasa presentaron los más elevados potenciales enzimáticosThe seasonal variation and enzymatic potential of microfungi isolated from senescent leaves and leaf litter of Nothofagus pumilio was studied. The study was performed in a N

  13. Catálogo ilustrado de frutos y semillas de la región subxerofítica de la Herrera (Mosquera, Cundinamarca, Colombia

    Directory of Open Access Journals (Sweden)

    Plazas Gamba Arcadio

    2004-12-01

    Full Text Available Dentro de los estudios realizados en el campo de la botánica, son muy pocos los enfocados en la morfología de los frutos y las semillas, dando como resultado que actualmente en Colombia, el conocimiento de estas estructuras para especies silvestres sea muy escaso. Por esta razón se
    realizó un estudio que pretendía caracterizar morfológicamente los frutos y las semillas de 50 especies pertenecientes a 46 géneros y 23 familias de dicotiledoneas silvestres encontradas en la región subxerofítica de La Herrera, en el sur occidente de Bogotá. Tanto los frutos y las semillas fueron descritos, se les tomaron fotos y se le realizó una ilustración científica. Para los frutos se utilizaron los criterios en los que agrupa los frutos de la dicotiledonias en diferentes tipos y subtipos. Así se obtuvieron dos grandes categorías, (simples y múltiples, nueve tipos (dos de frutos múltiples y siete de frutos simples y 17 subtipos, siendo el más predominante el tipo Nucoide, debido a la gran cantidad de plantas de la familia Asteraceae colectadas. Con el fin de poder determinar fácilmente una especie con el uso de los caracteres de los frutos y las semillas se elaboraron claves sinópticas y dicotómicas, además cada especie tiene una descripción general, sus nombres comunes, un breve párrafo donde se resaltan los caracteres más conspicuos de los frutos y las semillas y los nombres propuestos por Spjut (1994 y Roth (1977, para los tipos y subtipos de frutos encontrados. En el análisis de los caracteres morfológicos se encontró que para los frutos, la superficie y la presencia de estructuras florales persistentes son los caracteres más importantes en el momento de diferenciar las especies estudiadas, mientras que para las semillas los múltiples caracteres de la cubierta seminal y la presencia de alas o quillas prominentes, son los caracteres más destacados de estas estructuras. Teniendo en cuenta los caracteres morfológicos de los

  14. Caracterización molecular y cariológica de cuatro especies del Género Proechimys (Rodentia: echimyidae, en una colonia en cautiverio en el Instituto Nacional de Salud (Colombia

    Directory of Open Access Journals (Sweden)

    Fernando García Luis

    2004-12-01

    Full Text Available En el presente trabajo se realizó la caracterización cariológica y molecular de cuatro especies pertenecientes al género Proechimys, las cuales fueron colectadas en diferentes regiones de Colombia y posteriormente ubicadas en colonias en el Bioterio de Experimentación del Instituto Nacional de Salud-INS. El número estimado de especies varía según el criterio de diferentes autores lo cual reflejan la gran dificultad para establecer límites en Proechimys a sus taxones subordinados. En general, los caracteres morfológicos son la aproximación usual para evaluar las preguntas sistemáticas por la mayoría de mastozoólogos, pero ésto ha sido relativamente improductivo en Proechimys. Como consecuencia de las variaciones morfológicas presentadas en los individuos, varios autores se han centrado sobre este aspecto, buscando la manera más adecuada de establecer diferencias entre las especies y han recurrido a técnicas de tipo genético y molecular que
    permitan esclarecer la separación específica de los grupos. Para este trabajo la caracterización cariológica se llevó a cabo a partir de la técnica de cultivo de linfocitos de sangre periférica. La caracterización molecular se realizó a partir de un fragmento de 800 pares de bases del gen Citocromo B. Para la construcción de los árboles se utilizaron otras secuencias para Proechimys, disponibles en Genbank y se incluyeron secuencias suministradas, en calidad de préstamo, por el Doctor James Patton de la Universidad de California, Berkeley. Se confirmó, por medio de información cariológica y molecular, que los individuos de la colonia del INS pertenecen a cuatro especies diferentes las cuales fueron identificadas como: Proechimys chrysaeolus (departamento de Santander, P. sp. “Barinas” (departamento de Casanare, P. oconnelli (departamento de Casanare y P. canicollis (departamento de La Guajira. Los tiempos de divergencia obtenidos para las especies (entre 2,89
    MA y

  15. The diet of the South American sea lion (Otaria flavescens at Río Negro, Patagonia, Argentina, during the winter-spring period Dieta del lobo marino de un pelo sudamericano (Otaria flavescens en Río Negro, Patagonia, Argentina, durante el invierno y primavera

    Directory of Open Access Journals (Sweden)

    Raimundo L. Bustos

    2012-12-01

    Full Text Available The South American sea lion, Otaria flavescens (Shaw, 1800 population is steadily expanding along the Patagonian coast of Argentina in the last decades. However, little is known about the feeding ecology of the species in the area. The aim of this study was to analyze the food habits of O. flavescens from 91 scats collected at Río Negro province, during the winter and spring of 2005. Fish occurred in 96% of scats containing prey remains, followed by cephalopods (26%. Raneya brasiliensis (Kaup, 1856 was the most frequent and abundant species occurring in 58.6% of samples and constituting almost 50% of fish predated. Second in importance were Porichthys porosissimus (Cuvier, 1829 and Cynoscion guatucupa (Cuvier, 1830 in terms of occurrence (%FO 20.7 and numbers (29.6% respectively. The squid Loligo gahi (d'Orbigny, 1835 was the most frequent cephalopod prey (42.1%, whereas Octopus tehuelchus (d'Orbigny, 1834 was the most abundant (77%. The higher amount and diversity of prey found in the spring in comparison with the winter season might be related to a higher feeding activity of seals or to a seasonal increase in food availability in the area.La población del lobo marino de un pelo sudamericano Otaria flavescens (Shaw, 1800 ha experimentado un crecimiento continuo en las ultimas décadas en las costas de la Patagonia Argentina. Sin embargo, poco se conoce sobre la ecología trófica de la especie en el área. El objetivo de este estudio fue analizar los hábitos alimentarios de O. flavescens a partir de 91 fecas colectadas en la provincia de Río Negro, durante el invierno y la primavera del 2005. Los peces estuvieron presentes en el 96% de las fecas que contenían remanentes presas, seguidos por los cefalópodos (26%. Raneya brasiliensis (Kaup, 1856 fue la especie mas frecuente y abundante ocurriendo en el 58.6% de las muestras y constituyendo casi el 50% de los peces predados. Le siguieron en importancia Porichthys porosissimus (Cuvier, 1829 y

  16. Efecto de labranza, humedad y fertilización en el rendimiento de frijol y la patogenicidad de Macrophomina phaseolina (Tassi Goid Effects of tillage, moisture and fertilization on the yield of the common bean and the pathogenicity of Macrophomina phaseolina (Tassi Goid

    Directory of Open Access Journals (Sweden)

    Krystal Lira-Méndez

    2012-04-01

    Full Text Available El hongo Macrophomina phaseolina (Tassi Goid. causa la 'pudrición carbonosa' en frijol común (Phaseolus vulgaris L. y otros cultivos y afecta el crecimiento y el rendimiento de grano. En este trabajo se determinó el efecto de cuatro niveles de labranza (barbecho, destronque-bordeo, subsuelo-bordeo, cero, dos de humedad (temporal, riego y dos de fertilización (química, 40-20-00 NPK; biológica con la micorriza Glomus intraradices en el rendimiento de grano de la variedad Negro INIFAP en 2006 y 2007 en Río Bravo, México y en la patogenicidad de M. phaseolina. Los experimentos se establecieron en arreglo de tratamientos en parcelas subdivididas con tres repeticiones. Un aislamiento de M. phaseolina se obtuvo de plantas colectadas en cada unidad experimental y su patogenicidad se midió en semillas de cinco variedades de frijol (Azufrado Tapatío, Bayo Madero, Flor de Mayo Bajío, Negro Altiplano y Negro INIFAP. El riego y G. intraradices incrementaron el rendimiento de grano 144% y 12% respecto al temporal y la fertilización química, respectivamente. Los aislamientos de M. phaseolina de parcelas con riego, fertilización química, subsuelo-bordeo y barbecho fueron más agresivos en frijol. La aplicación de micorrizas y la labranza de conservación promueven la sostenibilidad del suelo y también podrían constituirse en medidas de manejo integrado de M. phaseolina en frijol.The fungus Macrophomina phaseolina (Tassi Goid causes the 'charcoal rot' disease in common beans (Phaseolus vulgaris L. and other crops and reduces plant growth and grain yield. In this work we determined the effects of four tillage levels (moldboard plow, shred-bedding, subsoil-bedding, no or zero tillage; two levels of soil moisture (rainfed, irrigated and two of fertilization (chemical, using the formula 40-20-00 NPK; biological, using the mycorrhiza Glomus intraradices in grain yield of the variety Negro INIFAP during 2006 and 2007 in Río Bravo, Mexico as well as

  17. Scripts em cena: HIV e mercado sexual no contexto turístico Scripts en escena: HIV y mercado sexualen el contexto turístico Scripts in scene: HIV and sexual market in the context of tourism

    Directory of Open Access Journals (Sweden)

    Renata Bellenzani

    2008-12-01

    Full Text Available A atividade turística tem impacto também na saúde das populações de comunidades anfitriãs. Com base em estudo etnográfico e em 14 entrevistas com monitores(as de turismo ambiental, o objetivo deste artigo é analisar como o cenário sexual no contexto do turismo e seus scripts sexuais constroem a vulnerabilidade de caiçaras às DSTs/HIV e ao mercado sexual. Scripts sexuais tradicionais operacionalizados num cenário de "curtição", "prazer", "desinibição sexual", evidenciaram desigualdades sociais entre caiçaras e turistas que ampliam a vulnerabilidade dos jovens às DSTs/HIV e à mercantilização de sua sexualidade. Os scripts sexuais femininos (passividade/ingenuidade dificultavam a negociação do preservativo nas cenas sexuais coletadas; os "mais pró-ativos" eram interpretados como disponibilidade para "programas". Os scripts "não negar fogo", "catar as turistas" também ampliavam a vulnerabilidade dos rapazes. O contexto turístico constrói um cenário sexual singular e atravessa as trajetórias socioafetivas dos moradores. Seu impacto deve ser considerado por políticas e programas de saúde locais.El turismo genera impactos socioculturales y también en la salud de las poblaciones de comunidades anfitrionas. Con base en observación etnográfica y 14 entrevistas con monitores (as del turismo ambiental el artículo analizará el escenario sexual y la operación de los scripts sexuales en la construcción de la vulnerabilidad de jóvenes nativos del lugar para con la(s ITS/SIDA y al mercado sexual. Scripts sexuales tradicionales empleados en el escenario de"diversión", "placer", "desinhibición sexual", evidenciaran desigualdades sexuales entre jóvenes nativos del lugar y turistas y amplían la vulnerabilidad a las ITS/SIDA y a la comercialización de su sexualidad. Los scripts sexuales femeninos (pasividad/ingenuidad dificultaron la negociación del condón en las escenas colectadas; los scripts "más autónomo" han

  18. AISLAMIENTO, IDENTIFICACIÓN Y CARACTERIZACIÓN DE NUCLEOPOLIEDROVIRUS NATIVOS DE SPODOPTERA FRUGIPERDA EN COLOMBIA ISOLATION, IDENTIFICATION AND CHARACTERIZATION OF NATIVE NUCLEOPOLYHEDROVIRUS OF SPODOPTERA FRUGIPERDA IN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Juliana Andrea Gómez Valderrama

    2010-12-01

    Full Text Available El gusano cogollero del maíz Spodoptera frugiperda (J.E. Smith es considerado la plaga más importante del cultivo en el mundo. En varios países se han empleado exitosamente los nucleopoliedrovirus de la familia Baculoviridae para su control. Sin embargo, en Colombia, no se cuenta ningún bioplaguicida viral registrado para el control de la plaga. En el presente trabajo, se realizó la búsqueda de aislamientos nativos de nucleopoliedrovirus en los departamentos de Tolima, Meta y Córdoba, mediante la recolección de larvas en diferentes cultivos. Las muestras fueron analizadas por microscopía para la búsqueda de partículas virales y los aislamientos encontrados se caracterizaron física y biológicamente. Se recolectaron 2.140 larvas de S. frugiperda en los tres departamentos muestreados. Sin embargo, sólo en un lugar (Cereté, Córdoba, se encontraron larvas con síntomas de infección viral en campo. El 2% de las muestras colectadas mostraron síntomas típicos de infección y en total se identificaron 3 aislamientos codificados como NPV003 (Córdoba, NPV009 (Tolima y NPV011 (Meta. Los aislamientos presentaron un tamaño de partícula entre 1,93 µm y 2,14 µm. Las concentraciones letales medias (CL50 sobre larvas neonatas oscilaron entre 2,2 x 105 CI/mL y 7,0 x 105 CI/mL y no se registraron estadísticas entre los aislamientos, sugiriendo que todos tienen la misma patogenicidad sobre larvas neonatas del insecto. Estos virus nativos representan la base para el desarrollo de una nueva alternativa biológica para el control de la plaga, siendo necesario iniciar los estudios para su formulación.Worldwide, the fall armyworm Spodoptera frugiperda (J.E. Smith is considered the most important pest of maize crop. Nucleopolyhedrovirus of Baculoviridae family have been successfully used in several countries for its control. However, in Colombia there are not any biopesticide registered for the control of this pest. In the present work, native

  19. Chemical and isotopic characteristics of rainwater at Los Humeros geothermal field, Puebla, Mexico and surrounding areas; Caracteristicas quimicas e isotopicas del agua de lluvia en el campo geotermico de Los Humeros, Puebla, Mexico y zonas aledanas

    Energy Technology Data Exchange (ETDEWEB)

    Tovar Aguado, Rigoberto; Cruz Grajales, Irma [Comision Federal de Electricidad, Los Humeros, Puebla (Mexico)

    2000-12-01

    A study of chemical and isotopic characteristics of rainwater at Los Humeros geothermal field was undertaken for the second consecutive year. Samples were collected in seven stations-two inside the field and five on the periphery. In 1996, a total of 99 samples were collected and 104 were collected in 1997. Of these, 19-18.26% of the total-had a negative alkalinity. The Atempan (No.5) and Campamento (No.1) stations showed the highest number of anomalous samples (31.25 and 27.8%, respectively). Anomalous samples in Perote station were not observed a result that we attribute to the predominant wind direction. The results for the Campamento station are attributed to the thermal inversion phenomena occurring when the samples with negative alkalinity were obtained. Concentrations of cations in some samples were relatively high, with the maximum concentration of calcium in the Los Humeros station (79.7 ppm) . Other significantly high values were found in the Texcal station (34.8 ppm) and Perote (33.8 ppm) due to the presence of dust particles scattered in the air and because of the lack of pavement where the sampling stations are located. Another factor affecting these figures could be the presence of block and lime factories in the neighborhood. Although measured concentrations may seem high, reports exist with similar concentrations in nongeothermal areas. Oxygen-18 and deuterium contents were determined for each stations, mixing anomalous samples. The results show that the most enriched samples correspond to the San Juan Xiutetelco, Puebla (No. 6) station and the minimum to the Perote Veracruz (No. 7) station. The concentration of SO{sub 4} has marine and industrial origins, with a contribution of the first source ranging between 10 and 25 percent. [Spanish] En el campo geotermico de Los Humeros, Puebla se realizo, por segundo ano consecutivo, la caracterizacion quimica e isotopica de agua de lluvia en muestras colectadas en siete estaciones, dos localizadas dentro

  20. Seed rain after a fire in a xerophytic shrubland Lluvia de semillas después de un incendio en un matorral xerófilo

    Directory of Open Access Journals (Sweden)

    Yuriana Martínez-Orea

    2012-06-01

    quemado y uno no quemado. Durante un año las diásporas fueron colectadas e identificadas. Los resultados mostraron que la riqueza de especies, las formas de vida y los síndromes de dispersión fueron diferentes entre sitios. Los mayores valores de abundancia y de riqueza de diásporas fueron observados en el sitio quemado. Este trabajo ofrece información básica acerca de la disponibilidad de las especies en forma de diásporas, misma que es estratégica en la restauración futura de áreas sujetas a constantes disturbios antropogénicos.

  1. Estudio de confiabilidad de la prueba de sialometría para flujo no estimulado en sujetos adultos clínicamente sanos Study of reliability of the sialometry test for non-stimulated flow in clinically healthy adult individuals

    Directory of Open Access Journals (Sweden)

    J Aitken Saavedra

    2013-04-01

    Full Text Available Introducción: En personas sanas, la velocidad de flujo salival o sialometría (VFS puede afectarse por la edad, género y ritmo circadiano. No existe evidencia de la reproducibilidad de VFS no estimulada determinada en 5 minutos, en distintos momentos del día en un mismo individuo. Objetivos: Determinar confiabilidad de VFS no estimulada medida en 5 minutos, reproducibilidad en el tiempo y relación con rango etario y género. Metodología: Se determinó VFS durante 15 minutos en 42 individuos clínicamente sanos, con una mediana de 45.5 (30-65 años, entre 9 y 11 AM durante dos mañanas y entre 3 y 5 PM durante la tarde del segundo día de medición. La saliva se colectó en tubos separados durante 5 minutos y durante los 10 minutos restantes. El peso de las muestras fue expresado en ml/min. Los valores entre los grupos de estudio, se compararon mediante test t de Student, ANOVA y coeficiente de correlación de Spearman. Resultados: VFS promedio fue de 0.623 ± 0.329 y de 0.551 ± 0.289 a los 5 y 15 minutos respectivamente (p=0.001. VFS fue mayor en hombres a los 5 y 15 minutos (p=0.001. VFS en mujeres, disminuyó al aumentar la edad. No hubo diferencias en VFS a los 5 minutos (p=0.375 y a los 15 minutos (p=0.825, en distintos días y momentos del día, en un mismo individuo. Conclusión: VFS colectada durante 5 minutos, en un mismo individuo, presenta valores constantes en distintos días y momentos del día.Introduction: In healthy persons, the salivary flow rate (VFS or sialometry can be affected by the age, the gender and the circadian rhythm. There is no evidence of the reproducibility of the non-stimulated VFS determined in 5 minutes, in different moments of the day in the same individual. Aim: To determine the reliability of the non-stimulated VFS measured in 5 minutes, its reproducibility over time and its relation with the age range and the gender. Methodology: VFS was determined for 15 minutes in 42 clinically healthy individuals

  2. Inventario de Hymenoptera (Hexapoda en El Ventorrillo: un rico enclave de biodiversidad en la Sierra de Guadarrama (España Central

    Directory of Open Access Journals (Sweden)

    Nieves-Aldrey, José Luis

    2003-12-01

    estimated extrapolating overall regional richness data from Spain. The hymenopteran numbers from the inventory are compared with other local richness data from Spain and other surveys from Europe and America. The comparatively high abundance and richness figures at El Ventorrillo are emphasized. Results of the inventory, not yet completed, indicate a very high entomological diversity at the surveyed site, a small relatively well preserved area less than 0.5 km2, that probably is representative of other similar habitats in the Sierra of Guadarrama. This area is, however, under potential menace of alteration by the growing human and urban pressure of the vicinity of Madrid. We urge the politics and nature managers to protect this rich biodiversity spot. We hope that this work can help to support the recent proposal of creation of the National Park of the Sierra of Guadarrama.

    Se presentan los resultados globales del inventario de Hymenoptera llevado a cabo en el área de la Estación Biogeológica de El Ventorrillo, un área natural enclavada a 1450 metros de altitud en el sector central madrileño de la Sierra de Guadarrama. Con un programa de muestreo basado fundamentalmente en el uso de trampas Malaise, y adicionalmente trampas bandeja coloreadas y redes de barrido, llevado a cabo entre los años 1988 y 1991, se colectaron más de 1.000.000 de ejemplares de insectos que han sido ingresados en las colecciones del Museo Nacional de Ciencias Naturales de Madrid. Cerca de 600.000 ejemplares de insectos fueron separados hasta el nivel de orden, de los cuales 83.668 (un 13.8% correspondieron al orden Hymenoptera, siendo después de Diptera (450.000 ejemplares, un 77,5% del total el orden de insectos más numeroso en los muestreos. En las muestras colectadas se han identificado hasta la fecha 49 familias 518 géneros y 1310 especies de Hymenoptera; la riqueza total de himenópteros en las muestras colectadas se estima en más de 2700 especies, y la del conjunto

  3. 固氮基因的分子进化分析%An Analysis of Molecular Evolution of Nitrogen Fixation Genes

    Institute of Scientific and Technical Information of China (English)

    王前; 陈海魁; 王俊丽

    2013-01-01

    The nitrogen fixation gene sequences of nitrogen-fixing plants and microorganisms were obtained from the GenBank database to construct phylogenetic trees by neighbor joining method (microorganisms included 15 sequences,such as AE006469,and plants included 22 sequences,such as AF013594),which worked on the different nitrogen-fixing genes in the same nitrogen-fixing microorganism,the same kind of nitrogen fixation gene in many kinds of nitrogen-fixing microorganisms and plants.The results showed that:in the evolutionary tree of the nitrogen fixation genes of Sinorhizobium meliloti 1021,lpsL and exoA gene were clustered into a branch,nodD,nifH and fixA gene were clustered into a branch,whether the same law existed in other nitrogenfixing organisms or not,it needs further study because of lack of data;the evolutionary tree of nifH genes of nitrogen-fixing microorganisms was divided into four branches,various rhizobia were clustered into a branch,Frankia strains were clustered into a branch,Klebsiella pneumoniae and Trichormus Azollae were clustered into one branch only ; the phylogenetic tree of enod40 genes of nitrogen-fixing plants was divided into Fabaceae,Solanaceae,Poaceae,Casuarinaceae,which was basically consistent with the classification of APGⅢ.From the phylogenetic trees,as a whole,this study understands the nitrogen-fixing genes in the evolutionary history of the nitrogen-fixing genes in the nitrogen-fixing microorganisms and plants,which provides a theoretical evidence for the research on the nitrogen fixation genes of nitrogen-fixing plants and microorganisms and a reference for the application of the nitrogen fixation genes applying them in agriculture and other fields.%从GenBank数据库获取固氮微生物和固氮植物的固氮基因序列(固氮微生物包括AE006469等15条序列,固氮植物AF013594等22条序列),利用邻接法从同一固氮微生物的固氮基因、同种固氮基因在不同固氮微生物和不同固氮植物3个方面

  4. Potential of macrophyte for removing arsenic from aqueous solution Potencial de remoção de arsênio de solução aquosa por macrofita

    Directory of Open Access Journals (Sweden)

    F.P. Guimaraes

    2012-12-01

    Full Text Available The potential of three aquatic macrophytes, Azoll caroliniana, Salvinia minima and Lemna gibba, was evaluated in this work aimed at selection of plants to be used in remediation of environments contaminated by arsenic (As. The experiments were carried out in a greenhouse during six days in pots containing Hoagland solution (¼ ionic strength at As concentrations of 0.5; 2.5 and 5.0 mg L-1. The three species showed greater As accumulation as the concentration of the metalloid in solution increased. However, a reduction was detected in fresh and dry mass gain when the plants were exposed to high As concentrations. The macrophytes showed differences in efficiency of removal of As in solution. A. caroliniana, S. minima and L. gibba accumulated, on average, 0.130; 0.200; and 1.397 mg mDM-1, respectively, when exposed to 5.0 mg L-1 of As. The macrophytes absorbed a greater quantity of As in solution with low phosphate content. The greater As concentration in L. gibba tissues lowered the chlorophyll and carotenoid contents as shown by the high chlorosis incidence. Lemna gibba also exhibited a decrease in leaf size, with the total chlorophyll and carotenoid synthesis not being affected by As in A. caroliniana. This species exhibited purplish leaves with high concentration of anthocyanin, whose presence suggested association to phosphate deficiency. Marginal necrosis occurred on S. minima floating leaves, with the released daughter-plants not showing any visual symptoms during the treatment. The percentage of As removed from the solution decreased when the plants were exposed to high concentrations of the pollutant. Among the three species studied, only L. gibba could be considered an As hyper-accumulator. The use of this plant species for remediation of aquatic environments was shown to be limited and requires further investigation.O potencial de três macrófitas aquáticas - Azolla caroliniana, Salvinia mínima e Lemna gibba - foi avaliado neste

  5. Biologia de Anopheles (Kerteszia neivai H., D. & K., 1913 (Diptera: Culicidae en la costa Pacífica de Colombia: II. Fluctuación de la población adulta Biologia do Anopheles (Kerteszia neivai H., D. & K., 1913 (Diptera: Culicidae na costa do Pacífico Colombiano: II. Flutuação da população adulta Biology of Anopheles (Kerteszia neivai H., D. & K., 1913 (Diptera: Culicidae on the Pacific Coast of Colombia: II. Adult population fluctuation

    Directory of Open Access Journals (Sweden)

    Rodrigo Astaiza V.

    1988-04-01

    Full Text Available En la localidad de Charambirá, situada en el município de Istmina (Chocó en la costa Pacífica de Colombia, se presenta un problema de malaria endémica asociada con grandes poblaciones de mosquitos Anopheles del subgénero Kerteszia (A. neivai. Estos se crían en las colecciones de agua formadas por plantas epífitas de la família Bromeliaceae, que son muy abundantes en los árboles de mangle. En esa localidad se estudiaron: fluctuación poblacional y algunos aspectos ecológicos y etológicos de los adultos de esa especie de mosquito, con el objetivo de determinar su papel en la transmisión de malaria. Todos los mosquitos fueron colectados por cebos humanos. Los picos máximos de actividad ocurrieron en las horas crepusculares de la mañana y de la tarde (5:30 a 6:30 y 18:00 a 19:00 horas. En el período nocturno la actividad intradomiciliar fue baja y no hubo ninguna durante el día. El estado gonadotrófico de las hembras colectadas durante nos picos de actividad, mostró la existencia de dos poblaciones de mosquitos: una, en su mayoría individuos jóvenes que buscan su alimento en las horas de la tarde y la otra compuesta por individuos mas longevos, que buscan su alimento en la mañana. El estudio de la variación estacional mostró que las poblaciones son bajas en los meses de poca precipitación, pero a medida que aumenta el índice pluviométrico, aumenta el número de mosquitos. Se discute la relación que existe entre la presencia de los mosquitos y la prevalencia de malaria humana; se sugiere que A. neivai puede ser el responsable de la transmisión de malaria en la zona estudiada.Na localidade de Charambirá, situada no Municipio de Istmina (Chocó, na costa do Pacífico Colombiano, ocorre um tipo de malária endêmica associada com grandes populações de Anopheles do subgênero Kerteszia (A. neivai. Estes criam-se em coleções de água formadas por plantas epífitas pertencentes à família Bromeliaceae, as quais são muito

  6. Imunogenicidade da vacina brasileira contra hepatite B em adultos Inmunogenicidad de la vacuna brasilera contra hepatitis B en adultos Immunogenicity of the Brazilian hepatitis B vaccine in adults

    Directory of Open Access Journals (Sweden)

    José Cássio de Moraes

    2010-04-01

    dosis fue administrada en el momento del reclutamiento, la segunda y tercera 30 y 180 días después respectivamente, entre 2004 y 2005. Muestras de sangre fueron colectadas para análisis sexológico antes de la aleatorización, y posterior a la segunda y tercera dosis. Fue realizada la vigilancia activa de eventos adversos durante los cinco primero días posterior a la vacunación. Las diferencias fueron evaluadas por las pruebas de chi-cuadrado y exacto de Fisher, con nivel de significancia de 5%. RESULTADOS: No se observaron eventos adversos graves. La seroprotección fue confirmada en 98,6% (213/216 de los voluntarios del grupo experimental, en comparación a 95,6% (194/203 del grupo control. Los títulos geométricos promedios fueron de 12.557 y 11.673, respectivamente. CONCLUSIONES: La vacuna brasilera fue considerada equivalente a la vacuna de referencia y su uso recomendado para adultos.OBJECTIVE: To evaluate the immunogenicity and safety of a novel hepatitis B vaccine, after increasing antigen concentration to 25 μg, in comparison to the reference vaccine. METHODS: Single-blinded randomized trial comparing VrHB-IB (Instituto Butantan and the reference vaccine (Engerix B®, Glaxo Smith Kline. Volunteers aged 31 to 40 years were randomized to either experimental (n=216 or control (n=203 groups, and were given three doses of vaccine. The first dose was administered upon recruitment, and the second and third doses 30 and 180 days later, respectively, between 2004 and 2005. Blood samples were collected for analysis before randomization and after the second and third doses. Active search for adverse effects was perforned in the first five days after vaccination. Differences were evaluated using chi-square and Fisher's exact tests, with a 5% significance level. RESULTS: No severe adverse effects were observed. Seroprotection was confirmed in 98.6% (213/216 of volunteers in the experimental group and 95.6% (194/203 of those in the control group. Geometric mean titers

  7. Effect of the Cooling System and 1-MCP on the Incidence of Superficial Scald in ‘Granny Smith’ Apples Efecto del Sistema de Enfriamiento y 1-MCP sobre la Incidencia de Escaldado Superficial en Manzanas ‘Granny Smith’

    Directory of Open Access Journals (Sweden)

    Claudia Moggia

    2009-09-01

    Full Text Available A study was carried out to determine the effects of two cooling systems and the application of 1-methylcyclopropene (1-MCP, SmartFreshTM on the incidence of superficial scald in apples (Malus domestica Borkh. cv. Granny Smith. Fruit were collected from a commercial orchard (Colbún, Maule Region, Chile during 2004-2005 season. A completely randomized design was used in a 2 x 2 factorial arrangement, using cooling systems (normal and step-wise cooling and application of 1-MCP (0 and 625 nL L-1 i.a. as the main factors. Fruit from normal cooling were kept at 0 °C throughout the storage period (180 days. Step-wise cooling consisted of storing the fruit at 10 °C for 10 days; 4 °C for the next 20 days and 0 °C for the remaining 150 days. Every month, maturity indices and the chemicals, global antioxidant content (AO, α-farnesene (AF and conjugated trienes (TC, were measured. Incidence of superficial scald was determined after 180 days of storage, plus 10 days at 20 °C . The application of 1-MCP with both cooling systems was capable of maintaining firmness values around 8,2 kg up to the end of the storage period, as well as decreasing the concentration of AF, TC and AO during storage. Incidence of superficial scald on fruit with 1-MCP was 0%, regardless of the type of cooling. Among treatments without 1-MCP, step-wise-cooling was more effective in preventing superficial scald, resulting in 1.3% incidence compared to 75.6% with the normal cooling system. Nevertheless, from the fourth month onwards firmness was lower than that required for export.Se desarrolló un estudio para determinar el efecto de dos sistemas de enfriamiento y la aplicación de 1-metilciclopropeno (1-MCP, SmartFreshTM sobre la incidencia de escaldado superficial en manzanas (Malus domestica Borkh. cv. Granny Smith, colectadas de un huerto comercial (Colbún, Región del Maule, Chile durante la temporada 2004-2005. El ensayo consistió en un diseño completamente al azar con

  8. The logistic model for predicting the non-gonoactive Aedes aegypti females El modelo logístico para predecir la frecuencia de hembras no gonoactivas en función del tamaño corporal y tipo de colecta, en poblaciones de Aedes aegypti, en Monterrey, México

    Directory of Open Access Journals (Sweden)

    Filiberto Reyes-Villanueva

    2004-06-01

    .: seis de hembras capturadas en cebo humano, dos de nulíparas y dos colectadas en reposo intradomiciliar. Cada muestreo incluyó 60 hembras, en tres colonias endémicas para dengue, en Monterrey, Nuevo León, México, entre 1994 y 1996. Las hembras grávidas o con sangre en estómago fueron excluidas. Cada mosquito fue llevado al laboratorio y alimentado a repleción con sangre humana, y a las 48 horas los ovarios fueron disecados para registrar si estaban en fase gonoactiva o no. El tamaño corporal fue registrado por la longitud en mm del ala izquierda de cada mosquito. Se usó regresión logística para estimar la probabilidad de que una hembra fuera no gonoactiva, como una variable binaria, en función de la longitud alar, y del tipo de colecta. RESULTADOS: De las 600 hembras procesadas, 164 (27% permanecieron no gonoactivas, y su tamaño corporal mostró un intervalo (1.9-3.2 mm casi igual al total de las hembras (1.8-3.3 mm. El modelo de regresión logística fue significativo para estimar la probabilidad de que una hembra permanezca no gonoactiva (Y=1. El tipo de colecta no tuvo influencia significativa en la variable binaria, pero la probabilidad de no gonoactividad mostró una relación inversa con el tamaño corporal. CONCLUSIONES: Las poblaciones del vector del dengue en Monterrey, México, están integradas por hembras de tamaño muy variable. La regresión logística resultó útil para evaluar la probabilidad que tiene una hembra de quedar no gonoactiva después de una alimentación sanguínea. La necesidad de una segunda comida sanguínea está presente en cualquier mosquito, pero los pequeños tienen una mayor probabilidad de picar por segunda ocasión a una persona en un periodo de dos días, para poder madurar huevos.

  9. Pré-hipertensão e hipertensão em adultos de Florianópolis: estudo de base populacional Pre-hipertensión e hipertensión en adultos de Florianópolis (Brasil: estudio de base poblacional Prehypertension and hypertension among adults in a metropolitan area in Southern Brazil: population-based study

    Directory of Open Access Journals (Sweden)

    Diego Augusto Santos Silva

    2012-12-01

    relacionados a la salud, medidas antropométricas, morbilidades y autopercepción de salud fueron colectadas por medio de entrevistas domiciliares. Niveles de presión arterial sistólica y diastólica fueron evaluados. Adicionalmente, se preguntó sobre la ingesta de medicamentos y diagnóstico médico para hipertensión. La variable dependiente fue categorizada en normal, pre-hipertensión e hipertensión arterial. La regresión logística politómica múltiple fue empleada con uso del modelo Logit multinomial. RESULTADOS: La prevalencia de pre-hipertensión e hipertensión arterial fue de 36,1% (IC95% 33,3;38,8 y 40,1% (IC95% 36,6;43,5, respectivamente. El análisis de regresión politómico multivariable reveló que la pre-hipertensión estuvo asociada a hombres de color de piel negra, grupo etario encima de 50 años, inactivos físicamente en momentos de ocio y con pre-obesidad. La hipertensión arterial estuvo asociada a hombres, de color de piel negra, grupo etario encima de 40 años, tercil intermediario de renta per capita, escolaridad menor de 12 años, inactivos físicamente, pre-obesidad, obesidad, circunferencia de la cintura elevada y percepción negativa del estado de salud. CONCLUSIONES: Para controlar la hipertensión arterial en la población adulta de Florianópolis, es urgente aplicar políticas públicas eficaces para combatir la pre-hipertensión.OBJECTIVE: To assess the prevalence and factors associated with prehypertension and hypertension among adults. METHODS: Population-based cross-sectional study carried out with a sample of 1,720 adults in the city of Florianópolis, southern Brazil, from September 2009 to January 2012. Information on demographic and socioeconomic factors, health-related behaviors, anthropometric measures, morbidities, and self-rated health was collected through household interviews. Systolic and diastolic blood pressure levels were also assessed as well as use of antihypertensive medications and medical diagnosis of hypertension

  10. Avaliação nutricional de adultos da coorte de nascimentos de 1982, Pelotas, RS Evaluación nutricional de adultos de la cohorte de nacimientos de 1982, Pelotas, Sur de Brasil Nutritional evaluation follow-up of the 1982 birth cohort, Pelotas, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Denise P Gigante

    2008-12-01

    medidas de peso y estatura colectadas para cálculo del índice de masa corporal (IMC. Se definió bajo peso por el valor de IMC inferior a 18,5 kg/m²; exceso de peso por el IMC entre 25 y 30 30kg/m²; y obesidad por el IMC>30kg/m². Los efectos de variables socioeconómicas (renta familiar y escolaridad, demográfica (color de piel, peso al nacer y amamantamiento sobre bajo peso, exceso de peso y obesidad fueron analizados utilizando regresión de Poisson separadamente para hombres y mujeres. RESULTADOS: Las prevalencias de bajo peso, obesidad y exceso de peso fueron 6,0%, 8,2% y 28,9%, respectivamente. En el análisis ajustado solamente el peso al nacer se mantuvo asociado con bajo peso en hombres y mujeres. Hombres pobres tuvieron mayor riesgo de bajo peso, pero estuvieron protegidos de la obesidad y del exceso de peso. Por otro lado, el riesgo de obesidad y exceso de peso fue mayor entre las mujeres pobres. CONCLUSIONES: Los resultados refuerzan la importancia de la determinación socioeconómica sobre el estado nutricional, llamando la atención de cómo esos factores actúan de forma distinta en hombres y mujeres de diferentes situaciones nutricionales, indicando atención en lo que se refiere a medidas específicas en la prevención, mejorando el acceso a la información sobre educación alimentar y nutricional para toda la población.OBJECTIVE: To estimate the prevalence of over/underweight and its association with demographic and socioeconomic factors. METHODS: Longitudinal cohort study of youths born in 1982 in Pelotas, Southern Brazil. In 2004-5 we interviewed 4,198 of the 5,914 cohort subjects, obtaining weight and stature measurements that were used to calculate body mass index (BMI. Underweight was defined as BMI lower than 18,5 kg/m²; overweight as BMI between 25 and 30kg/m²; and obesity as BMI IMC > 30kg/m². The effects of socioeconomic (family income and schooling and demographic (skin color variables, birthweight, and breastfeeding on underweight

  11. Efeitos da dexmedetomidina sobre a coagulação sangüínea avaliada através do método da tromboelastografia Efectos de la dexmedetomidina sobre la coagulación sanguínea evaluada a través del método de la tromboelastografía Effects of dexmedetomidine on blood coagulation evaluated by thromboelastography

    Directory of Open Access Journals (Sweden)

    César Romão Martins

    2003-12-01

    adrenérgicos alfa2 puede presentar efectos pro y antiagregantes plaquetarios, por mecanismos directos e indirectos. En este estudio, se evaluaron los efectos de la dexmedetomidina sobre la coagulación a través del método de la tromboelastografia. MÉTODO: Veinticuatro pacientes fueron aleatoriamente divididos en tres grupos. Los pacientes del grupo 1 recibieron infusión de solución fisiológica (control, los del grupo 2 recibieron dexmedetomidina en la dosis de 1 µg.kg-1 en 10 minutos, seguida de infusión de 0,4 µg.kg-1.h-1 por 20 minutos y los del grupo 3 recibieron midazolam en dosis de 0,05 mg.kg-1. Los pacientes sedados mantuvieron índices 3 ó 4 en la escala de la sedación de Ramsay. Fueron colectadas muestras de sangre y se obtuvieron trazados de tromboelastografía previamente y después de 30 minutos del tratamiento. RESULTADOS: La dexmedetomidina, de forma estadísticamente significativa, aumentó el tiempo de reacción (parámetro R y diminuyó el índice de coagulación en los trazados finales en relación a los iniciales. No obstante, los valores permanecieron dentro de los intervalos considerados normales. Este fenómeno no fue observado en los demás grupos. CONCLUSIONES: La interacción de los mecanismos pro y antiagregantes de la dexmedetomidina lleva a una discreta hipocoagulación; sin embargo, mantiene la coagulación dentro de parámetros considerados normales. Los efectos de la dexmedetomidina sobre la coagulación probablemente no ocurren pela ansiólisis, una vez que la sedación fue igual al grupo que recibió midazolam.BACKGROUND AND OBJECTIVES: Dexmedetomidine is a highly selective alpha2-adrenoceptor agonist used in anesthesia for its hypnoanalgesic and cardiovascular effects. Stimulation of alpha2-adrenoceptors may determine pro and anti-platelet aggregation effects through direct and indirect mechanisms. This study aimed at determining the effects of dexmedetomidine on coagulation evaluated by thromboelastography. METHODS: Twenty

  12. Educação e trabalho na coorte de nascimentos de 1982 a 2004-5, Pelotas, RS Educación y trabajo en la cohorte de nacimientos de 1982 a 2005, Pelotas, Sur de Brasil Education and work in the Pelotas birth cohort from 1982 to 2004-5, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Fernando C Barros

    2008-12-01

    Full Text Available OBJETIVO: Analisar a influência de fatores socioeconômicos e biológicos precoces ao longo da vida sobre o ingresso na universidade e a inserção no mercado de trabalho dos jovens da coorte de nascimento de 1982. MÉTODOS: Estudo longitudinal de 5.914 nascimentos da cidade de Pelotas (RS, em 1982. Utilizando-se questionários aplicados ao jovem, foram coletadas informações sobre nível educacional e a inserção no mercado de trabalho durante acompanhamento da coorte realizado em 2004-5. Regressão de Poisson foi utilizada para estudar o efeito de variáveis demográficas, socioeconômicas, peso ao nascer e aleitamento materno sobre os desfechos. RESULTADOS: A escolaridade média foi de 9,4 anos (± 3,1 e 42% dos jovens estavam freqüentando a escola em 2004-5. Um de cada cinco jovens havia ingressado na universidade e cerca de dois terços estavam trabalhando no mês anterior à entrevista. O ingresso na universidade foi determinado pelas condições econômicas, e teve influência do peso ao nascer nas mulheres e da amamentação nos homens. A inserção no mercado de trabalho foi mais freqüente entre os homens mais pobres, mas não para as mulheres. CONCLUSÕES: A baixa inclusão universitária e a necessidade de inserção no mercado de trabalho dos jovens de famílias mais pobres mantêm um círculo vicioso que reproduz a hierarquia social dominante.OBJETIVO: Analizar la influencia de factores socioeconómicos y biológicos precoces a lo largo de la vida sobre el ingreso en la universidad y la inserción en el mercado de trabajo de los jóvenes de la cohorte de nacimiento de 1982. MÉTODOS: Estudio longitudinal de 5.914 nacimientos de la ciudad de Pelotas (Sur de Brasil, en 1982. Utilizándose cuestionarios aplicados al joven, fueron colectadas informaciones sobre el nivel educacional y la inserción en el mercado de trabajo durante acompañamiento de la cohorte realizado en 2004-5. Regresión de Poisson fue utilizada para estudiar el

  13. Comunidades de arañas (Arachnida:Araneae asociadas al dosel de bosques de tierra firme e igapó en la Estación Biológica Mosiro Itájura (Caparú, Vaupés, Amazonia Colombiana

    Directory of Open Access Journals (Sweden)

    Flórez Daza Eduardo

    2004-12-01

    Full Text Available El dosel de los bosques es estructuralmente complejo, por lo cual actúa como reservorio de una gran diversidad de artrópodos que pueden ser residentes permanentes y por lo tanto explotan los microhábitats disponibles (follaje, acumulaciones de liquen y hojarasca, epífitas, corteza, lianas y bejucos asociados, como sitio de vivienda o  alimentación. Se considera que los artrópodos de dosel conforman un componente importante en la cadena trófica de este estrato como fuente de alimentación para otros animales o como controladores naturales de insectos y demás artrópodos. En Colombia no se han realizado estudios encaminados al conocimiento de la araneofauna de dosel; por lo tanto el presente estudio constituye un primer aporte en este campo. Se efectuaron muestreos entre marzo y abril de 2003, a final de la época seca, en bosques de tierra firme e Igapó (inundable en la zona del bajo río Apaporis, Vaupés, Amazonia colombiana. Se seleccionaron 10 árboles en cada bosque a los cuales se accedió usando la técnica de cuerda simple. Las colectas se realizaron entre 18 y 23 m de altura en cada árbol, empleando los siguientes métodos: barrido con red entomológica (50 pases dobles, colecta de epífitas y revisión manual de hojarasca. Se colectó un total de 1.333 arañas, de las cuales se logró determinar hasta familia y separar a morfoespecie el 64%, que equivale a 850 individuos
    de 182 morfoespecies y 40 familias. En el bosque de Igapó se colectaron 560 arañas y se separó a nivel de morfoespecie 393 individuos, pertenecientes a 164 morforespecies y 29 familias. De las 773 arañas colectadas en el bosque de tierra firme se separaron 457 arañas pertenecientes a 162 morfoespecies y 32 familias. En el bosque de Igapó las familias con mayor número de especies resultaron ser Araneidae, Salticidae y Anyphaenidae, en tanto que las más abundantes fueron Salticidae, Pisauridae y Araneidae. En el bosque de tierra firme las familias

  14. Photosynthetic responses to UV-radiation of intertidal macroalgae from the Strait of Magellan (Chile Respuestas fotosintéticas a la radiación UV en algas intermareales del Estrecho de Magallanes (Chile

    Directory of Open Access Journals (Sweden)

    RALF RAUTENBERGER

    2009-03-01

    ón UV. Tanto las tasas de inhibición como las tasas de recuperación no estuvieron correlacionadas con grupos morfofuncionales ni con la distribución vertical. Por tanto, aunque la capacidad para aclimatar a la radiación UV varió entre las diferentes especies, los resultados sugieren que estas respuestas están basadas en ajustamientos metabólicos o posiblemente estrategias fotoprotectoras. En conclusión, y tomando en cuenta las características de adaptación a la luz, todas las especies colectadas en el mesolitoral y sublitoral del Estrecho de Magallanes están bien aclimatadas a las dosis de UV-B que ocurren en su habitat, lo cual es un prerrequisito para tolerar aumentos de UV-B durante disminución de ozono o durante condiciones de alta radiación en verano.

  15. Estudio de los estados larvales de la ictiofauna en la zona de Puerto Nariño, Amazonia Colombiana, durante el período de aguas ascendentes (2003

    Directory of Open Access Journals (Sweden)

    Gutiérrez Espinosa Mónica Andrea

    2004-12-01

    la prole sea llevada a zonas de criadero (parches de gramalotes en el área de várzea. La mayor o menor influencia de las aguas del río Amazonas, por tanto, está determinando la abundancia y la diversidad de larvas en los diferentes ambientes acuáticos muestreados. Es así como los sitios con mayor número de larvas y con valores altos de diversidad fueron aquellos en que la influencia de las aguas del río Amazonas es alta (río Amazonas, el río Loreto Yacu y el caño Zancudillo, colectándose el 75% de las larvas y presentando valores
    de diversidad de Shannon-Weever mayor a 2,5. Sitios con menor influencia de las aguas del río Amazonas como el lago Tarapoto y el caño Igarapé-Uassú presentaron menor abundancia de larvas (1,6% entre los dos, y valores de diversidad menor a 1,5. Se proponen sitios de desove de algunas especies como Anodus elongatus, Triportheus cf. Albus, T. cf elongatus, Mylossoma aureum y M. duriventre, teniendo en cuenta su abundancia en momentos específicos durante el muestreo y el estado de desarrollo en que fueron colectadas. Por medio de estudios sobre larvas se puede tener una visión general de la dinámica de la reproducción en determinados ambientes acuáticos, pudiéndose determinar épocas y sitos de desove, al igual que sitios de criadero de los juveniles de peces. Así se propone un modelo general de la dinámica reproductiva de los peces en la zona de várzea de Puerto Nariño.

  16. Características físicas y químicas de dos razas de maíz azul: morfología del almidón Physical and chemical characteristics of blue corn from two races: starch morphology

    Directory of Open Access Journals (Sweden)

    Edith Agama-Acevedo

    2011-06-01

    Full Text Available En México existen regiones donde se cultivan variedades criollas de maíz azul (Zea mays L., que poseen variabilidad de tamaño, densidad y dureza del grano, así como composición química. Estas variables si bien están definidas por el factor genético, también dependen de las prácticas de cultivo, condiciones climáticas y tipo de suelo. Las características físicas del grano de maíz tienen relación con aspectos de producción y rendimiento, mientras que su composición química y la morfología de los gránulos de almidón, ayudan a definir la calidad nutritiva y su uso en la elaboración de alimentos. El objetivo del trabajo fue determinar las propiedades físicas y químicas del grano maíz azul proveniente de dos razas, y caracterizar morfológicamente los gránulos del almidón de su endospermo. El trabajo se realizó en el Centro de Desarrollo de Productos Bióticos del Instituto Politécnico Nacional y en el Campo Experimental Valle de México del Instituto Nacional de Investigaciones Forestales Agrícolas y Pecuarias. Las muestras fueron colectadas en campo con los productores, seis materiales de la raza Tabloncillo en localidades de Sinaloa y nueve de la raza Chalqueño en localidades de Tlaxcala y Estado de México. Los maíces de la raza Tabloncillo presentaron granos pequeños, mayor dureza y cantidad de almidón dañado, y menores contenidos de antocianinas, que la raza Chalqueño. La cantidad de almidón de ambas razas fue de 0.78-0.89 g g-1 de muestra seca, y por su contenido de amilosa se clasifican como almidones normales. Las formas de los gránulos de almidón fueron esféricas con superficie lisa y una distribución bimodal (gránulos pequeños 2-8 µm y grandes 16-18 µm. Las diferencias principales entre las dos razas fueron su tamaño de grano, índice de flotación y contenido de antocianinas.There are areas in Mexico, where local varieties of blue corn are grown (Zea mays L., which have variability in size

  17. Impact of urban atmospheric environment on hospital admissions in the elderly Impacto del ambiente atmosférico urbano en las internaciones hospitalarias de ancianos Impacto do ambiente atmosférico urbano nas internações hospitalares de idosos

    Directory of Open Access Journals (Sweden)

    Edelci Nunes da Silva

    2012-08-01

    Full Text Available OBJECTIVE: To analyze the impact of intra-urban atmospheric conditions on circulatory and respiratory diseases in elder adults. METHODS: Cross-sectional study based on data from 33,212 hospital admissions in adults over 60 years in the city of São Paulo, southeastern Brazil, from 2003 to 2007. The association between atmospheric variables from Congonhas airport and bioclimatic index, Physiological Equivalent Temperature, was analyzed according to the district's socioenvironmental profile. Descriptive statistical analysis and regression models were used. RESULTS: There was an increase in hospital admissions due to circulatory diseases as average and lowest temperatures decreased. The likelihood of being admitted to the hospital increased by 12% with 1ºC decrease in the bioclimatic index and with 1ºC increase in the highest temperatures in the group with lower socioenvironmental conditions. The risk of admission due to respiratory diseases increased with inadequate air quality in districts with higher socioenvironmental conditions. CONCLUSIONS: The associations between morbidity and climate variables and the comfort index varied in different groups and diseases. Lower and higher temperatures increased the risk of hospital admission in the elderly. Districts with lower socioenvironmental conditions showed greater adverse health impacts.OBJETIVO: Analizar los efectos de las condiciones climáticas intra-urbanas en las enfermedades circulatorias y respiratorias en ancianos. MÉTODOS: Estudio transversal con 33.212 internaciones hospitalarias de ancianos en la ciudad de Sao Paulo, Sudeste de Brasil. Las variables atmosféricas colectadas en el aeropuerto de Congonhas y el índice bioclimático Physiological Equivalent Temperature fueron analizados según el perfil socioeconómico del vecindario. Se utilizaron análisis estadístico descriptivo y modelos de regresión. RESULTADOS: Hubo aumento en las internaciones por enfermedades circulatorias al

  18. Temporal variation and size class distribution in a hepertological assemblage from Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    Martori, Ricardo

    2005-05-01

    Full Text Available Desde el punto de vista de la conservación, conocer la abundancia, la diversidad, y los patrones de actividad de un ensamble herpetológico son medulares para comprender la dinámica de la comunidad y el modo de cómo es utilizado el hábitat. En este proyecto propusimos cuatro hipótesis nulas: 1 La frecuencia de captura de cada una de las especies será similar en los dos años relevados. 2 La frecuencia de capturas de cada especie es similar durante los meses estudiados. 3 La actividad de cada especie es similar a la actividad del resto del ensamble. 4 Las proporciones de cada grupo etario de cada especie se mantienen constantes en el tiempo. Durante este estudio fueron colectadas diecinueve especies, diez especies de Amphibia distribuidas en cuatro familias y nueve especies de Squamata distribuidas en siete familias. En hábitats relativamente complicados que poseen una estructura vegetal compleja y presentan patrones de actividad herpetológica irregular, el uso de trampas de caída resulta uno de los pocos métodos eficientes para la evaluación de la actividad de animales terrestres. El uso de trampas de caída es un método efectivo para realizar inventarios herpetológicos pero los resultados deben ser tratados con precaución porque este método captura algunas especies más fácilmente que otras. Los principales resultados obtenidos por este estudio fueron: La hipótesis 1 fue rechazada, para todas las especies exceptuando a Mabuya dorsivittata, que mostró frecuencias de actividad similares en ambos años, la hipótesis 2 también fue rechazada porque todas las especies mostraron significativas diferencias de actividad temporal. Las especies más variables fueron Odontophrynus americanus y Bufo fernandezae; la más constante Pantodactylus schreibersi. La tercera hipótesis fue rechazada para todas las especies salvo Elachistocleis bicolor que presentó un patrón de actividad similar al ensamble. La hipótesis 4 fue rechazada, los

  19. From genetic neighbourhood to local community: Estimating a key parameter of the Unified Neutral Theory of Biodiversity A partir del vecindario genético al vecindario de comunidad: Estimación de un parámetro clave de la Teoría Neutral Unificada de la biodiversidad

    Directory of Open Access Journals (Sweden)

    BARRY J RICHARDSON

    2011-12-01

    la Teoría Neutral Unificada. Avances en el campo de la Teoría neutral de la Genética permiten calcular el tamaño de un vecindario genético en el contexto de aislamiento a través de procesos de distancia, lo cual sugiere una manera de estimar los tamaños equivalentes de una comunidad local (el vecindario de la comunidad ecológica. Ellos se deriva estimando valores de autocorrelación espacial a la distancia geográfica cero, lo cual se obtiene usando la distribución de frecuencias relativas de las especies de las muestras de campos, separadas por distintas distancias geográficas. Para demostrar los métodos propuestos, consistentes muestras de coleópteros fueron colectadas con la fumigación de 52 árboles en bosques de Nothofagus y 24 árboles en bosques de Araucaria, los cuales estaban ampliamente distribuidos en el centro sur de Chile. También se obtuvo un set de datos de 62000 coleópteros para otros propósitos. El tamaño efectivo estimado de las comunidades de coleópteros locales para cada tipo de bosque es alrededor de 12000 individuos para depredadores y 30000 individuos para fitófago/xilófagos. Por otra parte, la extensión geográfica de la comunidad de un barrio puede ser utilizados de otras maneras. En primer lugar, porque se relaciona con la distancia recorrida entre el nacimiento y la crianza, lo que proporciona información sobre los procesos de la comunidad a escala geográfica; entrega medidas de escalas donde la recolonización rápida es posible y escalas en las cuales las sobre que barreras no son fáciles de pasar en un hábitat. En segundo lugar, las réplicas de muestras geográficamente separadas por el tamaño de la comunidad de un barrio, no son independientes, representando pseudoréplicas de la metacomunidad característica.

  20. Utilidad en la combinación de oligonucleótidos universales para la detección del virus del papiloma humano en cáncer cervicouterino y lesiones premalignas Usefulness of combining universal oligonucleotides in detecting human papillomavirus in cervical cancer and premalignant lesions

    Directory of Open Access Journals (Sweden)

    Adela Carrillo

    2004-02-01

    Full Text Available OBJETIVO: Determinar la frecuencia y distribución del virus del papiloma humano en los diferentes estadios que conforman la historia natural del cáncer cérvico uterino, y optimizar la detección mediante el uso de diferentes oligonucleótidos universales. MATERIAL Y MÉTODOS: Se trata de un estudio transversal, descriptivo, en el que las muestras fueron colectadas durante enero a diciembre de 1999. El procesamiento de las muestras y el análisis de los datos se realizaron en el Instituto Nacional de Cancerología en la Ciudad de México. Se hizo análisis comparativo con t de Student para valores continuos y con ji cuadrada para proporciones, y análisis de concordancia entre biopsia y exudado cervical con la prueba estadística de Kappa. Para la detección del virus se utilizó la técnica de la reacción en cadena de la polimerasa (PCR con oligonucleótidos universales los cuales reconocen diferentes regiones del gen L1 (MY09/11; GP5/6; L1C1/2, y oligonucleótidos específicos para el VPH 16 y el VPH 18, así como secuenciación directa de los productos de la PCR. RESULTADOS: Se analizaron 154 muestras: 65 (42.2% citologías normales, 45 (29.2% lesiones de alto y bajo grado, y 44 (28.6% de cáncer invasor. El VPH fue detectado en 95.5% de los casos de cáncer invasor, en 91.6% de lesiones de alto grado, en 66.7% de lesiones de bajo grado y en 23.1% de citologías normales, por la PCR con al menos uno de los juegos de oligonucleótidos utilizados. La detección fue más eficiente en las muestras obtenidas por biopsia que en los exudados cervicovaginales. El porcentaje total de detección del VPH con un juego de oligonucleótidos universales (37.6% aumentó sustancialmente (60.4% al combinarlo con otros dos juegos de oligonucleótidos universales. CONCLUSIONES: La presencia del VPH de alto riesgo es elevada inclusive en mujeres con epitelios cervicales con diagnóstico citológico normal. La detección del VPH mejora al utilizar distintos

  1. Hematology and agglutination titer after polyvalent immunization and subsequent challenge with Aeromonas hydrophila in Nile tilapia (Oreochromis niloticus Hematología y título de aglutinación después de inmunización polivalente y desafío con Aeromonas hydrophila a tilapias del Nilo (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    RL Bailone

    2010-01-01

    (8 Unidades Formadoras de Colonias (UFC/mL, de vacuna conteniendo proporciones iguales de Aeromonas hydrophila, Pseudomonas aeruginosa y Enterococcus durans inactivadas con formalina, fueron testeadas por inyección intraperitoneal (i.p.. Los peces fueron desafiados 10 días después de la vacunación i.p. con la dosis (DL50-96h de 1 x 10(7 UFC de A. hydrophila/mL resuspendida en solución salina estéril. Por lo tanto, para analizar los parámetros hematológicos, la actividad antimicrobiana y aglutinante del suero de las muestras, fueron colectadas 48 h después del desafío. Antes de la infección experimental, el número de eritrocitos fue superior en los peces vacunados con 1 x 10(8 UFC/mL. Sin embargo, después del desafío, el número total de trombocitos fue mayor en los peces vacunados con la mayor dosis. Antes y después del desafío, el número total de leucocitos y el número de linfocitos presentaron mayores valores en los peces vacunados. El número de monocitos en los peces vacunados y en los inyectados con solución salina fue mayor antes del desafío. El mayor título de aglutinación frente A. hydrophila, P. aeruginosa y E. durans fue observado en los peces vacunados con 1 x 10(8 UFC/mL. Antes del desafío la actividad antimicrobiana del suero sanguíneo fue mayor en los peces no vacunados y en los vacunados con 1 x 10(8 UFC/mL, y mismo después del desafío los peces no vacunados y los inyectados con solución salina presentaron mayor actividad antimicrobiana. En este trabajo fue posible comprobar que después de 10 días la vacuna polivalente en la concentración de 1 x 10(8 UFC/mL estimuló la producción de eritrocitos, leucocitos, trombocitos y linfocitos circulantes reduciendo los niveles de glucosa.

  2. 20th century fluctuations in the abundance of siliceous microorganisms preserved in the sediments of the Puyuhuapi Channel (44° S, Chile Fluctuaciones en la abundancia de microorganismos silíceos preservados en los sedimentos del canal Puyuhuapi (44° S, Chile, durante el siglo XX

    Directory of Open Access Journals (Sweden)

    LORENA REBOLLEDO

    2005-09-01

    (44° S, 70° O en los fiordos chilenos. Se utilizan las tasas de acumulación y las concentraciones de diatomeas y silicoflagelados, carbono orgánico (Corg y sílice biogénico (SiOPAL como indicadores de la producción exportada y las fluctuaciones en la contribución de diatomeas de agua dulce como indicadores de precipitación y descargas de ríos. Se analizaron muestras de sedimentos colectadas mediante un sacatestigo de caja en dos sitios en el canal Puyuhuapi: Estación 35 (ubicada en la cabeza del fiordo dentro del seno Ventisquero; 56 m de profundidad y Estación 40 (en la mitad del canal; 270 m de profundidad de agua. Las tasas de sedimentación superficial fueron de 0,75 cm año-1 en la Estación 35 y 0,25 cm año-1 en la Estación 40. En ambos sitios el contenido promedio de SiOPAL fue de ~ 4 %. Las tasas de acumulación de diatomeas así como la contribución de diatomeas de agua dulce fueron más altas en la cabeza del fiordo (1,59 10(10 valvas m-2 año-1 y 22 % que en la mitad de este (1,08 10(10 valvas m-2 año-1 y 14 % respectivamente. Las abundancias de diatomeas fueron dos órdenes de magnitud más altas que la contribución de silicoflagelados. En general, los sedimentos del canal Puyuhuapi son caracterizados por diatomeas típicas de ambientes de altos nutrientes: en ambos sitios, las esporas del género Chaetoceros dominan la asociación de diatomeas (> 40 % de la asociación total de diatomeas, esporas de Chaetoceros radicans/cinctus, Ch. constrictus/vanheurcki, Ch. debilis y Ch. diadema. En general se observa un aumento en la tasa de acumulación de microorganismos silíceos desde finales del siglo XIX hasta comienzos de 1980, y un descenso hacia finales de la década de 1990. Asociamos una disminución en la diatomeas, sílice biogénico y silicoflagelados hacia el presente, sugiriendo una reducción en la productividad. Esto es acompañado por una disminución en las diatomeas de agua dulce desde mediados de los años 1970, con una disminuci

  3. Perfil eletrocardiográfico e conteúdo glicogênico muscular de ratos tratados com nandrolona Perfil electrocardiográfico y contenido glicogénico muscular de ratones tratados con nandrolona Electrocardiographic profile and muscle glycogen content of rats treated with nandrolone

    Directory of Open Access Journals (Sweden)

    Carlos Alberto da Silva

    2010-12-01

    áfico, contenido glicogénico y de proteínas totales de los músculos cardíacos y esqueléticos, así como las concentraciones plasmática de albúmina. MÉTODOS: Los animales del grupo tratado recibieron la droga en la concentración 5mg/kg por vía subcutánea, dos veces por semana, durante tres semanas. Una vez por semana, los ratones fueron anestesiados con Pentobarbital sódico (50mg/Kg, ip y sometidos a evaluación por medio de electrocardiograma (ECG. Después del período experimental, muestras de los músculos cardíaco (ventrículo izquierdo - VI, sóleo (S, gastrocnemio blanco (GB, gastrocnemio rojo (GV, pectoral (P, intercostal (IC y diafragma (D fueron colectadas y analizadas. Los datos (media±epm fueron evaluados de acuerdo con ANOVA, segundo test de Tukey (p>0,05. RESULTADOS: Los ratones del grupo tratado presentaron alteraciones en los siguientes parámetros cardíacos: intervalo QRS, intervalo QTc y frecuencia cardíaca, caracterizados por un aumento de estos, teniendo el ápice en el intervalo de la semana de pretratamiento a la primera semana. Las reservas de glicógeno en el VI presentaron aumento de 127%. En relación a la cantidad de proteínas totales, una diferencia significativa fue constatada en el S, GV y D. En cuanto al perfil bioquímico y al hematocrito, fue observado un aumento en el porcentaje de eritrocitos. CONCLUSIÓN: El estudio muestra que importantes alteraciones cardíacas son provocadas precozmente, sugiriendo una jerarquía en la secuencia de modificaciones que comprometen la homeostasia del organismo.BACKGROUND: We considered both the indiscriminate use of steroids by top athletes and by physically active individuals. OBJECTIVE: To evaluate the effects of nandrolone decanoate on the electrocardiographic profile, glycogen content and total-protein profile of skeletal and cardiac muscles, as well as the plasma albumin concentrations. METHODS: The drug was administered subcutaneously, at a concentration of 5 mg/kg, twice a week for three

  4. Phenotypic response of Lycopersicon chilense to water deficit Respuesta fenotípica de Lycopersicon chilense al deficit hídrico

    Directory of Open Access Journals (Sweden)

    CARLOS MALDONADO

    2003-03-01

    adjustment rather than genetic variation.La variación fenotípica que induce el ambiente en las plantas ha sido considerada como una respuesta que maximiza la adaptación a ambientes heterogéneos. Lycopersicon chilense, una especie de tomate endémica del Desierto de Atacama, presenta variaciones fenotípicas altitudinales en sus ambientes naturales, las que podrían deberse a diferentes grados de disponibilidad de agua en el suelo. Se hipotetiza que (a semillas de poblaciones provenientes de distintos ambientes, crecidas en un ambiente común, presentarán fenotipos semejantes, si las poblaciones no están diferenciadas genéticamente y que (b las diferentes poblaciones al ser sometidas a dos niveles de sequía deberían variar su constitución fenotípica con respecto al grupo control. Se estudió la respuesta de 20 rasgos fenotípicos en nueve poblaciones de Lycopersicon chilense sometidas a distintos niveles de riego. Las semillas fueron colectadas en un gradiente altitudinal (desde los 20 a los 3.075 m de altitud, germinadas, puestas a crecer a las mismas condiciones climáticas y sometidas a tres niveles de riego: bajo (80 % CC, moderado (40 % CC y severo (20 % CC. A pesar de las diferencias climáticas en sus ambientes naturales, la respuesta fenotípica de las plantas fue semejante en las nueve poblaciones cuando crecieron en un ambiente común. Diferencias significativas entre las poblaciones se encontraron en tres de los 20 rasgos investigados (el número de semillas por fruto, el peso fresco de los frutos y el volumen de los frutos. El déficit hídrico indujo una respuesta fenotípica en 12 caracteres. Los más significantivos fueron: peso seco de las raíces, cobertura, número de frutos cuajados y el número de semillas por fruto. Interacción entre las poblaciones y el tratamiento de déficit hídrico se encontró sólo en el número de semillas por fruto, el peso fresco de los frutos y el volumen de los frutos. Nuestros datos indican que la respuesta fenot

  5. Fatores de risco e proteção à infecção respiratória aguda em lactentes Factores de riesgo y protección de la infección respiratoria aguda en lactantes Risk and protective factors of acute respiratory infections in infants

    Directory of Open Access Journals (Sweden)

    Claudia Regina Cachulo Lopes

    2009-12-01

    embarazo (n=42, y el tercero la recibía en el posparto inmediato (n=45. Las infecciones presumiblemente causadas por el pneumococo en los lactantes fueron acompañadas a los tres y seis meses de vida y colectadas muestras de nasofaringe. Fueron investigados factores de riesgo como: fumadores en el domicilio, otros niños en el domicilio y amamantamiento materno exclusivo. RESULTADOS: La vacuna pneumocóccica polisacarídica no mostró protección contra infecciones causadas por pneumococo. Sin embargo, el amamantamiento materno exclusivo hasta los seis meses protegió los lactantes contra las infecciones respiratorias (OR=7,331. La colonización de la nasofaringe por pneumococo a los tres o seis meses aumentó la probabilidad de infecciones respiratorias (OR=2,792. CONCLUSIONES: Lactantes amamantados exclusivamente con leche materna hasta los seis meses son significativamente protegidos contra infecciones por pneumococos, independientemente de la vacunación pneumocóccica.OBJECTIVE: To analyze the effectiveness of maternal pneumococcal polysaccharide vaccine and the risk and protective factors for acute respiratory infections in infants. METHODS: Nested cross-sectional study of a clinical trial evaluating children of 139 women selected in a public prenatal care unit in the municipality of São Paulo, Southeastern Brazil, from 2005 to 2006. Subjects were randomly assigned to three groups: non-immunized (n=46; immunized with pneumococcal polysaccharide vaccine in the last trimester of pregnancy (n=42; and immunized with the vaccine immediately after childbirth (n=45. Infants were followed up for infections presumably caused by pneumococcus at the age of three and six months and nasopharyngeal samples were collected. Risk factors such as smokers living in the same household, siblings and exclusive maternal breastfeeding were investigated. RESULTS: The pneumococcal polysaccharide vaccine did not provide protection against pneumococcus infections. However, exclusive maternal

  6. Alteração da relação testosterona: cortisol induzida pelo treinamento de força em mulheres Alteración de la relación testosterona: cortisol inducida por el entrenamiento de fuerza en mujeres Alteration of testosterone: cortisol ratio induced by resistance training in women

    Directory of Open Access Journals (Sweden)

    Marco Carlos Uchida

    2004-06-01

    con un año de experiencia en entrenamiento de fuerza fueron sometidas al protocolo MS. Las muestras de sangre fueron colectadas antes e imediatamente después del ejercicio, en el primer día y después de ocho semanas de entrenamiento. Los tests de 1-RM y de repeticiones máximas fueron realizados también al inicio y al final después de las ocho semanas del entrenamiento de fuerza. No fueron observadas alteraciones de la masa corporal, IMC, porcentaje de masa grasa, fuerza (1-RM para los ejercicios supino, agachamiento y rosca directa. El número de repeticiones máximas al 50% de 1-RM fue aumentando solamente apenas para el supino (p The ratio between the concentration of testosterone and cortisol (T:C is frequently used as indicative of the stress level imposed by the exercise. Alterations in the concentration of these hormones are responsible for modulating several responses induced by training, such as hypertrophy and strength gain. The objective of the present study was to investigate the influence of the resistance training protocol, also known as multiple-series (MS, on the strength gain, the muscular endurance and the relation between the concentration of catabolic hormones (cortisol and anabolic hormones (testosterone. In order to test this hypothesis, five young women with one-year of strength training practice were submitted to the MS protocol. The blood samples were collected before and immediately after the exercise at the first day and after eight weeks of training. The 1-RM and the maximal repetition tests were also performed at the beginning and after eight weeks of strength training. No alterations on the body mass, on the IMC, on the fat mass percentage and on the maximal strength (1-RM on bench press, squat and arm curl were observed. The number of maximal repetitions at 50% of the 1-RM was increased only for the bench press (p < 0.05. No alterations on the concentration of the total testosterone were observed. The cortisol plasmatic

  7. Prevalência de subtipos do HIV-1 em amostra de pacientes de um centro urbano no sul do Brasil Prevalencia de subtipos de VIH-1 en muestra de pacientes de un centro urbano en el sur de Brasil Prevalence of HIV-1 subtypes in patients of an urban center in Southern Brazil

    Directory of Open Access Journals (Sweden)

    Daniel Simon

    2010-12-01

    Full Text Available OBJETIVO: Estimar a prevalência dos subtipos do HIV-1 e analisar fatores associados. MÉTODOS: Foi realizado um estudo transversal com amostra de conveniência de 80 pacientes adultos HIV-positivos atendidos em serviço especializado em DST/Aids em Canoas, RS, no período de julho de 2008 a janeiro de 2009. A determinação dos subtipos do HIV foi realizada por amplificação de fragmento do genoma viral pela reação em cadeia da polimerase seguida do seqüenciamento dos fragmentos amplificados. Variáveis sociodemográficas, clínicas e comportamentais foram coletadas em questionário estruturado. Foi realizada análise estatística univariada utilizando os testes de qui-quadrado e t de Student. RESULTADOS: Foi observada uma prevalência maior do subtipo C (43,8%; IC 95%: 32,9;54,6, seguida pelo CRF31_BC (35,0%; IC 95%: 24,6;45,5 e subtipos B (18,8%; IC 95%: 10,2;27,3 e F (2,4%; IC 95%: 0;5,9. Outros subtipos de HIV-1 não foram observados. Pacientes infectados com CRF31_BC apresentaram diagnóstico mais recente do que os pacientes infectados com o subtipo B (p OBJETIVO: Estimar la prevalencia de los subtipos de VIH-1 y analizar factores asociados. MÉTODOS: Se realizó un estudio transversal con muestra de conveniencia de 80 pacientes adultos VIH-positivos atendidos en servicio especializado en DST/Sida en Canoas, Sur de Brasil, en el período de julio de 2008 a enero de 2009. La determinación de los subtipos de VIH fue realizada por amplificación de fragmento del genoma viral por la reacción en cadena de la polimerasa seguida de la secuenciación de los fragmentos amplificados. Variables sociodemográficas, clínicas y conductuales fueron colectadas en cuestionario estructurado. Se realizó análisis estadístico univariado utilizando las pruebas de chi-cuadrado y t de Student. RESULTADOS: Se observó una prevalencia mayor del subtipo C (43,8%; IC 95%:32,9;54,6, seguido de la CRF31_BC (35,0%; IC 95%: 24,6;45,5 y subtipos B (18,8%; IC 95

  8. Influência da utilização da órtese de tornozelo durante atividades do voleibol: avaliação eletromiográfica Influencia de la utilización de la ortesis del tobillo durante las actividades del voleibol: evaluación electromiográfica Use of ankle bracing for volleyball activities

    Directory of Open Access Journals (Sweden)

    Jefferson Rosa Cardoso

    2005-10-01

    évias en el miembro dominante. Fué colectada la contracción isométrica voluntaria máxima (CIVM de cada músculo y, en seguida, la actividad electromiográfica en diferentes situaciones con y sin la ortesis, en orden aleatoria. La ortesis utilizada poseía apoyos laterales. La señal electromiográfico fué cuantificado por la raiz cuadrada de la média (RMS y normalizado por la CIVM. Se realizó un análisis de la varianza de las medidas repetidas para verificar la diferencia de la actividad eléctrica de los músculos envueltos en cada actividad, con o sin ortesis, con significación estadística de 5% (p The ankle sprain is the most frequently found acute injury in volleyball. Aiming to prevent the occurrence of ankle injuries, prophylactic equipment as the bracing had been developed. This study had the purpose to evaluate the performance of the ankle muscles (tibialis anterior, peroneous longus, and medial and lateral gastrocnemius by measuring the electrical activity in different volleyball activities (vertical jumping and lateral shuffling with and without using ankle bracing. Nine young female volleyball athletes with ages ranging from 14 to 17 years (: 15.8 ± 1.3 were evaluated, all of them without previous injuries in the dominant member. Maximal voluntary isometric contractions (MVIC of each muscle was collected, and after that, the electromyographic activity in different situations with and without using the bracing, randomly. The bracing used had two lateral supports. The electromyographic signal was quantified by the root mean square (RMS, and normalized by the MVIC. Analysis of the variance with repeated measurement was used to verify the difference of the electric activity of the muscles involved in each activity, with and without using the bracing, with 5% (p < 0.05 significance level. It was identified a statistically significant difference in phase I of the jumping in favor of the tibialis anterior (p < 0.001 and in phase II in favor of the three

  9. Geochemical composition of surface sediments near Isla de Sacrificios coral reef ecosystem, Veracruz, Mexico Composición geoquímica de sedimentos superficiales alrededor del ecosistema arrecifal de Isla de Sacrificios, Veracruz, México

    Directory of Open Access Journals (Sweden)

    Leticia Rosales-Hoz

    2008-08-01

    Full Text Available Twenty three surface sediment samples were collected in the area surrounding the Isla de Sacrificios located in the southwestern Gulf of Mexico. The temporal impact of natural discharges in the area was evaluated through the study of the textural and chemical characteristics of the sediments that surround the Veracruz Reef System. The particle size during the three sampled seasons was associated with the prevailing energy conditions. The degree of influence of terrigenous sediments was evaluated through the content of Al2O3, SiO2, Na2O and K2O, which is higher in October (2004 compared to June (2004 and/or February (2005 due to the rainy season. It was observed that gravel, CaO and CO3 were significant variables grouped in Factor 1 that suggested that gravel-sized fractions are produced by the abrasion of the reef in February (2005 and being correlated with other variables in June (2004. Another groupings were among SiO2, CaO, K2O, CO3, for October (2004 which suggested dilution of carbonates due to the terrigenous input. In addition, the factor analysis showed that grain size and heavy minerals represented by TiO2, MnO, MgO and Fe2O3 have a major importance in February (2005 associated with fluvial discharges. The factor analysis showed that the sedimentological and geochemical characteristics of the sediments varied throughout the different seasons. A correlation among Al2O3 and Na2O, P2O5, y Fe2O3 and organic carbon in the three sampling seasons suggested that these chemical components have a terrigenous source.Se estudiaron veintitrés muestras de sedimento superficial, colectadas en los alrededores de la Isla de Sacrificios, ubicada al suroeste del Golfo de México. El impacto temporal de las descargas naturales fue evaluado a través de las características texturales y químicas de los sedimentos que rodean al SAV. El tamaño de partículas de los sedimentos en las tres estaciones del año estuvo en función con las condiciones de energ

  10. Frecuencia de mutaciones asociadas con resistencia a pirimetamina y sulfadoxina. Análisis de muestras clínicas procedentes de un área endémica para Plasmodium falciparum

    Directory of Open Access Journals (Sweden)

    Moisés Wasserman

    2000-02-01

    -family: Arial">*Colectadas entre agosto y septiembre de 1997 por la Corporación de Investigaciones Biológicas de Medellín y gentilmente suministradas por el Dr. William Rojas.

  11. Estudio comparativo de las comunidades de arañas (Araneae en cultivos de algodón convencional y transgénico en el departamento del Tolima, Colombia

    Directory of Open Access Journals (Sweden)

    Flórez Daza Eduardo

    2005-07-01

    Full Text Available Los cultivos son agroecosistemas que actúan como reservorio de una gran diversidad de fauna en la que se incluyen las arañas. La importancia de su estudio radica en la necesidad de conocer más sobre su biología y relaciones ecológicas con el medio, para así aprovecharla como herramienta en el control biológico de plagas. Como una herramienta adicional, el control genético que consiste en la modificación de la información genética para conseguir unos rasgos deseados, ha tomado
    fuerza en la última década, generando un aumento en la producción a nivel nacional. La variedad de algodón Bt (Bollgard de la compañía Monsanto, produce una proteína para el control de insectos (Cry1Ac derivada de la bacteria Bacillus thuringiensis subsp. kurstaki, utilizada para el control de insectos plaga, especialmente lepidópteros. Estas proteínas han demostrado ser específicas para las plagas a las cuales están dirigidas y parecen no tener efectos nocivos para organismos benéficos. En vista de la necesidad de evaluar el efecto de esta variedad mejorada de algodón sobre la araneofauna, se llevó a cabo el presente estudio, haciendo una comparación anivel de comunidades. Para esto se llevó a cabo una fase inicial de campo, en la granja Los Marañones entre los meses de mayo y julio de 2004 cubriendo las etapas de formación de estructuras florales y maduración de un cultivo de algodón convencional y un cultivo de algodón genéticamente
    modificado (Bollgard en el municipio de Espinal, departamento del Tolima, Colombia. Se colectaron un total de 2.764 arañas; 1.259 fueron colectadas en el algodón convencional y 1.505 en el algodón Bt. Se registraron 83 morfoespecies en 17 familias para el algodón convencional y 86 morfoespecies en 20 familias para el algodón Bt. Las familias más abundantes fueron Theridiidae y Linyphiidae para los dos cultivos. No hubo diferencias estadísticamente significativas entre las diversidades de los

  12. Suplementação de ácidos graxos ômega 3 em atletas de competição: impacto nos mediadores bioquímicos relacionados com o metabolismo lipídico Adición de ácidos grasos omega 3 en atletas de competición: impacto en los mediadores bioquímicos relacionados con el metabolismo lipídico Omega 3 fatty acids-supplementation to competition athletes: impact on the biochemical indicators related to the lipid metabolism

    Directory of Open Access Journals (Sweden)

    Priscila de Mattos Machado Andrade

    2006-12-01

    ácido docosapentaenóico. Muestras de sangre fueron colectadas inmediatamente antes (T0, a los quince (T15, a los treinta (T30 y a los cuarenta y cinco (T45 días de suplementación para análisis de la composición de los ácidos grasos por cromatografía gaseosa y para cuantificación de las lipoproteínas plasmáticas a través de kits comerciales específicos. RESULTADOS: Los resultados revelaron un desajuste en la dieta de los atletas considerando la ingestión g/kg de masa corporal de los macro nutrientes. El análisis del cuestionario de frecuencia de consumo mostró que los atletas no ingirieron regularmente fuentes alimentares de omega 3 y que el consumo de pescado, en 85% de la muestra, era inferior o igual a 1 vez por semana. El perfil de ácidos grasos plasmáticos mostró un aumento de los ácidos grasos poliinsaturados omega 3 (P 0,05. CONCLUSIÓN: La suplementación de ácidos grasos N-3 en atletas de natación altera los indicadores bioquímicos del metabolismo lipídico, influyendo en la reducción de las lipoproteínas plasmáticas, ricas en colesterol y en la prevención de enfermedades cardiovasculares.PURPOSE: To assess the effects of omega 3 fatty acid supplementation to swimmers on biochemical indicators. METHODS: Male elite swimmers (n = 14 were assessed in a placebo-controlled randomized study over a 6-week (45-day experimental period. The placebo group (GP received mineral oil (n = 6 and the supplemented group (GOP received fish oil (n = 8 containing a total of 950 mg of eicosapentaenoic acid and 500 mg of docosapentaenoic acid. Immediately before starting the supplementation (T0, as well as 15 (T15, 30 (T30 and 45 (T45 days after that point, blood samples were collected and analyzed by gas chromatography for fatty acids composition, and by specific commercial kits for plasmatic lipoproteins. RESULTS: The results showed that the diets of the swimmers were unbalanced regarding the macronutrient ingestion/body weight ratio (g/kg. The

  13. Efecto de la sequía en la producción de biomasa y grano de frijol Drought effect in bean biomass and grain production

    Directory of Open Access Journals (Sweden)

    Efraín Acosta-Díaz

    2011-04-01

    excepción, todas estas variedades fueron colectadas en la región de prueba, lo que demuestra la importancia de la adaptación local en condiciones de sequía.Intermittent drought is most limiting factor for bean production (Phaseolus vulgaris L. under seasonal conditions in Mexico. Aim of this work was to determine drought effect on biomass accumulation of sprout and grain yield in creole and introduced seasonal bean varieties. Two experiments were set, one with 21 native varieties and another with 15 introduced varieties, from different uncertain type growth habit, at Academic Unit La Asención from Agronomy School of Universidad Autónoma de Nuevo León, Mexico in 2009. Experiments were done under two treatments of soil humidity: irrigation during whole cycle and drought. In irrigation treatment soil was kept above 60% of serviceable humidity during cultivation cycle, by precipitation and four irrigation aids (two before and other two after flowering, while in treatment of drought irrigation was suspended when flowering started. In both experiments, under drought condition biomass accumulation of sprout and grain yield was significantly lower (p≤ 0.01 than in irrigation treatment. In general, effect of drought treatment on sprout's dry weight was greater in native varieties, while effect on grain yield was greater in introduced varieties. In drought, varieties with higher yield were: native, Pinto-2, Pinto-1, Amarillo Mantequilla, Boleado, Bayo Blanco, Canelo and Quipincillo Rojo-1; and introduced, Peruano, Flor de Mayo Media Oreja, Pinto-5 and Ojo de Cabra. In accordance with drought susceptibility index and geometric average, most efficient varieties for production of grain yield under both humidity conditions were: Pinto-2, Amarillo Mantequilla, Pinto-1, Boleado, Peruano, Flor de Mayo Media Oreja, Pinto-5 and Ojo de Cabra; without exception, all these varieties were collected in test region, which demonstrates importance of local adaptation under drought

  14. Avaliação de atividades de controle para enteroparasitos em uma aldeia Kaingáng do Paraná Evaluación de actividades de control para enteroparásitos en una aldea Kaingáng de Paraná, Sur de Brasil Evaluation of enteroparasite control activities in a Kaingáng community of Southern Brazil

    Directory of Open Access Journals (Sweden)

    Max Jean de Ornelas Toledo

    2009-12-01

    fueron colectadas 250, 147 y 126 muestras de heces, respectivamente. Fueron utilizados los métodos de sedimentación espontánea, centrífugo-fluctuación y Kato/Katz. Las condiciones de vivienda e higiene fueron determinadas utilizándose cuestionario aplicado a 69 (2004, 57 (2005 y 38 (2006 de las 90 familias. RESULTADOS: Las prevalencias totales de enteroparásitos de 2004-06 fueron, respectivamente, 91,6%, 94,6% y 87,3%, sin reducción significativa. La prevalencia de algunas especies disminuyó, mientras que la de otras aumentó significativamente. Las infecciones de alta intensidad por geohelmintos presentaron tasas menores de 2% en el período de estudio. Hubo aumento en las tasas de entrevistados que relataron usar el baño (pOBJECTIVE: To analyze the parasitological state of families in an indigenous community after institution of enteroparasite control measures. METHODS: A longitudinal study was conducted between 2004 and 2006 among 447 individuals of the Kaingáng ethnic group, in the municipality of Cândido de Abreu, Southern Brazil. The enteroparasite control measures were: sanitation improvements in 2003, antiparasite treatments that were administered during the study period, and health education activities that were started in 2005. Parasitological health indicators were obtained through three coproparasitological surveys (in 2004, 2005 and 2006, in which 250, 147 and 126 stool samples, respectively, were collected. These were evaluated using the spontaneous sedimentation, centrifugation-flotation and Kato-Katz methods. Housing and hygiene conditions were assessed by means of a questionnaire applied to 69 (2004, 57 (2005 and 38 (2006 of the 90 families. RESULTS: The overall prevalences of enteroparasites were 91.6% (2004, 94.6% (2005 and 87.3% (2006 and did not show any significant reduction. The prevalence of some species decreased, while the prevalence of others increased significantly. High-intensity infections due to geohelminths presented rates of

  15. The effects of temperature and oxygen availability on intracapsular development of Acanthina monodon (Gastropoda: Muricidae El efecto de la temperatura y la disponibilidad de oxígeno sobre el desarrollo intracapsular de Acanthina monodon (Gastropoda: Muricidae

    Directory of Open Access Journals (Sweden)

    MIRIAM FERNÁNDEZ

    2006-06-01

    stages per capsule. This suggests that even when a comparable number of embryos develops at high temperature, subsequent survival may be affected, since developed embryos attained smaller sizes. The negative effect of high temperature on embryo aggregation has also been reported for Brachyuran crabs, affecting female patterns of oxygen provision and brooding costs. This evidence suggests that aggregating embryos in the ocean, even under optimum oxygen conditions, may be negatively affected at high temperatures. Spatial patterns of distribution of brooding species in the ocean tend to agree with this prediction. Our analysis is particularly relevant given the current increase in temperature and the proportion of anoxic areas in the world's oceansLos organismos marinos y dulceacuícolas muestran modelos similares de cuidado parental y están confrontados con similares restricciones para incubar, lo que sugiere que existen límites ambientales comparables guiando la evolución del cuidado parental en sistemas acuáticos. El bajo coeficiente de difusión y la baja solubilidad del oxígeno en ambientes acuáticos afecta la adquisición de oxígeno y por lo tanto la capacidad para agregar los embriones. El efecto de otras variables ambientales críticas, como la temperatura, es menos claro. Se evaluaron los efectos de la temperatura y la disponibilidad de oxígeno sobre (1 el número de embriones desarrollados y sin desarrollar, (2 la proporción de embriones que alcanza estados avanzados de desarrollo (contabilizando no solo embriones desarrollados y sin desarrollar sino también anormales, (3 la asincronía en el desarrollo (estimada solo cuando ocurrió desarrollo embrionario, y (4 el tamaño final, con el objetivo final de identificar las limitaciones que estos factores imponen sobre el cuidado parental en el mar. La especie modelo fue el gastrópodo Acanthina monodon. Cápsulas recientemente depositadas fueron colectadas e incubadas bajo diferentes condiciones

  16. Culicídeos em bromélias: diversidade de fauna segundo influência antrópica, litoral de São Paulo Culícidos en bromelias: diversidad de fauna según influencia antrópica, litoral de Brasil Culicidae in bromeliads: diversity of species by anthropic environments, coastal area of Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Gisela R A M Marques

    2008-12-01

    comparadas con base en estimaciones de la diversidad para medir la riqueza, dominancia y análisis de varianza (ANOVA. RESULTADOS: Se colectaron 31.134 formas inmaduras de mosquitos en las bromelias, distribuidas en siete géneros y 37 especies. El ambiente urbano registró mayor abundancia, 14.575 individuos, seguido del periurbano con 10.987, y la selva virgen, con el menor número de ejemplares, 5.572. Fueron colectadas 30 especies en el habitat urbano, 32 en el periurbano y 33 en la selva. Las especies dominantes fueron Culex (Microculex pleuristriatus en los ambientes urbano y perirurbano, y Culex ocellatus en la selva. De acuerdo con el test de ANOVA la frecuencia de mosquitos en bromelias no fue diferente entre los ambientes investigados (F=0,5564; p=0,5769. La diversidad de especies en la selva fue mayor, y semejante entre el periurbano y el urbano. CONCLUSIONES: La composición específica de culícidos en bromelias de suelo se mostró diversificada, siendo mayor en aquellas de ambientes de selva. Las especies dominantes fueron Cx. (Mcx. pleuristriatus e Cx. ocellatus.OBJECTIVE: To compare diversity of Culicidae species collected from ground bromeliads in an urban, and periurban area and primitive forest. METHODS: Study carried out in the city of Ilhabela, northern stretch of the coast of the State of São Paulo, Southeastern Brazil, from March 1998 to July 1999. Fortnightly immature Culicidae collections were undertaken in bromeliad tanks located in urban, and periurban areas, and primitive forest. The frequencies of species collected in the different environments were compared based on the estimated diversity to assess their richness, dominance and variance (ANOVA. RESULTS: A total of 31,134 immature mosquitoes from seven different genera and 37 species were collected from ground bromeliads. The urban environment had the greatest abundance (14,575 specimens, followed by the periurban (10,987 and then the forest environment (5,572. There were collected 30 species

  17. Determinantes precoces da glicemia casual em adultos da coorte de nascimentos de 1982, Pelotas, RS Determinantes precoces de la glicemia casual en adultos de la cohorte de nacimientos de 1982, Pelotas, Sur de Brasil Early determinants of random blood glucose among adults of the 1982 birth cohort, Pelotas, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Bernardo L Horta

    2008-12-01

    Full Text Available OBJETIVO: Avaliar o efeito de variáveis socioeconômicas, peso ao nascer, duração da amamentação e mudança de renda sobre a glicemia ao acaso em jovens adultos. MÉTODOS: Estudo sobre coorte de nascidos em 1982, quando os 5.914 nascimentos hospitalares ocorridos na cidade de Pelotas foram identificados e as mães entrevistadas. As crianças, cujas famílias residiam na área urbana da cidade, foram acompanhadas diversas vezes. Em 2004-5, 4.927 indivíduos da coorte foram entrevistados e 3.730 tiveram sangue da polpa digital coletado para medida da glicemia casual. Foi avaliada a associação entre glicemia casual e cor da pele, renda familiar ao nascer, escolaridade materna, mudança de renda entre 1982 e 2004-5, peso ao nascer e duração da amamentação. RESULTADOS: A média da glicemia foi de 97,3±15,1mg/dL, sendo maior entre os homens. Nenhuma das variáveis estudadas esteve associada com a glicemia dos homens. Entre as mulheres, a escolaridade materna, a renda familiar aos 23 anos e o peso ao nascimento estiveram inversamente associados com a glicemia. Contudo, o efeito do peso ao nascer perdeu a significância estatística na análise multivariável. CONCLUSÕES: O peso ao nascer e a duração da amamentação não apresentaram efeito em longo prazo sobre a glicemia casual, apenas a escolaridade materna e a renda atual estiveram associados com a glicemia casual nas mulheres.OBJETIVO: Evaluar el efecto de variables socioeconómicas, peso al nacer, duración del amamantamiento y cambio de renta sobre la glicemia al azar en jóvenes adultos. MÉTODOS: Estudio sobre cohorte de nacidos en 1982, cuando los 5.914 nacimientos hospitalares ocurridos en la ciudad de Pelotas fueron identificados y las madres entrevistadas. Los niños, cuyas familiar residían en el área urbana de la ciudad, fueron acompañadas diversas veces. En 2004-5, 4.927 individuos de la cohorte fueron entrevistados y 3.730 tuvieron sangre de la pulpa digital colectada

  18. Avaliação da estrutura dos centros de atenção psicossocial do município de São Paulo, SP Evaluación de la estructura de los centros de atención psicosocial del municipio de Sao Paulo, Sureste de Brasil Evaluation of psychosocial healthcare services in the city of São Paulo, Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Andréia de Fátima Nascimento

    2009-08-01

    "equipamentos-síntese" dos quais os usuários não recebem alta, até serviços que encaminham e dão alta após a estabilização dos sintomas dos usuários, numa tentativa de construção de uma rede de cuidados.OBJETIVO: Describir la estructura física, recursos humanos y modalidades de atención existentes en los centros de atención psicosocial (CAPS. MÉTODOS: Fueron incluidos en el estudio 21 CAPS para atención de adultos, vinculados a la Secretaria Municipal de Salud de Sao Paulo (Sureste de Brasil, entre 2007 y 2008. Fueron colectadas informaciones sobre las instalaciones físicas de los servicios, recursos humanos disponibles y procedimientos de cuidado al paciente, utilizando instrumento estandarizado. Fueron realizados análisis descriptivos de los datos y la prueba de Chi-cuadrado para evaluar la asociación entre los tipos de actividades y el origen y localización de los servicios. RESULTADOS: Diez servicios fueron creados como ambulatorios y posteriormente transformados, ocho eran hospitales-día y apenas tres fueron creados como CAPS. Ningún servicio funcionaba diariamente durante 24 horas. Mitad de los servicios funcionaba en inmuebles alquilados, con instalaciones físicas inadecuadas especialmente para atenciones grupales. La composición de los equipos de servicios fue bastante diversa. Las actividades desempeñadas en los CAPS fueron heterogéneas, con mayor valorización de las actividades grupales desarrolladas con usuarios dentro de los CAPS y poca integración a los otros equipos de salud. Los servicios de origen ambulatorio presentaban actividades artesanales y los que habían sido hospitales-día realizaban más actividades de integración psicofísica. El perfil de actividades se relacionó con la distribución regional de los servicios. CONCLUSIONES: La heterogeneidad de los CAPS parece relacionarse con la historia de los programas de salud mental implementados en el municipio desde la década de 1980 y a la diversidad socioeconómica y cultural

  19. Patterns of deliveries in a Brazilian birth cohort: almost universal cesarean sections for the better-off Padrones de partos en una cohorte de nacimientos: cesáreas casi universales para los riesgos Padrões dos partos em uma coorte de nascimentos: cesarianas quase universais para os ricos

    Directory of Open Access Journals (Sweden)

    Aluísio J D Barros

    2011-08-01

    fueron entrevistadas aún en el hospital, cuando informaciones detalladas de la gestación, el parto y el recién nacido, junto con una historia de salud materna y características de la familia fueron colectadas. Características maternas y el financiamiento del parto fueron los principales factores estudiados. También se hizo descripción de la distribución de las cesáreas por hora del día y día de la semana. Técnicas de padrón de análisis descriptivo y pruebas chi-cuadrado para comparar proporciones y regresión Poisson para explorar el efecto independiente de predictores de la cesárea fueron los métodos utilizados. RESULTADOS: La tasa global de cesáreas fue de 45%, 36% entre pacientes del servicio público y 81% en el servicio privado, donde se relató que 35% de las cesáreas fueron electivas. Las cesáreas fueron más frecuentes martes y miércoles, con una reducción de cerca de un tercio los domingos, mientras que los partos normales presentaron distribución uniforme a lo largo de la semana. El horario de las cesáreas en el servicio público y en el privado fue muy diferente. La escolaridad materna se asoció positivamente con la cesárea entre las madres del servicio público, pero no del privado. CONCLUSIONES: La cesárea fue muy frecuente entre las madres más ricas, y fuertemente asociada con la escolaridad materna entre pacientes del servicio público. Los padrones descritos son compatibles con la hipótesis de que las cesáreas son hechas, en gran parte, para atender la conveniencia de las agendas de los médicos. La situación actual sólo será revertida con políticas radicales.OBJETIVO: Descrever o padrão dos partos em uma coorte de nascimentos, comparando partos normais e cesarianos. MÉTODOS: Todos os recém-nascidos de moradoras da área urbana de Pelotas (RS em 2004 foram recrutados para uma coorte de nascimentos. As mães foram entrevistadas ainda no hospital, quando informações detalhadas sobre a gestação, o parto e o rec

  20. Utilização de serviços de saúde por adultos da coorte de nascimentos de 1982 a 2004-5, Pelotas, RS Utilización de servicios de salud por adultos de la cohorte de nacimientos de 1982 a 2005, Pelotas, Sur de Brasil Pattern of health services utilization by adults of the Pelotas birth cohort from 1982 to 2004-5, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Juvenal S Dias-da-Costa

    2008-12-01

    acompañados hasta los 23 años. El desenlace fue definido por informaciones colectadas sobre consultas con profesionales de la salud realizadas en el año anterior a la entrevista entre 2004 y 2005. Los locales de consulta fueron clasificados como públicos, privados o seguros de salud. Los análisis descriptivos fueron realizados para utilización y tipo de servicio de salud. Regresión de Poisson fue utilizada en el análisis ajustado. RESULTADOS: De los entrevistados, 72,0% tuvieron consulta con profesionales de la salud en el año anterior a la entrevista; 86,2% (IC 95% 84,7;87,7 de las mujeres y 59,3% (IC 95% 57,3;61,3 de los hombres. A pesar de que se excluyeron las consultas con ginecólogos, las mujeres continuaban más consultas que los hombres, 68,4% (IC 95% 66,4;70,4. La utilización de los servicios de salud fue más frecuente entre los entrevistados de mejor nivel socioeconómico. Diferencia de menor uso en relación al color de piel no blanca fue observada solamente entre los jóvenes del sexo masculino. Hubo diferencias en relación al tipo de profesional consultado por hombres y mujeres y también conforme a la renta familiar. Hombres y mujeres consultaron más frecuentemente el sistema público, los servicios por convenio y en menor proporción el sistema privado. CONCLUSIONES: La situación socioeconómica influencio la utilización y el tipo de servicio de salud, con hombres y mujeres clasificados como "pobres en el momento", indicando menor utilización de servicios. Tales diferencias socioeconómicas pueden ser indicativas de dificultades de acceso al sistema de salud.OBJECTIVE: To describe the pattern of health services utilization by young adults. METHODS: Longitudinal study in Pelotas (Southern Brazil, in which the individuals were identified at birth in 1982 and followed up until 23 years of age. The outcome was defined by information collected about visits to health professionals that were attended in the year before the interview, between 2004

  1. Utilização de assentos de segurança por crianças matriculadas em creches Utilización de asientos de seguridad por niños matriculados en guarderías Child safety restraint use among children attending day care centers

    Directory of Open Access Journals (Sweden)

    Sergio Ricardo Lopes de Oliveira

    2009-10-01

    asociados. MÉTODOS: Estudio transversal observacional, con muestreo estratificado, realizado en 15 guarderías de la ciudad de Maringá (Sur de Brasil, entre los meses de marzo y mayo de 2007. Cada guardería fue visitada en sólo un día lectivo. El resultado considerado fue la utilización de asiento de seguridad infantil por niños de hasta cuatro anos de edad. Carros (N=301 que transportaban niños menores de cuatro anos de edad fueron abordados y las informaciones fueron colectadas por medio de cuestionarios semi-estructurados. Las variables relacionadas a distribución de adultos y niños en los asientos del vehículo, situación de restricción de adultos pasajeros y niños y sexo del conductor fueron analizadas. Para análisis de los datos se aplicó la prueba exacta de Fisher, ji-cuadrado de Mantel-Haenszel y regresión logística. RESULTADOS: Entre los conductores abordados, 51,8% usaban cinturón de seguridad (60,4% de las mujeres, 44,9% de los hombres. Entre los niños, 36,1% usaban asientos de seguridad infantil, 45,4% eran transportadas sueltas, 16,0% estaban en las piernas de adultos, 2,7% usaban el cinturón de seguridad. Según la regresión logística, los factores que más influenciaron el uso de asientos de seguridad infantil fueron: edad del niño inferior a 15 meses (OR=3,76, uso de cinturón de seguridad por el conductor (OR= 2,45 y niños pertenecientes a los estratos sociocupacionales de mayor renta y escolaridad (OR=1,37. CONCLUSIONES: La utilización de asientos de seguridad infantil se mostró asociada a la edad del niño, uso de cinturón de seguridad por el conductor y estrato sociocupacional de la guardería. Frente al bajo índice de utilización, el uso de los asientos de seguridad infantil surge como desafío a la medicina preventiva en Brasil, exigiendo atención y actuación para su diseminación en la población.OBJECTIVE: To estimate the prevalence of child safety restraint use and factors associated. METHODS: Observational cross

  2. Uso de medicamentos do nascimento aos dois anos: Coorte de Nascimentos de Pelotas, RS, 2004 Uso de medicamentos desde el nacimiento hasta los dos años: Cohorte de Nacimientos de Pelotas, Sur de Brasil, 2004 Medicine use from birth to age two years: the 2004 Pelotas (Brazil Birth Cohort Study

    Directory of Open Access Journals (Sweden)

    Edilson Almeida de Oliveira

    2010-08-01

    utilização de medicamentos nesta coorte foi elevada e remete à necessidade de priorização do uso racional de medicamentos nos primeiros anos de vida.OBJETIVO: Describir la utilización de medicamentos en niños a los tres, 12 y 24 meses de edad. MÉTODOS: Estudio transversal utilizando datos de la Cohorte de Nacimientos de Pelotas, Sur de Brasil, de 2004. Fueron incluidas 3.985 niños a los tres meses, 3.907 a los 12 meses y 3.868 a los 24 meses de edad. El hecho considerado fue el uso de medicamentos por los niños en los 15 días anteriores a la entrevista. Informaciones sobre las variables independientes (medicamentos utilizados, fuente de indicación, forma de adquisición, regularidad en el uso y grupos terapéuticos fueron colectadas por medio de cuestionario estandarizado, en entrevista a los padres en los domicilios. RESULTADOS: Las prevalencias en el uso de medicamentos a los tres, 12 y 24 meses fueron de 65,0% (IC 95%: 63,5;66,5, 64,4% (IC 95%: 62,9;65,9 e 54,7% (IC 95%: 53,1;56,2, respectivamente. Con el avance de la edad se observó disminución en el número total de medicamentos utilizados y aumento en la automedicación, ésta última alcanzando el 34% a los 24 meses. También, la frecuencia en el uso de medicamentos en carácter eventual aumentó y disminuyó con relación al uso continuo. Los medicamentos fueron adquiridos principalmente con recursos propios y cerca de 10% fue adquirido por el Sistema Único de Salud. Se observó cambio en el perfil de los grupos terapéuticos más utilizados en función de la edad. A los tres meses, el mayor uso fue de medicamentos dermatológicos (36%; a los 12 meses, de medicamentos para el sistema respiratorio (24%; e, a los 24 meses, de analgésicos (26%. Al compararse el uso a los 24 meses con el de los tres meses de edad se observó disminución en la utilización de: medicamentos destinados al tracto alimenticio y metabolismo, a los órganos de los sentidos, sistema cardiovascular y productos dermatol

  3. Efeito analgésico residual do fentanil em pacientes submetidos a revascularização do miocárdio com circulação extracorpórea Efecto analgésico residual del fentanil en pacientes sometidos a revascularización del miocárdio con circulación extracorpórea Residual analgesic effect of fentanyl in patients undergoing myocardial revascularization with cardiopulmonary bypass

    Directory of Open Access Journals (Sweden)

    Adriana Machado Issy

    2002-09-01

    estudio es evaluar el efecto analgésico del fentanil residual en el primero y segundo día después de revascularización miocárdica, bien como dosificar su concentración. MÉTODO: Fueron investigados 11 pacientes sometidos a revascularización del miocárdio con circulación extracorpórea, bajo anestesia general empleando 50 µg.kg-1 de fentanil, por vía venosa. Se evaluó la analgesia por la escala numérica verbal en los tiempos cero (extubación, 70 minutos, 3, 5, 8 y 12 horas en el primero día y en los tiempos cero (24 horas después de extubación, 70 minutos, 3, 5, 8 y 12 horas en el segundo día. El dolor fue evaluado mediante tos vigorosa y fisioterapia respiratoria. A cada mensuración del dolor, se cuestionó sobre la necesidad del paciente recibir complemento analgésico. Las muestras plasmáticas del fentanil fueron colectadas en los tiempos cero, 70 minutos, 3, 5, 8 y 12 horas del primero y segundo día de pós-operatorio y mensuradas por el método de radioinmunoensayo. RESULTADOS: La intensidad del dolor varió en media de 1,9 a 3,7 en el primero día y de 2,1 a 3,8 en el segundo día de pós-operatorio. Los niveles plasmáticos de fentanil (> 1 ng/ml, evidenciaron su contribución en la analgesia en el primero día después de la operación. CONCLUSIONES: A pesar de no haber sido observada correlación entre la concentración plasmática residual de fentanil y la intensidad del dolor, los pacientes presentaron dolor leve durante todo el período investigado (ENV BACKGROUND AND OBJECTIVES: In spite of the frequent use of high doses of fentanyl for major surgeries, the correlation of its residual plasma concentration to postoperative analgesia deserves further investigation. This study aimed at evaluating the residual analgesic effect of fentanyl in the first and second postoperative days of myocardial revascularization, as well as quantifying its concentration. METHODS: Participated in this study 11 patients undergoing myocardial revascularization

  4. Growth patterns in early childhood and the onset of menarche before age twelve Patrones de crecimiento en la infancia precoz y ocurrencia de menarca antes de doce años de edad Padrões de crescimento na infância precoce e ocorrência de menarca antes de doze anos de idade

    Directory of Open Access Journals (Sweden)

    Jeovany Martínez

    2010-04-01

    ón fueron colectadas por medio de entrevistas domiciliares. Los análisis estadísticos empleados fueron el chi-cuadrado de Pearson y ji-cuadrado para tendencia linear. Así mismo, análisis multivariable fue realizado usando la regresión de Poisson, siguiendo un modelo jerárquico. RESULTADOS: El promedio de edad de menarca fue de 12,4 años y la prevalencia de menarca antes de los 12 años fue de 24,3%. Mayores valores de escores Z en los índices peso/edad, altura/edad y peso/altura a los 19,4 y 43,1 meses correspondieron a mayores riesgos de presentar menarca antes de los 12 años. Ese riesgo fue sistemáticamente mayor en la edad de 43,1 meses. Niñas que experimentaron rápido crecimiento en escore Z de peso/edad entre el nacimiento y 19,4 meses o en escore Z de peso/edad o altura/edad entre 19,4 y 43,1 meses, mostraron mayores riesgos. El riesgo de menarca antes de los 12 años fue más elevado cuando el crecimiento rápido en escore Z de peso/edad ocurrió en ambos períodos; y aún mayor entre las niñas del primer tercil de la curva de Williams. Crecimiento rápido en escore Z de peso/altura no estuvo asociado con menarca antes de los 12 años. CONCLUSIONES: La edad de menarca se mostró influenciada por el estado nutricional y patrones de crecimiento durante la infancia precoz. Así, evitar sobrepeso y obesidad en la infancia precoz manteniendo un patrón "normal" de crecimiento parece ser importante para prevenir problemas de salud en futuras etapas de vida.OBJETIVO: Avaliar a relação entre padrões de crescimento na infância precoce e ocorrência de menarca antes de 12 anos de idade. MÉTODOS: O estudo incluiu 2.083 mulheres do estudo de coorte de nascidos em Pelotas, RS, de 1982. Variáveis antropométricas, comportamentais e relacionadas à gestação foram coletadas por meio de entrevistas domiciliares. As análises estatísticas empregadas foram o qui-quadrado de Pearson e qui-quadrado para tendência linear. Além disso, análise multivariável foi

  5. Resistência à insulina com a suplementação de creatina em animais de experimentação Resistencia a la insulina con la suplementación de creatina en animales de experimentación Insulin resistance with creatine supplementation in laboratory animals

    Directory of Open Access Journals (Sweden)

    Beatriz L. Costallat

    2007-02-01

    efectos de la suplementación oral de creatina para evaluar la posibilidad de la ocurrencia de resistencia a la insulina in vivo. MÉTODOS: Cuarenta y ocho ratones Wistar (24 hembras/24 machos fueron divididos en dos grupos de 24 (control y estudio y subdivididos en seis grupos de ocho. Por cuatro semanas, fueron alimentados con ración padrón, teniendo libre acceso al agua. Además de eso, el grupo estudio recibió dieta suplementaria de creatina (0,4 g de creatina para 30 mL de água por ratón/día. En los días 7, 14, 21 e 28 del experimento, 12 ratones fueron anestesiados (tiopental sódico 0,15 mL/100 g, despues de seis horas de ayuno, y sometidos a un test intravenoso de tolerancia a la insulina (0,5 ml de una solución de 30% de insulina humana regular y 70% de salina. Las muestras de sangre fueron colectadas de las venas de los rabos de los ratones, en los tiempos basal, tres, seis, nueve, 12 y 15 minutos trás la administración de insulina. La medida de la glucosa fué hecha por el método de la glucosa oxidasa. El trabajo fué previamente aprobado por lo Comité de Ética en Investigación del CCMB-PUCSP. RESULTADOS: La media constante de descenso de la glucosa (K ITT fué calculada por la fórmula 0,693/T1/2. El grupo de estudio cuando fué comparado con el grupo control presentó resistencia insulínica en el día 21 (p INTRODUCTION AND OBJECTIVE: Creatine supplementation has been used in order to improve muscular performance. This substance affects glucose metabolism and stimulates the in vitro as well as the in vivo insulin secretion. Nevertheless, long-term insulin hypersecretion may also induce insulin resistance. The present work analyzed the effects of creatine oral supplementation in order to evaluate the possibility of occurrence of resistance to in vivo insulin. METHODS: Forty-eight Wistar rats (24 female/24 male were divided in two groups of 24 (control and study and subdivided in six groups of eight. They were fed with standard food during four

  6. HIV rapid testing as a key strategy for prevention of mother-to-child transmission in Brazil Prueba rápida para el HIV como una estrategia para la prevención de la transmisión vertical en Brasil Teste rápido para o HIV como estratégia de prevenção da transmissão vertical no Brasil

    Directory of Open Access Journals (Sweden)

    Valdiléa G Veloso

    2010-10-01

    provide this population access to health care services after hospital discharge.OBJETIVO: Analizar la viabilidad de evaluación rápida del HIV entre gestantes en la admisión en la maternidad y de intervenciones para reducir la transmisión perinatal del HIV. MÉTODOS: Muestra de conveniencia de mujeres que desconocían su situación serológica para el HIV al ser admitidas para el parto en maternidades públicas de Rio de Janeiro (Sureste y de Porto alegre (Sur de Brasil, entre marzo de 2000 y abril de 2002. Las mujeres fueron aconsejadas y evaluadas con prueba rápida Determine HIV1/2 en la maternidad. Infección por el HIV fue confirmada por el algoritmo brasilero para el diagnóstico de la infección por el HIV. La transmisión intra- útero fue determinada por el PCR-DNA-HIV. Fueron realizados análisis descriptivos de los datos sociodemográficos, número de gestaciones y de abortos previos, número de visitas de prenatal, momento de la evaluación para el HIV, resultado de la prueba rápida para el HIV, intervenciones recibidas por los recién nacidos y de transmisión vertical del HIV, de acuerdo con cada ciudad. RESULTADOS: La prevalencia de HIV entre las mujeres fue de 6,5% (N=1.439 en Porto Alegre y 1,3% (N=3,778 en Rio de Janeiro. La mayoría fue evaluada durante el trabajo de parto en Porto Alegre y en el postparto, en Rio de Janeiro. Ciento y cuarenta y cuatro niños nacieron de 143 mujeres infectadas por el HIV. Todos los recién nacidos recibieron al menos la profilaxia con zidovudina oral, excepto uno en cada ciudad. Fue posible evitar cualquier exposición a la leche materna en 96,8% y 51,1% de los recién nacidos en Porto Alegre y en Rio de Janeiro, respectivamente. La zidovudina inyectable fue administrada durante el trabajo de parto a 68,8% de los recién nacidos en Porto Alegre y 27,7% en Rio de Janeiro. Entre aquellos con muestras de sangre colectadas hasta 48 horas de nacimiento, la transmisión intra-útero fue confirmada en cuatro casos en Rio

  7. Morfologia externa da operária de Lestrimelitta ehrhardtti (Hymenoptera: Meliponini

    Directory of Open Access Journals (Sweden)

    PARIZOTTO DANIELE. R

    2010-08-01

    ; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

    ABSTRACT

     Workers of Lestrimelitta ehrhardtti Friese were studied based on a great number of individuals collected in Castro municipality, Paraná State, Brazil. The specimens were described morphologically, measured and illustrated.

    KEY-WORDS: Apidae, stingless-bees, cleptobiotic, Neotropical.

     

    RESUMEN

    Se estudió un gran número de obreras de Lestrimelitta ehrhardtti Friese colectadas en el municipio de Castro, Paraná, Brasil. Los especímenes fueran descritos  morfológicamente, medidos e ilustrados.

    PALABRAS CLAVE: Apidae, abejas sin aguijón, cleptobiótica, Neotropical.

  8. INFLUENCIA DE LA FASE LUNAR EN LAS TASAS DE CAPTURA DE Selar crumenophthalmus (CARANGIDAE EN EL CARIBE DE COLOMBIA. UNA APROXIMACIÓN POR MODELOS LINEALES GENERALIZADOS

    Directory of Open Access Journals (Sweden)

    Altamar López Jairo

    2010-12-01

    ; mso-footer-margin:36.0pt; mso-paper-source:0;} div.Section1 {page:Section1;} -->

    Las tasas de captura de Selar crumenophthalmus provenientes de los desembarcos registrados en el norte del mar Caribe de Colombia fueron analizadas y estandarizadas mediante Modelos Lineales Generalizados (MLG. Se utilizó información colectada entre 1994 y 2001. Los factores que se utilizaron como predictores lineales fueron: año, mes, fase lunar, sector geográfico, y estrato de profundidad. Las mayores tasas de captura fueron detectadas durante los dos días de luna nueva máxima en el sector del Parque Nacional Natural Tayrona, lo cual indica que la mayor disponibilidad del recurso, dado su hábito nocturno y fototaxis positiva, está muy localizada en el tiempo. Esta condición ha de incorporarse en los esquemas ordenamiento, una vez que facilita la implementación de mecanismos de control pesquero. Se registró una disminución de la tasa de captura en los últimos dos años del periodo examinado, tendencia que sugiere el deterioro de la abundancia