WorldWideScience

Sample records for axonopodis pv phaseoli

  1. Characterization of Xanthomonas axonopodis pv. phaseoli isolates

    NARCIS (Netherlands)

    Nunes, W.M.C.; Corazza, M.J.; De Souza, S.A.C.D.; Tsai, S.M.; Kuramae, E.E.

    2008-01-01

    A simple, quick and easy protocol was standardized for extraction of total DNA of the bacteria Xanthomonas axonopodis pv. phaseoli. The DNA obtained by this method had high quality and the quantity was enough for the Random Amplified Polymorphic DNA (RAPD) reactions with random primers, and

  2. Reaction of common bean lines to Xanthomonas axonopodis pv. phaseoli and Curtobacterium flaccumfaciens pv. flaccumfaciens

    Directory of Open Access Journals (Sweden)

    Tamires Ribeiro

    2016-12-01

    Full Text Available The aim of this study was to evaluate the resistance of 58 common bean lines against common bacterial blight (Xanthomonas axonopodis pv. phaseoli and bacterial wilt (Curtobacterium flaccumfaciens pv. flaccumfaciens. The experimental design consisted of completely randomized blocks, with four replications per pathogen. The results were subjected to variance analysis by the F test at 1% probability. Significant differences between the treatments indicated different resistance levels among the lines against both pathogens. According to the Scott-Knott test, six lines were resistant to Xanthomonas axonopodis pv. phaseoli, 14 moderately resistant, and 38 susceptible. To Curtobacterium flaccumfaciens pv. flaccumfaciens, 11 lines were resistant, 26 moderately resistant and 21 susceptible. Among these, the lines Pr10-3-4/1, Pr10-5-2/1 and Pr10-5- 2/2 of the black bean group and C10-2-4/2 of the Carioca group were resistant to both major bacterial diseases affecting common bean in Brazil.

  3. Detection of Xanthomonas axonopodis pv. phaseoli in bean seeds by flow cytometry, immunostaining and direct viable counting

    NARCIS (Netherlands)

    Tebaldi, N.D.; Peters, J.; Chitarra, L.G.; Souza, R.M.; Zouwen, van der P.S.; Bergervoet, J.H.W.; Wolf, van der J.M.

    2010-01-01

    Flow cytometric analysis of immuno-stained cells (immuno-FCM) was compared to immunofluorescence microscopy (IF) and dilution plating on a semi-selective medium, for quantitative detection of Xanthomonas axonopodis pv. phaseoli (Xap) in bean seed extracts. Cell concentrations of Xap between 103-107

  4. Genome sequencing reveals a new lineage associated with lablab bean and genetic exchange between Xanthomonas axonopodis pv. phaseoli and Xanthomonas fuscans subsp. fuscans

    Directory of Open Access Journals (Sweden)

    Valente eAritua

    2015-10-01

    Full Text Available Common bacterial blight is a devastating seed-borne disease of common beans that also occurs on other legume species including lablab and Lima beans. We sequenced and analysed the genomes of 26 isolates of Xanthomonas axonopodis pv. phaseoli and X. fuscans subsp. fuscans, the causative agents of this disease, collected over four decades and six continents. This revealed considerable genetic variation within both taxa, encompassing both single-nucleotide variants and differences in gene content, that could be exploited for tracking pathogen spread. The bacterial isolate from Lima bean fell within the previously described Genetic Lineage 1, along with the pathovar type isolate (NCPPB 3035. The isolates from lablab represent a new, previously unknown genetic lineage closely related to strains of X. axonopodis pv. glycines. Finally, we identified more than 100 genes that appear to have been recently acquired by Xanthomonas axonopodis pv. phaseoli from X. fuscans subsp. fuscans.

  5. Bioassay for selection of biocontroller bacteria against bean common blight (Xanthomonas axonopodis pv. phaseoli Bioensaio para seleção de bactérias biocontroladoras do crestamento bacteriano comum do feijão (Xanthomonas axonopodis pv. phaseoli

    Directory of Open Access Journals (Sweden)

    Zarela G.C.N. Zanatta

    2007-09-01

    Full Text Available Emphasis has been given on selection of micro-organism for biological control. However, in order to evaluate the biological control potential of a great number of micro-organisms in a small period of time it is necessary to develop an efficient bioassay. Seven hundred and sixty bacterial isolates from different habitats, were selected for compatibility with Rhizobium leguminosarum bv. phaseoli (SEMIA 4077 e SEMIA 4080. Among them 596 isolates were ineffective against both rhizobia. Bean seeds immersed in suspension of each one of these isolates were agitated for 5 hours at 10ºC and sowed in non-sterilized soil. The plants were kept in greenhouse. After the development of cotyledonary and primary leaves, these were removed and bioassayed for Xanthomonas axonopodis pv. phaseoli (XAP control. In the cotyledonary leaves, it was observed that the isolate DFs093 offered 100% control, DFs041 and DFs1297 offered 90% and DFs490, DFs769, DFs831, DFs842 and DFs843 offered 80% control. In the primary leaves, the DFs482 isolated offered 100% and the DFs080, DFs348, DFs513, DFs622, DFs769, DFs842 and DFs912 offered 80% of XAP control.Tem-se dado muita ênfase ao controle biológico mediante seleção de microorganismos. Porém, para se avaliar o potencial de biocontroladores de forma massal e em pequeno intervalo de tempo é necessário desenvolver um bioensaio eficiente. Bactérias de diferentes sítios, num total de 760 isolados, foram selecionadas para compatibilidade com Rhizobium leguminosarum bv. phaseoli estirpes SEMIA 4077 e SEMIA 4080, onde 596 isolados foram inefetivos contra ambos rizóbios. Sementes de feijão foram imersas em suspensão de cada um destes isolados sendo agitadas por 5 horas a 10ºC, plantadas em solo não esterelizado, sendo as plantas mantidas em casa de vegetação. Após o desenvolvimento das folhas cotiledonares e folhas primárias, estas foram retiradas e avaliadas por bioensaio para o controle de Xanthomonas axonopodis pv

  6. Detecção de Xanthomonas axonopodis pv. phaseoli em sementes de feijoeiro provenientes do estado do Paraná, Brasil Detection of Xanthomonas axonopodis pv. phaseoli in common bean seeds from the state of Paraná (Brazil

    Directory of Open Access Journals (Sweden)

    João Pereira Torres

    2009-06-01

    Full Text Available O crestamento bacteriano comum do feijoeiro causado por sobrevivência e disseminação da Xap, a semente representa o mais Xanthomonas axonopodis pv. phaseoli (Xap é a principal doença eficiente. A qualidade sanitária de 34 amostras de sementes de feijoeiro do feijoeiro comum no Brasil. O patógeno encontra-se disseminado produzidas no estado do Paraná, nas safras 1998/99 e 1999, foram em todas as regiões produtoras do país, porém com maior importância avaliadas quanto à presença de Xap em macerados de sementes nos estados do Paraná, Rio de Janeiro, São Paulo e na região do Brasil plaqueados em meio semi-seletivo. Cinqüenta por cento dos lotes de Central, sobretudo na safra das águas. Dentre os vários meios de sementes foram portadores de Xap com incidência de 0,1% a 1,7%.The common bacterial blight of bean, caused by Xanthomonas effective means of survival and dissemination of the Xap. The health axonopodis pv. phaseoli (Xap, is a major disease of common beans quality of 34 samples of seeds lots of common beans produced in the in Brazil. Even though this pathogen is disseminated in all production state of Paraná during 1998/99 and 1999 were evaluated to the presence regions of the country, it has caused major damages in the states of of Xap in seed macerates plated on a semi-selective culture medium. Paraná, Rio de Janeiro and São Paulo and in Central Region of Brazil, Fifty percent of the seed lots were carrying out by Xap with an particularly during the rainy season. Infected bean seeds are most incidence range of 0.1% to 1.7%.

  7. Otimização da técnica de PCR para detecção de Xanthomonas axonopodis pv. phaseoli em sementes de feijão

    OpenAIRE

    Silva, Franklin Cordeiro

    2014-01-01

    O crestamento bacteriano comum, causado por Xanthomonas axonopodis pv. phaseoli (Xap), é a principal bacteriose do feijoeiro no Brasil, sendo transmitida principalmente por sementes. O presente trabalho foi realizado com o objetivo de aperfeiçoar uma técnica para detecção de Xap em sementes de feijão, por meio da utilização de diferentes métodos de preparação do extrato para a detecão via PCR, além da detecção simultânea de Xap e Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff) nos extr...

  8. Otimização da técnica de PCR para a detecção de Xanthomonas axonopodis pv. phaseoli em sementes de feijão

    OpenAIRE

    Silva,Franklin Cordeiro; Souza,Ricardo Magela de; Zacaroni,Ana Beatriz; Lelis,Flávia Mara Vieira; Figueira,Antonia dos Reis

    2013-01-01

    O crestamento bacteriano comum, causado por Xanthomonas axonopodis pv. phaseoli (Xap), é a principal bacteriose do feijoeiro no Brasil, sendo transmitida principalmente por sementes. O presente trabalho teve como objetivo aperfeiçoar uma técnica, por meio de diferentes métodos de preparação do extrato, para a detecção de Xap, bem como sua detecção simultânea com Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff) nos extratos de sementes de feijão,via PCR. A partir de amostras de sementes ...

  9. Meio semi-seletivo para detectar Xanthomonas axonopodis pv. phaseoli em sementes de feijoeiro e sua erradicação através do tratamento de sementes com o fungicida tolylfluanid A semi-selective medium to detect Xanthomonas axonopodis pv. phaseoli in bean seeds and its eradication through seed treatment with tolylfluanid

    Directory of Open Access Journals (Sweden)

    Lucilene Paula Lopes

    2008-09-01

    Full Text Available Estudou-se a eficiência do meio semi-seletivo desenvolvido para Xanthomonas axonopodis pv. malvacearum (Xam do algodoeiro, com algumas modificações, na detecção de Xanthomonas axonopodis pv. phaseoli (Xap em sementes de feijoeiro, bem como a eficiência do fungicida tolylfluanid na erradicação de Xap através do tratamento de sementes. Foram utilizadas sementes naturalmente infectadas por Xap, procedentes de diferentes municípios do Estado do Paraná. Houve o desenvolvimento de colônias bacterianas ao redor das sementes infectadas sob meio semi-seletivo entre seis e 12 dias de incubação. A freqüência de recuperação de colônias da bactéria em relação ao meio Agar nutriente (AN variou entre 30 a 112%. O crescimento de Xap foi inibido a concentrações entre 54 a 1500 ppm do fungicida tolylfluanid. A bactéria foi recuperada das sementes não tratadas em meio semi-seletivo, mas não das sementes tratadas em solução do fungicida tolylfluanid (1,20g/L água. Em casa de vegetação, das 400 sementes tratadas com tolylfluanid não foi produzida nenhuma planta com sintomas da doença até 30 dias após a semeadura, enquanto que 9,75% das sementes não tratadas apresentaram sintomas de Xap. Em um outro experimento, das 1200 sementes não tratadas um total de 7,08% e 11,67% das plantas mostraram-se com sintomas da doença, enquanto que das sementes tratadas 0,5% e 2,4% apresentaram sintomas, 26 e 46 dias após a semeadura, respectivamente.The efficiency of a semi-selective medium developed for Xanthomonas axonopidis pv. malvacearum (Xam, was verified with some modifications, in detecting the presence of X. axonopodis pv. phaseoli (Xap in bean seed. Seed samples naturally infected with Xap were collected from the State of Paraná. The bacterial growth developed around the infected seed in the semi-selective medium after 12 days after incubation. The recovery frequency of bacterial colonies in relation to nutrient agar varied between 30

  10. Expression Profiling of Virulence and Pathogenicity Genes of Xanthomonas axonopodis pv. citri

    Science.gov (United States)

    Astua-Monge, Gustavo; Freitas-Astua, Juliana; Bacocina, Gisele; Roncoletta, Juliana; Carvalho, Sérgio A.; Machado, Marcos A.

    2005-01-01

    DNA macroarrays of 279 genes of Xanthomonas axonopodis pv. citri potentially associated with pathogenicity and virulence were used to compare the transcriptional alterations of this bacterium in response to two synthetic media. Data analysis indicated that 31 genes were up-regulated by synthetic medium XVM2, while only 7 genes were repressed. The results suggest that XVM2 could be used as an in vitro system to identify candidate genes involved in pathogenesis of X. axonopodis pv. citri. PMID:15659697

  11. Insights into xanthomonas axonopodis pv. Citri biofilm through proteomics

    KAUST Repository

    Zimaro, Tamara

    2013-08-07

    Background: Xanthomonas axonopodis pv. Citri (X. a. pv. Citri) causes citrus canker that can result in defoliation and premature fruit drop with significant production losses worldwide. Biofilm formation is an important process in bacterial pathogens and several lines of evidence suggest that in X. a. pv. Citri this process is a requirement to achieve maximal virulence since it has a major role in host interactions. In this study, proteomics was used to gain further insights into the functions of biofilms. Results: In order to identify differentially expressed proteins, a comparative proteomic study using 2D difference gel electrophoresis was carried out on X. a. pv. Citri mature biofilm and planktonic cells. The biofilm proteome showed major variations in the composition of outer membrane proteins and receptor or transport proteins. Among them, several porins and TonB-dependent receptor were differentially regulated in the biofilm compared to the planktonic cells, indicating that these proteins may serve in maintaining specific membrane-associated functions including signaling and cellular homeostasis. In biofilms, UDP-glucose dehydrogenase with a major role in exopolysaccharide production and the non-fimbrial adhesin YapH involved in adherence were over-expressed, while a polynucleotide phosphorylase that was demonstrated to negatively control biofilm formation in E. coli was down-regulated. In addition, several proteins involved in protein synthesis, folding and stabilization were up-regulated in biofilms. Interestingly, some proteins related to energy production, such as ATP-synthase were down-regulated in biofilms. Moreover, a number of enzymes of the tricarboxylic acid cycle were differentially expressed. In addition, X. a. pv. Citri biofilms also showed down-regulation of several antioxidant enzymes. The respective gene expression patterns of several identified proteins in both X. a. pv. Citri mature biofilm and planktonic cells were evaluated by

  12. Caracterização de isolados de Xanthomonas axonopodis pv. manihotis = Characterization of isolates of Xanthomonas axonopodis pv. manihotis

    Directory of Open Access Journals (Sweden)

    Roberto Luis Portz

    2006-07-01

    Full Text Available A bacteriose (Xanthomonas axonopodis pv. manihotis e a doenca de maior importancia economica na cultura da mandioca. Para estudar a variabilidade genetica desta bacteria no Oeste do Parana, foram realizados levantamentos em Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa e Pato Bragado. Os isolados foram caracterizados em relacao a atividade de amilase, ƒ¿ e ƒÀ-esterase e agressividade. Dos 61 materiais vegetais coletados, obtiveram-se 19 isolados da bacteria, com maior incidencia para variedades de mesa em relacao aqueles para industria. Manivas provenientes de Pato Bragado, Entre Rios do Oeste e Mercedes apresentaram incidencias de 10, 27 e 10%, respectivamente, valores inferiores aos de Marechal Candido Rondon (50% e Nova Santa Rosa (58%. Os isolados foram agrupados em cinco, seis e 12 grupos em relacao a capacidade amilolitica, agressividade e isoenzimas de esterase, respectivamente. Nao houve relacao entre atividade de amilase e agressividade. Isolados de Marechal Candido Rondon foram mais agressivos que os provenientes das outras regioes. O agrupamento com base em esterase permitiu verificar que isolados provenientes de Entre Rios do Oeste, Nova Santa Rosa e Mercedes apresentaram alto grau de similaridade. Estes resultados indicam haver diferenciacaoentre os isolados da bacteria presentes nos municipios amostrados.The bacterial blight (Xanthomonas axonopodis pv. manihotis is the most important disease of cassava. To study the genetic variability of pathogen in the West of Parana, a research was carried out at Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa and Pato Bragado. The isolates were characterized to amylase activity, ƒ¿ and ƒÀ-esterase and aggressiveness. From 61 collected materials, were obtained 19 bacterial isolates, with larger incidence for varieties of human consume than those for industry. Stems from Pato Bragado, Entre Rios do Oeste and Mercedes

  13. Estrategias para diferenciar xanthomonas campestris pv. phaseoli con sales inorgánicas

    Directory of Open Access Journals (Sweden)

    Mildred Zapata

    2001-01-01

    Full Text Available Colonias de Xanthomonas campestris pv. phaseoli (Xcp aisladas de hojas de habichuelas con síntomas de tizón común en Puerto Rico, República Dominicana y Costa Rica fueron caracterizadas como patogénicas en hojas de Phaseolus vulgaris. Sin embargo, éstas fueron clasificadas en los patovares phaseoli, vesicatoria, carotae y xanthosoma por el sistema Biolog. Las cepas de Xcp crecidas en 2, 3, 5-Trifenil cloruro de tetrazolio (TTC mostraron colonias convexas, brillosas, lisas y de color rojo en diferentes tamaños. TTC fue reducido por las cepas de Xcp a un pigmento rojo intenso, un formazán de trifenilo. No se encontraron diferencias en virulencia y tipos de colonias en las cepas identificadas por pruebas de patogenicidad como Xcp. Por otro lado, hubo diferencias en el tipo de colonia en cultivos bacterianos identificados como: Pseudomonas cissicola, P. fulva, Corynebacterium, Rhodococcus, y Shingomonas

  14. Susceptibility of Bean Genotypes to Xanthomonas campestris pv. phaseoli in Greenhouse Conditions

    Directory of Open Access Journals (Sweden)

    Biljana Todorović

    2008-01-01

    Full Text Available Plants of 17 bean genotypes were evaluated under greenhouse conditions for their reaction to X. campestris pv. phaseoli, the causal agent of common blight of beans, following leaf-spray inoculation with bacterial suspension (108 cfu/ml. The plants were evaluated based on the number of leaf lesions, and the disease severity index (DSI was calculated.The evaluated genotypes showed various levels of susceptibility to X. campestris pv. phaseoli strain VS-1. The results of both experiments showed that the cultivar Oreol was the most resistant. The genotypes: KB 142, HR-45, Tisa and Panonski tetovac also showed low susceptibility with DSI values in the first trial ranging from 2.27 to 3.60. The same genotypes, with the exception of Panonski tetovac, were also categorized as low-susceptible to the bacterium in the second experiment, having the DSI values between 2.27 and 3.60. Most genotypes (Slavonski žutozeleni, Zlatko, Biser, Sremac, Naya Nayahit were categorized as susceptible in the first experiment, including Panonski tetovac in the second one, while the genotypes Dvadesetica, Prelom and Oplenac displayed the highest susceptibility in both trials.

  15. A simple method for in vivo expression studies of Xanthomonas axonopodis pv. citri.

    Science.gov (United States)

    Mehta, Angela; Rosato, Yoko B

    2003-11-01

    A major problem in studying bacterial plant pathogens is obtaining the microorganism directly from the plant tissue to perform in vivo expression (protein or mRNA) analyses. Here we report an easy and fast protocol to isolate Xanthomonas axonopodis pv. citri directly from the host plant, in sufficient amounts to perform protein fingerprinting by 2-D gel electrophoresis as well as RNA expression assays. The protein profile obtained was very similar to that of X. axonopodis pv. citri grown in the presence of a leaf extract of Citrus sinensis; however, some differential proteins expressed in vivo were observed. Total RNA extraction revealed typical 16S and 23S bands in the agarose gel, and RT-PCR reactions using primers specific for genes of the bacterium confirmed the quality of the RNA preparation. Also, RT-PCR reactions using plant ribosomal primers were employed, and no amplification product was obtained, indicating that plant RNA is not present in the bacterium RNA sample.

  16. Efect of aqueous extract from turmeric (Curcuma longa L.) in Xanthomonas axonopodis pv. manihotis.

    OpenAIRE

    Odair Josà Kuhn

    2003-01-01

    The cassava bacterial blight caused by Xanthomonas axonopodis pv. manihotis is the most importance disease of the culture and it is distributed in all the places where it is cultivated. Infected stems constitute themselves in the principal way of the bacterium dissemination to new cultivation areas. The chemical control of phytobacteria is difficult due to the products shortage, as well as, the existing ones are used exclusively in plantations of high economic value. By the other hand, the al...

  17. Genetic diversity of Xanthomonas axonopodis pv. citri based on plasmid profile and pulsed field gel electrophoresis

    Directory of Open Access Journals (Sweden)

    Carvalho Flávia Maria de Souza

    2005-01-01

    Full Text Available Xanthomonas axonopodis pv. citri strains that cause disease in citrus were investigated by pulsed field and plasmid profile analysis. For the first method, genomic DNA was digested by the rare-cutting enzymes Xba I and Vsp I. The strains evaluated were collected in seven different States of Brazil and in Argentina, Bolivia, Paraguay and Uruguay. Genetic variability was found among strains of X. axonopodis pv. citri from different geographical areas Argentina, Bolivia and Uruguay, with similarities varying from 0.62 to 0.83. However, the strains collected in Brazil, despite being from different States, have shown a genetic similarity ranging from 0.83 to 1.00. Cluster analysis showed a relationship between genomic similarity and geographical origin of the strains. Plasmids were observed in all strains, with a total of five different plasmids, with sizes between 57.7 and 83.0 kilobases. The 72.6 kb plasmid was the most frequent, present in 15 out of 22 strains, while the 68.1 kb plasmid was observed in two strains only. Although the plasmid diversity detected in the present study was not very great, the X. axonopodis pv. citri strains evaluated showed a considerable degree of diversity with regard to this extrachromosomal genetic element.

  18. Cloning of a two-component signal transduction system of Xanthomonas campestris pv. phaseoli var. fuscans strain BXPF65

    DEFF Research Database (Denmark)

    Chan, JWYF; Maynard, Scott; Goodwin, PH

    1998-01-01

    A putative two-component signal transduction system was amplified and cloned from the plant pathogenic bacterium Xanthomonas campestris pv. phaseoli var. fuscans isolate BXPF65. The 620 bp amplified fragment was sequenced and analyzed with the BLAST Enhanced Alignment Utility (BEAUTY). BEAUTY ana...

  19. Produção e sensibilidade de isolados brasileiros de Xanthomonas axonopodis pv. citri à bacteriocinas

    Directory of Open Access Journals (Sweden)

    Marcel Bonini

    2012-09-01

    Full Text Available Este trabalho teve por objetivo avaliar a produção e a sensibilidade de 48 isolados brasileiros de X. axonopodis pv. citri (Xac à bacteriocinas. Pelos resultados obtidos, nenhum isolado de Xac foi sensível às bacteriocinas produzidas pelos isolados bacterianos avaliados.

  20. Multiplexed lateral flow microarray assay for detection of citrus pathogens Xylella fastidiosa and Xanthomonas axonopodis pv citri

    Energy Technology Data Exchange (ETDEWEB)

    Cary,; Bruce, R [Santa Fe, NM; Stubben, Christopher J [Los Alamos, NM

    2011-03-22

    The invention provides highly sensitive and specific assays for the major citrus pathogens Xylella fastidiosa and Xanthomonas axonopodis, including a field deployable multiplexed assay capable of rapidly assaying for both pathogens simultaneously. The assays are directed at particular gene targets derived from pathogenic strains that specifically cause the major citrus diseases of citrus variegated chlorosis (Xylella fastidiosa 9a5c) and citrus canker (Xanthomonas axonopodis pv citri). The citrus pathogen assays of the invention offer femtomole sensitivity, excellent linear dynamic range, and rapid and specific detection.

  1. Control of Xanthomonas campestris pv. phaseoli on Bean_Using Copper Compounds and Plant Activator

    Directory of Open Access Journals (Sweden)

    Biljana Todorović

    2006-01-01

    Full Text Available The efficacy of several new formulations of copper compounds, namely Cuprozin 35 WP (copper-oxychloride, Cuproxat (copper-sulphate, Funguran OH (copper-hydroxideand the plant activator Bion(acibenzolar-S-methyl, and their combinations with dithiocarbamates(Dithane M-70 was estimated in controlling Xanthomonas campestris pv. phaseoli (artificial inoculation in field conditions in two localities during 2006. In the locality Zemun, the efficacy of copper compounds ranged from 92.7% to 98.5%. The plant activator Bion 50 WG exhibited similar efficacy (94.4-97.1%. Combinations of Funguran OH and Dithane M-70, applied at different concentrations, also showed high efficacy (98.3-99.3%, as well as the combinations of Bion 50 WG and the other bactericides (95.5-96.8%. There was no significantdifference between the efficacies achieved by the compounds applied individually and their combinations, except Cuproxat, which exhibited decreased efficacy at lower concentration. In the locality Smederevska Palanka, the efficacy of copper compounds was 95.0-98.2%, while Bion achieved 96.8-97.7% efficacy. Combinations of copper-hydroxide(Funguran OH and dithiocarbamates (Dithane M-70 also showed high efficacy (98.1-99.4% but without a significant difference. The efficacy of combinations of Bion and copper-hydroxide, and Bion and mancozeb was 97.9-98.9%. There was no significant difference in the efficacies of the bactericides tested or the efficacies of their combinations in that locality.Our investigation confirmed high efficacy of acibenzolar-S-methyl, which was equal to the efficacy of standard bactericide treatment. This compound therefore offers a very good alternative to conventional chemicals used for controlling bacterial diseases in beans.

  2. Genotipos de frijol (Phaseolus Vulgaris l. resistentes a Xanthomonas campestris pv. phaseoli de Mexico

    Directory of Open Access Journals (Sweden)

    Rosa Navarrete

    2000-01-01

    Full Text Available Genotipos de frijol (Phaseolus vulgaris L. resistentes a Xanthomonas campestris pv. phaseoli de México. Durante 1995 se evaluó la reacción de genotipos de frijol de diversos origenes a Xcp, bajo condiciones de invernadero en el Campo Experimental del Valle de México, del INIFAP. Se realizaron tres experimentos con a120, b44 y csiete genotipos de frijol. Las plantas se inocularon por corte con navajas en la etapa V3, a y b con una mezcla de nueve cepas de Xcp y el c, con cada una de siete cepas con diferente grado de patogenicidad. La severidad se evaluó 20 días después de la inoculación, por comparación con una escala visual de nueve grados. Los datos se analizaron bajo un diseño completamente al azar. En a, los genotipos que mostraron reacción de resistencia a Xcp fueron: A 36, A 475, G 5686, G 11867, Harowood, SEA 14, XAN 266, MCD 4012 y REN 27. En b los genotipos resistentes fueron: Sequía Durango, Taylor y XAN 30. En los experimentos anteriores la severidad de la enfermedad mostró una distribución normal, con el máximo número de genotipos en el grado de severidad cinco en a y seis en b. Los resultados obtenidos indican que el uso de mezclas de cepas de bacterias con diferente patogenicidad es eficiente para identificar genotipos de frijol resistentes a Xcp. Los genotipos resistentes identificados en el último experimento, mostraron respuesta diferencial e interacciones genotipo por cepa. REN 27 y SEA 14 mostraron resistencia a las cepas utilizadas

  3. Crystal Structure of the FAD-Containing Ferredoxin-NADP+ Reductase from the Plant Pathogen Xanthomonas axonopodis pv. citri

    Directory of Open Access Journals (Sweden)

    María Laura Tondo

    2013-01-01

    Full Text Available We have solved the structure of ferredoxin-NADP(H reductase, FPR, from the plant pathogen Xanthomonas axonopodis pv. citri, responsible for citrus canker, at a resolution of 1.5 Å. This structure reveals differences in the mobility of specific loops when compared to other FPRs, probably unrelated to the hydride transfer process, which contributes to explaining the structural and functional divergence between the subclass I FPRs. Interactions of the C-terminus of the enzyme with the phosphoadenosine of the cofactor FAD limit its mobility, thus affecting the entrance of nicotinamide into the active site. This structure opens the possibility of rationally designing drugs against the X. axonopodis pv. citri phytopathogen.

  4. The molybdate-binding protein (ModA) of the plant pathogen Xanthomonas axonopodis pv. citri.

    Science.gov (United States)

    Balan, Andrea; Santacruz, Carolina P; Moutran, Alexandre; Ferreira, Rita C C; Medrano, Francisco J; Pérez, Carlos A; Ramos, Carlos H I; Ferreira, Luís C S

    2006-12-01

    The modABC operon of phytopathogen Xanthomonas axonopodis pv. citri (X. citri) encodes a putative ABC transporter involved in the uptake of the molybdate and tungstate anions. Sequence analyses showed high similarity values of ModA orthologs found in X. campestris pv. campestris (X. campestris) and Escherichia coli. The X. citri modA gene was cloned in pET28a and the recombinant protein, expressed in the E. coli BL21 (DE3) strain, purified by immobilized metal affinity chromatography. The purified protein remained soluble and specifically bound molybdate and tungstate with K(d) 0.29+/-0.12 microM and 0.58+/-0.14 microM, respectively. Additionally binding of molybdate drastically enhanced the thermal stability of the recombinant ModA as compared to the apoprotein. This is the first characterization of a ModA ortholog expressed by a phytopathogen and represents an important tool for functional, biochemical and structural analyses of molybdate transport in Xanthomonas species.

  5. Biological, serological and molecular techniques to xanthomonas axonopodis pv. Ci tri Asymptomatic detection

    International Nuclear Information System (INIS)

    Peyrou, M.; Del Campo, R.; Russi, P.; Mara, H.; Rigamonti, N.; Larrechart, L.; Perez, E.

    2012-01-01

    Xanthomonas axonopodis pv. ci tri (X ac) produces citrus canker disease in all citrus commercial species. The bacteria can be disseminated through vegetative propagation material in asymptomatic form. To optimize bacteria detection techniques applicable to asymptomatic citrus plant tissue routine analysis, ELISA, Immunofluorescence, Pcr, qRT P CR and host plant inoculation (bioassay) diagnostic techniques were compared. Tests were made from decimal dilutions between 108 uf6.ml-1 and 102 ufc.mL-1 using a pure culture of 49b strain.The detection level obtained was 1.8 x 102 ufc.mL-1 using Inmunofluorescence; 1.8x104 ufc.mL-1 with indirect ELISA, 1.8 x 103 ufc.mL-1 by means of PCR; 10 ufc.mL-1 through of qRT P CR and 230 ufc.mL-1 in sour orange inoculated plants. The experiment was repeated at least three times for each technique. Considering this result, and taking into account that sensitivity, practicity and cost, are important when a great number of plants need to be tested, the PCR and inoculation in host plants were those that met the best characteristics to be evaluated in asymptomatic plant material

  6. Disease Development and Symptom Expression of Xanthomonas axonopodis pv. citri in Various Citrus Plant Tissues.

    Science.gov (United States)

    Vernière, C J; Gottwald, T R; Pruvost, O

    2003-07-01

    ABSTRACT Experimental inoculations of Xanthomonas axonopodis pv. citri in different tissues of Tahiti lime and Pineapple sweet orange were conducted monthly under natural conditions on Réunion Island. The interactions between a set of environmental and epidemic variables associated with disease expression and 184 different factor combinations were investigated to determine the parameters needed to explain Asiatic citrus canker (ACC) disease expression. Area under the disease progress curve (AUDPC), inoculation date (Id), fruit and leaf age ratings (FAR and LAR), and number of days during the first 2 weeks postinoculation for which the temperature was less than 14 degrees C (T(min)) or more than 28 degrees C (T(max)) were retained by principal component analysis and canonical correlation analysis as the most meaningful epidemic and environmental variables, respectively. AUDPC as the strongest dependent variable and combinations of the environmental variables as independent variables were used in multiple regression analyses. Tissue age rating at the time of infection was a good predictor for disease resulting from spray inoculation on fruits and leaves and also on fruits following a wound inoculation. Temperature, as expressed by T(min) or T(max), was also a significant factor in determining disease development described by AUDPC. Mature green stems were highly susceptible after wounding, similarly to leaves, but buds and leaf scars expressed the lowest susceptibility. These variations in disease expression according to the tissues will have different impacts on ACC epidemiology.

  7. COMPARING INOCULATION METHODS TO EVALUATE THE GROWTH OF Xanthomonas axonopodis pv. manihotis ON CASSAVA PLANTS

    Directory of Open Access Journals (Sweden)

    Alejandra Muñoz Bodnar

    2015-05-01

    RESUMEN Xanthomonas axonopodis pv. manihotis (Xam es el agente causal del tizón bacteriano de la yuca, una de las principales enfermedades de los cultivos de yuca en América del Sur y África. Hasta ahora, el desarrollo de la enfermedad se mide a través de AUDPC (Area  Under Disease Progress curve, pero no hay disponibles métodos cuantitativos fiables,  esto debido posiblemente a la alta variabilidad del crecimiento bacteriano en la planta. Para establecer un método exacto para la cuantificación bacteriana durante el curso de la infección Xam dentro de los tejidos del huésped, se analizaron las poblaciones de bacterias sobre tallo y hojas, así como corte de hojas de las variedades de yucaMCOL1522 y SG107-35 con la cepa virulenta CIO151 Xam. En esta investigación se muestra que el movimiento de las bacterias a lo largo de los tejidos y especialmente en las hojas es estocástico. Por otra parte, hemos podido demostrar el crecimiento diferencial de la cepa virulenta  Xam CIO151 tras la punción al tallo y la cuantificación de la bacteria a 6 cm de distancia del punto de inoculación de dos variedades que presentan niveles contrastantes de susceptibilidad.

  8. Amplification of DNA of Xanthomonas axonopodis pv. citri from historic citrus canker herbarium specimens.

    Science.gov (United States)

    Li, Wenbin; Brlansky, Ronald H; Hartung, John S

    2006-05-01

    Herbaria are important resources for the study of the origins and dispersal of plant pathogens, particularly bacterial plant pathogens that incite local lesions in which large numbers of pathogen genomes are concentrated. Xanthomonas axonopodis pv. citri (Xac), the causal agent of citrus bacterial canker disease, is a notable example of such a pathogen. The appearance of novel strains of the pathogen in Florida and elsewhere make it increasingly important to understand the relationships among strains of this pathogen. USDA-ARS at Beltsville, Maryland maintains approximately 700 herbarium specimens with citrus canker disease lesions up to 90 years old, originally collected from all over the world, and so is an important resource for phytogeographic studies of this bacterium. Unfortunately, DNA in herbarium specimens is degraded and may contain high levels of inhibitors of PCR. In this study, we compared a total of 23 DNA isolation techniques in combination with 31 novel primer pairs in order to develop an efficient protocol for the analysis of Xac DNA in herbarium specimens. We identified the most reliable extraction method, identified in terms of successful amplification by our panel of 31 primer pairs. We also identified the most robust primer pairs, identified as successful in the largest number of extracts prepared by different methods. We amplified Xac genomic sequences up to 542 bp long from herbarium samples up to 89 years old. Primers varied in effectiveness, with some primer pairs amplifying Xac DNA from a 1/10,000 dilution of extract from a single lesion from a citrus canker herbarium specimen. Our methodology will be useful to identify pathogens and perform molecular analyses of bacterial and possibly fungal genomes from herbarium specimens.

  9. Infección de callo embriogénico friable de yuca con Xanthomonas axonopodis pv. manihotis (Xam)

    OpenAIRE

    Paula Díaz Tatis; Carlos Andrés Zárate; Adriana Bernal Giraldo; Camilo López Carrascal

    2016-01-01

    Las nuevas tecnologías para la edición de genomas, como los TALEN y el sistema CRISPR/Cas9, representan una gran oportunidad para mejorar características deseables en diferentes organismos. Los TALEN son el resultado del acoplamiento de nucleasas a los TALE (Transcription Activator-Like Effectors), los cuales son efectores naturales de gran importancia en la patogénesis de las especies de Xanthomonas. Xanthomonas axonopodis pv. manihotis (Xam) es el agente causal del añublo bacteriano de la y...

  10. Structural-functional characterization and physiological significance of ferredoxin-NADP reductase from Xanthomonas axonopodis pv. citri.

    Directory of Open Access Journals (Sweden)

    María Laura Tondo

    Full Text Available Xanthomonas axonopodis pv. citri is a phytopathogen bacterium that causes severe citrus canker disease. Similar to other phytopathogens, after infection by this bacterium, plants trigger a defense mechanism that produces reactive oxygen species. Ferredoxin-NADP(+ reductases (FNRs are redox flavoenzymes that participate in several metabolic functions, including the response to reactive oxygen species. Xanthomonas axonopodis pv. citri has a gene (fpr that encodes for a FNR (Xac-FNR that belongs to the subclass I bacterial FNRs. The aim of this work was to search for the physiological role of this enzyme and to characterize its structural and functional properties. The functionality of Xac-FNR was tested by cross-complementation of a FNR knockout Escherichia coli strain, which exhibit high susceptibility to agents that produce an abnormal accumulation of (•O(2(-. Xac-FNR was able to substitute for the FNR in E. coli in its antioxidant role. The expression of fpr in X. axonopodis pv. citri was assessed using semiquantitative RT-PCR and Western blot analysis. A 2.2-fold induction was observed in the presence of the superoxide-generating agents methyl viologen and 2,3-dimethoxy-1,4-naphthoquinone. Structural and functional studies showed that Xac-FNR displayed different functional features from other subclass I bacterial FNRs. Our analyses suggest that these differences may be due to the unusual carboxy-terminal region. We propose a further classification of subclass I bacterial FNRs, which is useful to determine the nature of their ferredoxin redox partners. Using sequence analysis, we identified a ferredoxin (XAC1762 as a potential substrate of Xac-FNR. The purified ferredoxin protein displayed the typical broad UV-visible spectrum of [4Fe-4S] clusters and was able to function as substrate of Xac-FNR in the cytochrome c reductase activity. Our results suggest that Xac-FNR is involved in the oxidative stress response of Xanthomonas axonopodis pv

  11. FORMULASI PADAT RHIZOBAKTERIA INDIGENUS BACILLUS THURINGIENSIS TS2 DAN WAKTU PENYIMPANAN UNTUK MENGENDALIKAN PENYAKIT PUSTUL BAKTERI XANTHOMONAS AXONOPODIS PV. GLYCINES

    Directory of Open Access Journals (Sweden)

    Yulmira Yanti

    2017-05-01

    Full Text Available Solid formulations of indigenous rhizobacteria Bacillus thuringiensis TS2 and storage time to control bacterial pustule disease Xanthomonas axonopodis pv. glycines. Bacterial pustule disease caused by Xanthomonas axonopodis pv. Glycines is a major constraint in soybean cultivation. Indigenous rhizobacteria Bacillus thuringiensis TS2 from soybean rhizosphere acquired from previous research is the best isolate which can control soybean bacterial pustule disease and increase growth rate of soybean. To increased its stability and interaction with soybean plants, Bacillus thuringiensis TS2 was urged to test furthermore especially its formulation with based formula tapioca powder, peat and bulk. The most effective storage time also need to test. Result showed that all rhizobacterial formula had ability to decrease incidence of bacterial pustule disease compared to control. Moreover, all the three formula could increase plant growth, total of leaves, total of branch and yields. Flowering time was also advanced by 1-8 days compared to control. Decreasing of disease rate and increasing of plant growth rate variated between different formulations.

  12. Differential expression of pathogenicity- and virulence-related genes of Xanthomonas axonopodis pv. citri under copper stress

    Directory of Open Access Journals (Sweden)

    Ana Carolina Basílio Palmieri

    2010-01-01

    Full Text Available In this study, we used real-time quantitative PCR (RT-qPCR to evaluate the expression of 32 genes of Xanthomonas axonopodis pv. citri related to pathogenicity and virulence that are also involved in copper detoxification. Nearly all of the genes were up-regulated, including copA and copB. Two genes homologous to members of the type II secretion system (xcsH and xcsC and two involved in the degradation of plant cell wall components (pglA and pel were the most expressed in response to an elevated copper concentration. The type II secretion system (xcs operon and a few homologues of proteins putatively secreted by this system showed enhanced expression when the bacteria were exposed to a high concentration of copper sulfate. The enhanced expression of the genes of secretion II system during copper stress suggests that this pathway may have an important role in the adaptative response of X. axonopodis pv. citri to toxic compounds. These findings highlight the potential role of these genes in attenuating the toxicity of certain metals and could represent an important means of bacterial resistance against chemicals used to control diseases.

  13. Crystallization, data collection and phasing of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri

    International Nuclear Information System (INIS)

    Santacruz, C. P.; Balan, A.; Ferreira, L. C. S.; Barbosa, J. A. R. G.

    2006-01-01

    The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222 1, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222 1 , with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress

  14. Crystallization, data collection and phasing of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri

    Energy Technology Data Exchange (ETDEWEB)

    Santacruz, C. P.; Balan, A.; Ferreira, L. C. S. [Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil); Barbosa, J. A. R. G., E-mail: joao@lnls.br [Centro de Biologia Molecular e Estrutural (CeBiMe), Laboratório Nacional de Luz Síncrotron (LNLS), CP 6192, Campinas, SP 13084-971 (Brazil); Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil)

    2006-03-01

    The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222{sub 1,} with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222{sub 1}, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress.

  15. Crystallization, data collection and data processing of maltose-binding protein (MalE) from the phytopathogen Xanthomonas axonopodis pv. citri

    International Nuclear Information System (INIS)

    Souza, C. S.; Ferreira, L. C. S.; Thomas, L.; Barbosa, J. A. R. G.; Balan, A.

    2009-01-01

    The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. Maltose-binding protein is the periplasmic component of the ABC transporter responsible for the uptake of maltose/maltodextrins. The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. The crystal belonged to the primitive hexagonal space group P6 1 22, with unit-cell parameters a = 123.59, b = 123.59, c = 304.20 Å, and contained two molecules in the asymetric unit. It diffracted to 2.24 Å resolution

  16. The role of type III effectors from Xanthomonas axonopodis pv. manihotis in virulence and suppression of plant immunity.

    Science.gov (United States)

    Medina, Cesar Augusto; Reyes, Paola Andrea; Trujillo, Cesar Augusto; Gonzalez, Juan Luis; Bejarano, David Alejandro; Montenegro, Nathaly Andrea; Jacobs, Jonathan M; Joe, Anna; Restrepo, Silvia; Alfano, James R; Bernal, Adriana

    2018-03-01

    Xanthomonas axonopodis pv. manihotis (Xam) causes cassava bacterial blight, the most important bacterial disease of cassava. Xam, like other Xanthomonas species, requires type III effectors (T3Es) for maximal virulence. Xam strain CIO151 possesses 17 predicted T3Es belonging to the Xanthomonas outer protein (Xop) class. This work aimed to characterize nine Xop effectors present in Xam CIO151 for their role in virulence and modulation of plant immunity. Our findings demonstrate the importance of XopZ, XopX, XopAO1 and AvrBs2 for full virulence, as well as a redundant function in virulence between XopN and XopQ in susceptible cassava plants. We tested their role in pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) and effector-triggered immunity (ETI) using heterologous systems. AvrBs2, XopR and XopAO1 are capable of suppressing PTI. ETI suppression activity was only detected for XopE4 and XopAO1. These results demonstrate the overall importance and diversity in functions of major virulence effectors AvrBs2 and XopAO1 in Xam during cassava infection. © 2017 BSPP AND JOHN WILEY & SONS LTD.

  17. The PthB protein from Xanthomonas axonopodis pv. Manihotis is an autoactive in yeast two-hybrid assays

    International Nuclear Information System (INIS)

    Gil, Juliana; Bohorquez, Laura; Castiblanco, Luisa B; Bernal, Adriana; Lopez, Camilo

    2011-01-01

    Cassava bacterial blight disease is caused by the gram-negative bacteria Xanthomonas axonopodis pv. manihotis (Xam), and constitutes one of the most important constraints for cassava production. One of the first determinants of pathogenicity identified in this bacterium is the PthB gene. The PthB protein belongs to the PthB/AvrBs3 family, characterized by the presence of nuclear localization signal (NLS) and acidic activation (AAD) domains, suggesting that these proteins are transcription factors. The identification of cassava proteins interacting with PthB could give insights about the function of this protein in the pathogenicity of this bacterium. In this work we cloned PthB in the yeast two hybrid expression vector plaw10, generating a fusion protein with the binding domain (BD) of the transcription factor Gal4. In this work, PthB was cloned in a translational fusion with Gal4-BD (DNA Binding Domain). After transforming this construct into a yeast strain, autoactivation of the reporter genes was observed, even at the highest concentrations of 3-AT. The deletion of the first, second or both NLS and the AAD did not eliminate the ability of autoactivation of PthB. These results show the impossibility of using PthB to screen a cassava cDNA library to identify the proteins interacting with PthB.

  18. Crystallographic structure and substrate-binding interactions of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri.

    Science.gov (United States)

    Balan, Andrea; Santacruz-Pérez, Carolina; Moutran, Alexandre; Ferreira, Luís Carlos Souza; Neshich, Goran; Gonçalves Barbosa, João Alexandre Ribeiro

    2008-02-01

    In Xanthomonas axonopodis pv. citri (Xac or X. citri), the modA gene codes for a periplasmic protein (ModA) that is capable of binding molybdate and tungstate as part of the ABC-type transporter required for the uptake of micronutrients. In this study, we report the crystallographic structure of the Xac ModA protein with bound molybdate. The Xac ModA structure is similar to orthologs with known three-dimensional structures and consists of two nearly symmetrical domains separated by a hinge region where the oxyanion-binding site lies. Phylogenetic analysis of different ModA orthologs based on sequence alignments revealed three groups of molybdate-binding proteins: bacterial phytopathogens, enterobacteria and soil bacteria. Even though the ModA orthologs are segregated into different groups, the ligand-binding hydrogen bonds are mostly conserved, except for Archaeglobus fulgidus ModA. A detailed discussion of hydrophobic interactions in the active site is presented and two new residues, Ala38 and Ser151, are shown to be part of the ligand-binding pocket.

  19. Bioinformatic identification of cassava miRNAs differentially expressed in response to infection by Xanthomonas axonopodis pv. manihotis

    Science.gov (United States)

    2012-01-01

    Background microRNAs (miRNAs) are short RNA molecules that control gene expression by silencing complementary mRNA. They play a crucial role in stress response in plants, including biotic stress. Some miRNAs are known to respond to bacterial infection in Arabidopsis thaliana but it is currently unknown whether these responses are conserved in other plants and whether novel species-specific miRNAs could have a role in defense. Results This work addresses the role of miRNAs in the Manihot esculenta (cassava)-Xanthomonas axonopodis pv. manihotis (Xam) interaction. Next-generation sequencing was used for analyzing small RNA libraries from cassava tissue infected and non-infected with Xam. A full repertoire of cassava miRNAs was characterized, which included 56 conserved families and 12 novel cassava-specific families. Endogenous targets were predicted in the cassava genome for many miRNA families. Some miRNA families' expression was increased in response to bacterial infection, including miRNAs known to mediate defense by targeting auxin-responding factors as well as some cassava-specific miRNAs. Some bacteria-repressed miRNAs included families involved in copper regulation as well as families targeting disease resistance genes. Putative transcription factor binding sites (TFBS) were identified in the MIRNA genes promoter region and compared to promoter regions in miRNA target genes and protein coding genes, revealing differences between MIRNA gene transcriptional regulation and other genes. Conclusions Taken together these results suggest that miRNAs in cassava play a role in defense against Xam, and that the mechanism is similar to what's known in Arabidopsis and involves some of the same families. PMID:22361011

  20. La proteína PthB de Xanthomonas axonopodis pv. manihotis es autoactiva en ensayos de doble hibrido

    Directory of Open Access Journals (Sweden)

    Juliana Gil

    2011-01-01

    Full Text Available La bacteriosis vascular de yuca producida por la bacteria Xanthomonas axonopodis pv. manihotis (Xam es uno de los factores limitantes para la producción de yuca. Dentro de los primeros factores de patogenicidad identificados en esta bacteria se encuentra el gen pthB. La proteína PthB pertenece a la familia de efectores PthA/AvrBs3, que se caracterizan por presentar dominios NLS (Nuclear Localization Signal y un dominio AAD (Acidic Activation Domain, lo cual sugiere que estas proteínas actúan como factores de transcripción. La identificación de las proteínas de yuca que interactúan con PthB permitiría dar luces sobre la función de esta proteína en la patogenicidad de esta bacteria. En este trabajo se clonó pthB en una fusión traduccional con el BD (Binding Domain del factor de transcripción GAL4. Después de transformar este constructo en una cepa de levadura, se observó autoactivación de los genes reporteros, incluso a concentraciones altas de 3-AT. La eliminación del primer, segundo o de los dos NLS y del AAD no eliminaron la capacidad de autoactivación de los genes reporteros mediada por PthB. Estos resultados indican la imposibilidad de su utilización en un tamizaje de una librería de ADNc de yuca para identificar las proteínas que interactúan con PthB.

  1. Production of inulinase by Xanthomonas campestris pv phaseoli using onion (Allium cepa) and garlic (Allium sativum) peels in solid state cultivation.

    Science.gov (United States)

    Ayyachamy, M; Khelawan, K; Pillay, D; Permaul, K; Singh, S

    2007-10-01

    To access inulinase production by Xanthomonas campestris pv phaseoli using the submerged and solid state cultivation (SSC) methods. Various carbon sources, inulin-rich solid substrates and pure synthetic inulin were tested for their efficiency in inulinase induction. The highest inulinase production (17.42 IU ml(-1)) in submerged cultures of X. campestris was observed with inulin as a carbon source with an initial pH, temperature and agitation of 7.0, 37 degrees C and 150 rev min(-1) respectively. Among the various substrates, garlic peels (117 IU gds(-1)) and onion peels (101 IU gds(-1)) were found to be the best for inulinase production. The inulinase production level of X. campestris was 6.7-fold higher in garlic and 5.8-fold in onion, under optimized SSC conditions compared with the submerged culture. This is the first report on inulinase production from garlic and onion peels by X. campestris using SSC. SSC is an efficient method for inulinase production by X. campestris for commercial applications.

  2. Reação de híbridos interespecíficos de Passiflora spp. à Xanthomonas axonopodis pv. passiflorae

    Directory of Open Access Journals (Sweden)

    Elisiane Fuhrmann

    2014-01-01

    Full Text Available Avaliou-se o grau de resistência de 36 clones de maracujazeiro obtidos por seleção massal de sete progênies de híbridos interespecíficos a três isolados de Xanthomonas axonopodis pv. passiflorae. As progênies foram obtidas por meio de cruzamentos entre a cultivar comercial Passiflora edulis "flavicarpa" com as espécies silvestres P. caerulea, P. edulis "roxo" e P. setacea. Os isolados da bactéria foram obtidos em Rio Claro-SP, Planaltina-DF e Limeira-SP. Clones individuais foram inoculados com solução bacteriana na concentração de 108ufc ml-1 aos 120 dias da semeadura. As avaliações ocorreram aos 5, 10 e 15 dias após a inoculação, medindo-se o diâmetro longitudinal e transversal das lesões. Em seguida, calculou-se a área abaixo da curva de progresso da lesão (AACPL. O delineamento experimental foi em blocos ao acaso com parcelas subdivididas, sendo os genótipos os tratamentos distribuídos em quatro blocos com parcelas de três plantas para cada genótipo. Em cada parcela, plantas individuais foram inoculadas com um dos isolados da bactéria, totalizando três plantas com isolados diferentes. Plantas das espécies genitoras P. caerulea (AACPL=0,17 e P. setacea (AACPL=14,50 apresentaram alto grau de resistência, quando comparadas às plantas da testemunha BRS Gigante Amarelo (AACPL=4089,25, enquanto genótipos híbridos apresentaram valores intermediários (AACPL de 15,67 a 768,42, indicando a importância desses materiais como fontes de resistência à bacteriose.

  3. XopN-T3SS effector of Xanthomonas axonopodis pv. punicae localizes to the plasma membrane and modulates ROS accumulation events during blight pathogenesis in pomegranate.

    Science.gov (United States)

    Kumar, Rishikesh; Soni, Madhvi; Mondal, Kalyan K

    2016-12-01

    Bacterial blight caused by Xanthomonas axonopodis pv. punicae (Xap) is a major disease of pomegranate. Xap secretes effector proteins via type III secretion system (T3SS) to suppress pathogen-associated molecular pattern (PAMP)-triggered plant immunity (PTI). Previously we reported that XopN, a conserved effector of Xap, modulate in planta bacterial growth, and blight disease. In continuation to that here we report the deletion of XopN from Xap caused higher accumulation of reactive oxygen species (ROS) including H 2 O 2 and O 2 - . We quantitatively assessed the higher accumulation of H 2 O 2 in pomegranate leaves infiltrated with Xap ΔxopN compared to Xap wild-type. We analysed that 1.5 to 3.3 fold increase in transcript expression of ROS and flg22-inducible genes, namely FRK1, GST1, WRKY29, PR1, PR2 and PR5 in Arabidopsis when challenged with Xap ΔxopN; contrary, the up-regulation of all the genes were compromised when challenged with either Xap wild-type or Xap ΔxopN+xopN. Further, we demonstrated the plasma-membrane based localization of XopN protein both in its natural and experimental hosts. All together, the present study suggested that XopN-T3SS effector of Xap gets localized in the plasma membrane and suppresses ROS-mediated early defense responses during blight pathogenesis in pomegranate. Copyright © 2016 Elsevier GmbH. All rights reserved.

  4. A plant natriuretic peptide-like molecule of the pathogen Xanthomonas axonopodis pv. citri causes rapid changes in the proteome of its citrus host

    Directory of Open Access Journals (Sweden)

    Ottado Jorgelina

    2010-03-01

    Full Text Available Abstract Background Plant natriuretic peptides (PNPs belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival. Results Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 α subunit, maturase K, and α- and β-tubulin. Conclusions We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence.

  5. A plant natriuretic peptide-like molecule of the pathogen Xanthomonas axonopodis pv. citri causes rapid changes in the proteome of its citrus host

    KAUST Repository

    Garavaglia, Betiana S

    2010-03-21

    Background: Plant natriuretic peptides (PNPs) belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP) uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival.Results: Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 ? subunit, maturase K, and ?- and ?-tubulin.Conclusions: We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence. 2010 Garavaglia et al; licensee BioMed Central Ltd.

  6. Crystallization and preliminary X-ray diffraction analysis of XAC1151, a small heat-shock protein from Xanthomonas axonopodis pv. citri belonging to the α-crystallin family

    Energy Technology Data Exchange (ETDEWEB)

    Hilario, Eduardo; Teixeira, Elaine Cristina; Pedroso, Gisele Audrei; Bertolini, Maria Célia [Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil); Medrano, Francisco Javier, E-mail: fjmedrano@yahoo.com [Departamento de Cristalografia de Proteínas, Centro de Biologia Molecular Estrutural, Laboratório Nacional de Luz Síncrotron, Caixa Postal 6192, CEP 13084-971, Campinas-SP (Brazil); Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil)

    2006-05-01

    XAC1151, a small heat-shock protein from X. axonopodis pv. citri belonging to the α-crystallin family, was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The hspA gene (XAC1151) from Xanthomonas axonopodis pv. citri encodes a protein of 158 amino acids that belongs to the small heat-shock protein (sHSP) family of proteins. These proteins function as molecular chaperones by preventing protein aggregation. The protein was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The crystal belongs to the rhombohedral space group R3, with unit-cell parameters a = b = 128.7, c = 55.3 Å. The crystal structure was solved by molecular-replacement methods. Structure refinement is in progress.

  7. Análise da diversidade genética de isolados de Xanthomonas axonopodis pv. malvacearum do algodoeiro Analysis of genetic diversity among the isolates of Xanthomonas axonopolis pv. malvacearum of cotton

    Directory of Open Access Journals (Sweden)

    Maria Paula Nunes

    2009-06-01

    Full Text Available A mancha angular do algodoeiro, causada por Xanthomonas axonopodis pv. malvacearum (Xam, é uma doença de importância econômica e pode causar perdas apreciáveis no rendimento. A doença pode ser controlada por resistência varietal desde que haja conhecimento sobre a variabilidade das populações do patógeno. A variabilidade genética e a estabilidade patogênica entre os isolados deste patógeno não foram suficientemente estudadas, principalmente considerando a introdução de novas cultivares e a expansão da cultura. O objetivo do presente estudo foi avaliar a variabilidade genética entre os 61 isolados de Xam, provenientes de diversas cultivares e regiões do Brasil, através de ensaios moleculares. Análises de ERIC e REP-PCR demonstraram dois grupos distintos de Xam associados a região geográfica de origem. Não foram observadas diferenças nos perfis dos isolados através de PCR-RFLP da região 16S-23S rDNA. A região espaçadora 16S-23S rDNA de três linhagens de Xam foi analisada através de clonagem e sequenciamento e seis diferenças nas seqüências foram encontradas. A técnica de RAPD revelou um maior nível de polimorfismo, distinguindo 6 grupos de Xam a 85% de similaridade. Os resultados indicam a existência de variabilidade muito restrita entre os isolados analisados.Angular leaf spot or black arm of cotton, caused by Xanthomonas axonopodis pv. malvacearum (Xam, is a disease of economic importance. The disease can be controlled by using resistant cultivars if the knowledge regarding the genetic variability of the pathogen population is available. The genetic variability and the pathogen stability among the isolates of this pathogen have not been sufficiently studied, especially considering the introduction of new cultivars and the expansion of areas under cotton cultivation. The objective of the present study was to identify genetic variability among 61 isolates of Xam collected from different cultivars and geographic

  8. 1H HRMAS NMR spectroscopy and chemometrics for evaluation of metabolic changes in citrus sinensis Caused by Xanthomonas axonopodis pv. citri

    International Nuclear Information System (INIS)

    Silva, Lorena M.A.; Alves Filho, Elenilson G.; Choze, Rafael; Liao, Luciano M.; Alcantara, Glaucia B.

    2012-01-01

    Xanthomonas axonopodis (Xac) bacterium causes one of the most feared and untreatable diseases in citriculture: citrus canker. To understand the response mechanisms of orange trees when attacked by Xac, leaves and fruits of Citrus sinensis were directly evaluated by HRMAS NMR (high resolution magic angle spinning nuclear magnetic resonance) spectroscopy. This technique allows the analysis of samples without laborious pre-treatments and also allows access to important information about chemical composition of samples. The orange tree leaves and fruit peels investigated in this study demonstrated the biochemical changes caused by Xac. Aided by chemometric analysis, the HRMAS NMR results show relevant changes in amino acids, carbohydrates, organic acids and terpenoids content. (author)

  9. Caracterización de la respuesta morfológica de variedades susceptibles y resistentes de yuca (Manihot esculenta Crantz a la bacteriosis vascular causada por Xanthomonas axonopodis pv. manihotis

    Directory of Open Access Journals (Sweden)

    Tamara Sandino

    2015-06-01

    Full Text Available Xanthomonas axonopodis pv. manihotis es una de las principales limitaciones del cultivo de yuca. En esta investigación, mediante microscopía óptica, se realizó un análisis comparativo de los cambios morfológicos e histoquímicos en tallos de una variedad de yuca susceptible (TMS60444 y una resistente (CM6438-14, 7 y 14 días después de ser inoculadas con la cepa patogénica CIO151. Se pudo detectar que la variedad resistente genera barreras de calosa en las paredes celulares del parénquima cortical y del floema, manteniendo funcional este tejido. En tanto que los tejidos vasculares de la variedad susceptible colapsan, el floema por obstrucción total con tapones de calosa y por formación de compuestos fenólicos, y el xilema por formación de tílides y/o acumulación de compuestos fenólicos, sin poder frenar el avance sistémico de la enfermedad.

  10. Epiphytic bacteria from various bean genotypes and their potential ...

    African Journals Online (AJOL)

    Naturally occurring epiphytic non-pathogeni bacteria were isolated from reproductive tissue of various bean genotypes grown in the field and screened for both in vitro and in vivo antagonism to Xanthomonas axonopodis pv. phaseoli (formely X. campestris pv phaseoli). Of the 22 potential bacterial antagonists screened in ...

  11. Pathogenic and genetic variation in Xanthomonas axonopodis pv ...

    African Journals Online (AJOL)

    Thus, results based on reaction of the majority isolates, suggest the absence of different races. However, the distinct differential reaction recorded for a single isolate, may prove to represent another, as yet unrecorded, race of this pathogen. Both RAPD and AFLP analyses revealed high frequency of DNA polymorphism ...

  12. A plant natriuretic peptide-like gene in the bacterial pathogen Xanthomonas axonopodis may induce hyper-hydration in the plant host: a hypothesis of molecular mimicry

    Directory of Open Access Journals (Sweden)

    Sayed Muhammed

    2004-03-01

    Full Text Available Abstract Background Plant natriuretic peptides (PNPs are systemically mobile molecules that regulate homeostasis at nanomolar concentrations. PNPs are up-regulated under conditions of osmotic stress and PNP-dependent processes include changes in ion transport and increases of H2O uptake into protoplasts and whole tissue. Presentation of the hypothesis The bacterial citrus pathogen Xanthomonas axonopodis pv. Citri str. 306 contains a gene encoding a PNP-like protein. We hypothesise that this bacterial protein can alter plant cell homeostasis and thus is likely to represent an example of molecular mimicry that enables the pathogen to manipulate plant responses in order to bring about conditions favourable to the pathogen such as the induced plant tissue hyper-hydration seen in the wet edged lesions associated with Xanthomonas axonopodis infection. Testing the hypothesis We found a Xanthomonas axonopodis PNP-like protein that shares significant sequence similarity and identical domain organisation with PNPs. We also observed a significant excess of conserved residues between the two proteins within the domain previously identified as being sufficient to induce biological activity. Structural modelling predicts identical six stranded double-psi β barrel folds for both proteins thus supporting the hypothesis of similar modes of action. No significant similarity between the Xanthomonas axonopodis protein and other bacterial proteins from GenBank was found. Sequence similarity of the Xanthomonas axonopodis PNP-like protein with the Arabidopsis thaliana PNP (AtPNP-A, shared domain organisation and incongruent phylogeny suggest that the PNP-gene may have been acquired by the bacteria in an ancient lateral gene transfer event. Finally, activity of a recombinant Xanthomonas axonopodis protein in plant tissue and changes in symptoms induced by a Xanthomonas axonopodis mutant with a knocked-out PNP-like gene will be experimental proof of molecular mimicry

  13. Analysis of Kenyan isolates of Fusarium solani f. sp. phaseoli from ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-03

    Jun 3, 2008 ... number of soil-borne pathogenic fungi including Macro- phomina phaseolina, Rhizoctonia solani, Pythium spp. and F. solani f.sp. phaseoli are some of the major causes of low yields (Nderitu et al., 1997). Bean root rot caused by F. solani f.sp. phaseoli has been reported worldwide, including Mexico, Brazil ...

  14. Evolutionary history of the plant pathogenic bacterium Xanthomonas axonopodis.

    Directory of Open Access Journals (Sweden)

    Nadia Mhedbi-Hajri

    Full Text Available Deciphering mechanisms shaping bacterial diversity should help to build tools to predict the emergence of infectious diseases. Xanthomonads are plant pathogenic bacteria found worldwide. Xanthomonas axonopodis is a genetically heterogeneous species clustering, into six groups, strains that are collectively pathogenic on a large number of plants. However, each strain displays a narrow host range. We address the question of the nature of the evolutionary processes--geographical and ecological speciation--that shaped this diversity. We assembled a large collection of X. axonopodis strains that were isolated over a long period, over continents, and from various hosts. Based on the sequence analysis of seven housekeeping genes, we found that recombination occurred as frequently as point mutation in the evolutionary history of X. axonopodis. However, the impact of recombination was about three times greater than the impact of mutation on the diversity observed in the whole dataset. We then reconstructed the clonal genealogy of the strains using coalescent and genealogy approaches and we studied the diversification of the pathogen using a model of divergence with migration. The suggested scenario involves a first step of generalist diversification that spanned over the last 25,000 years. A second step of ecology-driven specialization occurred during the past two centuries. Eventually, secondary contacts between host-specialized strains probably occurred as a result of agricultural development and intensification, allowing genetic exchanges of virulence-associated genes. These transfers may have favored the emergence of novel pathotypes. Finally, we argue that the largest ecological entity within X. axonopodis is the pathovar.

  15. Interaction of Acidithiobacillus ferrooxidans, Rhizobium phaseoli and Rhodotorula sp. in bioleaching process based on Lotka–Volterra model

    Directory of Open Access Journals (Sweden)

    Xuecheng Zheng

    2016-07-01

    Conclusion: The relationship among microorganisms during leaching could be described appropriately by Lotka–Volterra model between the initial and peak values. The relationship of A. ferrooxidans and R. phaseoli could be considered as mutualism, whereas, the relationship of A. ferrooxidans and R. phaseoli could be considered as commensalism.

  16. Improvement of common bacterial blight resistance in South African ...

    African Journals Online (AJOL)

    Common bacterial blight (CBB) caused by Xanthomonas axonopodis pv. phaseoli is an important seed-borne disease of dry beans in South Africa. Development of resistant cultivars is considered the best control measurement for the disease. Backcross breeding was used to improve BB resistance in the small white ...

  17. resistance and inheritance of common bacterial blight in yellow ...

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Common bean (Phaseolus vulgaris L.) is the most important food legume among the pulses. It is a cheap source of protein, especially in Sub-Saharan Africa. However, bean production is ... rust (Uromyces appendiculatus), common bacterial blight (Xanthomonas axonopodis p.v. phaseoli), and bean common mosaic and ...

  18. Resistance and inheritance of common bacterial blight in yellow bean

    African Journals Online (AJOL)

    Common bean (Phaseolus vulgaris L.) is the most important food legume among the pulses. It is a cheap source of protein, especially in Sub-Saharan Africa. However, bean production is constrained by bacterial diseases, of which common bacterial blight (Xanthomonas axonopodis p.v. phaseoli) is prevalent in Africa.

  19. Identification of Glomerella cingulata f. sp phaseoli recombinants by RAPD markers.

    Science.gov (United States)

    Camargo, O A; Souza, E A; Mendes-Costa, M C; Santos, J B; Soares, M A

    2007-09-30

    We examined the capacity of strains of Glomerella cingulata f. sp phaseoli fungus (Colletotrichum lindemuthianum sexual stage) to form recombinants, using random amplified polymorphic DNA (RAPD). Crosses of all possible combinations between strains 40, 42, 20, 21, 22, 23, 24, 25, and 26 were made on Petri dishes using M3 culture medium. The 42 x 21 cross produced the largest number of perithecia and five asci; the respective ascospores were isolated. RAPD analysis was performed on the parents and descendants. The 62 polymorphic RAPD bands obtained were used to assess the genetic similarity using the method of Sorence and Dice and clustering analysis in the form of a dendrogram by the UPGMA method. The RAPD markers allowed identification of recombinants from the cross between strains 42 and 21 of G. cingulata f. sp phaseoli and 40 ascospores presented 63 and 49% genetic similarity with parents 2 (strain 42) and 1 (strain 21), respectively.

  20. Ultrastructural aspects in perithecia hyphae septal pores of Glomerella cingulata F. SP. Phaseoli

    OpenAIRE

    Roca M.,María Gabriela; Ongarelli,Maria das Graças; Davide,Lisete Chamma; Mendes-Costa,Maria Cristina

    2000-01-01

    Glomerella cingulata (Stonem.) Spauld. & Schrenk f. sp. phaseoli, better known in its anamorphic state Colletotrichum lindemuthianum (Sacc. & Magn.) Briosi & Cav., is a causal agent of anthracnose in beans (Phaseolus vulgaris L.). Ultrastructural aspects of the perithecial hyphae of this pathogen were studied. The perithecia hyphae septal pores were found either plugged by a vesicle or unplugged. Some perithecia hyphae septa presented no pore. The Woronin bodies, close to the sept...

  1. ASSESSMENT OF Trichoderma ISOLATES FOR VIRULENCE EFFICACY ON Fusarium oxysporum F. sp. Phaseoli

    Directory of Open Access Journals (Sweden)

    Jane Otadoh

    2010-10-01

    Full Text Available Trichoderma has been widely studied for their biocontrol ability, but their use as biocontrol agents in agriculture is limited due to the unpredictable efficiency which is affected by biotic and abiotic factors in soil. Isolates of Trichoderma from Embu soils were evaluated for their ability to control Fusarium oxysporum f. sp. phaseoli., in vitro and promote seedling growth in the greenhouse. Bioassays were run using dual cultures and diffusible compound production analysis. The Trichoderma isolates significantly (p

  2. Ultrastructural aspects in perithecia hyphae septal pores of Glomerella cingulata F. SP. Phaseoli

    Directory of Open Access Journals (Sweden)

    Roca M. María Gabriela

    2000-01-01

    Full Text Available Glomerella cingulata (Stonem. Spauld. & Schrenk f. sp. phaseoli, better known in its anamorphic state Colletotrichum lindemuthianum (Sacc. & Magn. Briosi & Cav., is a causal agent of anthracnose in beans (Phaseolus vulgaris L.. Ultrastructural aspects of the perithecial hyphae of this pathogen were studied. The perithecia hyphae septal pores were found either plugged by a vesicle or unplugged. Some perithecia hyphae septa presented no pore. The Woronin bodies, close to the septal pores, appeared as globose structures which were more electron dense than the occlusions plugging the septal pore.

  3. Dimorfismo de ascósporos em Glomerella cingulata f.sp. phaseoli

    OpenAIRE

    Castro, Renata A.; Mendes-Costa, Maria C.; Souza, Elaine A.

    2006-01-01

    O objetivo deste trabalho foi caracterizar linhagens de Glomerella cingulata f. sp. phaseoli quanto ao crescimento micelial, formação de peritécio e dimorfismo de ascósporos. Foram avaliadas quatro linhagens nos meios de cultura de folhas de feijoeiro e meio M3 e em condições com e sem fotoperíodo. O comprimento dos ascósporos da linhagem normal e da mutante foi determinado. Houve diferença significativa quanto ao crescimento micelial e tamanho dos ascósporos. Constatou-se, pela primeira vez,...

  4. A DNA-Based Procedure for In Planta Detection of Fusarium oxysporum f. sp. phaseoli.

    Science.gov (United States)

    Alves-Santos, Fernando M; Ramos, Brisa; García-Sánchez, M Asunción; Eslava, Arturo P; Díaz-Mínguez, José María

    2002-03-01

    ABSTRACT We have characterized strains of Fusarium oxysporum from common bean fields in Spain that were nonpathogenic on common bean, as well as F. oxysporum strains (F. oxysporum f. sp. phaseoli) pathogenic to common bean by random amplified polymorphic DNA (RAPD) analysis. We identified a RAPD marker (RAPD 4.12) specific for the highly virulent pathogenic strains of the seven races of F. oxysporum f. sp. phaseoli. Sequence analysis of RAPD 4.12 allowed the design of oligonucleotides that amplify a 609-bp sequence characterized amplified region (SCAR) marker (SCAR-B310A280). Under controlled environmental and greenhouse conditions, detection of the pathogen by polymerase chain reaction was 100% successful in root samples of infected but still symptomless plants and in stem samples of plants with disease severity of >/=4 in the Centro Internacional de Agricultura Tropical (CIAT; Cali, Colombia) scale. The diagnostic procedure can be completed in 5 h and allows the detection of all known races of the pathogen in plant samples at early stages of the disease with no visible symptoms.

  5. Interacción de Tsukamurella paurometabola C-924 con Rhizobium leguminosarum biovar phaseoli CFH en el cultivo de frijol

    Directory of Open Access Journals (Sweden)

    Marieta Marín Bruzos

    2013-01-01

    Full Text Available En el estudio se evaluaron, mediante análisis de los parámetros fenológicos de las plantas, la interacción de Tsukamurella paurometabola C-924 con Rhizobium leguminosarum biovar phaseoli CFH en el cultivo de frijol. Se emplearon cuatro tratamientos: plantas sin inocular (control, inoculadas con T. paurometabola C-924, inoculadas con R. leguminosarum biovar phaseoli CFH e inoculadas con ambas cepas. Se observaron diferencias significativas (P < 0.01 en los porcentajes de germinación de las plantas tratadas con microorganismos de forma independiente o conjunta con respecto al control sin inocular. Se determinó que la inoculación de T. paurometabola C-924 afectó el proceso de nodulación de R. leguminosarum biovar phaseoli CFH. Sin embargo, esto no incidió de manera significativa en la altura de las plantas ni en el diámetro del tallo, ya que no se encontraron diferencias entre los tratamientos para estos parámetros. Para el número de hojas, los mejores resultados se obtuvieron con la aplicación de T. paurometabola C-924. Se concluyó que la interacción de T. paurometabola C-924 con R. leguminosarum biovar phaseoli CFH en el frijol estimuló significativamente la germinación de las semillas y el número de hojas de las plantas con respecto al control sin inocular. Aunque la aplicación de T. paurometabola C-924 no favoreció la nodulación de R. leguminosarum biovar phaseoli CFH, esto no afectó las características fenológicas del cultivo.

  6. Ultrastructural aspects in perithecia hyphae septal pores of Glomerella cingulata F. SP. Phaseoli Ultraestrutura dos poros septais em hifas de peritécios de Glomerella cingulata f. sp. phaseoli

    OpenAIRE

    María Gabriela Roca M.; Maria das Graças Ongarelli; Lisete Chamma Davide; Maria Cristina Mendes-Costa

    2000-01-01

    Glomerella cingulata (Stonem.) Spauld. & Schrenk f. sp. phaseoli, better known in its anamorphic state Colletotrichum lindemuthianum (Sacc. & Magn.) Briosi & Cav., is a causal agent of anthracnose in beans (Phaseolus vulgaris L.). Ultrastructural aspects of the perithecial hyphae of this pathogen were studied. The perithecia hyphae septal pores were found either plugged by a vesicle or unplugged. Some perithecia hyphae septa presented no pore. The Woronin bodies, close to the septal pores, ap...

  7. The apo structure of sucrose hydrolase from Xanthomonas campestris pv. campestris shows an open active-site groove

    DEFF Research Database (Denmark)

    Champion, Elise; Remaud-Simeon, Magali; Skov, Lars Kobberøe

    2009-01-01

    , are not engaged in salt-bridge formation in the resting X. campestris enzyme. In the absence of the salt bridge an opening is created which gives access to subsite -1 from the ;nonreducing' end. Binding of the glucosyl moiety in subsite -1 is therefore likely to induce changes in the conformation of the active......-site cleft of the X. campestris enzyme. These changes lead to salt-bridge formation that shortens the groove. Additionally, this finding has implications for understanding the molecular mechanism of the closely related subfamily 4 glucosyl transferase amylosucrase, as it indicates that sucrose could enter...... of GH-13. Comparisons with structures of the highly similar sucrose hydrolase from X. axonopodis pv. glycines most notably showed that residues Arg516 and Asp138, which form a salt bridge in the X. axonopodis sucrose complex and define part of the subsite -1 glucosyl-binding determinants...

  8. Influência da natureza do rejeito agroindustrial fermentado por Xanthomonas axonopodis pv. manihotis nas propriedades das gomas xantana resultantes

    Directory of Open Access Journals (Sweden)

    Denilson de Jesus Assis

    2014-01-01

    Full Text Available Um destino para resíduos agro-industriais é usá-los como substratos fermentescíveis, diminuindo o custo na produção de produtos com alto valor agregado. Este trabalho avaliou a influência da natureza dos resíduos fermentescíveis e das cepas de Xanthomonas sobre a produção e propriedades do biopolímero resultante. A produção foi realizada em agitador orbital (250 rpm / 28 °C / 120 h por fermentação de sacarose (controle, glicerina residual do biodiesel e resíduo líquido de sisal. Tanto a composição do substrato como as cepas mostraram um forte efeito sobre a produção (0,36-2,40 gL- 1, viscosidade aparente (13,73 para 36,31 mPa.s e massa molecular (2,1-5,9 × 10(6 Da da goma de xantana resultante, não influenciando o comportamento pseudoplástico de soluções aquosas dos biopolímeros.

  9. Induction of soybean resistance to bacterial pustule disease (Xanthomonas axonopodis pv. glycines) by rhizobacteria and organic material treatment

    Science.gov (United States)

    Khaeruni, A.; Johan, E. A.; Wijayanto, T.; Taufik, M.; Syafar, A. A. R.; Kade Sutariati, G. A.

    2018-02-01

    This study aimed to evaluate the role of different formulations and types of organic matter in improving yield and resistance of soybean plants to bacterial pustule disease. The study was prepared based on a randomized block design with a factorial pattern. The first factor was the application of rhizobacterial formulation (biofresh), ie F0 = without the application of rhizobacteria, F1 = application of biofresh in solid formulation, and F2 = application of biofresh in liquid formulation. The second factor was the application of organic materials, namely B1 = compost of soybean litter + cow dung, B2 = compost of rice straw + cow dung, B3 = compost of soybean litter + rice straw + cow dung. Observation of disease severity and soybean yield was conducted on five sample plants in each treatment. The results showed that the treatment of biological agent biofresh in solid formulation combined with compos of soybean litter, was the best treatment in increasing plant resistance to bacterial pustule disease and seed weight. Plant resistance induction occurred systemically characterized by salicylic acid increase of 0.3 mg and peroxidase increase of 0.07 unit / mL in the sample plants.

  10. Selectable genes for transformation of the fungal plant pathogen Glomerella cingulata f. sp. phaseoli (Colletotrichum lindemuthianum).

    Science.gov (United States)

    Rodriguez, R J; Yoder, O C

    1987-01-01

    Glomerella cingulata f. sp. phaseoli (Gcp) was transformed using either of two selectable markers: the amdS + gene of Aspergillus nidulans, which encodes acetamidase and permits growth on acetamide as the sole nitrogen source and the hygBR gene of Escherichia coli which encodes hygromycin B (Hy) phosphotransferase and permits growth in the presence of the antibiotic Hy. The amdS+ gene functioned in Gcp under control of A. nidulans regulatory signals and hygBR was expressed after fusion to a promoter from Cochliobolus heterostrophus, another filamentous ascomycete. Protoplasts to be transformed were generated with the digestive enzyme complex Novozym 234 and then were exposed to plasmid DNA in the presence of 10 mM CaCl2 and polyethylene glycol. Transformation occurred by integration of single or multiple copies of either the amdS+ or hygBR plasmid into the fungal genome. There was no evidence of autonomous plasmid replication. Transformants were mitotically stable on selective and nonselective media. However, transforming DNA in hygBR transformants was observed to occasionally rearrange during nonselective growth, resulting in fewer copies of the plasmid per genome. These transformants were capable of infecting bean (Phaseolus vulgaris), the Gcp host plant, and after recovery from infected tissue were found to have retained both the transforming DNA unrearranged in their genomes and the Hy resistance phenotype. All single-conidial cultures derived from both amdS+ and hygBR transformants had the transplanted phenotype, suggesting that transformants were homokaryons.

  11. Building Integrated PV and PV/Hybrid Products - The PV:BONUS Experience: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, H.; Pierce, L. K.

    2001-10-01

    Presented at the 2001 NCPV Program Review Meeting: Successes and lessons learned from PV:BONUS (Building Opportunities in the United States in PV). This program has funded the development of PV or PV/hybrid products for building applications.

  12. Controle de Rhizoctonia solani e Fusarium oxysporum f.sp. phaseoli por biopreparados de isolados de Trichoderma spp.

    Directory of Open Access Journals (Sweden)

    Pedro Paulo Dias

    2013-12-01

    Full Text Available Os experimentos objetivaram avaliar em condições de casa de vegetação o biocontrole dos fitopatógenos Rhizoctonia solani (RS e Fusarium oxysporum f.sp. phaseoli (FOP em alface (Lactuca sativa L. cultivar Regina, e feijão-vagem (Phaseolus vulgaris L. cultivar Alessa, respectivamente, utilizando como agentes antagonistas, 10 isolados de Trichoderma spp. selecionados em testes in vitro. Foram feitos biopreparados à base de arroz previamente colonizado por isolados de Trichoderma spp. e posteriormente triturados. Para a realização dos testes, os biopreparados foram inoculados previamente na proporção de 10(9 conídios.mL-1, em substrato comercial para produção de mudas. Após sete dias, os patógenos foram introduzidos separadamente em duas concentrações distintas: R. solani na proporção de 144 mg de meio de arroz por kg de substrato e F. oxysporum f.sp. phaseoli inoculado na forma de suspensão contendo 4,75 x 10(6 conídios.mL-1. Avaliou-se a influência dos biopreparados na % de damping-off de pós-emergência em plantas de alface e a severidade de murcha em plantas de feijão-vagem. O biopreparado referente ao isolado T-03 foi o mais eficiente no controle de R. solani em plantas de alface cultivar Regina, por ter reduzido a incidência de damping-off de pós-emergência nessa cultura. Por outro lado, nenhum dos biopreparados apresentou efeito antagonista satisfatório à F. oxysporum f.sp. phaseoli em plantas de feijão-vagem.

  13. Fire resistant PV shingle assembly

    Science.gov (United States)

    Lenox, Carl J.

    2012-10-02

    A fire resistant PV shingle assembly includes a PV assembly, including PV body, a fire shield and a connection member connecting the fire shield below the PV body, and a support and inter-engagement assembly. The support and inter-engagement assembly is mounted to the PV assembly and comprises a vertical support element, supporting the PV assembly above a support surface, an upper interlock element, positioned towards the upper PV edge, and a lower interlock element, positioned towards the lower PV edge. The upper interlock element of one PV shingle assembly is inter-engageable with the lower interlock element of an adjacent PV shingle assembly. In some embodiments the PV shingle assembly may comprise a ventilation path below the PV body. The PV body may be slidably mounted to the connection member to facilitate removal of the PV body.

  14. The PV market

    International Nuclear Information System (INIS)

    Hammond, B.

    1992-01-01

    This paper forecasts the photovoltaic (PV) market growth for the 1990s. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market however is highly dependent on a number of market factors such as the cost of conventional energy the cost of PV systems utility acceptance of PV and regulatory controls. Government and institutional regulations, environmental issues, and OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer stand-alone and utility markets

  15. Grid integrated distributed PV (GridPV).

    Energy Technology Data Exchange (ETDEWEB)

    Reno, Matthew J.; Coogan, Kyle

    2013-08-01

    This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functions are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in the OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function in the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

  16. Insights into Genome Plasticity and Pathogenicity of the Plant Pathogenic Bacterium Xanthomonas campestris pv. vesicatoria Revealed by the Complete Genome Sequence

    Science.gov (United States)

    Thieme, Frank; Koebnik, Ralf; Bekel, Thomas; Berger, Carolin; Boch, Jens; Büttner, Daniela; Caldana, Camila; Gaigalat, Lars; Goesmann, Alexander; Kay, Sabine; Kirchner, Oliver; Lanz, Christa; Linke, Burkhard; McHardy, Alice C.; Meyer, Folker; Mittenhuber, Gerhard; Nies, Dietrich H.; Niesbach-Klösgen, Ulla; Patschkowski, Thomas; Rückert, Christian; Rupp, Oliver; Schneiker, Susanne; Schuster, Stephan C.; Vorhölter, Frank-Jörg; Weber, Ernst; Pühler, Alfred; Bonas, Ulla; Bartels, Daniela; Kaiser, Olaf

    2005-01-01

    The gram-negative plant-pathogenic bacterium Xanthomonas campestris pv. vesicatoria is the causative agent of bacterial spot disease in pepper and tomato plants, which leads to economically important yield losses. This pathosystem has become a well-established model for studying bacterial infection strategies. Here, we present the whole-genome sequence of the pepper-pathogenic Xanthomonas campestris pv. vesicatoria strain 85-10, which comprises a 5.17-Mb circular chromosome and four plasmids. The genome has a high G+C content (64.75%) and signatures of extensive genome plasticity. Whole-genome comparisons revealed a gene order similar to both Xanthomonas axonopodis pv. citri and Xanthomonas campestris pv. campestris and a structure completely different from Xanthomonas oryzae pv. oryzae. A total of 548 coding sequences (12.2%) are unique to X. campestris pv. vesicatoria. In addition to a type III secretion system, which is essential for pathogenicity, the genome of strain 85-10 encodes all other types of protein secretion systems described so far in gram-negative bacteria. Remarkably, one of the putative type IV secretion systems encoded on the largest plasmid is similar to the Icm/Dot systems of the human pathogens Legionella pneumophila and Coxiella burnetii. Comparisons with other completely sequenced plant pathogens predicted six novel type III effector proteins and several other virulence factors, including adhesins, cell wall-degrading enzymes, and extracellular polysaccharides. PMID:16237009

  17. PV-WEB: internet-based PV information tool

    International Nuclear Information System (INIS)

    Cowley, P.

    2003-01-01

    This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members

  18. Global PV Market Development

    International Nuclear Information System (INIS)

    Schmidt, F.

    2009-01-01

    The dawn of 2009 saw several events which caused major turbulence in the global photovoltaic industry. In 2008 the Spanish PV market grew beyond all expectations and even outranked Germany as the world's number one market. However, the promotion scheme was modified and a market cap was introduced in 2009, cutting back the maximum capacity to be installed to about the level of 2007. In addition, the industry is facing an oversupply of PV modules and a harsh recession which is significantly affecting the traditionally strong PV markets. International photovoltaic companies are challenged by a changing market situation: all of a sudden, competition has increased significantly, pushing the customer to the fore. As a result, a consolidation process is expected within the PV industry worldwide. However, the story is not all negative. In the U.S., the election of Barack Obama may be seen as the starting signal for a massive expansion in PV, likely to bring the country to first place globally within the next five years. Furthermore, different markets and market segments are being opened up - especially in Europe - thanks to the gradual arrival of generation parity and new PV support mechanisms. EuPD Research has observed and studied international PV markets since its foundation. The information included in the presentation is based on a wide range of quantitative and qualitative studies that EuPD Research has conducted in the key markets since 2002. Florian Schmidt, EuPD Research's Head of Product Management, will give an overview of the global PV market and how it is developing in this crucial year 2009. Aspects such as technology development, production capacities and the demand side will be included, with a special emphasis on the European PV markets. So far Chinese PV companies have often benefited from the booming PV markets in Europe, above all Germany and Spain. Due to the lack of domestic market, the Chinese industry strongly depends on the export and is

  19. ORF Sequence: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Xanthomonas axonopodis pv. citri str. 306] MTQRLMKTALIGVLALVSQGALAQAADKPAKALTSGEVTSMLTAKGYTKVHDLKFEHGVWTADAR...SGDGKDVDVHIDPVTGRVYGDQTTSKLSEADVRASLSTGGYADVHDLKFNDGLWKADAKRNGQKVELHVDPEDGHVVSVEND

  20. Ciclo de vida y reproducción de Caliothrips phaseoli (Thysanoptera: Thripidae sobre Fabaceae y Solanaceae (Plantae en condiciones de laboratorio

    Directory of Open Access Journals (Sweden)

    Mirta R. SOSA

    2017-01-01

    Full Text Available Los objetivos del presente estudio fueron I conocer el tiempo de desarrollo de cada estado y estadio de Caliothrips phaseoli en Phaseolus vulgaris L. (Fabaceae, Cicer arietinum L. (Fabaceae, Nicotiana glauca Graham y N. tabacum L. (Solanaceae, y II el tipo de reproducción bajo condiciones de laboratorio (25 ± 1 ºC; 72 ± 6% de humedad relativa y 12 hs luz / 12 hs oscuridad. Para la cría se utilizaron hojas maduras de cada planta que se colocaron en frascos oscuros de vidrio dentro de jaulas de cría. Diariamente se controló el desarrollo de cada estado y estadio de C. phaseoli sobre cada planta, contándose además el número de individuos y el sexo de los adultos emergidos. Se comprobó que N. glauca, P. vulgaris y N. tabacum son plantas hospederas de C. phaseoli. La densidad de la pubescencia de C. arietinum limitó la alimentación e impidió la oviposición de C. phaseoli, por lo que no representaría una planta hospedera eficiente para este trips. La duración promedio del ciclo total de C. phaseoli alcanzado en las solanáceas fue mayor en N. tabacum (20,6 días y menor en N. glauca (16 días, mientras que en la fabácea (P. vulgaris alcanzó un valor intermedio (19 días. En N. tabacum y P. vulgaris fue la misma ya que no se encontraron diferencias significativas entre ellas. En las tres especies vegetales, el estado que necesitó más tiempo de desarrollo fue el de huevo (6-8 días, seguido por el de larva II (4 - 4,5 días, mientras que la larva I y los estados quiescentes variaron entre 1,85 y 3,36 días. Esta especie se reproduce por anfigonia y partenogénesis con descendencia exclusiva de machos en este último caso.

  1. PV investment in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Hueser, Pius [Nova Energy GmbH, (Switzerland)

    2007-06-15

    This presentation is mainly about how the PV market in Europe has been growing, and which elements are going to determine if this market succeed or failed not only in Europe but also in the rest of the world. In the first part of this presentation, it is mentioned how in 2005 the development of some PV technologies triggered the PV market growth without any marketing control. Then, there are explained the aspects that changed such situation out of control, therefore, it emerged the beginning of the consolidation of this market. There are briefly explained those factors that are going to determine if this market succeed or failed in the future. Finally, there are given examples of some the PV investments. [Spanish] Esta presentacion habla principalmente de la manera en como ha crecido el Mercado de sistemas fotovoltaicos en Europa, asi tambien se mencionan los elementos fundamentales que determinaran el exito o fracaso de este mercado, no solamente en Europa sino tambien en el resto del mundo, en un futuro. En la primera parte de esta presentacion, se describe como en el 2005, debido al desarrollo de algunas tecnologias fotovoltaicas se desencadeno el crecimiento desenfrenado del mercado fotovoltaico. Despues, se explican los aspectos que hicieron que dicho crecimiento tomara su curso, teniendo como resultado el inicio de un mercado mas consolidado. Se explican brevemente los factores que determinaran si este mercado encuentra el exito o el fracaso en un futuro. Finalmente, se dan ejemplos de algunas adquisiciones fotovoltaicas.

  2. Firefighter Safety for PV Systems

    DEFF Research Database (Denmark)

    Mathe, Laszlo; Sera, Dezso; Spataru, Sergiu

    2015-01-01

    An important and highly discussed safety issue for photovoltaic (PV) systems is that as long as the PV panels are illuminated, a high voltage is present at the PV string terminals and cables between the string and inverters that is independent of the state of the inverter's dc disconnection switch...

  3. Testing for PV Reliability (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, S.; Bansal, S.

    2014-09-01

    The DOE SUNSHOT workshop is seeking input from the community about PV reliability and how the DOE might address gaps in understanding. This presentation describes the types of testing that are needed for PV reliability and introduces a discussion to identify gaps in our understanding of PV reliability testing.

  4. PV potential and potential PV rent in European regions

    DEFF Research Database (Denmark)

    Hansen, Anders Chr.; Thorn, Paul

    2013-01-01

    The paper provides a GIS based model for assessing the potentials of photovoltaic electricity in Europe by NUTS 2 regions. The location specific energy potential per PV-­‐panel area is estimated based on observations of solar irradiation, conversion efficiency, levelised costs and the social value...... of PV-­‐electricity. Combined with the potential density of PV-­‐panel area based on land cover and environental restrictions, the PV energy potential and the potential PV ressource rent is calculated. These calculations enbable the model to estimate the regional patterns at NUTS 2 level...

  5. MALDI-TOF-MS with PLS Modeling Enables Strain Typing of the Bacterial Plant Pathogen Xanthomonas axonopodis

    Science.gov (United States)

    Sindt, Nathan M.; Robison, Faith; Brick, Mark A.; Schwartz, Howard F.; Heuberger, Adam L.; Prenni, Jessica E.

    2017-11-01

    Matrix-assisted desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) is a fast and effective tool for microbial species identification. However, current approaches are limited to species-level identification even when genetic differences are known. Here, we present a novel workflow that applies the statistical method of partial least squares discriminant analysis (PLS-DA) to MALDI-TOF-MS protein fingerprint data of Xanthomonas axonopodis, an important bacterial plant pathogen of fruit and vegetable crops. Mass spectra of 32 X. axonopodis strains were used to create a mass spectral library and PLS-DA was employed to model the closely related strains. A robust workflow was designed to optimize the PLS-DA model by assessing the model performance over a range of signal-to-noise ratios (s/n) and mass filter (MF) thresholds. The optimized parameters were observed to be s/n = 3 and MF = 0.7. The model correctly classified 83% of spectra withheld from the model as a test set. A new decision rule was developed, termed the rolled-up Maximum Decision Rule (ruMDR), and this method improved identification rates to 92%. These results demonstrate that MALDI-TOF-MS protein fingerprints of bacterial isolates can be utilized to enable identification at the strain level. Furthermore, the open-source framework of this workflow allows for broad implementation across various instrument platforms as well as integration with alternative modeling and classification algorithms. [Figure not available: see fulltext.

  6. PV and PV/hybrid products for buildings

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, H. P.; Hayter, S. J.; Martin, R. L., Pierce, L. K.

    2000-05-15

    Residential, commercial, and industrial buildings combined are the largest consumers of electricity in the United States and represent a significant opportunity for photovoltaic (PV) and PV/hybrid systems. The U.S. Department of Energy (DOE) is conducting a phased research and product development program, Building Opportunities in the United States for Photovoltaics (PV:BONUS), focused on this market sector. The purpose of the program is to develop technologies and foster business arrangements integrating cost-effective PV or hybrid products into buildings. The first phase was completed in 1996 and a second solicitation, PV:BONUS2, was initiated during 1997. These projects are resulting in a variety of building-integrated products. This paper summarizes the recent progress of the seven firms and collaborative teams currently participating in PV:BONUS2 and outlines planned work for the final phase of their work.

  7. Advances in PV Inverters

    DEFF Research Database (Denmark)

    Anthon, Alexander

    and preferably low complexity leads to new research demands. This is especially true in the field of low cost residential PV inverters where efficiencies are used as major selling arguments. Traditional converter topologies equipped with conventional Silicon based semiconductors to date reach their limitations......, a replacement of only two switching devices per phase leg can greatly reduce the semiconductor losses. The Hybrid-NPC converter can be seen as an attractive and cost competitive alternative to the Silicon Carbide based converter, also allowing to overcome the major drawbacks with the conventional Silicon IGBT...

  8. Outdoor PV Degradation Comparison

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, D. C.; Smith, R. M.; Osterwald, C. R.; Gelak, E.; Kurtz, S. R.

    2011-02-01

    As photovoltaic (PV) penetration of the power grid increases, it becomes vital to know how decreased power output; may affect cost over time. In order to predict power delivery, the decline or degradation rates must be determined; accurately. At the Performance and Energy Rating Testbed (PERT) at the Outdoor Test Facility (OTF) at the; National Renewable Energy Laboratory (NREL) more than 40 modules from more than 10 different manufacturers; were compared for their long-term outdoor stability. Because it can accommodate a large variety of modules in a; limited footprint the PERT system is ideally suited to compare modules side-by-side under the same conditions.

  9. Sensorless PV Array Diagnostic Method for Residential PV Systems

    DEFF Research Database (Denmark)

    Sera, Dezso; Spataru, Sergiu; Mathe, Laszlo

    2011-01-01

    This work proposes a temperature and irradiance sensorless diagnostic method suitable for small residential PV installations, focusing on detection of partial shadows. The method works by detection of failures in crystalline silicone PV arrays by concomitant monitoring of some of their key...

  10. Interband cascade (IC) photovoltaic (PV) architecture for PV devices

    Science.gov (United States)

    Yang, Rui Q.; Tian, Zhaobing; Mishima, Tetsuya D.; Santos, Michael B.; Johnson, Matthew B.; Klem, John F.

    2015-10-20

    A photovoltaic (PV) device, comprising a PV interband cascade (IC) stage, wherein the IC PV stage comprises an absorption region with a band gap, the absorption region configured to absorb photons, an intraband transport region configured to act as a hole barrier, and an interband tunneling region configured to act as an electron barrier. An IC PV architecture for a photovoltaic device, the IC PV architecture comprising an absorption region, an intraband transport region coupled to the absorption region, and an interband tunneling region coupled to the intraband transport region and to the adjacent absorption region, wherein the absorption region, the intraband transport region, and the interband tunneling region are positioned such that electrons will flow from the absorption region to the intraband transport region to the interband tunneling region.

  11. Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2017-01-01

    In order to enable a more wide-scale utilization of PV systems, the cost of PV energy has to be comparable with other energy sources. Oversizing the PV array is one common approach to reduce the cost of PV energy, since it increases the PV energy yield during low solar irradiance conditions....... However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact on the overall PV energy cost, due to the increased maintenance for the PV inverters. This paper...... evaluates the lifetime of PV inverters considering the PV array sizing and installation sites, e.g., Denmark and Arizona. The results reveal that the PV array sizing has a considerable impact on the PV inverter lifetime and reliability, especially in Denmark, where the average solar irradiance level...

  12. PSCAD Modules Representing PV Generator

    Energy Technology Data Exchange (ETDEWEB)

    Muljadi, E.; Singh, M.; Gevorgian, V.

    2013-08-01

    Photovoltaic power plants (PVPs) have been growing in size, and the installation time is very short. With the cost of photovoltaic (PV) panels dropping in recent years, it can be predicted that in the next 10 years the contribution of PVPs to the total number of renewable energy power plants will grow significantly. In this project, the National Renewable Energy Laboratory (NREL) developed a dynamic modeling of the modules to be used as building blocks to develop simulation models of single PV arrays, expanded to include Maximum Power Point Tracker (MPPT), expanded to include PV inverter, or expanded to cover an entire PVP. The focus of the investigation and complexity of the simulation determines the components that must be included in the simulation. The development of the PV inverter was covered in detail, including the control diagrams. Both the current-regulated voltage source inverter and the current-regulated current source inverter were developed in PSCAD. Various operations of the PV inverters were simulated under normal and abnormal conditions. Symmetrical and unsymmetrical faults were simulated, presented, and discussed. Both the three-phase analysis and the symmetrical component analysis were included to clarify the understanding of unsymmetrical faults. The dynamic model validation was based on the testing data provided by SCE. Testing was conducted at SCE with the focus on the grid interface behavior of the PV inverter under different faults and disturbances. The dynamic model validation covers both the symmetrical and unsymmetrical faults.

  13. PV module mounting method and mounting assembly

    Science.gov (United States)

    Lenox, Carl J.S.; Johnson, Kurt M.

    2013-04-23

    A method for mounting PV modules to a deck includes selecting PV module layout pattern so that adjacent PV module edges are spaced apart. PV mounting and support assemblies are secured to the deck according to the layout pattern using fasteners extending into the deck. The PV modules are placed on the PV mounting and support assemblies. Retaining elements are located over and secured against the upper peripheral edge surfaces of the PV modules so to secure them to the deck with the peripheral edges of the PV modules spaced apart from the deck. In some examples a PV module mounting assembly, for use on a shingled deck, comprises flashing, a base mountable on the flashing, a deck-penetrating fastener engageable with the base and securable to the deck so to secure the flashing and the base to the shingled deck, and PV module mounting hardware securable to the base.

  14. PV solar system feasibility study

    International Nuclear Information System (INIS)

    Ashhab, Moh’d Sami S.; Kaylani, Hazem; Abdallah, Abdallah

    2013-01-01

    Highlights: ► This research studies the feasibility of PV solar systems. ► The aim is to develop the theory and application of a hybrid system. ► Relevant research topics are reviewed and some of them are discussed in details. ► A prototype of the PV solar system is designed and built. - Abstract: This research studies the feasibility of PV solar systems and aims at developing the theory and application of a hybrid system that utilizes PV solar system and another supporting source of energy to provide affordable heating and air conditioning. Relevant research topics are reviewed and some of them are discussed in details. Solar heating and air conditioning research and technology exist in many developed countries. To date, the used solar energy has been proved to be inefficient. Solar energy is an abundant source of energy in Jordan and the Middle East; with increasing prices of oil this source is becoming more attractive alternative. A good candidate for the other system is absorption. The overall system is designed such that it utilizes solar energy as a main source. When the solar energy becomes insufficient, electricity or diesel source kicks in. A prototype of the PV solar system that operates an air conditioning unit is built and proper measurements are collected through a data logging system. The measured data are plotted and discussed, and conclusions regarding the system performance are extracted.

  15. Low concentrator PV optics optimization

    Science.gov (United States)

    Sharp, Leonard; Chang, Ben

    2008-08-01

    Purpose: Cost reduction is a major focus of the solar industry. Thin film technologies and concentration systems are viable ways to reducing cost, with unique strengths and weakness for both. Most of the concentrating PV work focuses on high concentration systems for reducing energy cost. Meanwhile, many believe that low concentrators provide significant cost reduction potential while addressing the mainstream PV market with a product that acts as a flat panel replacement. This paper analyzes the relative benefit of asymmetric vs. symmetric optics for low-concentrators in light of specific PV applications. Approach: Symmetric and asymmetric concentrating PV module performance is evaluated using computer simulation to determine potential value across various geographic locations and applications. The selected optic design is modeled against standard cSi flat panels and thin film to determine application fit, system level energy density and economic value. Results: While symmetric designs may seem ideal, asymmetric designs have an advantage in energy density. Both designs are assessed for aperture, optimum concentration ratio, and ideal system array configuration. Analysis of performance across climate specific effects (diffuse, direct and circumsolar) and location specific effects (sunpath) are also presented. The energy density and energy production of low concentrators provide a compelling value proposition. More significantly, the choice of optics for a low concentrating design can affect real world performance. With the goal of maximizing energy density and return on investment, this paper presents the advantages of asymmetric optic concentration and illustrates the value of this design within specific PV applications.

  16. Flexible packaging for PV modules

    Science.gov (United States)

    Dhere, Neelkanth G.

    2008-08-01

    Economic, flexible packages that provide needed level of protection to organic and some other PV cells over >25-years have not yet been developed. However, flexible packaging is essential in niche large-scale applications. Typical configuration used in flexible photovoltaic (PV) module packaging is transparent frontsheet/encapsulant/PV cells/flexible substrate. Besides flexibility of various components, the solder bonds should also be flexible and resistant to fatigue due to cyclic loading. Flexible front sheets should provide optical transparency, mechanical protection, scratch resistance, dielectric isolation, water resistance, UV stability and adhesion to encapsulant. Examples are Tefzel, Tedlar and Silicone. Dirt can get embedded in soft layers such as silicone and obscure light. Water vapor transmittance rate (WVTR) of polymer films used in the food packaging industry as moisture barriers are ~0.05 g/(m2.day) under ambient conditions. In comparison, light emitting diodes employ packaging components that have WVTR of ~10-6 g/(m2.day). WVTR of polymer sheets can be improved by coating them with dense inorganic/organic multilayers. Ethylene vinyl acetate, an amorphous copolymer used predominantly by the PV industry has very high O2 and H2O diffusivity. Quaternary carbon chains (such as acetate) in a polymer lead to cleavage and loss of adhesional strength at relatively low exposures. Reactivity of PV module components increases in presence of O2 and H2O. Adhesional strength degrades due to the breakdown of structure of polymer by reactive, free radicals formed by high-energy radiation. Free radical formation in polymers is reduced when the aromatic rings are attached at regular intervals. This paper will review flexible packaging for PV modules.

  17. Solar PV. Innovators talking; Zon PV. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

  18. Progress & Frontiers in PV Performance

    Energy Technology Data Exchange (ETDEWEB)

    Deline, Chris; DiOrio, Nick; Jordan, Dirk; Toor, Fatima

    2016-09-12

    PowerPoint slides for a presentation given at Solar Power International 2016. Presentation includes System Advisor Model (SAM) introduction and battery modeling, bifacial PV modules and modeling, shade modeling and module level power electronics (MLPE), degradation rates, and PVWatts updates and validation.

  19. PV supply chain growing pains

    International Nuclear Information System (INIS)

    Wilkins, A.

    2010-01-01

    This article discussed issues involving the supply chain for photovoltaic (PV) equipment that is emerging in Ontario as a result of the Feed-in-Tariff (FIT) program that was launched in late 2009. The rapidly developing PV supply chain may not be taking a sustainable path. The domestic-content requirement is making manufacturers outlay capital to set up manufacturing in Ontario without reliable market data. Only a small number of dealer/installers have any meaningful experience designing and installing grid-tie PV. Until recently, wholesale distributors designed and supplied most grid-tie PV systems in Canada, and solar dealers/installers or electricians or electrical contractors did the installation. Instead of selling directly to dealer/installers, solar manufacturers should develop strong relationships with wholesalers, who have system design experience and product training. This would allow manufacturers to focus on their core strength, reach more customers, and keep lower inventory levels. Wholesale distributors in turn provide dealer/installers with expertise in product and system design, training from a range of manufacturers, marketing and logistics support, and immediate access to inventory. Manufacturers generally lack appropriate accounting, engineering, marketing, and logistics services to deal with a multitude of active accounts, and they are not structured to work with architects and engineers to do complete system design. Partnering with wholesale distributors allows manufacturers to take on the residential and small-scale commercial sectors by building brand awareness and increasing market share and sales across Canada. 2 figs.

  20. City and County Solar PV Training Program, Module 2: Screening and Identifying PV Projects

    Energy Technology Data Exchange (ETDEWEB)

    Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-04-09

    When screening and identifying PV projects, cities and counties should understand the different factors that impact the technical and economic potential of a PV project, the steps of the PV screening process, and how to use REopt Lite to screen a site for PV and storage project potential.

  1. Grid Integrated Distributed PV (GridPV) Version 2.

    Energy Technology Data Exchange (ETDEWEB)

    Reno, Matthew J.; Coogan, Kyle

    2014-12-01

    This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functio ns are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in th e OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function i n the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

  2. Optimal design of PV and HP system

    DEFF Research Database (Denmark)

    Nepper-Rasmussen, Bjarke Christian; Rasmussen, Theis Bo

    2015-01-01

    electric energy demand of the HP to hours where excess PV power is present. The self-consumption of the PV energy affects the overall net present value (NPV). In this paper, a method which maximizes the NPV by finding the cost-optimal combination of PV, HP and BT sizes, is proposed. Results show......Methods of utilizing residential produced photovoltaic (PV) power by converting to thermal energy through heat pumps (HP) are present in literature, where thermal energy is dispersed as either heat or hot water at the instant moment of PV production. In this paper an alternative solution...

  3. Chemical Composition and Antibacterial Activity of Essential Oils of Tagetes minuta (Asteraceae) against Selected Plant Pathogenic Bacteria

    Science.gov (United States)

    Wagacha, John M.; Dossaji, Saifuddin F.

    2016-01-01

    The objective of this study was to determine the chemical composition and antibacterial activity of essential oils (EOs) of Tagetes minuta against three phytopathogenic bacteria Pseudomonas savastanoi pv. phaseolicola, Xanthomonas axonopodis pv. phaseoli, and Xanthomonas axonopodis pv. manihotis. The essential oils were extracted using steam distillation method in a modified Clevenger-type apparatus while antibacterial activity of the EOs was evaluated by disc diffusion method. Gas chromatography coupled to mass spectrometry (GC/MS) was used for analysis of the chemical profile of the EOs. Twenty compounds corresponding to 96% of the total essential oils were identified with 70% and 30% of the identified components being monoterpenes and sesquiterpenes, respectively. The essential oils of T. minuta revealed promising antibacterial activities against the test pathogens with Pseudomonas savastanoi pv. phaseolicola being the most susceptible with mean inhibition zone diameters of 41.83 and 44.83 mm after 24 and 48 hours, respectively. The minimum inhibitory concentrations and minimum bactericidal concentrations of the EOs on the test bacteria were in the ranges of 24–48 mg/mL and 95–190 mg/mL, respectively. These findings provide a scientific basis for the use of T. minuta essential oils as a botanical pesticide for management of phytopathogenic bacteria. PMID:27721831

  4. Lightning protection of PV systems

    OpenAIRE

    Pons, Enrico; Tommasini, Riccardo

    2013-01-01

    Lightning strikes can affect photovoltaic (PV) generators and their installations, involving also the inverter's electronics. It is therefore necessary to evaluate the risk connected to lightning strikes in order to adopt the correct protective measures for the system. The Standard IEC (EN) 62305-2 reports the procedures for the risk calculation and for the choice of proper lightning protection systems. Usually the technical guidelines suggest protecting with SPDs (surge protective devices) b...

  5. Effect of domestic cooking on the starch digestibility, predicted glycemic indices, polyphenol contents and alpha amylase inhibitory properties of beans (Phaseolis vulgaris) and breadfruit (Treculia africana).

    Science.gov (United States)

    Chinedum, E; Sanni, S; Theressa, N; Ebere, A

    2018-01-01

    The effect of processing on starch digestibility, predicted glycemic indices (pGI), polyphenol contents and alpha amylase inhibitory properties of beans (Phaseolis vulgaris) and breadfruit (Treculia africana) was studied. Total starch ranged from 4.3 to 68.3g/100g, digestible starch ranged from 4.3 to 59.2 to 65.7g/100g for the raw and processed legumes; Resistance starch was not detected in most of the legumes except in fried breadfruit and the starches in both the raw and processed breadfruit were more rapidly digested than those from raw and cooked beans. Raw and processed breadfruit had higher hydrolysis curves than raw and processed beans with the amylolysis level in raw breadfruit close to that of white bread. Raw beans had a low glycemic index (GI); boiled beans and breadfruit had intermediate glycemic indices respectively while raw and fried breadfruit had high glycemic indices. Aqueous extracts of the food samples had weak α-amylase inhibition compared to acarbose. The raw and processed legumes contained considerable amounts of dietary phenols and flavonoids. The significant correlation (r=0.626) between α-amylase inhibitory actions of the legumes versus their total phenolic contents suggests the contribution of the phenolic compounds in these legumes to their α-amylase inhibitory properties. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. 100 KW pv system design

    International Nuclear Information System (INIS)

    Khan, N.; Abas, N.

    2010-01-01

    This paper reports the design of a 100kw photovolatic (PV) system for 10,000 ft/sup 2/ roof building. It explain the necessary design steps for medium power PV system specifications of associated accessories for large size building solar electrification. A comparison between various solar technologies and their ancillary anchors is provided to guide the young electric power and renewable energy engineers. It is to prove that hybrid photovolatic thermal (PVT) technology is more efficient than simple photovolatic (PV), photovolatic concentrator (PVC) or stand-alone solar thermal heating systems. We have been using fossil fuels from 1859 to 2009. Oil triggered population growth rate which in turn increased energy demand for iil. A 200 years close loop positive feedback has amplified oil production rate for few thousand barrels to 86-87 billion barrels. Today the world population is burning oil at rate of 1000 barrels/sec. The oil reserves are likely to end by 2050 (worst case) or 2100 (best case). At 1.7% growth rate the current global population might double to 12 billion barrels and electric power demand will increase from current 15 TW to TW. Unfortunately oil reserves would be breathing last and global warning would be at its climax. To cope with upcoming power, water water and energy cataclysms, it is more than essential to go for sustainable and renewable and renewable energy education and lifestyles. I hope this design venture will create interest among power and energy students, engineers and professional engine. (author)

  7. PV-CAD: an integrated tool for designing PV facades; PV-CAD - Ein integriertes Werkzeug zur Auslegung von PV-Fassaden

    Energy Technology Data Exchange (ETDEWEB)

    Giese, H.; Viotto, M. [Inst. fuer Solare Energieversorgungstechnik (ISET) e.V., Kassel (Germany); Esser, M.; Pukrop, D. [Univ. Oldenburg (Germany). Abt. Energie- und Halbleiterforschung; Stellbogen, D. [Zentrum fuer Sonnenergie- und Wasserstoff-Forschung, Stuttgart (Germany)

    1997-12-31

    PV-CAD provides PV system planners with a practice-oriented tool for an efficient design of PV facades. Being compatible with the standard programmes of the architects` and electrical engineering sectors it can be used on already existing systems and allows the user to draw on previously acquired knowedge. Its open interfaces permit the integration of further design tools. PV CAD works under Microsoft Windows for which it has the necessary graphic user interface. Its compliance to PC standards opens up a wide range of applications and permits its use also on inexpensive computers. Thanks to its promotion by the Federal Ministry for Education, Science, Research, and Technology under the research project ``Computer programmes for the design of photovoltaic facades`` PV-CAD is available at a moderate price. PV-CAD permits an efficient planning of solar facades and therefore has the potential to stimulate the use of PV on buildings. (orig.) [Deutsch] Mit PV-CAD steht dem Anlagenplaner ein anwendungsorientiertes Werkzeug zur Verfuegung, das eine rationelle Auslegung von PV-Fassaden ermoeglicht. Die Kompatibilitaet zu Standardprogrammen aus dem Architektur- und Elektrosektor erlaubt die Nutzung bereits vorhandener Systeme und damit erworbener Kenntnisse. Offene Schnittstellen gestatten die Einbindung weiterer Entwurfswerkzeuge. PV-CAD arbeitet unter Microsoft-Windows und verfuegt ueber die entsprechende grafische Benutzerschnittstelle. Die Kompatibilitaet zum PC-Standard eroeffnet eine sehr breite Anwenderbasis und ermoeglicht den Einsatz des Programms auch auf preiswerten Rechnern. Aufgrund der Foerderung durch das Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie im Rahmen des Forschungsprojekts `Rechnerprogramm zur Auslegung von Photovoltaik-Fassaden` steht PV-CAD preiswert zur Verfuegung. PV-CAD ermoeglicht eine effiziente Planung von Solarfassaden und kann daher dem PV-Einsatz in Gebaeuden weitere Impulse geben. (orig.)

  8. Multilocus Sequence Typing Reveals Relevant Genetic Variation and Different Evolutionary Dynamics among Strains of Xanthomonas arboricola pv. juglandis

    Directory of Open Access Journals (Sweden)

    Marco Scortichini

    2010-11-01

    Full Text Available Forty-five Xanthomonas arboricola pv. juglandis (Xaj strains originating from Juglans regia cultivation in different countries were molecularly typed by means of MultiLocus Sequence Typing (MLST, using acnB, gapA, gyrB and rpoD gene fragments. A total of 2.5 kilobases was used to infer the phylogenetic relationship among the strains and possible recombination events. Haplotype diversity, linkage disequilibrium analysis, selection tests, gene flow estimates and codon adaptation index were also assessed. The dendrograms built by maximum likelihood with concatenated nucleotide and amino acid sequences revealed two major and two minor phylotypes. The same haplotype was found in strains originating from different continents, and different haplotypes were found in strains isolated in the same year from the same location. A recombination breakpoint was detected within the rpoD gene fragment. At the pathovar level, the Xaj populations studied here are clonal and under neutral selection. However, four Xaj strains isolated from walnut fruits with apical necrosis are under diversifying selection, suggesting a possible new adaptation. Gene flow estimates do not support the hypothesis of geographic isolation of the strains, even though the genetic diversity between the strains increases as the geographic distance between them increases. A triplet deletion, causing the absence of valine, was found in the rpoD fragment of all 45 Xaj strains when compared with X. axonopodis pv. citri strain 306. The codon adaptation index was high in all four genes studied, indicating a relevant metabolic activity.

  9. Photovoltaics: PV takes off the UK

    International Nuclear Information System (INIS)

    Noble, Ray; Gregory, Jenny

    2000-01-01

    Despite historical ups and downs, there is still ambition to bring increasingly efficient photovoltaic (PV) systems to the market. PV for major remote telecommunications systems is now an established part of the market, many mobile phone systems are powered by PV and there is potential for increased use of home solar systems, especially in developing countries. Over the past few years, building-integrated PV (BIPV) has been on the increase. In 1999, global production from PV exceeded 200 MW and the UK installed capacity was greater than 1 MW. BIPV is a fast growing market and its characteristics and advantages are discussed. PV installations at Nottingham University, Greenwich Pavilion, BP Amoco Sunbury, Baglan Bay, BP filling stations, and Sainsbury's are described

  10. Adiabatic Rearrangement of Hollow PV Towers

    OpenAIRE

    Eric A Hendricks; Wayne H Schubert

    2010-01-01

    Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV). This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with...

  11. SunShot 2030 for Photovoltaics (PV): Envisioning a Low-Cost PV Future

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Wesley J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zuboy, Jarrett; Woodhouse, Michael A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-01

    This presentation summarizes the findings from the report 'SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future.' This presentation was given as a webinar on September 26, 2017.

  12. Processes and Materials for Flexible PV Arrays

    National Research Council Canada - National Science Library

    Gierow, Paul

    2002-01-01

    .... A parallel incentive for development of flexible PV arrays are the possibilities of synergistic advantages for certain types of spacecraft, in particular the Solar Thermal Propulsion (STP) Vehicle...

  13. 40 CFR 180.1261 - Xanthomonas campestris pv. vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages.

    Science.gov (United States)

    2010-07-01

    ... and Pseudomonas syringae pv. tomato specific Bacteriophages. 180.1261 Section 180.1261 Protection of.... vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages. An exemption from the requirement of... syringae pv. tomato specific bacteriophages in or on pepper and tomato. [74 FR 26536, June 3, 2009] ...

  14. Differentially Expressed Genes in Resistant and Susceptible Common Bean (Phaseolus vulgaris L. Genotypes in Response to Fusarium oxysporum f. sp. phaseoli.

    Directory of Open Access Journals (Sweden)

    Renfeng Xue

    Full Text Available Fusarium wilt of common bean (Phaseolus vulgaris L., caused by Fusarium oxysporum Schlechtend.:Fr. f.sp. phaseoli (Fop, is one of the most important diseases of common beans worldwide. Few natural sources of resistance to Fop exist and provide only moderate or partial levels of protection. Despite the economic importance of the disease across multiple crops, only a few of Fop induced genes have been analyzed in legumes. Therefore, our goal was to identify transcriptionally regulated genes during an incompatible interaction between common bean and the Fop pathogen using the cDNA amplified fragment length polymorphism (cDNA-AFLP technique. We generated a total of 8,730 transcript-derived fragments (TDFs with 768 primer pairs based on the comparison of a moderately resistant and a susceptible genotype. In total, 423 TDFs (4.9% displayed altered expression patterns after inoculation with Fop inoculum. We obtained full amplicon sequences for 122 selected TDFs, of which 98 were identified as annotated known genes in different functional categories based on their putative functions, 10 were predicted but non-annotated genes and 14 were not homologous to any known genes. The 98 TDFs encoding genes of known putative function were classified as related to metabolism (22, signal transduction (21, protein synthesis and processing (20, development and cytoskeletal organization (12, transport of proteins (7, gene expression and RNA metabolism (4, redox reactions (4, defense and stress responses (3, energy metabolism (3, and hormone responses (2. Based on the analyses of homology, 19 TDFs from different functional categories were chosen for expression analysis using quantitative RT-PCR. The genes found to be important here were implicated at various steps of pathogen infection and will allow a better understanding of the mechanisms of defense and resistance to Fop and similar pathogens. The differential response genes discovered here could also be used as

  15. Adiabatic Rearrangement of Hollow PV Towers

    Directory of Open Access Journals (Sweden)

    Eric A Hendricks

    2010-10-01

    Full Text Available Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV. This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with significant vortex structural and intensity change. The three-dimensional adiabatic rearrangements of two prototypical hurricane-like hollow PV towers (one thick and one thin are examined in an idealized framework. For both hollow towers, dynamic instability causes air parcels with high PV to be mixed into the eye preferentially at lower levels, where unstable PV wave growth rates are the largest. Little or no mixing is found to occur at upper levels. The mixing at lower and middle levels is most rapid for the breakdown of the thin hollow tower, consistent with previous barotropic results. For both hollow towers, this advective rearrangement of PV affects the tropical cyclone structure and intensity in a number of ways. First, the minimum central pressure and maximum azimuthal mean velocity simultaneously decrease, consistent with previous barotropic results. Secondly, isosurfaces of absolute angular momentum preferentially shift inward at low levels, implying an adiabatic mechanism by which hurricane eyewall tilt can form. Thirdly, a PV bridge, similar to that previously found in full-physics hurricane simulations, develops as a result of mixing at the isentropic levels where unstable PV waves grow most rapidly. Finally, the balanced mass field resulting from the PV rearrangement is warmer in the eye between 900 and 700 hPa. The location of this warming is consistent with observed warm anomalies in the eye, indicating that in certain instances the hurricane

  16. PV panel model based on datasheet values

    DEFF Research Database (Denmark)

    Sera, Dezso; Teodorescu, Remus; Rodriguez, Pedro

    2007-01-01

    This work presents the construction of a model for a PV panel using the single-diode five-parameters model, based exclusively on data-sheet parameters. The model takes into account the series and parallel (shunt) resistance of the panel. The equivalent circuit and the basic equations of the PV cell...

  17. Distributed PV Adoption - Sensitivity to Market Factors

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter; Sigrin, Ben

    2016-02-01

    NREL staff used the dSolar (distributed solar) model to forecast the adoption of distributed, behind-the-meter PV through the year 2050 for 9 different scenarios. The scenarios varied in their assumptions about a carbon tax, the cost of PV systems in the future, and what credit would be given for excess generation once current net metering policies expire.

  18. Identification and characterisation of Xanthomonas campestris pv

    African Journals Online (AJOL)

    Ednar Wulff

    2013-02-06

    Feb 6, 2013 ... Indiana 46514 USA) for identification of X. campestris pv. campestris following the instructions of the manufacturer. Acidovorax avenae subsp. avenae NCPPB 3353 a non- related plant pathogen to cabbage and Pseudomonas syringae pv. maculicola NCPPB 2039, a leaf spot pathogen of cabbage, served ...

  19. Global PV markets and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Wolfsegger, Cristoph [European Photolvoltaic Industry Association (EPIA), Brussels, Belgium (Belgium)

    2007-06-15

    This presentation mainly talks about the global importance of the PV industry, not only in the environmental sphere but also in the economic sphere. It is firstly given the major information of the European Photovoltaic Industry Association (EPIA), where there can be found the lists of those full member countries that work as: components manufacturers, consulting, and associate members. Then, it is given a briefly explanation about the Alliance for Rural Electrification (ARE), and the reasons why the -PV systems- are almost the panacea to both the energy and the environmental issue. In addition, it is given the most relevant information about how to implement this system in those regions that have not yet implemented it. Besides, there are explained some of the benefits that this system has. It is shortly explained how this system is working in German and it is also shown a comparison chart about the photovoltaic feed-in tariffs. There are shown some graphics and charts having information related to the global markets and the global installations of PV systems and other issues related to them. [Spanish] Esta presentacion habla principalmente acerca de la importancia que hoy en dia tiene la industria fotovoltaica alrededor del mundo, esto no solo ocurre en el ambito ambiental sino tambien en el economico. En la primer parte se muestra la informacion mas importante acerca de la Asociacion Europea de la Industria Fotovoltaica (EPIA por sus siglas en ingles), en donde se encuentran las listas de los paises que son miembros permanentes trabajando como: fabricantes de componentes, asesores y miembros asociados. Enseguida, se da, de manera escueta, una explicacion acerca de la ARE, asi como las razones por las que los sistemas fotovoltaicos son casi la panacea tanto para los problemas ambientales como para los energeticos. Ademas, se explica la informacion mas relevante acerca de como implementar este sistema en aquellas partes del mundo que todavia no lo han realizado

  20. Learning in PV trends and future prospects

    International Nuclear Information System (INIS)

    Schaeffer, G.J.; De Moor, H.H.C.

    2004-06-01

    For large scale application of PV cost reduction is essential. It is shown in this study that the price evolution is on track and even accelerating the last 15 years. Using an experience curve approach a learning rate of little over 20% was found consistent with other studies. As data were collected for small rooftop grid connected systems, it could be shown that this learning rate is not only found for modules, but also for BOS (all costs apart from the modules) in Germany as well as in the Netherlands. Projections of the future price of PV systems show that a learning rate of at least 20% is needed to make introduction of PV affordable. It is very effective to invest in learning, thus increasing the learning rate, as well as developing market segments were the value of PV is higher, such as residential PV systems in southern Europe

  1. Power of design - the future of building-integrated PV

    International Nuclear Information System (INIS)

    Abbate, Cinzia

    2001-01-01

    This paper discusses strategies to make building integrated photovoltaic (PV) systems more acceptable and to allow PV material to compete with conventional construction material. The history of developments in building integration and difficulties encountered by architects wishing to use PV products are explored, and the Dutch Amersfoot project in Utrecht involving a new suburb of 501 house covered with PV panels is described. Questions raised regarding architectural integration of PV systems, and PV systems and the construction market are discussed. The Italian PV programme, financial and political constraints, and the positioning of PV on existing structures are reported

  2. The market for photovoltaic (PV) technology

    International Nuclear Information System (INIS)

    Frantzis, L.; Vejtasa, K.M.

    1993-01-01

    This paper describes a study that was intended to provide the Electric Power Research Institute (EPRI) with a market analysis for photovoltaic (PV) technologies under development by EPRI and others. The analysis was to focus on markets and factors leading to significant incremental growth for PV demand, large enough to support more efficient scale PV manufacturing capacity. EPRI anticipates that PV ultimately could provide grid-connected power, however, the 1995--2010 market dynamics are uncertain. The specific objectives of this study, therefore, were to: determine what major future domestic US markets for PV technologies will emerge and provide enough volume to support significant improvements in manufacturing costs through manufacturing economies of scale; provide insight on what is needed to gain acceptance of PV technologies for electric power generation in those major markets; provide insight on when investments in demonstration and manufacturing facilities should be made and what is needed to be successful in each element of the business that these markets could support (e.g., technology development, manufacturing, sales, installation, and service); and provide key insights on the requirements for commercial success of PV in the utility sector

  3. Multifunctional a-Si PV systems

    Energy Technology Data Exchange (ETDEWEB)

    Peippo, K.; Lund, P.; Vartiainen, E. [Helsinki Univ. of Technology, Otaniemi (Finland). Advanced Energy Systems

    1998-10-01

    The optimal use of the various forms of solar energy (passive, active, daylighting, photovoltaics) in buildings calls for an optimal integration of the technologies. As energy conservation potential in space heating may soon be exhausted, electricity efficiency and on-site generation will play an increasing role in energy-conscious building design. There, dispersed PV systems integrated into buildings show a significant market potential, due to a number of benefits: no extra land area is required, PV-array may replace conventional cladding materials and become a building element. Moreover, the produced PV-electricity is more valuable for the building owner than for an electric utility

  4. PV-hybrid and mini-grid

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-07-01

    Within the 5th European PV-hybrid and mini-grid conference 29th and 30th April, 2010 in Tarragona (Spain) the following lectures were held: (1) Overview of IEA PVPS Task 11 PV-hybrid systems within mini grids; (2) Photovoltaic revolution for deployment in developing countries; (3) Legal and financial conditions for the sustainable operation of mini-grids; (4) EU instruments to promote renewable energies in developing countries; (5) PV hybridization of diesel electricity generators: Conditions of profitability and examples in differential power and storage size ranges; (6) Education suit of designing PV hybrid systems; (7) Sustainable renewable energy projects for intelligent rural electrification in Laos, Cambodia and Vietnam; (8) Techno-economic feasibility of energy supply of remote villages in Palestine by PV systems, diesel generators and electric grid (Case studies: Emnazeil and Atouf villages); (9) Technical, economical and sustainability considerations of a solar PV mini grid as a tool for rural electrification in Uganda; (10) Can we rate inverters for rural electrification on the basis of energy efficiency?; (11) Test procedures for MPPT charge controllers characterization; (12) Energy storage for mini-grid stabilization; (13) Redox flow batteries - Already an alternative storage solution for hybrid PV mini-grids?; (14) Control methods for PV hybrid mini-grids; (15) Partial AC-coupling in mini-grids; (15) Normative issues of small wind turbines in PV hybrid systems; (16) Communication solutions for PV hybrid systems; (17) Towards flexible control and communication of mini-grids; (18) PV/methanol fuel cell hybrid system for powering a highway security variable message board; (19) Polygeneration smartgrids: A solution for the supply of electricity, potable water and hydrogen as fuel for transportation in remote Areas; (20) Implementation of the Bronsbergen micro grid using FACDS; (21) A revisited approach for the design of PV wind hybrid systems; (22

  5. Linhagens de feijoeiro comum com fenótipos agronômicos favoráveis e resistência ao crestamento bacteriano comum e antracnose Common bean lines with suitable agronomic phenotypes and resistant to bacterial blight and anthracnose

    Directory of Open Access Journals (Sweden)

    Joaquim Geraldo Cáprio da Costa

    2003-10-01

    Full Text Available O crestamento bacteriano comum e a antracnoseincitados por Xanthomonas axonopodis pv. phaseoli (Smith Vauterin, Hoste, Kesters & Swings e Colletotrichum lindemuthianum (Sacc. & Magn. Scrib., respectivamente, podem reduzir consideravelmente a produtividade do feijoeiro comum (Phaseolus vulgaris L.. Conduziu-se este trabalho com o objetivo de obter linhagens com resistência conjunta ao crestamento bacteriano comum e à antracnose, com características agronômicas desejáveis. Foram obtidas 35 populações F2 provenientes de cruzamentos simples entre linhagens com resistência ao crestamento bacteriano comum proveniente de P. acutifolius A. Gray e linhagens resistentes à antracnose e com características agronômicas favoráveis. As populações segregantes de F2 a F5 foram inoculadas com o patótipo 89 de C. lindemuthianum com uma concentração de 1,2 x 10(6 conídios/mL e submetidas à seleção massal modificada. As plantas que apresentaram grau superior a 4 foram eliminadas. Na geração F5, foi realizada seleção individual das plantas remanescentes para obter as famílias F6. As famílias F6 foram avaliadas mediante inoculação com os patótipos 55, 89, 95 e 453 de C. lindemuthianum. As famílias F7 resistentes à antracnose foram inoculadas em casa-de-vegetação por incisão das folhas primárias com tesoura mergulhada em uma suspensão de 5 x 10(7 ufc do isolado XpCNF 15 de X. axonopodis pv. phaseoli. As linhagens resistentes foram avaliadas em quatro experimentos de campo. Foram selecionadas 17 linhagens com alto rendimento de grãos, resistentes ao crestamento bacteriano comum e à antracnose, com boa altura de inserção das vagens inferiores e resistentes ao acamamento.Common bacterial blight and anthracnose diseases, incited by Xanthomonas axonopodis pv. phaseoli (Smith Vauterin, Hoste, Kesters & Swings and Colletotrichum lindemuthianum (Sacc. & Magn. Scrib., respectively, are major constrains for dry bean (Phaseolus vulgaris L

  6. Custo adaptativo da indução de resistência em feijoeiro mediada pela rizobactéria Bacillus cereus ou acibenzolar-S-metil: atividade de enzimas, síntese de fenóis e lignina e biomassa Fitness cost of induced resistance in bean plants by the rhizobacteria Bacillus cereus or acibenzolar-S-methyl: enzymes activities, phenol and lignin synthesis, and biomass

    Directory of Open Access Journals (Sweden)

    Odair José Kuhn

    2010-06-01

    Full Text Available Plantas que utilizam recursos para defesa na ausência de pragas ou patógenos, arcarão com custos energéticos que podem refletir na sua produtividade. Assim, teve-se por objetivo avaliar os custos adaptativos da indução de resistência, antes da chegada do patógeno, em feijoeiro induzido por um indutor biótico (Bacillus cereus e um abiótico (acibenzolar-S-metil, ASM, em 2, 3 ou 4 aplicações distribuídas ao longo do ciclo da cultura. Avaliou-se o efeito protetor contra a bactéria Xanthomonas axonopodis pv. phaseoli, além da atividade de peroxidase, quitinase, β-1,3-glucanase, síntese de lignina, fenóis e crescimento com base na matéria seca. Observou-se que os indutores protegeram a cultura contra X. axonopodis pv. phaseoli com base na redução da severidade. O ASM aumentou a atividade de peroxidase, quitinase e β-1,3-glucanase, enquanto que o B. cereus aumentou apenas a peroxidase. O ASM aumentou a síntese de lignina e B. cereus não, enquanto que ASM diminuiu teor de fenóis e B. cereus não. O ASM reduziu a biomassa da planta, o que não ocorreu em plantas induzidas por B. cereus. Portanto, a resistência induzida por ASM apresenta elevado custo associado, enquanto que por B. cereus apresenta baixo custo, necessitando a indução de resistência ser melhor explorada e estudada para potencializar seu uso em feijoeiro.Plants that use resources to defend themselves in the absence of pests or pathogens will pay off with energy costs that can reflect in the productivity. Thus, the objective of this work was to evaluate the fitness costs of the resistance induced in bean plants, before the presence of the pathogen, by using biotic (Bacillus cereus and abiotic (acibenzolar-S-methyl, ASM inducers, applied 2, 3 or 4 times during the cycle of the culture. The protecting effect was evaluated against the bacterium Xanthomonas axonopodis pv. phaseoli. The activities of peroxidase, chitinase and β-1,3-glucanase, lignin and phenol

  7. Transformerless PV inverters. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Borup, U.

    2009-12-15

    Since the start of the project the market for grid connected PV inverters have developed further. When the project started three - phase inverter were only available in high power systems. The technology developed within this project will enable three phase technology also to be implemented in string inverters for system down to 10 kW. We expect this to be very attractive due to the increased demand for symmetrical feed-in to the grid. The project relevance is therefore high and the sector continues to develop very much driven by technology. Especially the inverter technology is getting a lot of focus. The inverter systems are expected to take a much larger role in supporting the electrical grid in the future. The technology platform developed within the project is prepared to be extended with these utility functionalities. The main results of the project were: 1) A new technology concept for transformer-less inverters has been demonstrated with a number of prototypes. 2) Efficiency above 97,7% has been proven. 3) Efficiency and Maximum power point tracking has been optimized to ensure that almost all energy produced of the panels is transferred to the grid. 4) The platform is developed with a very fast control board, which enables extended functionality as demanding grid supporting functions in the future. Details about cost price and details about the control loop implementation is excluded from the report due to the competitive situation for Danfoss Solar Inverters A/S. (LN)

  8. Robust PV Degradation Methodology and Application

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, Dirk [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Deline, Christopher A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kimball, Greg [SunPower; Anderson, Mike [SunPower

    2017-11-15

    The degradation rate plays an important role in predicting and assessing the long-term energy generation of PV systems. Many methods have been proposed for extracting the degradation rate from operational data of PV systems, but most of the published approaches are susceptible to bias due to inverter clipping, module soiling, temporary outages, seasonality, and sensor degradation. In this manuscript, we propose a methodology for determining PV degradation leveraging available modeled clear-sky irradiance data rather than site sensor data, and a robust year-over-year (YOY) rate calculation. We show the method to provide reliable degradation rate estimates even in the case of sensor drift, data shifts, and soiling. Compared with alternate methods, we demonstrate that the proposed method delivers the lowest uncertainty in degradation rate estimates for a fleet of 486 PV systems.

  9. China PV Business and Applications Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Sherring, Chris (Sherring Energy Associates)

    1999-08-30

    This report provides an overview of photovoltaics (PV) business and applications in China. Although more than 70 million people in China are without access to grid electricity, many of the unelectrified regions benefit from considerable renewable resources, including good solar insolation. Current annual PV sales are still modest, however, and are estimated to be between 2.0 and 2.5 megawatts. This and other significant PV data, including information regarding the current status of key aspects of Chinese businesses, markets, and distribution channels, are included in the report. Detailed company profiles of Chinese business organizations and summaries of visits made to these companies (as well as to more remote sites in Inner Mongolia to examine PV usage by the end-use customer) in September-October 1998 are also presented.

  10. Robust PV Degradation Methodology and Application

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, Dirk [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Deline, Christopher A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kimball, Gregory M. [SunPower Corporation; Anderson, Mike [SunPower Corporation

    2017-12-21

    The degradation rate plays an important role in predicting and assessing the long-term energy generation of photovoltaics (PV) systems. Many methods have been proposed for extracting the degradation rate from operational data of PV systems, but most of the published approaches are susceptible to bias due to inverter clipping, module soiling, temporary outages, seasonality, and sensor degradation. In this paper, we propose a methodology for determining PV degradation leveraging available modeled clear-sky irradiance data rather than site sensor data, and a robust year-over-year rate calculation. We show the method to provide reliable degradation rate estimates even in the case of sensor drift, data shifts, and soiling. Compared with alternate methods, we demonstrate that the proposed method delivers the lowest uncertainty in degradation rate estimates for a fleet of 486 PV systems.

  11. Leakage current measurement in transformerless PV inverters

    DEFF Research Database (Denmark)

    Kerekes, Tamas; Sera, Dezso; Mathe, Laszlo

    2012-01-01

    Photovoltaic (PV) installations have seen a huge increase during the last couple of years. Transformerless PV inverters are gaining more share of the total inverter market, due to their high conversion efficiency, small weight and size. Nevertheless safety should have an important role in case...... of these tranformerless systems, due to the missing galvanic isolation. Leakage and fault current measurement is a key issue for these inverter topologies to be able to comply with the required safety standards. This article presents the test results of two different current measurement sensors that were suggested...... to be used in commercial PV inverters for the measurement of leakage and fault ground currents. The German VDE0126–1–1 standard gives the limit for fault and leakage ground currents and all grid connected PV inverters have to comply with these limits and disconnect from the grid in case of a fault....

  12. Distributed PV Adoption in Maine Through 2021

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter; Sigrin, Ben

    2015-11-06

    NREL has used its dSolar (distributed solar) model to generate low-medium-high estimates of distributed PV adoption in Maine through 2021. This presentation gives a high-level overview of the model and modeling results.

  13. DNA polymorphism analysis of Xanthomonas campestris pv ...

    African Journals Online (AJOL)

    strand conformation polymorphism (SSCP) techniques using M13 and 16S rRNA primers, respectively, for genotyping of the phytopathogenic bacterium Xanthomonas campestris pv. campestris was studied. RAPD provided a simple, rapid, and ...

  14. Rating PV Power and Energy: Cell, Module, and System Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Emery, Keith

    2016-06-02

    A summary of key points related to research-level measurements of current vs. voltage measurement theory including basic PV operation, equivalent circuit, and concept of spectral error; PV power performance including PV irradiance sensors, simulators and commercial and generic I-V systems; PV measurement artifacts, intercomparisons, and alternative rating methods.

  15. A Practical Optimization Method for Designing Large PV Plants

    DEFF Research Database (Denmark)

    Kerekes, Tamas; Koutroulis, E.; Eyigun, S.

    2011-01-01

    Nowadays Photovoltaic (PV) plants have multi MW sizes, the biggest plants reaching tens of MW of capacity. Such large-scale PV plants are made up of several thousands of PV panels, each panel being in the range of 150-350W. This means that the design of a Large PV power plant is a big challenge...

  16. Building PV markets: customers and prices

    International Nuclear Information System (INIS)

    Haas, Reinhard

    2002-01-01

    What makes market deployment strategies for PV successful? A group of specialists (from IEA Task 7) has been looking at the progress made so far. Here, in the first of two articles based on their report, the author presents some of their findings, including benefits and barriers for defined groups of customers; how customers for PV systems are identified, and what they are willing to pay. It also looks at current prices in different countries, and their possible trends. (Author)

  17. PV Obelisk - Information system with photovoltaics

    International Nuclear Information System (INIS)

    Ruoss, D.; Rasmussen, J.

    2004-01-01

    This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed

  18. Environmental impact of PV cell waste scenario.

    Science.gov (United States)

    Bogacka, M; Pikoń, K; Landrat, M

    2017-12-01

    Rapid growth of the volume of waste from PV cells is expected in the following years. The problem of its utilization seems to be the most important issue for future waste management systems. The environmental impacts of the PV recycling scenario are presented in the manuscript. The analysis is based on the LCA approach and the average data available in specialized databases for silicon standard PV cell is used. The functional unit includes parameters like: efficiency, composition, surface area. The discussion on the environmental impact change due to the location of the PV production and waste processing plants is presented in the manuscript. Additionally, the discussion on the environmental effect of substituting different energy resources with PV cells is presented in the manuscript. The analysis of the PV cell life cycle scenario presented in the article was performed using the SIMA PRO software and data from Ecoinvent 3.0 database together with additional data obtained from other sources. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. The Value of Transparency in Distributed Solar PV Markets

    Energy Technology Data Exchange (ETDEWEB)

    OShaughnessy, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zamzam, Ahmed S [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-12-01

    Market transparency refers to the degree of customer awareness of product options and fair market prices for a given good. In The Value of Transparency in Distributed Solar PV Markets, we use residential solar photovoltaic (PV) quote data to study the value of transparency in distributed solar PV markets. We find that improved market transparency results in lower installation offer prices. Further, the results of this study suggest that PV customers benefit from gaining access to more PV quotes.

  20. Is solar PV generated electricity cheap in South Africa?

    CSIR Research Space (South Africa)

    Roro, Kittessa T

    2015-07-01

    Full Text Available Recent reported utility scale PV prices 222 % decrease in investment in 2013, despite record capacity additions of more than 32 % Solar PV Global Capacity Additions & Investment, 2004-2013 Main reason: Module prices are getting lower! Sources: REN21... curve: Volume + 100 % → Price -20 %Source: Navigant / PSE 2013 12 Contents Global PV overview South African PV market overview Recent reported utility scale PV prices 13 Integrated Resource Plan 2010 (IRP 2010, promulgated version) plans capacity...

  1. Assessing the PV business opportunities in Greece

    International Nuclear Information System (INIS)

    Patlitzianas, Konstantinos D.; Skylogiannis, Georgios K.; Papastefanakis, Dimitrios

    2013-01-01

    Highlights: • An approach of qualitative judgments for the PV opportunities through the assessing of the licenses’ value in Greece. • It can be supplied in other countries by applying different weights to the criteria. • It can be used by everyone in order to find a suitable PV investment without the need of experts in the field. - Abstract: Greece, as a member of the European Union (EU), has undertaken the obligation to meet the expected goals for the penetration of Renewable Energy Sources (RES) in the national energy balance in compliance with “20–20–20” goals (20% of the Gross Energy Consumption and 40% of the Gross Electricity Consumption should be covered by RES). Although the development of RES, and particularly of Photovoltaic (PV), in Greece during the last years has presented a satisfactory growth, the country is still far away from the above goals. The main reason for this delay is that – except the financial crisis – many licenses are inactive and waiting funding in order to be utilized. Additionally, the latest law (L.4152/2013) has forbidden the interconnection of new PV power Plants to the grid until the end of 2013. The above fact determines the significance of the existing PV Licenses in achieving the national goals. The aim of this paper is to present an integrated approach of qualitative judgments for the PV business opportunities through the assessing of the licenses’ value in Greece. The approach, which is based on a Multi Criteria Decision Making (MCDM) theory of quantifying multiple qualitative judgments, takes into account the real factors which can affect the expected production and cost of the PV installation and therefore the RoI (Return of Investment)

  2. Optimization of PV-based energy production by dynamic PV-panel/inverter configuration

    DEFF Research Database (Denmark)

    Paasch, Kasper; Nymand, Morten; Haase, Frerk

    This paper investigates the possible increase in annual energy production of a PV system with more than one MPPT (maximum power point tracker) input channels under Nordic illumination conditions, in case a concept of dynamic switching of the PV panels is used at the inputs of the inverters....

  3. Prospects for PV: a learning curve analysis

    International Nuclear Information System (INIS)

    Zwaan, Bob van der; Rabi, A.

    2003-01-01

    This article gives an overview of the current state-of-the-art of photovoltaic electricity technology, and addresses its potential for cost reductions over the first few decades of the 21st century. Current PV production cost ranges are presented, both in terms of capacity installation and electricity generation, of single crystalline silicon, multi-crystalline silicon, amorphous silicon and other thin film technologies. Possible decreases of these costs are assessed, as expected according to the learning-curve methodology. We also estimate how much PV could gain if external costs (due to environmental and health damage) of energy were internalised, for example by an energy tax. Our conclusions are that, (1) mainly due its high costs, PV electricity is unlikely to play a major role in global energy supply and carbon emissions abatement before 2020, (2) extrapolating learning curves observed in the past, one can expect its costs to decrease significantly over the coming years, so that a considerable PV electricity share world-wide could materialise after 2020, (3) niche-market applications, e.g. using stand-alone systems in remote areas, are crucial for continuing 'the ride along the learning curve', (4) damage costs of conventional (fossil) power sources are considerable, and their internalisation would improve the competitiveness of PV, although probably not enough to close the current cost gap. (author)

  4. PV Systems Reliability Final Technical Report.

    Energy Technology Data Exchange (ETDEWEB)

    Lavrova, Olga [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flicker, Jack David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Johnson, Jay [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Armijo, Kenneth Miguel [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Gonzalez, Sigifredo [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Schindelholz, Eric John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorensen, Neil R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Yang, Benjamin Bing-Yeh [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    The continued exponential growth of photovoltaic technologies paves a path to a solar-powered world, but requires continued progress toward low-cost, high-reliability, high-performance photovoltaic (PV) systems. High reliability is an essential element in achieving low-cost solar electricity by reducing operation and maintenance (O&M) costs and extending system lifetime and availability, but these attributes are difficult to verify at the time of installation. Utilities, financiers, homeowners, and planners are demanding this information in order to evaluate their financial risk as a prerequisite to large investments. Reliability research and development (R&D) is needed to build market confidence by improving product reliability and by improving predictions of system availability, O&M cost, and lifetime. This project is focused on understanding, predicting, and improving the reliability of PV systems. The two areas being pursued include PV arc-fault and ground fault issues, and inverter reliability.

  5. Quantifying Soiling Loss Directly From PV Yield

    Energy Technology Data Exchange (ETDEWEB)

    Deceglie, Michael G.; Micheli, Leonardo; Muller, Matthew

    2018-01-01

    Soiling of photovoltaic (PV) panels is typically quantified through the use of specialized sensors. Here, we describe and validate a method for estimating soiling loss experienced by PV systems directly from system yield without the need for precipitation data. The method, termed the stochastic rate and recovery (SRR) method, automatically detects soiling intervals in a dataset, then stochastically generates a sample of possible soiling profiles based on the observed characteristics of each interval. In this paper, we describe the method, validate it against soiling station measurements, and compare it with other PV-yield-based soiling estimation methods. The broader application of the SRR method will enable the fleet scale assessment of soiling loss to facilitate mitigation planning and risk assessment.

  6. Terawatt Challenge for Thin-Film PV

    Energy Technology Data Exchange (ETDEWEB)

    Zweibel, K.

    2005-08-01

    The evolution of PV into one of the world's largest industries is not going to happen without major unforeseen problems. However, this study attempts to address the obvious ones, so that we can put aside the mythology of PV (for example, that it is only ''boutique power'' or that one must pave the world with it to be useful) and get on with changing the world's energy infrastructure. With the years of rapid market growth now under way in PV, the author is sure this will not be the last effort to understand the real potential and pitfalls of meeting the Challenge.

  7. POWERED LED LIGHTING SUPPLIED FROM PV CELLS

    Directory of Open Access Journals (Sweden)

    Tirshu M.

    2011-12-01

    Full Text Available The paper deals with practical realization of efficient lighting system based on LED’s of 80W total power mounted on corridor ceiling total length of which is 120m and substitutes existing traditional lighting system consisting of 29 lighting blocks with 4 fluorescent lamps each of them and summary power 2088W. Realized lighting system is supplied from two photovoltaic panels of power 170W. Generated energy by PV cells is accumulated in two accumulators of 75Ah capacity and from battery by means of specialized convertor is applied to lighting system. Additionally, paper present data measured by digital weather station (solar radiation and UV index, which is mounted near of PV cells and comparative analyze of solar energy with real energy generated by PV cells is done. Measured parameters by digital weather station are stored by computer in on-line mode.

  8. Real time PV manufacturing diagnostic system

    Energy Technology Data Exchange (ETDEWEB)

    Kochergin, Vladimir [MicroXact Inc., Blacksburg, VA (United States); Crawford, Michael A. [MicroXact Inc., Blacksburg, VA (United States)

    2015-09-01

    The main obstacle Photovoltaic (PV) industry is facing at present is the higher cost of PV energy compared to that of fossil energy. While solar cell efficiencies continue to make incremental gains these improvements are so far insufficient to drive PV costs down to match that of fossil energy. Improved in-line diagnostics however, has the potential to significantly increase the productivity and reduce cost by improving the yield of the process. On this Phase I/Phase II SBIR project MicroXact developed and demonstrated at CIGS pilot manufacturing line a high-throughput in-line PV manufacturing diagnostic system, which was verified to provide fast and accurate data on the spatial uniformity of thickness, an composition of the thin films comprising the solar cell as the solar cell is processed reel-to-reel. In Phase II project MicroXact developed a stand-alone system prototype and demonstrated the following technical characteristics: 1) ability of real time defect/composition inconsistency detection over 60cm wide web at web speeds up to 3m/minute; 2) Better than 1mm spatial resolution on 60cm wide web; 3) an average better than 20nm spectral resolution resulting in more than sufficient sensitivity to composition imperfections (copper-rich and copper-poor regions were detected). The system was verified to be high vacuum compatible. Phase II results completely validated both technical and economic feasibility of the proposed concept. MicroXact’s solution is an enabling technique for in-line PV manufacturing diagnostics to increase the productivity of PV manufacturing lines and reduce the cost of solar energy, thus reducing the US dependency on foreign oil while simultaneously reducing emission of greenhouse gasses.

  9. Novel Methods to Determine Feeder Locational PV Hosting Capacity and PV Impact Signatures

    Energy Technology Data Exchange (ETDEWEB)

    Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Coogan, Kyle [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-05-01

    Often PV hosting capacity analysis is performed for a limited number of distribution feeders. For medium - voltage distribution feeders, previous results generally analyze less than 20 feeders, and then the results are extrapolated out to similar types of feeders. Previous hosting capacity research has often focused on determining a single value for the hosting capacity for the entire feeder, whereas this research expands previous hosting capacity work to investigate all the regions of the feeder that may allow many different hosting capacity values wit h an idea called locational hosting capacity (LHC)to determine the largest PV size that can be interconnected at different locations (buses) on the study feeders. This report discusses novel methods for analyzing PV interconnections with advanced simulati on methods. The focus is feeder and location - specific impacts of PV that determine the locational PV hosting capacity. Feeder PV impact signature are used to more precisely determine the local maximum hosting capacity of individual areas of the feeder. T he feeder signature provides improved interconnection screening with certain zones that show the risk of impact to the distribution feeder from PV interconnections.

  10. Economic perspective of PV electricity in Oman

    International Nuclear Information System (INIS)

    Al-Badi, A.H.; Albadi, M.H.; Al-Lawati, A.M.; Malik, A.S.

    2011-01-01

    Solar and wind energies are likely to play an important role in the future energy generation in Oman. This paper utilizes average daily global solar radiation and sunshine duration data of 25 locations in Oman to study the economic prospects of solar energy. The study considers a solar PV power plant of 5-MW at each of the 25 locations. The global solar radiation varies between slightly greater than 4 kWh/m 2 /day at Sur to about 6 kWh/m 2 /day at Marmul while the average value in the 25 locations is more than 5 kWh/m 2 /day. The results show that the renewable energy produced each year from the PV power plant varies between 9000 MWh at Marmul and 6200 MWh at Sur while the mean value is 7700 MWh of all the 25 locations. The capacity factor of PV plant varies between 20% and 14% and the cost of electricity varies between 210 US$/MWh and 304 US$/MWh for the best location to the least attractive location, respectively. The study has also found that the PV energy at the best location is competitive with diesel generation without including the externality costs of diesel. Renewable energy support policies that can be implemented in Oman are also discussed. -- Research highlights: → The global solar radiation values for 25 locations in Oman are obtained using satellite data that are corrected by data from ground stations. → The study considers a solar PV power plant of 5-MW to calculate the capacity factor (CF) and the cost of energy (COE) at each of the 25 locations. → The study has found that the CF of PV plant varies between 20% and 14% and the corresponding COE varies between 210 US$/MWh and 304 US$/MWh for the best location to the least attractive location, respectively. → The study has found that the PV energy at the best location is competitive with diesel generation without including the externality costs of diesel. → Since PV energy is not competitive with fossil fuel-based generation in most locations renewable energy support mechanisms have been

  11. Updating Interconnection Screens for PV System Integration

    Energy Technology Data Exchange (ETDEWEB)

    Coddington, M.; Mather, B.; Kroposki, B.; Lynn, K.; Razon, A.; Ellis, A.; Hill, R.; Key, T.; Nicole, K.; Smith, J.

    2012-02-01

    This white paper evaluates the origins and usefulness of the capacity penetration screen, offer short-term solutions which could effectively allow fast-track interconnection to many PV system applications, and considers longer-term solutions for increasing PV deployment levels in a safe and reliable manner while reducing or eliminating the emphasis on the penetration screen. Short-term and longer-term alternatives approaches are offered as examples; however, specific modifications to screening procedures should be discussed with stakeholders and must ultimately be adopted by state and federal regulatory bodies.

  12. Seasonal energy storage - PV-hydrogen systems

    Energy Technology Data Exchange (ETDEWEB)

    Leppaenen, J. [Neste Oy/NAPS (Finland)

    1998-10-01

    PV systems are widely used in remote areas e.g. in telecommunication systems. Typically lead acid batteries are used as energy storage. In northern locations seasonal storage is needed, which however is too expensive and difficult to realise with batteries. Therefore, a PV- battery system with a diesel backup is sometimes used. The disadvantages of this kind of system for very remote applications are the need of maintenance and the need to supply the fuel. To overcome these problems, it has been suggested to use hydrogen technologies to make a closed loop autonomous energy storage system

  13. Análisis de adnc-aflp para la expresión diferencial de genes en la interacción manihot esculenta grantz (yuca) xanthomonas axonopodis pv. manihotis

    OpenAIRE

    Santaella, M.; Suárez, E.; González, C.; López, C.; Restrepo, S.; Badillo, A.; Verdier, V.

    2011-01-01

    Desarrollar patrones ADNc - AFLP, para identificar fragmentos expresados diferencialmente entre dos variedades de yuca, una resistente y una susceptible a la bacteriosis. Aislar, secuenciar y analizar los fragmentos seleccionados. Corroborar la expresión diferencial de estos fragmentos mediante "northern blots".

  14. Análisis de ADNC-AFLP para la expresión diferencial de genes en la interacción Manihot esculenta Grantz (Yuca Xanthomonas axonopodis pv. Manihotis

    Directory of Open Access Journals (Sweden)

    M. Santaella

    2001-07-01

    Full Text Available Desarrollar patrones ADNc - AFLP, para identificar fragmentos expresados diferencialmente entre dos variedades de yuca, una resistente y una susceptible a la bacteriosis. Aislar, secuenciar y analizar los fragmentos seleccionados. Corroborar la expresión diferencial de estos fragmentos mediante "northern blots".

  15. Análisis de ADNC-AFLP para la expresión diferencial de genes en la interacción Manihot esculenta Grantz (Yuca) Xanthomonas axonopodis pv. Manihotis

    OpenAIRE

    Verdier V.; Badillo A.; López C.; González C.; Suárez E.; Santaella M.; Restrepo S.

    2001-01-01

    Desarrollar patrones ADNc - AFLP, para identificar fragmentos expresados diferencialmente entre dos variedades de yuca, una resistente y una susceptible a la bacteriosis. Aislar, secuenciar y analizar los fragmentos seleccionados. Corroborar la expresión diferencial de estos fragmentos mediante "northern blots".

  16. National survey report on PV power applications in Switzerland 2006

    International Nuclear Information System (INIS)

    Huesser, P.; Hostettler, T.

    2007-01-01

    This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.

  17. A Practical Irradiance Model for Bifacial PV Modules

    Energy Technology Data Exchange (ETDEWEB)

    Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford

    2017-06-21

    A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using ray tracing software.

  18. Design optimization of grid-connected PV inverters

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2011-01-01

    The DC/AC inverters are the key elements in grid-connected PV energy production systems. In this paper, new design optimization techniques focused on transformerless (very high efficiency) PV inverters are proposed. They have been developed based on an analysis of the deficiencies of the current......, state-of-the-art PV inverters design technology, which limits the amount of PV energy supplied into the electric grid. The influences of the electric grid regulations and standards and the PV array operational characteristics on the design of grid-connected PV inverters have also been considered....... The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy injected into the electric grid by the optimized PV installation....

  19. A Practical Irradiance Model for Bifacial PV Modules: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford

    2017-06-15

    A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors (CFs) to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using the RADIANCE ray tracing program.

  20. Image analysis of PV module electroluminescence

    Science.gov (United States)

    Lai, T.; Ramirez, C.; Potter, B. G.; Simmons-Potter, K.

    2017-08-01

    Electroluminescence imaging can be used as a non-invasive method to spatially assess performance degradation in photovoltaic (PV) modules. Cells, or regions of cells, that do not produce an infra-red luminescence signal under electrical excitation indicate potential damage in the module. In this study, an Andor iKon-M camera and an image acquisition tool provided by Andor have been utilized to obtain electroluminescent images of a full-sized multicrystalline PV module at regular intervals throughout an accelerated lifecycle test (ALC) performed in a large-scale environmental degradation chamber. Computer aided digital image analysis methods were then used to automate degradation assessment in the modules. Initial preprocessing of the images was designed to remove both background noise and barrel distortion in the image data. Image areas were then mapped so that changes in luminescent intensity across both individual cells and the full module could be identified. Two primary techniques for image analysis were subsequently investigated. In the first case, pixel intensity distributions were evaluated over each individual PV cell and changes to the intensities of the cells over the course of an ALC test were evaluated. In the second approach, intensity line scans of each of the cells in a PV module were performed and variations in line scan data were identified during the module ALC test. In this report, both the image acquisition and preprocessing technique and the contribution of each image analysis approach to an assessment of degradation behavior will be discussed.

  1. MPPT algorithm for voltage controlled PV inverters

    DEFF Research Database (Denmark)

    Kerekes, Tamas; Teodorescu, Remus; Liserre, Marco

    2008-01-01

    This paper presents a novel concept for an MPPT that can be used in case of a voltage controlled grid connected PV inverters. In case of single-phase systems, the 100 Hz ripple in the AC power is also present on the DC side. Depending on the DC link capacitor, this power fluctuation can be used...

  2. Xanthan gum production by Xanthomonas campestris pv ...

    African Journals Online (AJOL)

    Cassava starch is a main renewable bio-resource with low price and mass production in Guangxi, China. It was used as carbon source in growing Xanthomonas campestris pv. campestris 8004 (Xcc 8004) for xanthan gum production in this study. The xanthan gum yield of gelatinized cassava starch was higher than that of ...

  3. PV-mooduli toodang suurfarmis / Teolan Tomson

    Index Scriptorium Estoniae

    Tomson, Teolan, 1932-

    2015-01-01

    Artiklis uuritakse PV-paneelide tootlikkuse langust nende vastastikuse varjutamise tõttu. Näidatakse, et Eesti oludes on soovitav kasutada paneelide madalaid kaldenurki ja suhtelist reavahet, mis ületab paneeli kõrguse pooleteistkordset väärtust

  4. TRNSYS HYBRID wind diesel PV simulator

    Energy Technology Data Exchange (ETDEWEB)

    Quinlan, P.J.A.; Mitchell, J.W.; Klein, S.A.; Beckman, W.A.; Blair, N.J. [Univ. of Wisconsin, Madison, WI (United States)

    1996-12-31

    The Solar Energy Laboratory (SEL) has developed a wind diesel PV hybrid systems simulator, UW-HYBRID 1.0, an application of the TRNSYS 14.2 time-series simulation environment. An AC/DC bus links up to five diesels and wind turbine models, along with PV modules, a battery bank, and an AC/DC converter. Multiple units can be selected. PV system simulations include solar angle and peak power tracking options. Weather data are Typical Meteorological Year data, parametrically generated synthesized data, or external data files. PV performance simulations rely on long-standing SEL-developed algorithms. Loads data are read as scalable time series. Diesel simulations include estimated fuel-use and waste heat output, and are dispatched using a least-cost of fuel strategy. Wind system simulations include varying air density, wind shear and wake effects. Time step duration is user-selectable. UW-HYBRID 1.0 runs in Windows{reg_sign}, with TRNSED providing a customizable user interface. 12 refs., 6 figs.

  5. Solar PV Industry in Jiangsu Province [China

    International Nuclear Information System (INIS)

    2010-03-01

    Jiangsu Province is a leading province in China both in terms of Solar PV application as well as its implementation. The Netherlands Business Support Office in Nanjing reports on the photovoltaic solar cell industry in Jiangsu Province with details on opportunities for foreign investors; applications of solar energy in the province; Chinese government; relevant organizations; and key Chinese players in this sector.

  6. Final Technical Report: PV Fault Detection Tool.

    Energy Technology Data Exchange (ETDEWEB)

    King, Bruce Hardison [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Christian Birk [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    The PV Fault Detection Tool project plans to demonstrate that the FDT can (a) detect catastrophic and degradation faults and (b) identify the type of fault. This will be accomplished by collecting fault signatures using different instruments and integrating this information to establish a logical controller for detecting, diagnosing and classifying each fault.

  7. PV System Component Fault and Failure Compilation and Analysis.

    Energy Technology Data Exchange (ETDEWEB)

    Klise, Geoffrey Taylor; Lavrova, Olga; Gooding, Renee Lynne

    2018-02-01

    This report describes data collection and analysis of solar photovoltaic (PV) equipment events, which consist of faults and fa ilures that occur during the normal operation of a distributed PV system or PV power plant. We present summary statistics from locations w here maintenance data is being collected at various intervals, as well as reliability statistics gathered from that da ta, consisting of fault/failure distributions and repair distributions for a wide range of PV equipment types.

  8. Fault Detection and Performance Monitoring in PV Systems

    OpenAIRE

    Vasco Brogueira Andrade

    2017-01-01

    Given the exponential growth of the PV sector in recent years and the market?s overall need for new PV monitoring solutions, this dissertation aims at creating an automatic fault detection tool for PV systems, more specifically for shading and soiling situations. By detecting deviations in the measured PV systems? data patterns, this tool aims at providing essential information for the deployment of the right maintenance strategy for each situation.

  9. Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.

  10. Impact of Rooftop Solar PV on Residential Distribution Network

    DEFF Research Database (Denmark)

    Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte; Pillai, Jayakrishnan Radhakrishna

    Increased environmental awareness in recent years has encouraged rapid growth of renewable energy sources especially solar PV and wind. Among them, small scale solar PV has been gaining more momentum especially at residential level. Even today moderate penetration of grid tied rooftop solar PV has...

  11. Impedance characterization of PV modules in outdoor conditions

    DEFF Research Database (Denmark)

    Oprea, Matei-lon; Thorsteinsson, Sune; Spataru, Sergiu

    2016-01-01

    Impedance spectroscopy (IS) has been used for laboratory characterizations of photovoltaic (PV) technologies under well controlled conditions. This work applies IS for outdoor characterization of PV panels, in order to observe the effect of irradiance (G) and temperature (T) on the PV module...

  12. The possibility of developing hybrid PV/T solar system

    Science.gov (United States)

    Dobrnjac, M.; Zivkovic, P.; Babic, V.

    2017-05-01

    An alternative and cost-effective solution to developing integrated PV system is to use hybrid photovoltaic/thermal (PV/T) solar system. The temperature of PV modules increases due to the absorbed solar radiation that is not converted into electricity, causing a decrease in their efficiency. In hybrid PV/T solar systems the reduction of PV module temperature can be combined with a useful fluid heating. In this paper we present the possibility of developing a new hybrid PV/T solar system. Hybrid PV/T system can provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation. We developed PV/T prototype consisted of commercial PV module and thermal panel with our original solution of aluminium absorber with special geometric shapes. The main advantages of our combined PV/T system are: removing of heat from the PV panel; extending the lifetime of photovoltaic cells; excess of the removing heat from PV part is used to heat the fluid in the thermal part of the panel; the possibility of using on the roof and facade constructions because less weight.

  13. Parameter extraction and estimation based on the PV panel outdoor ...

    African Journals Online (AJOL)

    This work presents a novel approach to predict the voltage-current (V-I) characteristics of a PV panel under varying weather conditions to estimate the PV parameters. Outdoor performance of the PV module (AP-PM-15) was carried out for several times. The experimental data obtained are validated and compared with the ...

  14. High Resolution PV Power Modeling for Distribution Circuit Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Norris, B. L.; Dise, J. H.

    2013-09-01

    NREL has contracted with Clean Power Research to provide 1-minute simulation datasets of PV systems located at three high penetration distribution feeders in the service territory of Southern California Edison (SCE): Porterville, Palmdale, and Fontana, California. The resulting PV simulations will be used to separately model the electrical circuits to determine the impacts of PV on circuit operations.

  15. Remote and Centralized Monitoring of PV Power Plants

    DEFF Research Database (Denmark)

    Kopacz, Csaba; Spataru, Sergiu; Sera, Dezso

    2014-01-01

    the inverters within each PV plant. The monitoring software stores the PV measurements in a data warehouse optimized for managing and data mining large amounts of data, from where it can be later visualized, analyzed and exported. By combining PV production measurements data with I-V curve measurements...

  16. Voltage rise mitigation for solar PV integration at LV grids

    DEFF Research Database (Denmark)

    Yang, Guangya; Marra, Francesco; Juamperez Goñi, Miguel Angel

    2015-01-01

    Solar energy from photovoltaic (PV) is among the fastest developing renewable energy systems worldwide. Driven by governmental subsidies and technological development, Europe has seen a fast expansion of solar PV in the last few years. Among the installed PV plants, most of them are situated at t...

  17. Assessing the need for better forecasting and observability of pv

    DEFF Research Database (Denmark)

    Alet, Pierre-Jean; Efthymiou, Venizelos; Graditi, Giorgio

    2017-01-01

    In its review of the challenges and opportunities associated with massive deployment of solar PV generation, the Grid integration working group of the ETIP PV identified forecasting and observability as critical technologies for the planning and operation of the power system with large PV...

  18. parameter extraction and estimation based on the pv panel outdoor

    African Journals Online (AJOL)

    userpc

    PV panel under varying weather conditions to estimate the PV parameters. Outdoor performance of the PV module (AP-PM-15) was carried out for several times. The .... Performance. Analysis of Different Photovoltaic. Technologies Based on MATLAB. Simulation. In Northwest University. Science, Faculty of Science Annual.

  19. PV Obelisk - Information system with photovoltaics; PV-Obelisk Orientierungssystem mit Photovoltaik

    Energy Technology Data Exchange (ETDEWEB)

    Ruoss, D.; Rasmussen, J.

    2004-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed.

  20. UTILIZAÇÃO DE DOIS MÉTODOS DE INOCULAÇÃO NA AVALIAÇÃO DA RESISTÊNCIA DE CULTIVARES E LINHAGENS DE FEIJOEIRO A Fusarium oxysporum F. SP. phaseoli USE OF TWO INOCULATION METHODS TO EVALUATE THE RESISTANCE OF COMMON BEAN CULTIVARS AND LINES TO Fusarium oxysporum F. SP. phaseoli

    Directory of Open Access Journals (Sweden)

    Leonardo Sousa Cavalcanti

    2002-02-01

    Full Text Available Este trabalho foi conduzido com o objetivo de comparar a eficiência de dois métodos de inoculação na avaliação da resistência de plantas de feijoeiro a Fusarium oxysporum f. sp. phaseoli. Avaliou-se a reação de 16 cultivares e linhagens, incluindo padrões de resistência e suscetibilidade à doença. Num dos métodos, o plantio foi realizado em solo tratado com brometo de metila (CH3Br. As plantas foram inoculadas através do método de perfuração do solo, que consistiu na aplicação de 10m de suspensão de conídios ao redor das plantas, previamente feridas. No outro método utilizado, denominado método de imersão de raízes, as plantas obtidas em areia lavada e aquecida (60ºC - 30min foram retiradas e lavadas em água corrente e cortadas em cerca de 01cm do sistema radicular, o qual foi imerso em suspensão de conídios por 05 minutos. As plantas foram então replantadas em vasos contendo solo tratado com brometo de metila. Em ambos os métodos de inoculação, as plantas estavam com 07 dias de germinação, sendo inoculadas com a suspensão de inóculo a uma concentração de 1 x 10(6 conídios/m. As plantas controle sofreram o mesmo tratamento, referente ao método de inoculação correspondente. O experimento foi delineado inteiramente ao acaso, em parcelas subdivididas, com 04 repetições por tratamento, sendo o método de inoculação locado na parcela principal e as cultivares e linhagens nas subparcelas. Cada repetição foi constituída por 01 vaso com 04 plantas. As avaliações foram realizadas aos 15, 20, 25 e 30 dias após a inoculação, baseadas em escala de notas, com 9 graus de infecção, proposta pelo CIAT. Os dados obtidos foram transformados para índice de doença de Mackinney. Observou-se uma maior eficiência do método de imersão das raízes, na avaliação da resistência do feijoeiro a murcha de Fusarium, evidenciando os genótipos Goiano precoce, RH 3104 e IPA-9 como resistentes, e LM 93204247, LM

  1. On Distributed PV Hosting Capacity Estimation, Sensitivity Study, and Improvement

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Fei; Mather, Barry

    2017-07-01

    This paper first studies the estimated distributed PV hosting capacities of seventeen utility distribution feeders using the Monte Carlo simulation based stochastic analysis, and then analyzes the sensitivity of PV hosting capacity to both feeder and photovoltaic system characteristics. Furthermore, an active distribution network management approach is proposed to maximize PV hosting capacity by optimally switching capacitors, adjusting voltage regulator taps, managing controllable branch switches and controlling smart PV inverters. The approach is formulated as a mixed-integer nonlinear optimization problem and a genetic algorithm is developed to obtain the solution. Multiple simulation cases are studied and the effectiveness of the proposed approach on increasing PV hosting capacity is demonstrated.

  2. Technologies to Increase PV Hosting Capacity in Distribution Feeders: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Fei; Mather, Barry; Gotseff, Peter

    2016-08-01

    This paper studies the distributed photovoltaic (PV) hosting capacity in distribution feeders by using the stochastic analysis approach. Multiple scenario simulations are conducted to analyze several factors that affect PV hosting capacity, including the existence of voltage regulator, PV location, the power factor of PV inverter and Volt/VAR control. Based on the conclusions obtained from simulation results, three approaches are then proposed to increase distributed PV hosting capacity, which can be formulated as the optimization problem to obtain the optimal solution. All technologies investigated in this paper utilize only existing assets in the feeder and therefore are implementable for a low cost. Additionally, the tool developed for these studies is described.

  3. PV Working with Industry, 2nd Quarter, 2000

    Energy Technology Data Exchange (ETDEWEB)

    Poole, L.; Moon, S.

    2000-06-29

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The Second Quarter, 2000, issue is titled ``Our Shared PV Future''. It contains a review of several important PV-related meetings held in the prior three months: the NCPV Program Review, the 16 European PV Conference, and year-2000 Earth Day activities in Denver, CO. The editorialist is Paul Maycock, Publisher of PV News.

  4. Accelerating residential PV expansion: demand analysis for competitive electricity markets

    International Nuclear Information System (INIS)

    Duke, Richard; Williams, Robert; Payne, Adam

    2005-01-01

    This article quantifies the potential market for grid-connected, residential photovoltaic (PV) electricity integrated into new homes built in the US. It complements an earlier supply-side analysis by the authors that demonstrates the potential to reduce PV module prices below $1.5/W p by scaling up existing thin-film technology in 100 MW p /yr manufacturing facilities. The present article demonstrates that, at that price, PV modules may be cost effective in 125,000 new home installations per year (0.5 GW p /yr). While this market is large enough to support multiple scaled up thin-film PV factories, inefficient energy pricing and demand-side market failures will inhibit prospective PV consumers without strong public policy support. Net metering rules, already implemented in many states to encourage PV market launch, represent a crude but reasonable surrogate for efficient electricity pricing mechanisms that may ultimately emerge to internalize the externality benefits of PV. These public benefits include reduced air pollution damages (estimated costs of damage to human health from fossil fuel power plants are presented in Appendix A), deferral of transmission and distribution capital expenditures, reduced exposure to fossil fuel price risks, and increased electricity system reliability for end users. Thus, net metering for PV ought to be implemented as broadly as possible and sustained until efficient pricing is in place. Complementary PV 'buydowns' (e.g., a renewable portfolio standard with a specific PV requirement) are needed to jumpstart regional PV markets

  5. Simulation of Distributed PV Power Output in Oahu Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Lave, Matthew Samuel [Sandia National Lab. (SNL-CA), Livermore, CA (United States)

    2016-08-01

    Distributed solar photovoltaic (PV) power generation in Oahu has grown rapidly since 2008. For applications such as determining the value of energy storage, it is important to have PV power output timeseries. Since these timeseries of not typically measured, here we produce simulated distributed PV power output for Oahu. Simulated power output is based on (a) satellite-derived solar irradiance, (b) PV permit data by neighborhood, and (c) population data by census block. Permit and population data was used to model locations of distributed PV, and irradiance data was then used to simulate power output. PV power output simulations are presented by sub-neighborhood polygons, neighborhoods, and for the whole island of Oahu. Summary plots of annual PV energy and a sample week timeseries of power output are shown, and a the files containing the entire timeseries are described.

  6. Optimal Design of Modern Transformerless PV Inverter Topologies

    DEFF Research Database (Denmark)

    Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede

    2013-01-01

    The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during...... the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inverter design variables are derived for each PV inverter topology and installation site. The H5, H6, neutral point...... clamped, active-neutral point clamped and conergy-NPC PV inverters designed using the proposed optimization process feature lower levelized cost of generated electricity and lifetime cost, longer mean time between failures and inject more PV-generated energy into the electric grid than their nonoptimized...

  7. Percutaneous vertebroplasty (pv): indications, contraindications, and technique

    International Nuclear Information System (INIS)

    Hoffmann, R.T.; Jakobs, T.F.; Wallnoefer, A.; Reiser, M.F.; Helmberger, T.K.

    2003-01-01

    Percutaneous vertebroplasty (pv) is a worldwide increasingly performed interventional therapeutic procedure. This article addresses indications, patient preparation, technical requirements and approach as well as possible complications of percutaneous vertebroplasty. Percutaneous vertebroplasty is a technique consisting in an injection of bone cement into a vertebral body under imaging guidance. This procedure is performed to relief pain and support the mechanical stability in partially collapsed vertebral bodies. In the management of spinal compression fractures secondary to osteoporosis, myeloma, osteolytic metastases and aggressive hemangiomas, percutaneous vertebroplasty yields analgesic effect, and provides additional fortification in weakened segments of the vertebral column. Contraindications include major bleeding disorders, radicular pain and pain caused by compression of the myelon. Percutaneous vertebroplasty results in prompt pain relief and rapid rehabilitation. In experienced hands, using correct technique, pv is a safe and effective procedure for treating pain, caused either by osteoporotic or malignant vertebral compression fractures. (orig.) [de

  8. Materials Testing for PV Module Encapsulation

    Energy Technology Data Exchange (ETDEWEB)

    Jorgensen, G.; Terwilliger, K.; Glick, S.; Pern, J.; McMahon, T.

    2003-05-01

    Important physical properties of materials used in PV module packaging are presented. High-moisture-barrier, high-resistivity, adhesion-promoting coatings on polyethyl-ene terephthalate (PET) films have been fabricated and characterized for use in PV module application and com-pared to standard polymer backsheet materials. Ethylene vinyl acetate (EVA) and an encapsulant replacement for EVA are studied for their water vapor transmission rate (WVTR) and adhesion properties. WVTR, at test conditions up to 85C/100% relative humidity (RH), and adhesion val-ues are measured before and after filtered xenon arc lamp ultraviolet (UV) exposure and damp heat exposure at 85C/85% RH. Water ingress is quantified by weight gain and embedded humidity sensors.

  9. INFLUÊNCIA DA DENSIDADE DE INÓCULO DE Fusarium solani f.sp. phaseoli NA SEVERIDADE DA PODRIDÃO RADICULAR SECA DO FEIJOEIRO EFFECT OF Fusarium solani f.sp. phaseoli INOCULUM DENSITY ON DRY ROOT ROT SEVERITY IN THE COMMON BEAN

    Directory of Open Access Journals (Sweden)

    Gesimária Ribeiro Costa

    2007-09-01

    Full Text Available

    Foram testadas quatro densidades de inóculo de Fusarium solani, em gramas por litro de solo (1,0; 2,0; 4,0 e 8,0 e um tratamento testemunha, em solo tipo Latossolo Vermelho-Escuro, cultivado e não cultivado, com o objetivo de determinar a densidade mínima de inóculo no solo necessária para a ocorrência de podridão radicular seca do feijoeiro. Como variáveis respostas foram avaliadas: número de microorganismos totais do solo, número de propágulos de F. solani, atividade microbiológica total do solo e severidade da doença em plântulas. Os resultados indicaram que a densidade de inóculo do fungo variou com o tipo de solo. Para um solo não cultivado a densidade necessária para causar a doença esteve acima de 5.127 propágulos por grama de solo, enquanto para o solo cultivado a densidade de inóculo para causar doença foi de 3.701 propágulos por grama de solo. Os índices de doença em plântulas cultivadas sob o solo cultivado foram duas vezes superiores ao índice de doença de plântulas sob o solo não cultivado. A atividade microbiológica total nos solos, determinada pela desidrogenase de fluorescina diacetato, não se correlacionou com a população dos microorganismos, indicando que a simples presença desses não implica em que estejam ativos.

    PALAVRAS-CHAVE: Solo supressivo; solo conducivo; Phaseolus vulgaris.

    Four densities of Fusarium solani inoculum (1, 2, 4 and 8 g/L of soil were tested for determining the minimum inoculum density for the occurrence of bean dry root rot, in two soil types. The response variables evaluated were the total number of microorganisms in the soil, the number of F. solani f. sp. phaseoli propagules, total soil microbial activity and seedling disease severity

  10. Energy balance of the global photovoltaic (PV) industry--is the PV industry a net electricity producer?

    Science.gov (United States)

    Dale, Michael; Benson, Sally M

    2013-04-02

    A combination of declining costs and policy measures motivated by greenhouse gas (GHG) emissions reduction and energy security have driven rapid growth in the global installed capacity of solar photovoltaics (PV). This paper develops a number of unique data sets, namely the following: calculation of distribution of global capacity factor for PV deployment; meta-analysis of energy consumption in PV system manufacture and deployment; and documentation of reduction in energetic costs of PV system production. These data are used as input into a new net energy analysis of the global PV industry, as opposed to device level analysis. In addition, the paper introduces a new concept: a model tracking energetic costs of manufacturing and installing PV systems, including balance of system (BOS) components. The model is used to forecast electrical energy requirements to scale up the PV industry and determine the electricity balance of the global PV industry to 2020. Results suggest that the industry was a net consumer of electricity as recently as 2010. However, there is a >50% that in 2012 the PV industry is a net electricity provider and will "pay back" the electrical energy required for its early growth before 2020. Further reducing energetic costs of PV deployment will enable more rapid growth of the PV industry. There is also great potential to increase the capacity factor of PV deployment. These conclusions have a number of implications for R&D and deployment, including the following: monitoring of the energy embodied within PV systems; designing more efficient and durable systems; and deploying PV systems in locations that will achieve high capacity factors.

  11. An Analysis of Open World PvP in LOTRO's PvMP as a Case Study for PvP Games

    Directory of Open Access Journals (Sweden)

    Toh Weimin

    2014-11-01

    Full Text Available This article focuses on the analysis of emergent gameplay, based on a case study of the author's subjective gameplay experience of Player versus Monster Player (PvMP in The Lord of the Rings Online (LOTRO. The argument presented here is that although there is a core system of Player versus Player (PvP which LOTRO shares with other online games, each type of online game has a specific kind of PvP system which attracts players to engage in the gameplay. For instance, the open world sandbox type of PvP attracts certain players to play in LOTRO's PvMP. One of the main aims of this study is thus to investigate some of the core systems of PvP gameplay in open world sandbox PvP. In this article, LOTRO is shown to offer unique opportunities for studying emergent gameplay in open world games, with particular relevance to PvP studies. Two of the core systems of PvP discussed include the design of the simple gameplay rules to support emergent gameplay, and the community's attitudes towards player's behaviours. The types of emergent gameplay discussed include free play versus negotiated fair play, the players' utilisation of strategies in open world PvP to support collaborative and competitive gameplay, and the changing dynamics of open ended gameplay. It is hoped that the analysis provided in this article would form the­ basis of future work on a more general framework for understanding PvP in other online games.

  12. Integrating Solar PV in Utility System Operations

    Energy Technology Data Exchange (ETDEWEB)

    Mills, A.; Botterud, A.; Wu, J.; Zhou, Z.; Hodge, B-M.; Heany, M.

    2013-10-31

    This study develops a systematic framework for estimating the increase in operating costs due to uncertainty and variability in renewable resources, uses the framework to quantify the integration costs associated with sub-hourly solar power variability and uncertainty, and shows how changes in system operations may affect these costs. Toward this end, we present a statistical method for estimating the required balancing reserves to maintain system reliability along with a model for commitment and dispatch of the portfolio of thermal and renewable resources at different stages of system operations. We estimate the costs of sub-hourly solar variability, short-term forecast errors, and day-ahead (DA) forecast errors as the difference in production costs between a case with “realistic” PV (i.e., subhourly solar variability and uncertainty are fully included in the modeling) and a case with “well behaved” PV (i.e., PV is assumed to have no sub-hourly variability and can be perfectly forecasted). In addition, we highlight current practices that allow utilities to compensate for the issues encountered at the sub-hourly time frame with increased levels of PV penetration. In this analysis we use the analytical framework to simulate utility operations with increasing deployment of PV in a case study of Arizona Public Service Company (APS), a utility in the southwestern United States. In our analysis, we focus on three processes that are important in understanding the management of PV variability and uncertainty in power system operations. First, we represent the decisions made the day before the operating day through a DA commitment model that relies on imperfect DA forecasts of load and wind as well as PV generation. Second, we represent the decisions made by schedulers in the operating day through hour-ahead (HA) scheduling. Peaking units can be committed or decommitted in the HA schedules and online units can be redispatched using forecasts that are improved

  13. PV solar electricity: status and future

    Science.gov (United States)

    Hoffmann, Winfried

    2006-04-01

    Within the four main market segments of PV solar electricity there are already three areas competitive today. These are off-grid industrial and rural as well as consumer applications. The overall growth within the past 8 years was almost 40 % p.a. with a "normal" growth of about 18 % p.a. for the first three market segments whereas the grid connected market increased with an astonishing 63 % p.a. The different growth rates catapulted the contribution of grid connected systems in relation to the total market from about one quarter 6 years ago towards more than three quarters today. The reason for this development is basically due to industry-politically induced market support programs in the aforementioned countries. It is quite important to outline under which boundary conditions grid connected systems will be competitive without support programs like the feed in tariff system in Germany, Spain and some more to come in Europe as well as investment subsidies in Japan, US and some other countries. It will be shown that in a more and more liberalized utility market worldwide electricity produced by PV solar electricity systems will be able to compete with their generating cost against peak power prices from utilities. The point of time for this competitiveness is mainly determined by the following facts: 1. Price decrease for PV solar electricity systems leading to an equivalent decrease in the generated cost for PV produced kWh. 2. Development of a truly liberalized electricity market. 3. Degree of irradiation between times of peak power demand and delivery of PV electricity. The first topic is discussed using price experience curves. Some explanations will be given to correlate the qualitative number of 20 % price decrease for doubling cumulative worldwide sales derived from the historic price experience curve with a more quantitative analysis based on our EPIA-Roadmap (productivity increase and ongoing improvements for existing technologies as well as development

  14. Parallel experimental study of a novel super-thin thermal absorber based photovoltaic/thermal (PV/T) system against conventional photovoltaic (PV) system

    OpenAIRE

    Peng Xu; Xingxing Zhang; Jingchun Shen; Xudong Zhao; Wei He; Deying Li

    2015-01-01

    Photovoltaic (PV) semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T) panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the...

  15. The Value of Transparency in Distributed Solar PV Markets

    Energy Technology Data Exchange (ETDEWEB)

    OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-09

    Distributed solar photovoltaic (PV) markets are relatively non-transparent: PV price and product information is not readily available, searching for this information is costly (in terms of time and effort), and customers are mostly unfamiliar with the new technology. Quote aggregation, where third-party companies collect PV quotes on behalf of customers, may be one way to increase PV market transparency. In this paper, quote aggregation data are analyzed to study the value of transparency for distributed solar PV markets. The results suggest that easier access to more quotes results in lower prices. We find that installers tend to offer lower prices in more competitive market environments. We supplement the empirical analysis with key findings from interviews of residential PV installers.

  16. Photovoltaic (PV) energy in the Netherlands and Switzerland. A comparison

    International Nuclear Information System (INIS)

    Van der Loo, F.; Spiessens, P.

    1995-01-01

    The development of photovoltaic (PV) energy in Switzerland and the Netherlands is compared for a number of aspects. The Swiss have realized more PV capacity. Also the economic conditions to develop PV are better in Switzerland than in the Netherlands. In Switzerland the public support is mobilized for solar energy while in the Netherlands a social basis is created for wind energy. 3 ills., 3 tabs

  17. Improving the efficiency of photovoltaic (PV) panels by oil coating

    International Nuclear Information System (INIS)

    Abd-Elhady, M.S.; Fouad, M.M.; Khalil, T.

    2016-01-01

    Highlights: • It is possible to improve the efficiency of PV panels by increasing the amount of light transmitted to the panel. • Coating PV panels by a fine layer of Labovac oil increases the amount of sun light transmitted to the panel. • Coating PV panels by a fine layer of Labovac oil increases the power output of the panel. • Coating PV panels with a layer of Labovac oil has to be applied in cold countries and not in hot regions. - Abstract: The objective of this research is to develop a new technique for improving the efficiency of Photovoltaic (PV) panels. This technique is done by coating the front surface of the PV panel by a fine layer of oil in order to increase the amount of light transmitted to the panel, and consequently its efficiency. Different types of oils are examined, including both mineral oils and natural oils. In case of mineral oils; vacuum pump oil (Labovac oil), engine oil (Mobil oil) and brake oil (Abro oil) are examined, while in case of natural oils; olive and sunflower oils are examined. An experimental setup has been developed to examine the performance of the PV panels as a function of oil coatings. The experimental setup consists of an artificial sun, the PV panel under investigation, a cooling system and a measuring system to measure the performance of the panel. It has been found that coating the PV panel with a fine layer of Labovac oil, ∼1 mm thick, improves the efficiency of the PV panel by more than 20%, and this is due to the high transmissivity of the Labovac oil compared to other oils. However, the Labovac oil has a drawback which is overheating of the panel due to its high transmissivity. Coating of PV panels with a fine layer of Labovac oil should be done only in cold regions, in order to avoid the heating effect that can decrease the power output of PV panels.

  18. NREL PV Working With Industry Newsletter: 4th Quarter 1999

    Energy Technology Data Exchange (ETDEWEB)

    Moon, S.; Poole, L.

    2000-03-03

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The Fourth Quarter, 1999 issue, titled ''Knowledge is PV Power'' focuses on the contribution of the university-based subcontractors to the PV Program. The editorialist is Robert Birkmire, Director of the Institute of Energy Conversion, which is affiliated with the University of Delaware.

  19. PV window - Development and demonstrations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Haugaard, P.

    2011-05-15

    Using the results from the EU project RenewTransnet, which focused on the development of a pane with integrated solar cells, the goal of this project is to develop these principles into a window solution. This window solution is targeted to Danish building tradition and architecture. It is expected that an elegant PV-window solution for both new and retrofit buildings is developed during this project, and which appearance can be customized to each building. Based on results from a related projects carried out by Gaia Solar, the window solution will have the potential of being approximately 30% cheaper than similar products on the market. In this project this price reduction is the objective of the development of a window solution. The project team has succeeded in developing a 2-layer PV-window with glass / glass lamination with EVA as foil, which is 35% cheaper than similar products on the market. Since the price for the frame-profile does not differ significantly at market level, the price comparison is made on the basis of the developed PV-pane. The objective of 30 % price reduction in relation to similar products on the market is met. A special production process to the making glass/glass lamination with EVA as foil has been developed, in which a frame is put around the module which intends both to remove the unwanted tension along the edges, and to prevent the significant spillage of EVA from the module under pressure and prevent the invasive bubbles along the edge of module. Since the developed production method for making glass/glass modules with EVA is simple, a further cost reduction will primarily be in a reduction of the price of the cell. The project process has resulted in the development of a product, which due to continuous restrictions in the building regulations, will be very attractive in future buildings. (LN)

  20. Ancillary services provided by PV power plants

    Directory of Open Access Journals (Sweden)

    Antonio PIERNO

    2016-07-01

    Full Text Available Renewable energy sources are widely utilized in distributed generation systems, and, recently, they are also considered for providing ancillary services. The paper is focused on PV plants, a survey of the most interesting papers published in the literature in the last decade is reported and the main characteristics of the technical proposals, with their advantages and limits, are evidenced. The results are schematically shown in a table that immediately gives the opportunity to be aware of what was already done, representing a reference tool.

  1. Ultra Accelerated Testing of PV Module Components

    Energy Technology Data Exchange (ETDEWEB)

    Pitts, J. R.; King, D. E.; Bingham, C.; Czanderna, A. W.

    1998-10-28

    Using concentrated natural sunlight at the NREL High Flux Solar Furnace, we have exposed several materials to acceleration factors of up to 400 times the normal outdoor UV exposure dose. This accelerated rate allows the exposure of materials such that a year of outdoor exposure can be simulated in about 5 hours. We have studied the solarization of cerium containing glass, the degradation of ethylene vinyl acetate laminated between borosilicate glass, and the yellowing of standard polystyrene test coupons. The first two candidates are of interest to the photovoltaics (PV) program, and the last candidate material is a widely used dosimeter for ultra violet (UV) exposure in accelerated weathering chambers

  2. Considerations on modelling grid-integrated PV

    CSIR Research Space (South Africa)

    Carter-Brown, Clinton

    2017-08-01

    Full Text Available /ZAR assumed Sources: http://www.energy.gov.za/files/renewable-energy-status-report/Market-Overview-and-Current-Levels-of-Renewable-Energy- Deployment-NERSA.pdf; http://www.saippa.org.za/Portals/24/Documents/2016/Coal%20IPP%20factsheet.pdf; http... became cost competitive to conventionals during the last decade (PV: last 2-3 years) • Subsidy-driven market creation in first-mover renewables regions (US, Europe, Japan) led to technology improvements and mass manufacturing In matured markets...

  3. Interharmonics from Grid-Connected PV Systems

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2017-01-01

    As the penetration level of grid-connected Photovoltaic (PV) systems increases, the power quality is one of the major concerns for system operators and the demands are becoming even stricter. The impact of interharmonics on the grid has been acknowledged in recent research when considering a large...... of the Maximum Power Point Tracking (MPPT) algorithm is one of the sources that induce interharmonics in the grid current, especially at low-power operating conditions. Accordingly, three mitigation solutions are discussed to address this issue, and simulations have been carried out to verify the effectiveness...

  4. Accelerating residential PV expansion: supply analysis for competitive electricity markets

    International Nuclear Information System (INIS)

    Payne, Adam; Williams, Robert H.; Duke, Richard

    2001-01-01

    Photovoltaic (PV) technology is now sufficiently advanced that market support mechanisms such as net metering plus a renewable portfolio standard (RPS) could induce rapid PV market growth in grid-connected applications. With such support mechanisms, markets would be sufficiently large that manufacturers could profitably build and operate 100 MW p /yr PV module factories, and electricity costs for residential rooftop PV systems would compare favorably with residential electricity prices in certain areas (e.g., California and the greater New York region in the US). This prospect is illustrated by economic and market analyses for one promising technology (amorphous silicon thin-film PV) from the perspectives of both module manufacturers and buyers of new homes with rooftop PV systems. With public policies that reflect the distributed and environmental benefits offered by PV-and that can sustain domestic PV market demand growth at three times the historical growth rate for a period of the order of two decades - PV could provide 3% of total US electricity supply by 2025. (Author)

  5. Fault Analysis and Detection in Microgrids with High PV Penetration

    Energy Technology Data Exchange (ETDEWEB)

    El Khatib, Mohamed [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hernandez Alvidrez, Javier [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Ellis, Abraham [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-05-01

    In this report we focus on analyzing current-controlled PV inverters behaviour under faults in order to develop fault detection schemes for microgrids with high PV penetration. Inverter model suitable for steady state fault studies is presented and the impact of PV inverters on two protection elements is analyzed. The studied protection elements are superimposed quantities based directional element and negative sequence directional element. Additionally, several non-overcurrent fault detection schemes are discussed in this report for microgrids with high PV penetration. A detailed time-domain simulation study is presented to assess the performance of the presented fault detection schemes under different microgrid modes of operation.

  6. Solar Energy: Incentives to Promote PV in EU27

    Directory of Open Access Journals (Sweden)

    María del P. Pablo-Romero

    2013-11-01

    Full Text Available The growth in the use of renewable energies in the EU has been remarkable. Among these energies is PV. The average annual growth rate for the EU-27 countries in installed PV capacity in the period 2005-2012 was 41.2%. While the installed capacity of PV has reached almost 82 % of National Renewable Energy Action Plan (NREAP targets for the EU-27 countries for 2020, it is still far from being used at its full potential. Over recent years, several measures have been adopted in the EU to enhance and promote PV. This paper undertakes a complete review of the state of PV power in Europe and the measures taken to date to promote it in EU-27. 25 countries have adopted measures to promote PV. The most widespread measure to promote PV use is Feed- in Tariffs. Tariffs are normally adjusted, in a decreasing manner, annually. Nevertheless, currently, seven countries have decided to accelerate this decrease rate in view of cost reduction of the installations and of higher efficiencies. The second instrument used to promote PV in the EU-27 countries is the concession of subsidies. Nevertheless, subsidies have the disadvantage of being closely linked to budgetary resources and therefore to budgetary constraints. In most EU countries, subsidies for renewable energy for PV are being lowered. Twelve EU-27 countries adopted tax measures. Low-interest loans and green certificate systems were only sparingly used.

  7. Evaluation of a solar PV tracking prototype on tropic regions

    Directory of Open Access Journals (Sweden)

    Cristian Manuel Agudelo Restrepo

    2016-06-01

    Full Text Available Nowadays climate change is a big concern for human society, due to our high dependence on fossil fuels. A great amount of research effort is focused in solar photovoltaic (PV systems, particularly on the improvement of the conversion efficiency. One technique commonly used is the tracking systems, where the solar PV moves with the sun in order to capture the maximum direct solar radiation. This paper presents a solar PV single-axis tracking system prototype, and a comparison regarding its energy conversion efficiency with a fixed solar PV installation. The system was tested in Fusagasugá, Colombia, which is located in the tropics region.

  8. NREL PV Working With Industry, v. 27, Third Quarter 2000

    Energy Technology Data Exchange (ETDEWEB)

    Poole, L.; Nahan, R.

    2000-09-12

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The third quarter, contains articles on several important PV-related conferences held in the prior three months: the REAP/HBCU Conference and the IPS-2000 Photochemistry Conference. The issue also contains a preview article of the PV Specialists conference held in Alaska in September. The editorialist is John Benner, PV Specialist Conference Program Chairman.

  9. Solar photovoltaic (PV) energy; latest developments in the building integrated and hybrid PV systems

    International Nuclear Information System (INIS)

    Zahedi, A.

    2006-01-01

    Environmental concerns are growing and interest in environmental issues is increasing and the idea of generating electricity with less pollution is becoming more and more attractive. Unlike conventional generation systems, fuel of the solar photovoltaic energy is available at no cost. And solar photovoltaic energy systems generate electricity pollution-free and can easily be installed on the roof of residential as well as on the wall of commercial buildings as grid-connected PV application. In addition to grid-connected rooftop PV systems, solar photovoltaic energy offers a solution for supplying electricity to remote located communities and facilities, those not accessible by electricity companies. The interest in solar photovoltaic energy is growing worldwide. Today, more than 3500MW of photovoltaic systems have been installed all over the world. Since 1970, the PV price has continuously dropped [8]. This price drop has encouraged worldwide application of small-scale residential PV systems. These recent developments have led researchers concerned with the environment to undertake extensive research projects for harnessing renewable energy sources including solar energy. The usage of solar photovoltaic as a source of energy is considered more seriously making future of this technology looks promising. The objective of this contribution is to present the latest developments in the area of solar photovoltaic energy systems. A further objective of this contribution is to discuss the long-term prospect of the solar photovoltaic energy as a sustainable energy supply. [Author

  10. Interconnection of inverter dominated PV-hybrid systems; Vernetzung stromrichterdominierter PV-Hybridsysteme

    Energy Technology Data Exchange (ETDEWEB)

    Landau, M.; Engler, A.; Geipel, R.; Strauss, P. [Institut fuer Solare Energieversorgungstechnik (ISET), Kassel (Germany); Heinzemann, T.; Rothert, M. [SMA System-, Mess- und Anlagentechnik - Regelsysteme GmbH, Niestetal (Germany)

    2004-07-01

    In the bay of Gaidouromandra on the Greek island of Kythnos two three phase power supply systems were set up and operated within the frame of two European projects from 2000 to 2001. One is a PV-battery system and the other one is a PV-battery-diesel system. A speciality of both systems is the distributed PV-generation with the solar panels and PV-inverters (Sunny Boy {sup registered}) installed on the properties of several inhabitants. With the combination of both supply systems and changing the grid topology from three to single phase operation the problems further developments and a lot of system advantages could be demonstrated. The implementation of the new SELFSYNC {sup registered} multi master control method resulted in further improvement concerning available peak power and system reliability. In June 2003 the two three phase supply systems were converted into one single phase system. First operation experience is available and reported on. It is shown, that a suitable grid topology and interconnection result in advantages for the overall supply system. The benefits of the parallel operation of three Sunny Island {sup registered} battery inverters on a single phase are: (1) less inverters necessary, (2) lower idle consumption of the overall system, (3) increased power of the single phase and (4) redundancy. (orig.)

  11. Experimental investigation of PV modules recycling; PV module recycle no jikkenteki kento

    Energy Technology Data Exchange (ETDEWEB)

    Unagida, H.; Kurokawa, K. [Tokyo University of Agriculture and Technology, Tokyo (Japan); Sakuta, K.; Otani, K.; Murata, K. [Electrotechnical Laboratory, Tsukuba (Japan)

    1997-11-25

    Recycling, cost/energy analysis and recovery experiment were made on crystalline silicon PV modules with EVA(ethylene vinyl acetate)-laminated structure. The life of modules is dependent not on performance deterioration of PV cells themselves but on yellowing or poor transmittance of EVA caused by ultraviolet ray, and disconnection between cells by thermal stress. Recovery is carried out in 3 stages of cell, wafer and material. Recovery in the stages of cell and wafer results in considerable reduction of energy and cost. The recovery experiment was carried out using PV module samples prepared by cutting the modules into 25times15mm pieces after removing Al frames from the used modules, peeling back sheets and cutting off EVA. Since a nitric acid process at 70-80degC can dissolve EVA effectively, it is promising for reuse of surface glass and PV cells as they are. This process is also carried out under a condition around room temperature and pressure, contributing to cost reduction and energy saving for recycling. Generation of harmful NOx is only a problem to be solved. 2 refs., 6 figs., 1 tab.

  12. Projecting of PV facades in consideration of PV-specific operating conditions; Besonderheiten bei der Projektierung von Photovoltaik-Fassadenanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Decker, B.; Grimmig, B.; Mencke, D. [Institut fuer Solarenergieforschung GmbH Hameln/Emmerthal (ISFH), Emmerthal (Germany). Gruppe Photovoltaik-Systeme; Stellbogen, D. [Zentrum fuer Sonnenenergie- und Wasserstoff-Forschung Baden-Wuerttemberg (ZSW), Stuttgart (Germany). Fachgebiet Photovoltaische Anlagentechnik

    1998-02-01

    PV facades can provide several additional functions such as weather protection, thermal insulation, daylighting or sun protection. On the other hand, specific operating conditions for PV facades must be taken into account when selecting components and designing the system. Depending on ventilation conditions, there is a large range of maximum module temperatures. South-oriented PV facades receive about 30% less yearly irradiation than an optimally inclined PV generator, hence reflection losses are approximately 4% higher. The maximum of yearly irradiation lies only in the 400-600 W/m{sup 2} range. Surrounding buildings and/or vegetation can impair performance of the PV-facades. For a south-oriented PV facade an annual yield in the range of 470-560 kwh/kW{sub p}.a has been prodicted which was verified by operating results of eight PV facades. (orig.) [Deutsch] Photovoltaik (PV) Fassaden ermoeglichen neben der Stromerzeugung zusaetzliche Funktionen wie Wetterschutz bzw. Waermedaemmung des Gebaeudes oder Tageslichtnutzung bzw. Sonnenschutz der Innenraeume. Allerdings muessen fassadenspezifische Betriebsbedingungen, bei der Komponentenauswahl und Systemauslegung beruecksichtigt werden. Unterschiedliche Hinterlueftungsbedingungen fuehren zu einer grossen Bandbreite der maximalen Modultemperatur. PV-Suedfassaden empfangen etwa 30% weniger Jahreseinstrahlung als ein optimal geneigter PV-Generator. Die Haelfte der jaehrlichen Einstrahlung trifft mit Einfallswinkeln groesser 50 auf die vertikal angeordneten Module wodurch die Reflexionsverluste um ca. 4% hoeher sind. Das Maximum der Jahreseinstrahlung liegt nur um 400-600 W/m{sup 2} und erreicht selten Werte ueber 800 W/m{sup 2}. Umliegende Gebaeude oder Vegetation koennen zu Teilabschattungen des Generators fuehren. Fuer eine vertikale PV-Suedfassade wird ein Jahresenergieertrag in Hoehe von 470-560 kWh/kW{sub p}.a prognostiziert, der anhand der Betriebsergebnisse von acht PV-Fassadenanlagen verifiziert werden konnte

  13. ANFIS-based estimation of PV module equivalent parameters: application to a stand-alone PV system with MPPT controller

    OpenAIRE

    KULAKSIZ, Ahmet Afşin

    2012-01-01

    The performance and system cost of photovoltaic (PV) systems can be improved by employing high-efficiency power conditioners with maximum power point tracking (MPPT) methods. Fast implementation and accurate operation of MPPT controllers can be realized by modeling the characteristics of PV modules, obtaining equivalent parameters. In this study, adaptive neuro-fuzzy inference systems (ANFISs) have been used to obtain 3 of the parameters in a single-diode model of PV cells, namely serie...

  14. The potential market for PV building products

    International Nuclear Information System (INIS)

    1998-01-01

    This study was carried out by ECOTEC Research and Consulting Limited (ECOTEC) in collaboration with the Newcastle Photovoltaic Application Centre (NPAC) and ECD Energy and Environment (ECD) under the Department of Trade and Industry's (DTI) New and Renewable Energy Programme (contract reference S/P2/00277/00/00). The aim was to assess the future market potential for building-integrated photovoltaic (BIPV) products in terms of current product availability, product development needs, the nature and size of the potential market, and the opportunities for government and the PV supply industry to work together to develop the market. The study itself comprised a review of existing BIPV products, an analysis of the development of the world market for BIPV, a market research survey of building professionals, and meetings of two 'focus groups' drawn from the PV 'supply side' and from buildings professionals. In principle, BIPV products can be used in virtually any type of building, but the main applications are considered to be housing and offices. (author)

  15. Development of NIL processes for PV applications

    Science.gov (United States)

    Hauser, H.; Tucher, N.; Tokai, K.; Schneider, P.; Wellens, Ch.; Volk, A.; Barke, S.; Müller, C.; Glinsner, T.; Bläsi, B.

    2015-03-01

    Due to its high resolution and applicability for large area patterning, Nanoimprint Lithography (NIL) is a promising technology for photovoltaic (PV) applications. However, a successful industrial application of NIL processes is only possible if large-area processing on thin, brittle and potentially rough substrates can be achieved in a high-throughput process. In this work, the development of NIL processes using the novel SmartNILTM technology from EV Group with a focus on PV applications is described. We applied this tooling to realize a honeycomb texture (8 μm period) on the front side of multicrystalline silicon solar cells leading to an improvement in optical efficiency of 7% relative and a total efficiency gain of 0.5% absolute compared to the industrial standard texture (isotexture). On the rear side of monocrystalline silicon solar cells, we realized diffraction gratings to make use of light trapping effects. An absorption enhancement of up to 35% absolute at a wavelength of 1100 nm is demonstrated. Furthermore, we combined photolithography and NIL processes to introduce features for metal contacts into honeycomb master structures, which initially were realized using interference lithography. As final application, we investigated the realization of very fine contact fingers with prismatic shape in order to minimize reflection losses.

  16. Impact of residential PV adoption on Retail Electricity Rates

    International Nuclear Information System (INIS)

    Cai, Desmond W.H.; Adlakha, Sachin; Low, Steven H.; De Martini, Paul; Mani Chandy, K.

    2013-01-01

    The price of electricity supplied from home rooftop photo voltaic (PV) solar cells has fallen below the retail price of grid electricity in some areas. A number of residential households have an economic incentive to install rooftop PV systems and reduce their purchases of electricity from the grid. A significant portion of the costs incurred by utility companies are fixed costs which must be recovered even as consumption falls. Electricity rates must increase in order for utility companies to recover fixed costs from shrinking sales bases. Increasing rates will, in turn, result in even more economic incentives for customers to adopt rooftop PV. In this paper, we model this feedback between PV adoption and electricity rates and study its impact on future PV penetration and net-metering costs. We find that the most important parameter that determines whether this feedback has an effect is the fraction of customers who adopt PV in any year based solely on the money saved by doing so in that year, independent of the uncertainties of future years. These uncertainties include possible changes in rate structures such as the introduction of connection charges, the possibility of PV prices dropping significantly in the future, possible changes in tax incentives, and confidence in the reliability and maintainability of PV. -- Highlights: •Households who install PV reduce their electricity consumption from the grid. •Electricity rates must increase for utility companies to recover its fixed costs. •However, higher electricity rates give households more incentives to adopt PV. •We find that this feedback has significant impact on PV uptake only in later years. •Utility companies could lose a significant fraction of high consumption customers

  17. National survey report on PV power applications in Switzerland 2006

    Energy Technology Data Exchange (ETDEWEB)

    Huesser, P. [Nova Energie GmbH, Aarau (Switzerland); Hostettler, T. [Ingenieurbuero Hostettler, Berne (Switzerland)

    2007-07-01

    This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.

  18. PV O&M Cost Model and Cost Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Walker, Andy

    2017-03-15

    This is a presentation on PV O&M cost model and cost reduction for the annual Photovoltaic Reliability Workshop (2017), covering estimating PV O&M costs, polynomial expansion, and implementation of Net Present Value (NPV) and reserve account in cost models.

  19. Molecular characterization of Pseudomonas syringae pv. tomato isolates from Tanzania

    DEFF Research Database (Denmark)

    Shenge, K.C.; Stephan, D.; Mabagala, R. B.

    2008-01-01

    Bacterial speck caused by Pseudomonas syringae pv. tomato is an emerging disease of tomato in Tanzania. Following reports of outbreaks of the disease in many locations in Tanzania, 56 isolates of P. syringae pv. tomato were collected from four tomato- producing areas and characterized using patho...

  20. Linearised model for PV panel power output variation with changes ...

    Indian Academy of Sciences (India)

    PALLAVI BHARADWAJ

    This equivalent resistance represents the load seen at the PV panel terminals. It is dependent on the actual power drawn by the system and the interfacing converter between the PV panels and the load. Thus it is a function of the converter duty ratio and load characteristics. Due to the disturbance, output characteristics of ...

  1. Linearised model for PV panel power output variation with changes ...

    Indian Academy of Sciences (India)

    PALLAVI BHARADWAJ

    2017-10-26

    Oct 26, 2017 ... which can be the PV panel current or the real power. In this work a linearised model is derived to relate the change in system input, namely: irradiance and temperature, with its output, namely: array current and power. The proposed model is experimentally verified with tests run on PV panels, when they are ...

  2. NREL Suite of Tools for PV and Storage Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Salasovich, James A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-04-03

    Many different factors such as the solar resource, technology costs and incentives, utility cost and consumption, space available, and financial parameters impact the technical and economic potential of a PV project. NREL has developed techno-economic modeling tools that can be used to evaluate PV projects at a site.

  3. PVSOFT99 - Photovoltaic (PV) System Sizing And Simulation Software

    African Journals Online (AJOL)

    A computer program (PVSOFT99) has been developed for sizing and simulation of stand-alone photovoltaic (PV) systems. Two distinct PV sizing algorithms, one based on the worst case and the other on the reliability concept, have been incorporated in the program. The reliability concept is generalized in that variation of ...

  4. Control of Single-Stage Single-Phase PV inverter

    DEFF Research Database (Denmark)

    Ciobotaru, Mihai; Teodorescu, Remus; Blaabjerg, Frede

    2005-01-01

    In this paper the issue of control strategies for single-stage photovoltaic (PV) inverter is addressed. Two different current controllers have been implemented and an experimental comparison between them has been made. A complete control structure for the single-phase PV system is also presented...

  5. On the Impacts of PV Array Sizing on the Inverter Reliability and Lifetime

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2018-01-01

    , the total energy yield can be increased under weak solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter reliability and lifetime. In that case, it may result in a negative impact on the overall PV......To enable a more wide scale utilization of PV systems, the cost of PV energy should be comparable to or even lower than other energy sources. Due to the relatively low cost of PV modules, oversizing PV arrays becomes a common approach to reduce the cost of PV energy in practice. By doing so...... energy cost, due to the increased maintenance for the PV inverters. With the above concern, this paper evaluates the reliability and lifetime of PV inverters considering the PV array sizing. The evaluation is based on the mission profile of the installation sites in Denmark and Arizona, where...

  6. Optimum Design Of On Grid Pv System Using Tracking System

    Directory of Open Access Journals (Sweden)

    Saeed Mansour

    2015-05-01

    Full Text Available Abstract The fossil fuel is a main issue in the world due to the increase of fossil fuel cost and the depletion of the fossil fuel with continuous increasing demand on electricity. With continuous decrease of PV panels cost it is interesting to consider generation of electricity from PV system. To provide electric energy to a load in a remote area where electric grid utility is not available or connection with grid utility is available there are two approaches of photovoltaic system PV without tracking system Fixed System and PV with tracking systems. The result shows that the energy production by using PV with tracking system generates more energy in comparison with fixed panels system. However the cost per produced KWH is less in case of using fixed panels. This is the backbone in choice between two approaches of photovoltaic system. In this work a system design and cost analysis for two approaches of photovoltaic system are considered.

  7. Overview of Recent Grid Codes for PV Power Integration

    DEFF Research Database (Denmark)

    Craciun, Bogdan-Ionut; Kerekes, Tamas; Sera, Dezso

    2012-01-01

    The challenge to bring down the cost of produced photovoltaic (PV) power had a major impact on the PV market and in consequence the grid operators experienced higher and higher PV power penetration. The growing share of this decentralized generation plants started to affect the grid stability...... and Distribution System Operators (DSOs) had to keep the safety and reliability of the network under strict rules and regulations. The aim of the paper is to realize a survey of recent Grid Codes (GC) and regulations for grid connected PV systems. The focus is on grid interface requirements, power quality concerns...... and Anti-Islanding (AI) issues regarding PV systems connected to low voltage (LV) and medium voltage (MV) levels of the network....

  8. Review of Solar PV Market Development in East Africa

    DEFF Research Database (Denmark)

    Hansen, Ulrich Elmer; Pedersen, Mathilde Brix; Nygaard, Ivan

    While the diffusion of solar home systems in Kenya has been market-based for some years, the diffusion of PV in most other Sub-Saharan African countries has been driven by government and donor-supported projects aimed at serving specific needs for electricity while at the same time creating...... a national niche market for PV. This practice is rapidly changing and, as in industrialised countries, there is evidence of a transition towards more market-based diffusion and private-sector involvement for PV systems for private consumers, institutions and villages. This transition has been facilitated...... the development of PV markets not only in terms of installed capacity and market volume, but also with regard to local industry and PV business development. The paper concludes by drawing attention to particular factors that have been used in the literature to explain disparities in market...

  9. A global strategy for the European PV industry

    Energy Technology Data Exchange (ETDEWEB)

    Viaud, M.; Despotou, E.; Latour, M. [European Photovoltaic Industry Association (EPIA) secretariat, Brussels (Belgium); Hoffmann, W.; Macias, E.; Cameron, M.; Laborde, E. [European Photovoltaic Industry Association (EPIA), Brussels (Belgium)

    2004-07-01

    The objective was to develop a comprehensive strategy that answers to the need of today European PV industry. Namely: - Develop PV markets in Europe - Develop export markets. - Position the European PV industry within the European political environment and support the effort of national actors in their local objectives. This method lends itself to brainstorming to create actions and synergies, on order to achieve strategy objectives. The whole work is based on working groups clearly defined on the purpose, where all EPIA members are invited to participate. The overall first results are presented during the 19. EU PV Conference in Paris and EPIA will do recommendations on actions to be undertaken in the future. This strategy is co-financed by EPIA members and the 6. Framework Programme for research of the European Commission through the PV Catapult project. (authors)

  10. PV-DSM: Policy actions to speed commercialization

    International Nuclear Information System (INIS)

    Hoff, T.; Wenger, H.J.; Keane, D.M.

    1993-01-01

    Pacific Gas and Electric Company (PG ampersand E) recently applied Demand-Side Management (DSM) evaluation techniques to photovoltaic (PV) technology to develop the concept of photovoltaics as a Demand-Side Management option (PV-DSM). The analysis demonstrated that PV-DSM has the potential to be economically attractive. Two criticisms in response to that analysis are that the assumptions of 25 year financing and a 25 year evaluation period are unrealistic. This paper responds to those criticisms and documents the mathematical relationships to calculate the value of PV-DSM from a customer's perspective. It demonstrates how regulatory and government agencies could implement policies to resolve both issues and speed PV commercialization

  11. Costs of Residential Solar PV Plants in Distribution Grid Networks

    DEFF Research Database (Denmark)

    Kjær, Søren Bækhøj; Yang, Guangya; Ipsen, Hans Henrik

    2015-01-01

    In this article we investigate the impact of residential solar PV plants on energy losses in distribution networks and their impact on distribution transformers lifetime. Current guidelines in Denmark states that distribution transformers should not be loaded with more than 67% solar PV power...... called “Availability Tariff”. According to the Danish Energy Regulatory Authority, the Availability Tariff must cover the exact expenses, with energy savings etc. from the solar PV plants taken into consideration. Our conclusion is that a distribution network, which represents a typical residential...... to avoid accelerated loss of life. If a solar PV plant causes this limit to be exceeded, the particular owner has to pay for upgrading the transformer. Distribution Network Operators also charge an annual tariff from the solar PV plants to cover the expenses to keep the grid capacity available, the so...

  12. Status of High Performance PV: Polycrystalline Thin-Film Tandems

    Energy Technology Data Exchange (ETDEWEB)

    Symko-Davies, M.

    2005-02-01

    The High-Performance Photovoltaic (HiPerf PV) Project was initiated by the U.S. Department of Energy to substantially increase the viability of photovoltaics (PV) for cost-competitive applications so that PV can contribute significantly to our energy supply and our environment. The HiPerf PV Project aims at exploring the ultimate performance limits of existing PV technologies, approximately doubling their sunlight-to-electricity conversion efficiencies during its course. This work includes bringing thin-film cells and modules toward 25% and 20% efficiencies, respectively, and developing multijunction concentrator cells and modules able to convert more than one-third of the sun's energy to electricity (i.e., 33% efficiency). This paper will address recent accomplishments of the NREL in-house research effort involving polycrystalline thin-film tandems, as well as the research efforts under way in the subcontracted area.

  13. A global strategy for the European PV industry

    International Nuclear Information System (INIS)

    Viaud, M.; Despotou, E.; Latour, M.; Hoffmann, W.; Macias, E.; Cameron, M.; Laborde, E.

    2004-01-01

    The objective was to develop a comprehensive strategy that answers to the need of today European PV industry. Namely: - Develop PV markets in Europe - Develop export markets. - Position the European PV industry within the European political environment and support the effort of national actors in their local objectives. This method lends itself to brainstorming to create actions and synergies, on order to achieve strategy objectives. The whole work is based on working groups clearly defined on the purpose, where all EPIA members are invited to participate. The overall first results are presented during the 19. EU PV Conference in Paris and EPIA will do recommendations on actions to be undertaken in the future. This strategy is co-financed by EPIA members and the 6. Framework Programme for research of the European Commission through the PV Catapult project. (authors)

  14. Costs of Residential Solar PV Plants in Distribution Grid Networks

    DEFF Research Database (Denmark)

    Kjær, Søren Bækhøj; Yang, Guangya; Ipsen, Hans Henrik

    2015-01-01

    In this article we investigate the impact of residential solar PV plants on energy losses in distribution networks and their impact on distribution transformers lifetime. Current guidelines in Denmark states that distribution transformers should not be loaded with more than 67% solar PV power...... to avoid accelerated loss of life. If a solar PV plant causes this limit to be exceeded, the particular owner has to pay for upgrading the transformer. Distribution Network Operators also charge an annual tariff from the solar PV plants to cover the expenses to keep the grid capacity available, the so...... called “Availability Tariff”. According to the Danish Energy Regulatory Authority, the Availability Tariff must cover the exact expenses, with energy savings etc. from the solar PV plants taken into consideration. Our conclusion is that a distribution network, which represents a typical residential...

  15. Do feed-in tariffs drive PV cost or viceversa?

    International Nuclear Information System (INIS)

    Antonelli, Marco; Desideri, Umberto

    2014-01-01

    Highlights: • The distribution of PV installations on the territory is not a function of the solar radiation. • Cost of PV plants were adapted to the FIT framework. • The FIT for PV in Italy was considered an incentive to financial investment. • The FIT for PV in Italy did not stimulate the development of national PV industry. - Abstract: A survey of the PV market in Italy was done studying a number of installations of different sizes whose economic data were known and assessed. The Italian market has experienced a boom in the PV market after the first mechanism of feed-in tariffs was promoted in 2005. The variations of the tariff structure in the following years have caused significant changes in the market structure in terms of average size and technical characteristics of installed plants. However, an Italian PV industry was not stimulated by the incentives and only companies involved in installation and maintenance were created. At the same time, the cost of the PV plants components, design and commissioning have followed quite a particular trend, which is more determined by the tariffs than by the market development and structure. It is quite clear that the costs of PV plants component are not driven by the amount of installations but by the tariffs, with a trend that follows the decreases in the incentives and not the global installed power. It is therefore very important to study the right tariff mechanisms and benefits to avoid financial disturbances on the market and to promote a real competitive market instead of a simple financial operation under a fake façade of green economy

  16. PV Performance Modeling Methods and Practices: Results from the 4th PV Performance Modeling Collaborative Workshop.

    Energy Technology Data Exchange (ETDEWEB)

    Stein, Joshua [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-03-01

    In 2014, the IEA PVPS Task 13 added the PVPMC as a formal activity to its technical work plan for 2014-2017. The goal of this activity is to expand the reach of the PVPMC to a broader international audience and help to reduce PV performance modeling uncertainties worldwide. One of the main deliverables of this activity is to host one or more PVPMC workshops outside the US to foster more international participation within this collaborative group. This report reviews the results of the first in a series of these joint IEA PVPS Task 13/PVPMC workshops. The 4th PV Performance Modeling Collaborative Workshop was held in Cologne, Germany at the headquarters of TÜV Rheinland on October 22-23, 2015.

  17. Innovations in Wind and Solar PV Financing

    Energy Technology Data Exchange (ETDEWEB)

    Cory, K.; Coughlin, J.; Jenkin, T.; Pater, J.; Swezey, B.

    2008-02-01

    There is growing national interest in renewable energy development based on the economic, environmental, and security benefits that these resources provide. Historically, greater development of our domestic renewable energy resources has faced a number of hurdles, primarily related to cost, regulation, and financing. With the recent sustained increase in the costs and associated volatility of fossil fuels, the economics of renewable energy technologies have become increasingly attractive to investors, both large and small. As a result, new entrants are investing in renewable energy and new business models are emerging. This study surveys some of the current issues related to wind and solar photovoltaic (PV) energy project financing in the electric power industry, and identifies both barriers to and opportunities for increased investment.

  18. Analytical Improvements in PV Degradation Rate Determination

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, D. C.; Kurtz, S. R.

    2011-02-01

    As photovoltaic (PV) penetration of the power grid increases, it becomes vital to know how decreased power output may affect cost over time. In order to predict power delivery, the decline or degradation rates must be determined accurately. For non-spectrally corrected data several complete seasonal cycles (typically 3-5 years) are required to obtain reasonably accurate degradation rates. In a rapidly evolving industry such a time span is often unacceptable and the need exists to determine degradation rates accurately in a shorter period of time. Occurrence of outliers and data shifts are two examples of analytical problems leading to greater uncertainty and therefore to longer observation times. In this paper we compare three methodologies of data analysis for robustness in the presence of outliers, data shifts and shorter measurement time periods.

  19. Molecular detection of Xanthomonas oryzae pv. oryzae, Xanthomonas oryzae pv. oryzicola, and Burkholderia glumae in infected rice seeds and leaves

    Science.gov (United States)

    Polymerase chain reaction (PCR) is particularly useful for plant pathogen detection. In the present study, multiplex PCR and SYBR green real-time PCR were developed to facilitate simultaneous detection of three important rice pathogens, Xanthomonas oryzae pv. oryzae, X. oryzae pv. oryzicola, and Bur...

  20. SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Wesley J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Woodhouse, Michael A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-09-12

    In this report we summarize the implications, impacts, and deployment potential of reaching the SunShot 2030 targets for the electricity system in the contiguous United States. We model 25 scenarios of the U.S. power sector using the Regional Energy Deployment Systems (ReEDS) and Distributed Generation (dGen) capacity expansion models. The scenarios cover a wide range of sensitivities to capture future uncertainties relating to fuel prices, retirements, renewable energy capital costs, and load growth. We give special attention to the potential for storage costs to also rapidly decline due to its large synergies with low-cost solar. The ReEDS and dGen models project utility- and distributed-scale power sector evolution, respectively, for the United States. Both models have been designed with special emphasis on capturing the unique traits of renewable energy, including variability and grid integration requirements. Across the suite of scenarios modeled, we find that reaching the SunShot 2030 target has the potential to lead to significant capacity additions of PV in the United States. By 2050, PV penetration levels are projected to reach 28-46 percent of total generation. If storage also sees significant reductions in cost, then the 2050 solar penetration levels could reach 41-64 percent. PV deployment is projected to occur in all of the lower 48 states, though the specific deployment level is scenario dependent. The growth in PV is projected to be dominated by utility-scale systems, but the actual mix between utility and distributed systems could ultimately vary depending on how policies, system costs, and rate structures evolve.

  1. Valley of Death analysis for polymer PV technology; Valley of Death analyse voor polymere PV technologie

    Energy Technology Data Exchange (ETDEWEB)

    Schoots, K. [ECN Beleidsstudies, Petten (Netherlands)

    2013-12-15

    This report describes the results of a qualitative study of the barriers that actors involved in the development and commercialization of polymer solar cells, may encounter. The purpose of this socio-economic research is to identify these barriers for the (market) development of thin film polymeric PV technology and to develop strategies for them in order to overcome the constraints. The necessary data are collected from interviews with actors who are active in the development and deployment of conventional solar cells. Based on the results from this study, it is conclude that it is important for the Organic PV industry to carry out many market experiments beyond the built environment. The report provides recommendations with regard to the markets in which these experiments are most likely to succeed and which drivers should be taken into account [Dutch] Dit rapport beschrijft de resultaten van een kwalitatief onderzoek naar de barrieres die actoren, betrokken bij de ontwikkeling en marktintroductie van polymere zonnecellen, kunnen tegenkomen. Het doel van dit sociaal-economische onderzoek is deze barrieres voor de (markt)ontwikkeling van dunne film polymere PV technologie te identificeren en strategieen te ontwikkelen om ze voor te zijn of ze te overbruggen. De benodigde gegevens worden verzameld uit interviews met actoren die actief zijn in de ontwikkeling en uitrol van conventionele zonnecellen. Op basis van de resultaten uit dit onderzoek komen we tot de conclusie dat het voor de Organische PV sector belangrijk is veel marktexperimenten aan te gaan buiten de gebouwde omgeving. Het rapport geeft aanbevelingen in welke soort markten deze experimenten de meeste kans van slagen hebben en met welke drivers van marktpartijen rekening moet worden gehouden.

  2. Optimal Solar PV Arrays Integration for Distributed Generation

    Energy Technology Data Exchange (ETDEWEB)

    Omitaomu, Olufemi A [ORNL; Li, Xueping [University of Tennessee, Knoxville (UTK)

    2012-01-01

    Solar photovoltaic (PV) systems hold great potential for distributed energy generation by installing PV panels on rooftops of residential and commercial buildings. Yet challenges arise along with the variability and non-dispatchability of the PV systems that affect the stability of the grid and the economics of the PV system. This paper investigates the integration of PV arrays for distributed generation applications by identifying a combination of buildings that will maximize solar energy output and minimize system variability. Particularly, we propose mean-variance optimization models to choose suitable rooftops for PV integration based on Markowitz mean-variance portfolio selection model. We further introduce quantity and cardinality constraints to result in a mixed integer quadratic programming problem. Case studies based on real data are presented. An efficient frontier is obtained for sample data that allows decision makers to choose a desired solar energy generation level with a comfortable variability tolerance level. Sensitivity analysis is conducted to show the tradeoffs between solar PV energy generation potential and variability.

  3. Three junction holographic micro-scale PV system

    Science.gov (United States)

    Wu, Yuechen; Vorndran, Shelby; Ayala Pelaez, Silvana; Kostuk, Raymond K.

    2016-09-01

    In this work a spectrum splitting micro-scale concentrating PV system is evaluated to increase the conversion efficiency of flat panel PV systems. In this approach, the dispersed spectrum splitting concentration systems is scaled down to a small size and structured in an array. The spectrum splitting configuration allows the use of separate single bandgap PV cells that increase spectral overlap with the incident solar spectrum. This results in an overall increase in the spectral conversion efficiency of the resulting system. In addition other benefits of the micro-scale PV system are retained such reduced PV cell material requirements, more versatile interconnect configurations, and lower heat rejection requirements that can lead to a lower cost system. The system proposed in this work consists of two cascaded off-axis holograms in combination with a micro lens array, and three types of PV cells. An aspherical lens design is made to minimize the dispersion so that higher concentration ratios can be achieved for a three-junction system. An analysis methodology is also developed to determine the optical efficiency of the resulting system, the characteristics of the dispersed spectrum, and the overall system conversion efficiency for a combination of three types of PV cells.

  4. Kauai Island Utility Co-op (KIUC) PV integration study.

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, Abraham; Mousseau, Tom (Knoxville, TN)

    2011-08-01

    This report investigates the effects that increased distributed photovoltaic (PV) generation would have on the Kauai Island Utility Co-op (KIUC) system operating requirements. The study focused on determining reserve requirements needed to mitigate the impact of PV variability on system frequency, and the impact on operating costs. Scenarios of 5-MW, 10-MW, and 15-MW nameplate capacity of PV generation plants distributed across the Kauai Island were considered in this study. The analysis required synthesis of the PV solar resource data and modeling of the KIUC system inertia. Based on the results, some findings and conclusions could be drawn, including that the selection of units identified as marginal resources that are used for load following will change; PV penetration will displace energy generated by existing conventional units, thus reducing overall fuel consumption; PV penetration at any deployment level is not likely to reduce system peak load; and increasing PV penetration has little effect on load-following reserves. The study was performed by EnerNex under contract from Sandia National Laboratories with cooperation from KIUC.

  5. What's stopping a huge expansion of the PV market?

    International Nuclear Information System (INIS)

    Varadi, P.F.

    1998-01-01

    Over the past 25 years the terrestrial PV industry has turned into a billion-dollar global business. The necessary technology is available and substantial market growth is continuing. It has often been said that the cost of PV must come down further before the technology really takes off. However the author argues here that the dominant segments of the market are not price-sensitive and that the future explosive expansion of PV markets will need financing on a global basis, assured quality in the products, and the institution of an extensive public-awareness programme of advertising, promotion and education. (author)

  6. PV Validation and Bankability Workshop: San Jose, California

    Energy Technology Data Exchange (ETDEWEB)

    Granata, J.; Howard, J.

    2011-12-01

    This report is a collaboration between Sandia National Laboratories, the National Renewable Energy Laboratory, and the Florida Solar Energy Center (FSEC). The report provides feedback from the U.S. Department of Energy's (DOE) Solar Program PV Validation and Bankability Workshop in San Jose, California on August 31, 2011. It focuses on the current state of PV in the United States, private funding to fund U.S. PV industry growth, roles and functions of the regional test center program, and ways to improve the current validation and bankability practices.

  7. PV Project Finance in the United States, 2016

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, David; Lowder, Travis; Schwabe, Paul

    2016-09-01

    This brief is a compilation of data points and market insights that reflect the state of the project finance market for solar photovoltaic (PV) assets in the United States as of the third quarter of 2016. This information can generally be used as a simplified benchmark of the costs associated with securing financing for solar PV as well as the cost of the financing itself (i.e., the cost of capital). Three sources of capital are considered -- tax equity, sponsor equity, and debt -- across three segments of the PV marketplace.

  8. State financed PV technology projects in Nigeria

    Energy Technology Data Exchange (ETDEWEB)

    Gyoh, L.; Gyoh, S. [Iceberg PVPS Consultants, Sheffield (United Kingdom)

    2004-07-01

    Despite the progress made by the democratic government of Nigeria to eradicate poverty, there are still millions of people without access to electricity. It would not be financially viable to extend the national electricity grid to each electoral ward, in remote locations in the country. The use of photovoltaic technology now brings electricity to many rural areas as part of the provision of basic needs by the Nigerian authorities. The Nasarawa State Government has embarked on the provision of all it electoral wards with solar powered water supply systems to carter for a mostly rural population of 3.4 million people. The Benue, Taraba, Bauchi and Jigawa State governments have embarked on similar schemes in Rural Water Supply, Health and the Educational sectors of the economy. Ambitious PV programmes, of this nature, inevitably face challenges in developing countries. The preliminary recommendations, of this ongoing study, have been made to address some of the potential challenges in some of the key areas. This paper reviews the implementation progress and suggests some of the lessons that might be learnt. (authors)

  9. State financed PV technology projects in Nigeria

    International Nuclear Information System (INIS)

    Gyoh, L.; Gyoh, S.

    2004-01-01

    Despite the progress made by the democratic government of Nigeria to eradicate poverty, there are still millions of people without access to electricity. It would not be financially viable to extend the national electricity grid to each electoral ward, in remote locations in the country. The use of photovoltaic technology now brings electricity to many rural areas as part of the provision of basic needs by the Nigerian authorities. The Nasarawa State Government has embarked on the provision of all it electoral wards with solar powered water supply systems to carter for a mostly rural population of 3.4 million people. The Benue, Taraba, Bauchi and Jigawa State governments have embarked on similar schemes in Rural Water Supply, Health and the Educational sectors of the economy. Ambitious PV programmes, of this nature, inevitably face challenges in developing countries. The preliminary recommendations, of this ongoing study, have been made to address some of the potential challenges in some of the key areas. This paper reviews the implementation progress and suggests some of the lessons that might be learnt. (authors)

  10. Promotional drivers for grid-connected PV

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Polo, A.; Hass, R.; Suna, D.

    2009-03-15

    This report for the International Energy Agency (IEA) made by Task 10 of the Photovoltaic Power Systems (PVPS) programme takes a look at promotional measures for grid-connected photovoltaic systems. The mission of the Photovoltaic Power Systems Programme is to enhance the international collaboration efforts which accelerate the development and deployment of photovoltaic solar energy. The objective of Task 10 is stated as being to enhance the opportunities for wide-scale, solution-oriented application of photovoltaics in the urban environment. The paper discusses the core objective of this study which was to analyse the success of various governmental regulatory programs and governmental and non-governmental marketing programs for grid-connected PV systems. To meet this objective, a review of the most important past and current programs around the world was conducted. The theoretical bases of supply and demand are explained and the types of existing strategies are documented in a second Section. In Chapter 3, various programs around the world are described. Chapter 4 focuses on defining success criteria which will be used for the analysis of the programs. Finally, the major conclusions drawn complete this analysis.

  11. PV GRID Advisory Paper. Consultation version: key recommendations

    Energy Technology Data Exchange (ETDEWEB)

    Barth, Bianca; Concas, Giorgia; Cossent, Rafael; Franz, Oliver; Frias, Pablo; Hermes, Roland; Lama, Riccardo; Loew, Holger; Mateo, Carlos; Rekinger, Manoel; Sonvilla, Paolo Michele; Vandenbergh, Michel

    2014-01-15

    PV GRID is a transnational collaborative effort under the umbrella of the Intelligent Energy Europe programme. The main project goal is to enhance photovoltaic (PV) hosting capacity in distribution grids while overcoming regulatory and normative barriers hampering the application of available technical solutions. The European PV GRID advisory paper aims at providing an overview of the issues and barriers that need to be addressed in order to enhance the distribution grid hosting capacity for PV and other distributed generation (DG).To this purpose, barriers are classified as either cross-cutting challenges or specific barriers, depending on whether they have an overarching, system-wide character or rather focus on one single issue such as curtailment, self-consumption or storage. Finally, a set of preliminary recommendations on how to overcome these issues is presented, allowing for the implementation of the identified technical solutions.

  12. Robustness analysis of the efficiency in PV inverters

    DEFF Research Database (Denmark)

    Pigazo, Alberto; Liserre, Marco; Blaabjerg, Frede

    2013-01-01

    During last years an increasing attention has been paid to the efficiency of grid-connected PV inverters. They are manufactured from a number of discrete components and by using a certain topology and control strategy. Hence, the performance of a certain PV inverter not only depends on the selected...... topology and control strategy but also on the characteristics of the employed components. The aim of this paper is evaluate the effect of physical variations associated to the main components on the overall efficiency of PV inverters. It is concluded that a statistical evaluation of the power converter...... provides a better understanding of the PV inverter performance and, in this sense, the definition of the European Efficiency must be reviewed in order to show the quality of the manufactured product....

  13. Control of Single-Stage Single-Phase PV inverter

    DEFF Research Database (Denmark)

    Ciobotaru, Mihai; Teodorescu, Remus; Blaabjerg, Frede

    2005-01-01

    In this paper the issue of control strategies for single-stage photovoltaic (PV) inverter is addressed. Two different current controllers have been implemented and an experimental comparison between them has been made. A complete control structure for the single-phase PV system is also presented......-forward; - and the grid current controller implemented in two different ways, using the classical proportional integral (PI) and the novel proportional resonant (PR) controllers. The control strategy was tested experimentally on 1.5 kW PV inverter........ The main elements of the PV control structure are: - a maximum power point tracker (MPPT) algorithm using the incremental conductance method; - a synchronization method using the phase-locked-loop (PLL), based on delay; - the input power control using the dc voltage controller and power feed...

  14. Measures for diffusion of solar PV in selected African countries

    DEFF Research Database (Denmark)

    Nygaard, Ivan; Hansen, Ulrich Elmer; Mackenzie, Gordon A.

    2017-01-01

    that governments’ strategies to promoting solar PV are moving from isolated projects towards frameworks for market development and that there are high expectations to upgrading in the PV value chain through local assembly of panels and local production of other system elements. Commonly identified measures include......This paper investigates how African governments are considering supporting and promoting the diffusion of solar PV. This issue is explored by examining so-called ‘technology action plans (TAPs)’, which were main outputs of the Technology Needs Assessment project implemented in 10 African countries...... from 2010 to 2013. The paper provides a review of three distinct but characteristic trajectories for PV market development in Kenya (private-led market for solar home systems), Morocco (utility-led fee-for service model) and Rwanda (donorled market for institutional systems). The paper finds...

  15. Heritage plaza parking lots improvement project- Solar PV installation

    Energy Technology Data Exchange (ETDEWEB)

    Hooks, Todd [Agua Caliente Indian Reservation, Palm Springs, CA (United States)

    2017-03-31

    The Agua Caliente Band of Cahuilla Indians (ACBCI or the “Tribe”) installed a 79.95 kW solar photovoltaic (PV) system to offset the energy usage costs of the Tribal Education and Family Services offices located at the Tribe's Heritage Plaza office building, 90I Tahquitz Way, Palm Springs, CA, 92262 (the "Project"). The installation of the Solar PV system was part of the larger Heritage Plaza Parking Lot Improvements Project and mounted on the two southern carport shade structures. The solar PV system will offset 99% of the approximately 115,000 kWh in electricity delivered annually by Southern California Edison (SCE) to the Tribal Education and Family Services offices at Heritage Plaza, reducing their annual energy costs from approximately $22,000 annually to approximately $200. The total cost of the proposed solar PV system is $240,000.

  16. Retaining the Value of PV at High Penetration Workshop

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, Sarah; Bolen, Michael

    2017-01-19

    PV prices have dropped and are now attractive without incentives for peaking applications in some locations. Modeling suggests and, empirically, some regions demonstrate that as PV penetration increases its value decreases, predominantly due to a decrease in energy and capacity value. It is not apparent what technologies and price may be needed for PV to supply tens of percent of electricity in the most economically efficient manner. A 1-day workshop was co-sponsored by EPRI and NREL with support from ASU. A dozen presentations and discussions introduced how the interplay of various technologies impact the value of PV, identified technical challenges and gaps impeding implementation, and discussed future R&D needs and opportunities.

  17. The PV Corrosion Fault Prognosis Based on Ensemble Kalman Filter

    Directory of Open Access Journals (Sweden)

    Radouane Ouladsine

    2017-01-01

    Full Text Available The degradation of photovoltaic (PV modules remains a major concern on the control and the development of the photovoltaic field, particularly, in regions with difficult climatic conditions. The main degradation modes of the PV modules are corrosion, discoloration, glass breaks, and cracks of cells. However, corrosion and discoloration remain the predominant degradation modes that still require further investigations. In this paper, a model-based PV corrosion prognostic approach, based on an ensemble Kalman filter (EnKF, is introduced to identify the PV corrosion parameters and then estimate the remaining useful life (RUL. Simulations have been conducted using measured data set, and results are reported to show the efficiency of the proposed approach.

  18. A comparison of design features of 80 pv-powered products

    NARCIS (Netherlands)

    Apostolou, G.; Reinders, A.H.M.E.

    2012-01-01

    In this paper 80 commercially available PV products have been analysed. The data set comprises 46 low power PV products in the range of 0 to 17 Wp and 34 PV products with a power of 17 Wp up to 27 kWp. The goal of our study is to investigate and evaluate features of PV products that are available on

  19. Impacts of Solar PV Arrays on Physicochemical Properties of Soil

    Science.gov (United States)

    Cagle, A.; Choi, C. S.; Macknick, J.; Ravi, S.; Bickhart, R.

    2017-12-01

    The deployment of renewable energy technologies, such as solar photovoltaics (PV), is rapidly escalating. While PV can provide clean, renewable energy, there is uncertainty regarding its potential positive and/or negative impacts on the local environment. Specifically, its effects on the physicochemical properties of the underlying soil have not been systematically quantified. This study facilitates the discussion on the effects of PV installations related to the following questions: i. How do soil moisture, infiltration rates, total organic carbon, and nitrogen contents vary spatially under a PV array? ii. How do these physicochemical properties compare to undisturbed and adjacent land covered in native vegetation? iii. Are these variations statistically significant to provide insight on whether PV installations have beneficial or detrimental impacts on soil? We address these questions through field measurements of soil moisture, infiltration, grain particle size distribution, total organic carbon, and nitrogen content at a 1-MW solar PV array located at the National Renewable Energy Laboratory in Golden, Colorado. We collect data via multiple transects underneath the PV array as as well as in an adjacent plot of undisturbed native vegetation. Measurements are taken at four positions under the solar panels; the east-facing edge, center area under the panel, west-facing edge, and interspace between panel rows to capture differences in sun exposure as well as precipitation runoff of panels. Measurements are collected before and after a precipitation event to capture differences in soil moisture and infiltration rates. Results of this work can provide insights for research fields associated with the co-location of agriculture and PV installations as well as the long term ecological impacts of solar energy development. Trends in physicochemical properties under and between solar panels can affect the viability of co-location of commercial crops in PV arrays, the

  20. NREL PV working with industry, Third quarter 1998

    Energy Technology Data Exchange (ETDEWEB)

    Moon, S.; Cook, G.

    1998-12-04

    This quarterly report encourages cooperative R and D by providing the US PV industry with information on activities and capabilities of the laboratories. This issue contains information on the CIS and CdTe R and D teams, an editorial by Richard King on the stand-out accomplishments of the PV Program, and an overview of the NCPV Program Review Meeting highlighting the strength of US photovoltaics.

  1. In the balance. The social costs and benefits of PV

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, C. [ECN Solar Energy, Petten (Netherlands)

    2013-10-16

    For more than a decade, the growth in PV markets surpassed expectations. Then, in 2012, the European market declined for the first time compared with the previous year. As policymakers' support for PV hesitates over the costs to society of this technology, it is timely to take an overview of the social costs and benefits, also referred to as the 'external costs', of PV electricity. In this article, these costs are put into perspective vis-a-vis those associated with conventional electricity-generating technologies. The external costs of electricity can be broken down into: (1) the environmental and health costs; (2) the costs of subsidies and energy security; and (3) the costs for grid expansion and reliability. Included in these costs are the increased insurance, health, social and environmental costs associated with damages to health, infrastructure and environment, as well as tax payments that subsidize producers of electricity or fuels, their markets and the electricity infrastructure. A life cycle assessment (LCA) of the environmental impact is used in the quantification of the associated environmental and health costs. Because the environmental footprint of PV electricity is highly dependent on the electricity mix used in PV module fabrication, the environmental indicators are calculated for PV electricity manufactured using different electricity mixes, and compared with those for the European electricity mix (UCTE), and electricity generated by burning 100% coal or 100% natural gas. In 2012 USD, coal electricity requires 19-29 eurocent/kWh above the market price, compared with 1-1.6 eurocent/kWh for PV manufactured with 100% coal electricity. The sum of the subsidies, avoided fossil-fuel imports and energy security, and the economic stimulation associated with PV electricity deployment, amounts to net external benefits. Integrating high penetrations of renewables, with the same reliability as we have today, appears to be fully feasible and

  2. Improvements in world-wide intercomparison of PV module calibration

    OpenAIRE

    Salis, E.; Pavanello, D.; Field, M.; Kräling, U.; Neuberger, F.; Kiefer, K.; Osterwald, C.; Rummel, S.; Levi, D.; Hishikawa, Y.; Yamagoe, K.; Ohshima, H.; Yoshita, M.; Müllejans, H.

    2017-01-01

    The calibration of the electrical performance for seven photovoltaic (PV) modules was compared between four reference laboratories on three continents. The devices included two samples in standard and two in high-efficiency crystalline silicon technology, two CI(G)S and one CdTe module. The reference value for each PV module parameter was calculated from the average of the results of all four laboratories, weighted by the respective measurement uncertainties. All single results were then anal...

  3. Influence of Special Weather on Output of PV System

    Science.gov (United States)

    Zhang, Zele

    2018-01-01

    The output of PV system is affected by different environmental factors, therefore, it is important to study the output of PV system under different environmental conditions. Through collecting data on the spot, collecting the output of photovoltaic panels under special weather conditions, and comparing the collected data, the output characteristics of the photovoltaic panels under different weather conditions are obtained. The influence of weather factors such as temperature, humidity and irradiance on the output of photovoltaic panels was investigated.

  4. Economic and policy analysis for solar PV systems in Indiana

    International Nuclear Information System (INIS)

    Jung, Jinho; Tyner, Wallace E.

    2014-01-01

    In recent years, the energy market in the US and globally is expanding the production of renewable energy. Solar energy for electricity is also expanding in the US. Indiana is one of the states expanding solar energy with solar photovoltaic (PV) systems. Therefore, we conduct benefit cost analysis with several uncertain input variables to determine the economics of adopting solar PV systems in Indiana based on policy instruments that could increase adoption of solar PV systems. The specific objectives are analyses of the cost distribution of solar PV systems compared with grid electricity in homes and estimating the probability that solar can be cheaper than electricity from grids under different policy combinations. We first do the analysis under current policy and then the analysis under potential policy options for a variety of scenarios. Also, the results inform government policy makers on how effective the alternative policies for encouraging solar PV systems are. The results show that current policies are important in reducing the cost of solar PV systems. However, with current policies, there is only 50–50 chance of solar being cheaper than electricity from grids. If potential policies are implemented, solar PV systems can be more economical than grid electricity. - Highlights: • We investigate the economics of solar PV systems based on policy instruments. • We do scenario analyses under different combinations of policies. • We examine the probability of solar being cheaper than grid electricity for each scenario. • With current policies, there is 50–50 chance of solar being cheaper than the grid. • With depreciation and carbon tax, solar is much more economical than the grid

  5. Developing solar: PV solar system markets in Africa

    International Nuclear Information System (INIS)

    Asali, Karim

    2002-01-01

    Governments, NGO's and UN organisations are increasingly convinced that renewable energies not only help to solve energy problems in Africa but are indispensable in alleviating regional disparities, social problems and bridging the digital gap. Still, many years after introducing high efficiency solar PV systems the necessary breakthrough of implementing them on a mass scale is still not a reality. The author provides perspectives on developing solar PV in Africa. (Author)

  6. Parallel experimental study of a novel super-thin thermal absorber based photovoltaic/thermal (PV/T system against conventional photovoltaic (PV system

    Directory of Open Access Journals (Sweden)

    Peng Xu

    2015-11-01

    Full Text Available Photovoltaic (PV semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the overall field system involved 15 stand-alone PV panels and 15 retrofitted PV/T panels. The laboratory testing results demonstrated the PV/T panel could achieve the electrical efficiency of about 16.8% (relatively 5% improvement comparing with the stand-alone PV panel, and yield an extra amount of heat with thermal efficiency of nearly 65%. The field testing results indicated that the hybrid PV/T panel could enhance the electrical return of PV panels by nearly 3.5%, and increase the overall energy output by nearly 324.3%. Further opportunities and challenges were then discussed from aspects of different PV/T stakeholders to accelerate the development. It is expected that such technology could become a significant solution to yield more electricity, offset heating load freely and reduce carbon footprint in contemporary energy environment.

  7. Performance analysis of PV panel under varying surface temperature

    Directory of Open Access Journals (Sweden)

    Kumar Tripathi Abhishek

    2018-01-01

    Full Text Available The surface temperature of PV panel has an adverse impact on its performance. The several electrical parameters of PV panel, such as open circuit voltage, short circuit current, power output and fill factor depends on the surface temperature of PV panel. In the present study, an experimental work was carried out to investigate the influence of PV panel surface temperature on its electrical parameters. The results obtained from this experimental study show a significant reduction in the performance of PV panel with an increase in panel surface temperature. A 5W PV panel experienced a 0.4% decrease in open circuit voltage for every 1°C increase in panel surface temperature. Similarly, there was 0.6% and 0.32% decrease in maximum power output and in fill factor, respectively, for every 1°C increase in panel surface temperature. On the other hand, the short circuit current increases with the increase in surface temperature at the rate of 0.09%/°C.

  8. Fuzzy Logic Based MPPT Controller for a PV System

    Directory of Open Access Journals (Sweden)

    Carlos Robles Algarín

    2017-12-01

    Full Text Available The output power of a photovoltaic (PV module depends on the solar irradiance and the operating temperature; therefore, it is necessary to implement maximum power point tracking controllers (MPPT to obtain the maximum power of a PV system regardless of variations in climatic conditions. The traditional solution for MPPT controllers is the perturbation and observation (P&O algorithm, which presents oscillation problems around the operating point; the reason why improving the results obtained with this algorithm has become an important goal to reach for researchers. This paper presents the design and modeling of a fuzzy controller for tracking the maximum power point of a PV System. Matlab/Simulink (MathWorks, Natick, MA, USA was used for the modeling of the components of a 65 W PV system: PV module, buck converter and fuzzy controller; highlighting as main novelty the use of a mathematical model for the PV module, which, unlike diode based models, only needs to calculate the curve fitting parameter. A P&O controller to compare the results obtained with the fuzzy control was designed. The simulation results demonstrated the superiority of the fuzzy controller in terms of settling time, power loss and oscillations at the operating point.

  9. Review of Artificial Abrasion Test Methods for PV Module Technology

    Energy Technology Data Exchange (ETDEWEB)

    Miller, David C. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Muller, Matt T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Simpson, Lin J. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-08-01

    This review is intended to identify the method or methods--and the basic details of those methods--that might be used to develop an artificial abrasion test. Methods used in the PV literature were compared with their closest implementation in existing standards. Also, meetings of the International PV Quality Assurance Task Force Task Group 12-3 (TG12-3, which is concerned with coated glass) were used to identify established test methods. Feedback from the group, which included many of the authors from the PV literature, included insights not explored within the literature itself. The combined experience and examples from the literature are intended to provide an assessment of the present industry practices and an informed path forward. Recommendations toward artificial abrasion test methods are then identified based on the experiences in the literature and feedback from the PV community. The review here is strictly focused on abrasion. Assessment methods, including optical performance (e.g., transmittance or reflectance), surface energy, and verification of chemical composition were not examined. Methods of artificially soiling PV modules or other specimens were not examined. The weathering of artificial or naturally soiled specimens (which may ultimately include combined temperature and humidity, thermal cycling and ultraviolet light) were also not examined. A sense of the purpose or application of an abrasion test method within the PV industry should, however, be evident from the literature.

  10. Performance evaluation of stand alone hybrid PV-wind generator

    Energy Technology Data Exchange (ETDEWEB)

    Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H. [Faculty of Electrical Engineering, Universiti Teknikal Malaysia Melaka (UTeM), Hang Tuah Jaya, 76100 Melaka (Malaysia); Yahaya, M. S. [Faculty of Engineering Technology, Universiti Teknikal Malaysia Melaka (UTeM), Hang Tuah Jaya, 76100 Melaka (Malaysia)

    2015-05-15

    This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand.

  11. Residential Solar PV Systems in the Carolinas: Opportunities and Outcomes.

    Science.gov (United States)

    Alqahtani, Bandar Jubran; Holt, Kyra Moore; Patiño-Echeverri, Dalia; Pratson, Lincoln

    2016-02-16

    This paper presents a first-order analysis of the feasibility and technical, environmental, and economic effects of large levels of solar photovoltaic (PV) penetration within the services areas of the Duke Energy Carolinas (DEC) and Duke Energy Progress (DEP). A PV production model based on household density and a gridded hourly global horizontal irradiance data set simulates hourly PV power output from roof-top installations, while a unit commitment and real-time economic dispatch (UC-ED) model simulates hourly system operations. We find that the large generating capacity of base-load nuclear power plants (NPPs) without ramping capability in the region limits PV integration levels to 5.3% (6510 MW) of 2015 generation. Enabling ramping capability for NPPs would raise the limit of PV penetration to near 9% of electricity generated. If the planned retirement of coal-fired power plants together with new installations and upgrades of natural gas and nuclear plants materialize in 2025, and if NPPs operate flexibly, then the share of coal-fired electricity will be reduced from 37% to 22%. A 9% penetration of electricity from PV would further reduce the share of coal-fired electricity by 4-6% resulting in a system-wide CO2 emissions rate of 0.33 to 0.40 tons/MWh and associated abatement costs of 225-415 (2015$ per ton).

  12. Training and certification of PV installers in Europe

    International Nuclear Information System (INIS)

    Tsoutsos, Theocharis; Tournaki, Stavroula; Gkouskos, Zacharias; Masson, Gaetan; Holden, John; Huidobro, Ana; Stoykova, Evelina; Rata, Camelia; Bacan, Andro; Maxoulis, Christos; Charalambous, Anthi

    2013-01-01

    The European strategy for the coming decades sets specific targets for a sustainable growth, including reaching a 20% share of renewables in final energy consumption till 2020. To achieve this target, a number of initiatives and measures have been in force. Europe, is currently the largest market for PV systems with more than 75% of the annual worldwide installations in 2011. The favourable European policies as well as the Member States’ supporting legislations have resulted in high market growth for photovoltaics. Applying PV technologies however, requires high qualified technicians to install, repair and maintain them. Until today, national markets have been growing faster than the skilled PV installers force can satisfy. The PVTRIN, an Intelligent Energy Europe action, addresses these issues by developing a training and certification scheme for technicians active in the installation and maintenance of small scale PV systems. During the implementation of the action, a market research was conducted in the six participating countries in order to record the stakeholders’ attitudes, perceptions and considerations and to adapt the training methods, tools and materials to the national PV industry requirements and markets’ needs. Indicative results of this analysis as well as the current situation regarding relevant training and certification schemes are presented in this paper. - Highlights: ► Market research in six EU countries on PV professional Training and Certification needs. ► PVTRIN scheme integrates the national legislations and the market's needs. ► The different aspects (technical, institutional, financial) are presented

  13. Performance evaluation of stand alone hybrid PV-wind generator

    Science.gov (United States)

    Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H.; Yahaya, M. S.

    2015-05-01

    This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand.

  14. Performance evaluation of stand alone hybrid PV-wind generator

    International Nuclear Information System (INIS)

    Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H.; Yahaya, M. S.

    2015-01-01

    This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand

  15. PVMirrors: Hybrid PV/CSP collectors that enable lower LCOEs

    Science.gov (United States)

    Fisher, Kate; Yu, Zhengshan Jason; Striling, Rob; Holman, Zachary

    2017-06-01

    The primary challenge with concentrating solar power (CSP) is that the conversion efficiency is low—and the cost high—compared to that of photovoltaics (PV), and the primary challenge with PV is that the energy generated cannot be stored cost effectively. We introduce a technology that hybridizes CSP and PV, resulting in power plants with high energy conversion efficiency and affordable storage. This is accomplished by replacing silvered troughs (or heliostat facets) with "PVMirrors" that and direct photons of each wavelength to the converter (PV or thermal) that may best use them. A PVMirror looks like a curved PV module that includes a spectrum-splitting dichroic mirror film; this film, which is the heart of the technology, transmits near-infrared light to the underlying silicon PV cells while reflecting both longer and shorter wavelengths to a thermal absorber tube. This paper investigates the optical performance of dichroic mirror film, the specularity of PVMirrors, and the anticipated levelized cost of energy (LCOE) from a PVMirror power plant. PVMirrors are found to decrease LCOE by more than 15% relative to CSP while retaining full dispatchability.

  16. Review of PV Inverter Technology Cost and Performance Projections

    Energy Technology Data Exchange (ETDEWEB)

    Navigant Consulting Inc.

    2006-01-01

    The National Renewable Energy Laboratory (NREL) has a major responsibility in the implementation of the U.S. Department of Energy's (DOE's) Solar Energy Technologies Program. Sandia National Laboratories (SNL) has a major role in supporting inverter development, characterization, standards, certifications, and verifications. The Solar Energy Technologies Program recently published a Multiyear Technical Plan, which establishes a goal of reducing the Levelized Energy Cost (LEC) for photovoltaic (PV) systems to $0.06/kWh by 2020. The Multiyear Technical Plan estimates that, in order to meet the PV system goal, PV inverter prices will need to decline to $0.25-0.30 Wp by 2020. DOE determined the need to conduct a rigorous review of the PV Program's technical and economic targets, including the target set for PV inverters. NREL requested that Navigant Consulting Inc.(NCI) conduct a review of historical and projected cost and performance improvements for PV inverters, including identification of critical barriers identified and the approaches government might use to address them.

  17. Continuing Developments in PV Risk Management: Strategies, Solutions, and Implications

    Energy Technology Data Exchange (ETDEWEB)

    Lowder, T.; Mendelsohn, M.; Speer, B.; Hill, R.

    2013-02-01

    As the PV industry matures, successful risk management practices will become more imperative to ensure investor confidence, control costs, and facilitate further growth. This report discusses several key aspects of risk management during the commercial- and utility-scale project life cycle, from identification of risks, to the process of mitigating and allocating those risks among project parties, to transferring those risks through insurance. The report also explores novel techniques in PV risk management, options to offload risks onto the capital markets, and innovative insurance policies (namely warranty policies) that address risks unique to the PV sector. One of the major justifications for robust risk management in the PV industry is the cost-reduction opportunities it affords. If the PV industry can demonstrate the capability to successfully manage its risks, thereby inspiring confidence in financiers, it may be able to obtain a lower cost of capital in future transactions. A lower cost of capital translates to a lower cost of energy, which will in turn enhance PV?s competitiveness at a time when it will have to rely less on subsidies to support its market penetration.

  18. Control Strategies for the DAB Based PV Interface System.

    Directory of Open Access Journals (Sweden)

    Hadi M El-Helw

    Full Text Available This paper presents an interface system based on the Dual Active Bridge (DAB converter for Photovoltaic (PV arrays. Two control strategies are proposed for the DAB converter to harvest the maximum power from the PV array. The first strategy is based on a simple PI controller to regulate the terminal PV voltage through the phase shift angle of the DAB converter. The Perturb and Observe (P&O Maximum Power Point Tracking (MPPT technique is utilized to set the reference of the PV terminal voltage. The second strategy presented in this paper employs the Artificial Neural Network (ANN to directly set the phase shift angle of the DAB converter that results in harvesting maximum power. This feed-forward strategy overcomes the stability issues of the feedback strategy. The proposed PV interface systems are modeled and simulated using MATLAB/SIMULINK and the EMTDC/PSCAD software packages. The simulation results reveal accurate and fast response of the proposed systems. The dynamic performance of the proposed feed-forward strategy outdoes that of the feedback strategy in terms of accuracy and response time. Moreover, an experimental prototype is built to test and validate the proposed PV interface system.

  19. Control Strategies for the DAB Based PV Interface System.

    Science.gov (United States)

    El-Helw, Hadi M; Al-Hasheem, Mohamed; Marei, Mostafa I

    2016-01-01

    This paper presents an interface system based on the Dual Active Bridge (DAB) converter for Photovoltaic (PV) arrays. Two control strategies are proposed for the DAB converter to harvest the maximum power from the PV array. The first strategy is based on a simple PI controller to regulate the terminal PV voltage through the phase shift angle of the DAB converter. The Perturb and Observe (P&O) Maximum Power Point Tracking (MPPT) technique is utilized to set the reference of the PV terminal voltage. The second strategy presented in this paper employs the Artificial Neural Network (ANN) to directly set the phase shift angle of the DAB converter that results in harvesting maximum power. This feed-forward strategy overcomes the stability issues of the feedback strategy. The proposed PV interface systems are modeled and simulated using MATLAB/SIMULINK and the EMTDC/PSCAD software packages. The simulation results reveal accurate and fast response of the proposed systems. The dynamic performance of the proposed feed-forward strategy outdoes that of the feedback strategy in terms of accuracy and response time. Moreover, an experimental prototype is built to test and validate the proposed PV interface system.

  20. Examples of successful architectural integration of PV: Germany

    International Nuclear Information System (INIS)

    Hagemann, I.B.

    2004-01-01

    In Germany building-integrated photovoltaics (BIPV) are developing rapidly, and much progress has been achieved in the past five years. BIPV can be used today in different ways on both existing and new buildings. Architects and designers are discovering BIPV. With the help of custom-made products available on the German market they are beginning to explore the technical limits of an aesthetic and structural integration of PV in buildings. As a result some exciting high-profile building projects with PV have been built, for example, the small service pavilion Meereslauschen in Steinhude or the new headquarters building of the Wood Trade Association in Munich. These projects show that the use of PV is very varied and offers opportunities for creative architects. However non-technical problems still need to be solved to allow a meaningful and widespread application of PV in the built environment. To decrease costs it is essential to develop further standard BIPV components. The aim of such developments should be to replace standard PV modules by products in which PV and structural building elements are melded into one design and structural unit. (author)

  1. Lifetime Evaluation of Grid-Connected PV Inverters Considering Panel Degradation Rates and Installation Sites

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2018-01-01

    Lifetime of PV inverters is affected by the installation sites related to different solar irradiance and ambient temperature profiles (also referred to as mission profiles). In fact, the installation site also affects the degradation rate of the PV panels, and thus long-term energy production...... and reliability. Prior-art lifetime analysis in PV inverters has not yet investigated the impact of PV panel degradations. This paper thus evaluates the lifetime of PV inverters considering panel degradation rates and mission profiles. Evaluations have been carried out on PV systems installed in Denmark...... and Arizona. The results reveal that the PV panel degradation rate has a considerable impact on the PV inverter lifetime, especially in the hot climate (e.g., Arizona), where the panel degrades at a faster rate. In that case, the PV inverter lifetime prediction can be deviated by 54%, if the impact of PV...

  2. NCBI nr-aa BLAST: CBRC-DNOV-01-1305 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1305 ref|NP_640667.1| vanillate O-demethylase oxygenase subunit [Xanth...omonas axonopodis pv. citri str. 306] gb|AAM35203.1| vanillate O-demethylase oxygenase subunit [Xanthomonas axonopodis pv. citri str. 306] NP_640667.1 5.1 38% ...

  3. Large scale PV plants - also in Denmark. Project report

    Energy Technology Data Exchange (ETDEWEB)

    Ahm, P. (PA Energy, Malling (Denmark)); Vedde, J. (SiCon. Silicon and PV consulting, Birkeroed (Denmark))

    2011-04-15

    Large scale PV (LPV) plants, plants with a capacity of more than 200 kW, has since 2007 constituted an increasing share of the global PV installations. In 2009 large scale PV plants with cumulative power more that 1,3 GWp were connected to the grid. The necessary design data for LPV plants in Denmark are available or can be found, although irradiance data could be improved. There seems to be very few institutional barriers for LPV projects, but as so far no real LPV projects have been processed, these findings have to be regarded as preliminary. The fast growing number of very large scale solar thermal plants for district heating applications supports these findings. It has further been investigated, how to optimize the lay-out of LPV plants. Under the Danish irradiance conditions with several winter months with very low solar height PV installations on flat surfaces will have to balance the requirements of physical space - and cost, and the loss of electricity production due to shadowing effects. The potential for LPV plants in Denmark are found in three main categories: PV installations on flat roof of large commercial buildings, PV installations on other large scale infrastructure such as noise barriers and ground mounted PV installations. The technical potential for all three categories is found to be significant and in the range of 50 - 250 km2. In terms of energy harvest PV plants will under Danish conditions exhibit an overall efficiency of about 10 % in conversion of the energy content of the light compared to about 0,3 % for biomass. The theoretical ground area needed to produce the present annual electricity consumption of Denmark at 33-35 TWh is about 300 km2 The Danish grid codes and the electricity safety regulations mention very little about PV and nothing about LPV plants. It is expected that LPV plants will be treated similarly to big wind turbines. A number of LPV plant scenarios have been investigated in detail based on real commercial offers and

  4. Solar Photovoltaic (PV) Distributed Generation Systems - Control and Protection

    Science.gov (United States)

    Yi, Zhehan

    This dissertation proposes a comprehensive control, power management, and fault detection strategy for solar photovoltaic (PV) distribution generations. Battery storages are typically employed in PV systems to mitigate the power fluctuation caused by unstable solar irradiance. With AC and DC loads, a PV-battery system can be treated as a hybrid microgrid which contains both DC and AC power resources and buses. In this thesis, a control power and management system (CAPMS) for PV-battery hybrid microgrid is proposed, which provides 1) the DC and AC bus voltage and AC frequency regulating scheme and controllers designed to track set points; 2) a power flow management strategy in the hybrid microgrid to achieve system generation and demand balance in both grid-connected and islanded modes; 3) smooth transition control during grid reconnection by frequency and phase synchronization control between the main grid and microgrid. Due to the increasing demands for PV power, scales of PV systems are getting larger and fault detection in PV arrays becomes challenging. High-impedance faults, low-mismatch faults, and faults occurred in low irradiance conditions tend to be hidden due to low fault currents, particularly, when a PV maximum power point tracking (MPPT) algorithm is in-service. If remain undetected, these faults can considerably lower the output energy of solar systems, damage the panels, and potentially cause fire hazards. In this dissertation, fault detection challenges in PV arrays are analyzed in depth, considering the crossing relations among the characteristics of PV, interactions with MPPT algorithms, and the nature of solar irradiance. Two fault detection schemes are then designed as attempts to address these technical issues, which detect faults inside PV arrays accurately even under challenging circumstances, e.g., faults in low irradiance conditions or high-impedance faults. Taking advantage of multi-resolution signal decomposition (MSD), a powerful signal

  5. The prospects for cost competitive solar PV power

    International Nuclear Information System (INIS)

    Reichelstein, Stefan; Yorston, Michael

    2013-01-01

    New solar Photovoltaic (PV) installations have grown globally at a rapid pace in recent years. We provide a comprehensive assessment of the cost competitiveness of this electric power source. Based on data available for the second half of 2011, we conclude that utility-scale PV installations are not yet cost competitive with fossil fuel power plants. In contrast, commercial-scale installations have already attained cost parity in the sense that the generating cost of power from solar PV is comparable to the retail electricity prices that commercial users pay, at least in certain parts of the U.S. This conclusion is shown to depend crucially on both the current federal tax subsidies for solar power and an ideal geographic location for the solar installation. Projecting recent industry trends into the future, we estimate that utility-scale solar PV facilities are on track to become cost competitive by the end of this decade. Furthermore, commercial-scale installations could reach “grid parity” in about ten years, if the current federal tax incentives for solar power were to expire at that point. - Highlights: ► Assessment of the cost competitiveness of new solar Photovoltaic (PV) installations. ► Utility-scale PV installations are not yet cost competitive with fossil fuel power plants. ► Commercial-scale installations have already attained cost parity in certain parts of the U.S. ► Utility-scale solar PV facilities are on track to become cost competitive by the end of this decade

  6. Is rooftop solar PV at socket parity without subsidies?

    International Nuclear Information System (INIS)

    Hagerman, Shelly; Jaramillo, Paulina; Morgan, M. Granger

    2016-01-01

    Installations of rooftop solar photovoltaic (PV) technology in the United States have increased dramatically in recent years, in large part because of state and federal subsidies. In the future, such subsidies may be reduced or eliminated. From the homeowner's perspective, solar PV is competitive when it can produce electricity at a cost equivalent to the retail electricity rate, a condition sometimes referred to as “socket parity”. In assessing the economic viability of residential solar PV, most existing literature considers only a few locations and fails to consider the differences in PV system cost and electricity prices that exist across the U.S. We combined insolation data from more than 1000 locations, installation costs by region, and county-level utility rates to provide a more complete economic assessment of rooftop solar PV across the U.S. We calculated the break-even electricity prices and evaluated the reductions in installed costs needed to reach socket parity. Among the scenarios considered, we estimate that only Hawaii has achieved socket parity without the use of subsidies. With subsidies, six states reach socket parity, yet widespread parity is still not achieved. We find that high installation costs and financing rates are two of the largest barriers to socket parity. - Highlights: • We evaluate the economic viability of residential rooftop solar PV across the U.S. • Widespread socket parity has not been achieved in the U.S. without subsidies. • Net metering may be critical for the economic viability of rooftop solar PV.

  7. Plug and Play PV Systems for American Homes

    Energy Technology Data Exchange (ETDEWEB)

    Hoepfner, Christian [Fraunhofer USA, Inc., Boston, MA (United States)

    2016-12-22

    The core objectives of the Plug & Play PV Systems Project were to develop a PV system that can be installed on a residential rooftop for less than $1.50/W in 2020, and in less than 10 hours (from point of purchase to commissioning). The Fraunhofer CSE team’s approach to this challenge involved a holistic approach to system design – hardware and software – that make Plug & Play PV systems: • Quick, easy, and safe to install • Easy to demonstrate as code compliant • Permitted, inspected, and interconnected via an electronic process Throughout the three years of work during this Department of Energy SunShot funded project, the team engaged in a substantive way with inspectional services departments and utilities, manufacturers, installers, and distributors. We received iterative feedback on the system design and on ideas for how such systems can be commercialized. This ultimately led us to conceiving of Plug & Play PV Systems as a framework, with a variety of components compatible with the Plug & Play PV approach, including string or microinverters, conventional modules or emerging lightweight modules. The framework enables a broad group of manufacturers to participate in taking Plug & Play PV Systems to market, and increases the market size for such systems. Key aspects of the development effort centered on the system hardware and associated engineering work, the development of a Plug & Play PV Server to enable the electronic permitting, inspection and interconnection process, understanding the details of code compliance and, on occasion, supporting applications for modifications to the code to allow lightweight modules, for example. We have published a number of papers on our testing and assessment of novel technologies (e.g., adhered lightweight modules) and on the electronic architecture.

  8. PV-BUK: Operating and maintenance costs of photovoltaic installations; PV-BUK - Betriebs- und Unterhaltskosten von PV-Anlagen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Stettler, S.; Toggweiler, P. [Enecolo AG, Moenchaltorf (Switzerland); Ruoss, D.; Schudel, P. [Envision, Lucerne (Switzerland); Kottmann, A.; Steinle, F. [BE Netz AG, Lucerne (Switzerland)

    2008-03-15

    This final report elaborated for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a project carried out to determine the costs for facility management, to estimate future cost development and to propose activities for the further reduction of the operation and maintenance costs of photovoltaic systems. Information on the cost situation was collected by literature study, as well as in interviews and surveys with photovoltaic (PV) experts and the owners of PV installations. The discussion of the results at a workshop with about 20 Swiss PV experts is noted. The results are presented and discussed. These show that operating costs per kWh decrease with the size of the PV system. Figures are quoted. The major part of the costs are quoted as being those for spare parts, especially for the inverter. The authors are of the opinion that, in future, costs for facility management will further decrease, as they are partly linked to capital and insurance costs. Potential for optimisation is said to exist in several areas of facility management such as, for example, in system monitoring and fast reaction in the case of malfunctions.

  9. Ação de tinturas e óleos essenciais de plantas medicinais sobre o crestamento bacteriano comum do feijoeiro e na produção de proteínas de indução de resistência

    Directory of Open Access Journals (Sweden)

    Sandra Cristina Vigo

    2009-12-01

    Full Text Available A exploração da atividade biológica de compostos secundários presentes nas tinturas ou em óleos essenciais de plantas podem representar, ao lado da indução de resistência, mais uma forma potencial de controle de doenças em plantas cultivadas. O presente trabalho objetivou avaliar o potencial de tinturas de Lippia alba, Lippia sidoides, Mikania glomerata, Equisetum sp. e Hedera helix e óleos essenciais de Rosmarinus officinalis e Cinnamomum zeylanicum nas atividades in vitro, in vivo e na produção de proteínas na indução de resistência, em plantas de feijão vagem cultivar Bragança. Os resultados obtidos demonstraram que as tinturas de L. alba e L. sidoides e os óleos essenciais (R. officinalis e C. zeylanicum apresentaram atividade in vitro aos isolados de Xanthomonas axonopodis pv. phaseoli. Todas as tinturas ensaiadas apresentaram menores valores do progresso da doença (AACPD, em relação à testemunha, merecendo destaque a tintura de L. alba, que estavam correlacionadas com os maiores teores de polifenoloxidase, peroxidase e proteínas solúveis totais, evidenciando uma possível indução de resistência. Os óleos essenciais não apresentaram diferença na AACPD e nem na indução de proteínas.Additionally to resistance inducers, the exploitation of secondary compounds biological activity present in plants alcohol extracts or essential oils could potential way to control diseases in cultivated plants. This aimed to evaluate the potential of Lippia alba, Lippia sidoides, Mikania glomerata, Equisetum sp. and Hedera helix alcohol extracts and, Rosmarinus officinalis and Cinnamomum zeylanicum essential oils on in vitro and in vivo activity, and protein production on resistance induction in snap beans Bragança cultivar. Results showed in vitro activity against Xanthomonas axonopodis pv. phaseoli for L. alba and L. sidoides extracts, and essential oils. Although all alcohol extracts have showed the lowest area under the

  10. Evaluation of pyraclostrobin and acibenzolar-S-methyl on common bacterial blight of snap beanAvaliação de pyraclostrobin e acibenzolar-S-methyl sobre o crestamento bacteriano comum do feijão-vagem

    Directory of Open Access Journals (Sweden)

    Renata de Cássia Camara

    2012-04-01

    Full Text Available Assays were done under greenhouse conditions in order to evaluate the effect of pyraclostrobin (0.0375, 0.0750 and 0.150 mL.L-1 and acibenzolar-S-methyl (ASM (0.025 g.L-1 in common bacterial blight, using leaves of snap beans cultivar Bragança. These chemicals were sprayed at three different times: five days before; five days before + five days after; and five days after leaf inoculation with an isolate of Xanthomonas axonopodis pv. phaseoli. They were determinate the levels of polyphenoloxidase, peroxidase and total soluble proteins on inoculated and non-inoculated leaves of snap beans sprayed with pyraclostrobin (0.075 g.L-1 and ASM (0.025 g.L-1. All concentration of pyraclostrobin and ASM reduced the area under the disease progress curve (AUDPC on leaves of snap beans, and the least AUDPC value was observed when this products were sprayed five days before + five days after inoculation. Higher levels of polyphenoloxidase, peroxidase and the total soluble proteins were observed on leaves sprayed with pyraclostrobin or ASM.Ensaios foram conduzidos sob condições de casa-de-vegetação para avaliar o efeito de pyraclostrobin (0,0375; 0.0750 e 0,150 mL.L-1 e acibenzolar-S-methyl (ASM (0.025 g.L-1 sobre o crestamento bacteriano comum, em folhas de feijão-vagem cultivar Bragança. Os produtos foram pulverizados em três diferentes períodos: cinco dias antes, cinco dias antes + cinco dias após e cinco dias após a inoculação dos folíolos com um isolado de Xanthomonas axonopodis pv. phaseoli. Foram determinados os teores de polifenoloxidase, peroxidase e proteínas solúveis totais em folhas inoculadas e não-inoculadas de feijão-vagem pulverizadas com pyraclostrobin (0,075 g.L-1 e ASM (0,025 g.L-1. Todas as concentrações de pyraclostrobin e ASM reduziram os valores da área abaixo da curva do progresso da doença (AUPDC e o menor valor da AUPDC foi observado para a aplicação dos produtos cinco dias antes + cinco dias após a inocula

  11. Performance of a PV module augmented by a plane reflector

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, G. E; Hussein, H. M. S; Mohamad, M. A [Dokki, Giza (Egypt)

    2000-07-01

    This paper presents a comparative experimental study on the performance of a PV module augmented by a south facing titled plane reflector and another identical one without reflector. The tilt angles of the two PV modules and reflector overhang are selected to be according to a previous theoretical study by the authors. The reflector tilt angle has been changed once a month so that the reflected beams from the plane reflector cover the total surface area of the PV module all days of every month during the high solar radiation period (i.e. three hours before and after solar noon). The study has been carried out on the two PV modules for a complete year under the actual atmospheric conditions of Cairo, Egypt. The measuring system used in the study comprises a data acquisition system, a computer, an electronic load and weather station. The experimental results indicate that the plane reflector enhances the yearly output energy of the PV module y about 22%. [Spanish] Este articulo presenta un estudio comparativo experimental sobre el rendimiento de un modulo de PV aumentado por un reflector plano inclinado mirando hacia el sur y otro identico sin reflector. Los angulos de inclinacion de los dos modulos y el reflector sobresaliente se seleccionan para que esten de acuerdo con un estudio teorico previo hecho por los autores. El angulo de inclinacion del reflector se cambio una vez al mes de manera que los rayos reflejados por el reflector plano cubrieran el area total de la superficie del modulo de PV todos los dias de cada mes durante el periodo de radiacion alto (o sea tres horas antes y despues del medio dia solar). El estudio ha sido llevado a cabo en dos modulos de PV durante un ano completo bajo condiciones atmosfericas reales de El Cairo, Egipto. El sistema de medicion usado en el estudio comprende un sistema de adquisicion de datos, una computadora, una memoria electronica y una estacion climatologica. Los resultados experimentales indican que el reflector plano

  12. Lifetime Evaluation of PV Inverters considering Panel Degradation Rates and Installation Sites

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2017-01-01

    The PV inverter lifetime is affected by the installed sites related to different solar irradiance and ambient temperature profiles. In fact, the installation site also affects the PV panel degradation rate, and thus the long-term power production. Prior-art lifetime analysis in PV inverters has...... not yet investigated the impact of panel degradation. This paper thus evaluates the lifetime of PV inverters considering panel degradation rates and installation sites. Evaluations have been carried out on PV systems installed in Denmark and Arizona. The results reveal that the PV panel degradation rate...... has a considerable impact on the PV inverter lifetime, especially in the hot climate (e.g., Arizona), where the panel degrades at a faster rate. In that case, the PV inverter lifetime estimation can be deviated by 54%, if the impact of PV panel degradation is not taken into account....

  13. Methods for the Optimal Design of Grid-Connected PV Inverters

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2011-01-01

    and the efficient processing of this power by the DC/AC inverter. In this paper two new methods are presented for the optimal design of a PV inverter power section, output filter and MPPT control strategy. The influences of the electric grid regulations and standards as well as the PV array operational......The DC/AC inverters are used in grid-connected PV energy production systems as the power processing interface between the PV energy source and the electric grid. The energy injected into the electric grid by the PV installation depends on the amount of power extracted from the PV power source...... characteristics on the design of grid-connected PV inverters have been considered. The proposed methods have been applied for the optimal design of PV inverters installed at various sites in Europe. The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy...

  14. Solar Plus: A Holistic Approach to Distributed Solar PV

    Energy Technology Data Exchange (ETDEWEB)

    O' Shaughnessy, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ardani, Kristen [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cutler, Dylan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-05-25

    Solar 'plus' refers to an emerging approach to distributed solar photovoltaic (PV) deployment that uses energy storage and controllable devices to optimize customer economics. The solar plus approach increases customer system value through technologies such as electric batteries, smart domestic water heaters, smart air-conditioner (AC) units, and electric vehicles We use an NREL optimization model to explore the customer-side economics of solar plus under various utility rate structures and net metering rates. We explore optimal solar plus applications in five case studies with different net metering rates and rate structures. The model deploys different configurations of PV, batteries, smart domestic water heaters, and smart AC units in response to different rate structures and customer load profiles. The results indicate that solar plus improves the customer economics of PV and may mitigate some of the negative impacts of evolving rate structures on PV economics. Solar plus may become an increasingly viable model for optimizing PV customer economics in an evolving rate environment.

  15. Thermal modelling of PV module performance under high ambient temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C.; Harrison, S.J. [Queen' s Univ., Kingston, ON (Canada). Dept. of Mechanical and Materials Engineering Solar Calorimetry Lab; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering

    2005-07-01

    When predicting the performance of photovoltaic (PV) generators, the actual performance is typically lower than test results conducted under standard test conditions because the radiant energy absorbed in the module under normal operation raises the temperature of the cell and other multilayer components. The increase in temperature translates to a lower conversion efficiency of the solar cells. In order to address these discrepancies, a thermal model of a characteristic PV module was developed to assess and predict its performance under real field-conditions. The PV module consisted of monocrystalline silicon cells in EVA between a glass cover and a tedlar backing sheet. The EES program was used to compute the equilibrium temperature profile in the PV module. It was shown that heat is dissipated towards the bottom and the top of the module, and that its temperature can be much higher than the ambient temperature. Modelling results indicate that 70-75 per cent of the absorbed solar radiation is dissipated from the solar cells as heat, while 4.7 per cent of the solar energy is absorbed in the glass cover and the EVA. It was also shown that the operating temperature of the PV module decreases with increased wind speed. 2 refs.

  16. Modelling of flow and heat transfer in PV cooling channels

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C.; Harrison, S.J. [Queen' s Univ., Kingston, ON (Canada). Dept. of Mechanical and Materials Engineering Solar Calorimetry Lab; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering

    2005-07-01

    Under sunny conditions, the temperature of photovoltaic (PV) modules can be 20 to 30 degrees C above the ambient air temperature. This affects the performance of PV modules, particularly in regions with hot climates. For silicon solar cells, the maximum power decreases between 0.4 and 0.5 per cent for every degree C of temperature increase above a reference value. In an effort to address this issue, this experimental and numerical study examined an active PV panel evaporative cooling scheme that is typically used in hot arid climates. The cooling system circulated cool air behind the PV modules, extracting heat and lowering solar cell temperature. A fluid dynamic and thermal model of the combined system was developed using the EES program in order to study the configuration of the cooling channel and the characteristics of the cooling flow. Heat transfer and flow characteristics in the cooling channel were then calculated along with pressure drop and fan power associated with the air-circulation. The net power output was also calculated. The objective was to design a cost efficient cooling system and to optimize its flow and pressure drop in order to maximize power output. The study demonstrated how the performance of the PV panel is influenced by the geometry of the cooling channel, the inlet air temperature and the air flow rate. 2 refs.

  17. Modelling PV modules' performance in Sahelian climates

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C.; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering

    2003-08-01

    This paper describes the development of a thermo-optical model designed to evaluate the temperature of a photovoltaic (PV) module in an effort to design a cost-effective cooling system for PV modules operating under high ambient temperatures. The power output of a PV module is greatly reduced when its temperature rises. This loss in efficiency is particularly significant in Sahelian regions where PV modules are subjected to high solar radiation intensities and high ambient temperatures. The newly developed thermo-optical model confirms that most of the heat in a PV module is generated in the solar cell. The results of the analysis include: the optical absorption, reflection and transmission of the solar radiation incident on the module; the temperature distribution in the module; and, the heat transfer through the top and bottom of the module. At incidence angles of 60 degrees, approximately three-quarters of the heat is generated in the solar cell. The optical efficiency is 88.44 per cent at normal incidence angle and 82.48 per cent when the incidence angle is 60 degrees. It was determined that the cooling system should be located as close as possible to the solar cell in order to increase the thermal heat flow from the cell. 4 refs., 3 tabs., 4 figs.

  18. Solar cell junction temperature measurement of PV module

    KAUST Repository

    Huang, B.J.

    2011-02-01

    The present study develops a simple non-destructive method to measure the solar cell junction temperature of PV module. The PV module was put in the environmental chamber with precise temperature control to keep the solar PV module as well as the cell junction in thermal equilibrium with the chamber. The open-circuit voltage of PV module Voc is then measured using a short pulse of solar irradiation provided by a solar simulator. Repeating the measurements at different environment temperature (40-80°C) and solar irradiation S (200-1000W/m2), the correlation between the open-circuit voltage Voc, the junction temperature Tj, and solar irradiation S is derived.The fundamental correlation of the PV module is utilized for on-site monitoring of solar cell junction temperature using the measured Voc and S at a short time instant with open circuit. The junction temperature Tj is then determined using the measured S and Voc through the fundamental correlation. The outdoor test results show that the junction temperature measured using the present method, Tjo, is more accurate. The maximum error using the average surface temperature Tave as the junction temperature is 4.8 °C underestimation; while the maximum error using the present method is 1.3 °C underestimation. © 2010 Elsevier Ltd.

  19. Solar Plus: A Holistic Approach to Distributed Solar PV

    Energy Technology Data Exchange (ETDEWEB)

    OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ardani, Kristen B. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Cutler, Dylan S. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-06-08

    Solar 'plus' refers to an emerging approach to distributed solar photovoltaic (PV) deployment that uses energy storage and controllable devices to optimize customer economics. The solar plus approach increases customer system value through technologies such as electric batteries, smart domestic water heaters, smart air-conditioner (AC) units, and electric vehicles We use an NREL optimization model to explore the customer-side economics of solar plus under various utility rate structures and net metering rates. We explore optimal solar plus applications in five case studies with different net metering rates and rate structures. The model deploys different configurations of PV, batteries, smart domestic water heaters, and smart AC units in response to different rate structures and customer load profiles. The results indicate that solar plus improves the customer economics of PV and may mitigate some of the negative impacts of evolving rate structures on PV economics. Solar plus may become an increasingly viable model for optimizing PV customer economics in an evolving rate environment.

  20. PV Reconfiguration Systems: a Technical and Economic Study

    Directory of Open Access Journals (Sweden)

    Caruso M.

    2017-03-01

    Full Text Available Dynamical electrical array reconfiguration strategies for grid-connected PV systems have been proposed as solution to improve energy production due to the mismatch effect of PV plants during partial shading conditions. Strategies are based on the use of dynamic connections between PV panels given by the employment of switches that allow for each panel the series, parallel or exclusion connections, physically changing the electrical connections between the related PV modules, consequentially modifying the layout of the plant. Usually the cost of the dynamic matrix is not taken into account. This novel work evaluates the economic advantages obtained by the use of reconfiguration strategies in PV systems, by taking into consideration the price of energy due to incentives in different European and non-European countries and correlates it with the employment of two types of reconfigurators, with different internal structures. For each of the incentives proposed by the different Countries, the main strength and weakness points of the possible investment are highlighted and critically analyzed. From this analysis, it can be stated that the adoption of reconfiguration systems, in certain cases, can be a very convenient solution.

  1. Design of direct solar PV driven air conditioner

    KAUST Repository

    Huang, Bin-Juine

    2015-12-05

    © 2015 Elsevier Ltd. Solar air conditioning system directly driven by stand-alone solar PV is studied. The air conditioning system will suffer from loss of power if the solar PV power generation is not high enough. It requires a proper system design to match the power consumption of air conditioning system with a proper PV size. Six solar air conditioners with different sizes of PV panel and air conditioners were built and tested outdoors to experimentally investigate the running probabilities of air conditioning at various solar irradiations. It is shown that the instantaneous operation probability (OPB) and the runtime fraction (RF) of the air conditioner are mainly affected by the design parameter rpL (ratio of maximum PV power to load power). The measured OPB is found to be greater than 0.98 at instantaneous solar irradiation IT > 600 W m-2 if rpL > 1.71 RF approaches 1.0 (the air conditioner is run in 100% with solar power) at daily-total solar radiation higher than 13 MJ m-2 day-1, if rpL > 3.

  2. Thermal performances of vertical hybrid PV/T air collector

    Science.gov (United States)

    Tabet, I.; Touafek, K.; Bellel, N.; Khelifa, A.

    2016-11-01

    In this work, numerical analyses and the experimental validation of the thermal behavior of a vertical photovoltaic thermal air collector are investigated. The thermal model is developed using the energy balance equations of the PV/T air collector. Experimental tests are conducted to validate our mathematical model. The tests are performed in the southern Algerian region (Ghardaïa) under clear sky conditions. The prototype of the PV/T air collector is vertically erected and south oriented. The absorber upper plate temperature, glass cover temperature, air temperature in the inlet and outlet of the collector, ambient temperature, wind speed, and solar radiation are measured. The efficiency of the collector increases with increase in mass flow of air, but the increase in mass flow of air reduces the temperature of the system. The increase in efficiency of the PV/T air collector is due to the increase in the number of fins added. In the experiments, the air temperature difference between the inlet and the outlet of the PV/T air collector reaches 10 ° C on November 21, 2014, the interval time is between 10:00 and 14:00, and the temperature of the upper plate reaches 45 ° C at noon. The mathematical model describing the dynamic behavior of the typical PV/T air collector is evaluated by calculating the root mean square error and mean absolute percentage error. A good agreement between the experiment and the simulation results is obtained.

  3. Planar holographic spectrum-splitting PV module design

    Science.gov (United States)

    Gordon, Michael; Zhang, Deming; Vorndran, Shelby; Russo, Juan M.; Luscombe, Christine K.; Shaheen, Sean E.; Kostuk, Raymond K.

    2012-10-01

    A design is presented for a planar spectrum-splitting photovoltaic (PV) module using Holographic Optical Elements (HOEs). A repeating array of HOEs diffracts portions of the solar spectrum onto different PV materials arranged in alternating strips. Several combinations of candidate PV materials are explored, and theoretical power conversion efficiency is quantified and compared for each case. The holograms are recorded in dichromated gelatin (DCG) film, an inexpensive material which is easily encapsulated directly into the panel. If desired, the holograms can focus the light to achieve concentration. The side-by-side split spectrum layout has advantages compared to a stacked tandem cell approach: since the cells are electrically isolated, current matching constraints are eliminated. Combinations of dissimilar types of cells are also possible: including crystalline, thin film, and organic PV cells. Configurations which yield significant efficiency gain using relatively inexpensive PV materials are of particular interest. A method used to optimize HOE design to work with a different candidate cells and different package aspect ratios is developed and presented. (Aspect ratio is width of the cell strips vs. the thickness of the panel) The relationship between aspect ratio and HOE performance properties is demonstrated. These properties include diffraction efficiency, spectral selectivity, tracking alignment sensitivity, and uniformity of cell illumination.

  4. Photovoltaic Module Simulink Model for a Stand-alone PV System

    Science.gov (United States)

    Qi, Chen; Ming, Zhu

    Photovoltaic(PV) Module is indispensable of a stand-alone PV system. In this paper, a one-diode equivalent circuit-based versatile simulation model in the form of masked block PV module is proposed. By the model, it is allowed to estimate behavior of PV module with respect changes on irradiance intensity, ambient temperature and parameters of the PV module. In addition, the model is capable of function of Maximum Power Point Tracking (MPPT) which can be used in the dynamic simulation of stand-alone PV systems.

  5. Design optimization of transformerless grid-connected PV inverters including reliability

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2012-01-01

    This paper presents a new methodology for optimal design of transformerless Photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal values and types of the PV inverter components are calculated such that the PV inverter Levelized Cost...... to the non-optimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE....

  6. Generation of large-scale PV scenarios using aggregated power curves

    DEFF Research Database (Denmark)

    Nuño Martinez, Edgar; Cutululis, Nicolaos Antonio

    2017-01-01

    The contribution of solar photovoltaic (PV) power to the generation is becoming more relevant in modern power system. Therefore, there is a need to model the variability large-scale PV generation accurately. This paper presents a novel methodology to generate regional PV scenarios based on aggreg......The contribution of solar photovoltaic (PV) power to the generation is becoming more relevant in modern power system. Therefore, there is a need to model the variability large-scale PV generation accurately. This paper presents a novel methodology to generate regional PV scenarios based...

  7. PV as a core element of utility business plans

    International Nuclear Information System (INIS)

    Osborn, Don

    2000-01-01

    The author expounds the advantages and rationale for utility PV (photovoltaics) business strategies and discusses various initiatives being taken by some companies in the US. It is claimed that in perhaps 5-12 years the photovoltaics price will be competing with retail electricity and customer-owned utilities should be in a position to offer photovoltaics as an option rather than concede that business to someone else. Five specific reasons for investing in PVs are given and the message is that if you are not involved then get involved. The author describes his own company's commitments to PV and suggests that regulators and legislators should appreciate the long term interests of the ratepayer in that investment now in higher cost PV technology will lead to greater cost reductions in the future

  8. Comparative analysis of old, recycled and new PV modules

    Directory of Open Access Journals (Sweden)

    Haroon Ashfaq

    2017-01-01

    Full Text Available This paper presents comparative analysis of old, recycled and new PV modules. It is possible to recycle even very old products by modern standard processes in a value-conserving manner. About 90% of the materials recovered from solar panels can be recycled into useful products. Carbon emission and energy cost are low in manufacturing recycled SPV. Modules can be manufactured with recycled materials and reinstalled in systems as a full quality product with today’s technology good for another 25–30 years. Analysis of all the models of PV module is done with the help of MATLAB. This helps in comparison and proves the effectiveness of the recycled PV module based systems.

  9. Budgeting for Solar PV Plant Operations & Maintenance: Practices and Pricing.

    Energy Technology Data Exchange (ETDEWEB)

    Enbar, Nadav [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Weng, Dean [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-01-01

    With rising grid interconnections of solar photovoltaic (PV) systems, greater attention is being trained on lifecycle performance, reliability, and project economics. Expected to meet production thresholds over a 20-30 year timeframe, PV plants require a steady diet of operations and maintenance (O&M) oversight to meet contractual terms. However, industry best practices are only just beginning to emerge, and O&M budgets—given the arrangement of the solar project value chain—appear to vary widely. Based on insights from in-depth interviews and survey research, this paper presents an overview of the utility-scale PV O&M budgeting process along with guiding rationales, before detailing perspectives on current plant upkeep activities and price points largely in the U.S. It concludes by pondering potential opportunities for improving upon existing O&M budgeting approaches in ways that can benefit the industry at-large.

  10. Budgeting for Solar PV Plant Operations & Maintenance: Practices and Pricing.

    Energy Technology Data Exchange (ETDEWEB)

    Enbar, Nadav [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Weng, Dean [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    With rising grid interconnections of solar photovoltaic (PV) systems, greater attention is being trained on lifecycle performance, reliability, and project economics. Expected to meet production thresholds over a 20-30 year timeframe, PV plants require a steady diet of operations and maintenance (O&M) oversight to meet contractual terms. However, industry best practices are only just beginning to emerge, and O&M budgets—given the arrangement of the solar project value chain—appear to vary widely. Based on insights from in-depth interviews and survey research, this paper presents an overview of the utility-scale PV O&M budgeting process along with guiding rationales, before detailing perspectives on current plant upkeep activities and price points largely in the U.S. It concludes by pondering potential opportunities for improving upon existing O&M budgeting approaches in ways that can benefi t the industry at-large.

  11. National Survey Report of PV Power Applications in France 2014

    International Nuclear Information System (INIS)

    Kaaijk, Paul; Durand, Yvonnick

    2015-06-01

    The objective of Task 1 of the IEA Photovoltaic Power Systems Program is to promote and facilitate the exchange and dissemination of information on the technical, economic, environmental and social aspects of PV power systems. Task 1 activities support the broader PVPS objectives: to contribute to cost reduction of PV power applications, to increase awareness of the potential and value of PV power systems, to foster the removal of both technical and non-technical barriers and to enhance technology co-operation. An important deliverable of Task 1 is the annual Trends in photovoltaic applications report. In parallel, National Survey Reports are produced annually by each Task 1 participant. The PVPS web site www.iea-pvps.org also plays an important role in disseminating information arising from the program, including national information. This document is the French National Survey Report on photovoltaics for the year 2014

  12. Lessons Learned from the Photovoltaic Manufacturing Technology/PV Manufacturing R&D and Thin Film PV Partnership Projects

    Energy Technology Data Exchange (ETDEWEB)

    Margolis, R.; Mitchell, R.; Zweibel, K.

    2006-09-01

    As the U.S. Department of Energy's (DOE's) Solar Energy Technologies Program initiates new cost-shared solar energy R&D under the Solar America Initiative (SAI), it is useful to analyze the experience gained from cost-shared R&D projects that have been funded through the program to date. This report summarizes lessons learned from two DOE-sponsored photovoltaic (PV) projects: the Photovoltaic Manufacturing Technology/PV Manufacturing R&D (PVMaT/PVMR&D) project and the Thin-Film PV Partnership project. During the past 10-15 years, these two projects have invested roughly $330 million of government resources in cost-shared R&D and leveraged another $190 million in private-sector PV R&D investments. Following a description of key findings and brief descriptions of the PVMaT/PVMR&D and Thin-Film PV Partnership projects, this report presents lessons learned from the projects.

  13. Time series power flow analysis for distribution connected PV generation.

    Energy Technology Data Exchange (ETDEWEB)

    Broderick, Robert Joseph; Quiroz, Jimmy Edward; Ellis, Abraham; Reno, Matthew J.; Smith, Jeff; Dugan, Roger

    2013-01-01

    Distributed photovoltaic (PV) projects must go through an interconnection study process before connecting to the distribution grid. These studies are intended to identify the likely impacts and mitigation alternatives. In the majority of the cases, system impacts can be ruled out or mitigation can be identified without an involved study, through a screening process or a simple supplemental review study. For some proposed projects, expensive and time-consuming interconnection studies are required. The challenges to performing the studies are twofold. First, every study scenario is potentially unique, as the studies are often highly specific to the amount of PV generation capacity that varies greatly from feeder to feeder and is often unevenly distributed along the same feeder. This can cause location-specific impacts and mitigations. The second challenge is the inherent variability in PV power output which can interact with feeder operation in complex ways, by affecting the operation of voltage regulation and protection devices. The typical simulation tools and methods in use today for distribution system planning are often not adequate to accurately assess these potential impacts. This report demonstrates how quasi-static time series (QSTS) simulation and high time-resolution data can be used to assess the potential impacts in a more comprehensive manner. The QSTS simulations are applied to a set of sample feeders with high PV deployment to illustrate the usefulness of the approach. The report describes methods that can help determine how PV affects distribution system operations. The simulation results are focused on enhancing the understanding of the underlying technical issues. The examples also highlight the steps needed to perform QSTS simulation and describe the data needed to drive the simulations. The goal of this report is to make the methodology of time series power flow analysis readily accessible to utilities and others responsible for evaluating

  14. Sustainable recycling technologies for Solar PV off-grid system

    Directory of Open Access Journals (Sweden)

    Uppal Bhavesh

    2017-01-01

    Full Text Available Policy makers throughout the world have accepted climate change as a repercussion of fossil fuel exploitation. This has led the governments to integrate renewable energy streams in their national energy mix. PV off-grid Systems have been at the forefront of this transition because of their permanently increasing efficiency and cost effectiveness. These systems are expected to produce large amount of different waste streams at the end of their lifetime. It is important that these waste streams should be recycled because of the lack of available resources. Our study found that separate researches have been carried out to increase the efficiencies of recycling of individual PV system components but there is a lack of a comprehensive methodical research which details efficient and sustainable recycling processes for the entire PV off-grid system. This paper reviews the current and future recycling technologies for PV off-grid systems and presents a scheme of the most sustainable recycling technologies which have the potential for adoption. Full Recovery End-of-Life Photovoltaic (FRELP recycling technology can offer opportunities to sustainably recycle crystalline silicon PV modules. Electro-hydrometallurgical process & Vacuum technologies can be used for recovering lead from lead acid batteries with a high recovery rate. The metals in the WEEE can be recycled by using a combination of biometallurgical technology, vacuum metallurgical technology and other advanced metallurgical technologies (utrasonical, mechano-chemical technology while the plastic components can be effectively recycled without separation by using compatibilizers. All these advanced technologies when used in combination with each other provide sustainable recycling options for growing PV off-grid systems waste. These promising technologies still need further improvement and require proper integration techniques before implementation.

  15. Sustainable recycling technologies for Solar PV off-grid system

    Science.gov (United States)

    Uppal, Bhavesh; Tamboli, Adish; Wubhayavedantapuram, Nandan

    2017-11-01

    Policy makers throughout the world have accepted climate change as a repercussion of fossil fuel exploitation. This has led the governments to integrate renewable energy streams in their national energy mix. PV off-grid Systems have been at the forefront of this transition because of their permanently increasing efficiency and cost effectiveness. These systems are expected to produce large amount of different waste streams at the end of their lifetime. It is important that these waste streams should be recycled because of the lack of available resources. Our study found that separate researches have been carried out to increase the efficiencies of recycling of individual PV system components but there is a lack of a comprehensive methodical research which details efficient and sustainable recycling processes for the entire PV off-grid system. This paper reviews the current and future recycling technologies for PV off-grid systems and presents a scheme of the most sustainable recycling technologies which have the potential for adoption. Full Recovery End-of-Life Photovoltaic (FRELP) recycling technology can offer opportunities to sustainably recycle crystalline silicon PV modules. Electro-hydrometallurgical process & Vacuum technologies can be used for recovering lead from lead acid batteries with a high recovery rate. The metals in the WEEE can be recycled by using a combination of biometallurgical technology, vacuum metallurgical technology and other advanced metallurgical technologies (utrasonical, mechano-chemical technology) while the plastic components can be effectively recycled without separation by using compatibilizers. All these advanced technologies when used in combination with each other provide sustainable recycling options for growing PV off-grid systems waste. These promising technologies still need further improvement and require proper integration techniques before implementation.

  16. Industrial application of PV/T solar energy systems

    International Nuclear Information System (INIS)

    Kalogirou, S.A.; Tripanagnostopoulos, Y.

    2007-01-01

    Hybrid photovoltaic/thermal (PV/T) systems consist of PV modules and heat extraction units mounted together. These systems can simultaneously provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation than plain photovoltaics. Industries show high demand of energy for both heat and electricity and the hybrid PV/T systems could be used in order to meet this requirement. In this paper the application aspects in the industry of PV/T systems with water heat extraction is presented. The systems are analyzed with TRNSYS program for three locations Nicosia, Athens and Madison that are located at different latitudes. The system comprises 300 m 2 of hybrid PV/T collectors producing both electricity and thermal energy and a 10 m 3 water storage tank. The work includes the study of an industrial process heat system operated at two load supply temperatures of 60 deg. C and 80 deg. C. The results show that the electrical production of the system, employing polycrystalline solar cells, is more than the amorphous ones but the solar thermal contribution is slightly lower. A non-hybrid PV system produces about 25% more electrical energy but the present system covers also, depending on the location, a large percentage of the thermal energy requirement of the industry considered. The economic viability of the systems is proven, as positive life cycle savings are obtained in the case of hybrid systems and the savings are increased for higher load temperature applications. Additionally, although amorphous silicon panels are much less efficient than the polycrystalline ones, better economic figures are obtained due to their lower initial cost, i.e., they have better cost/benefit ratio

  17. Modular Power Converters for PV Applications

    Energy Technology Data Exchange (ETDEWEB)

    Ozpineci, Burak [ORNL; Tolbert, Leon M [ORNL

    2012-05-01

    This report describes technical opportunities to serve as parts of a technological roadmap for Shoals Technologies Group in power electronics for PV applications. There are many different power converter circuits that can be used for solar inverter applications. The present applications do not take advantage of the potential for using common modules. We envision that the development of a power electronics module could enable higher reliability by being durable and flexible. Modules would have fault current limiting features and detection circuits such that they can limit the current through the module from external faults and can identify and isolate internal faults such that the remaining modules can continue to operate with only minimal disturbance to the utility or customer. Development of a reliable, efficient, low-cost, power electronics module will be a key enabling technology for harnessing more power from solar panels and enable plug and play operation. Power electronics for computer power supplies, communication equipment, and transportation have all targeted reliability and modularity as key requirements and have begun concerted efforts to replace monolithic components with collections of common smart modules. This is happening on several levels including (1) device level with intelligent control, (2) functional module level, and (3) system module. This same effort is needed in power electronics for solar applications. Development of modular units will result in standard power electronic converters that will have a lower installed and operating cost for the overall system. These units will lead to increased adaptability and flexibility of solar inverters. Incorporating autonomous fault current limiting and reconfiguration capabilities into the modules and having redundant modules will lead to a durable converter that can withstand the rigors of solar power generation for more than 30 years. Our vision for the technology roadmap is that there is no need

  18. Development of a GIS Tool for High Precision PV Degradation Monitoring and Supervision: Feasibility Analysis in Large and Small PV Plants

    Directory of Open Access Journals (Sweden)

    Miguel de Simón-Martín

    2017-06-01

    Full Text Available It is well known that working photovoltaic (PV plants show several maintenance needs due to wiring and module degradation, mismatches, dust, and PV cell defects and faults. There are a wide range of theoretical studies as well as some laboratory tests that show how these circumstances may affect the PV production. Thus, it is mandatory to evaluate the whole PV plant performance and, then, its payback time, profitability, and environmental impact or carbon footprint. However, very few studies include a systematic procedure to quantify and supervise the real degradation effects and fault impacts on the field. In this paper, the authors first conducted a brief review of the most frequent PV faults and the degradation that can be found under real conditions of operation of PV plants. Then, they proposed and developed an innovative Geographic Information System (GIS application to locate and supervise them. The designed tool was applied to both a large PV plant of 108 kWp and a small PV plant of 9 kWp installed on a home rooftop. For the large PV plant, 24 strings of PV modules were modelized and introduced into the GIS application and every module in the power plant was studied including voltage, current, power, series and parallel resistances, fill factor, normalized PV curve to standard test conditions (STC, thermography and visual analysis. For the small PV installation three strings of PV panels were studied identically. It must be noted that PV modules in this case included power optimizers. The precision of the study enabled the researchers to locate and supervise up to a third part of every PV cell in the system, which can be adequately georeferenced. The developed tool allows both the researchers and the investors to increase control of the PV plant performance, to lead to better planning of maintenance actuations, and to evaluate several PV module replacement strategies in a preventive maintenance program. The PV faults found include hot

  19. PV domestic field trial. Third annual technical report

    Energy Technology Data Exchange (ETDEWEB)

    Crick, F.; Davies, N.; Munzinger, M.; Pearsall, N.; Martin, C.

    2004-07-01

    This report summaries the results of a field trials investigating the design, construction and operation of photovoltaic (PV) systems installed during 2003 to provide information for utilities, building developers and those involved in PV installations and operations. Topics examined include the appearance of the systems, their architectural integration, the different fixing methods, the cost effectiveness of the systems, problems encountered, and monitoring activities. Key issues discussed include communication and co-ordination between interested bodies, siting and location, and good practice. Details are given of monitoring inspection visits, and performance analysis.

  20. Models for a stand-alone PV system

    DEFF Research Database (Denmark)

    Hansen, A.D.; Sørensen, Poul Ejnar; Hansen, L.H.

    2001-01-01

    This report presents a number of models for modelling and simulation of a stand-alone photovoltaic (PV) system with a battery bank verified against a system installed at Risø National Laboratory. The work has been supported by the Danish Ministry ofEnergy, as a part of the activities in the Solar...... Energy Centre Denmark. The study is carried out at Risø National Laboratory with the main purpose to establish a library of simple mathematical models for each individual element of a stand-alone PVsystem, namely solar cells, battery, controller, inverter and load. The models for PV module and battery...

  1. High Efficient Bidirectional Battery Converter for residential PV Systems

    DEFF Research Database (Denmark)

    Pham, Cam; Kerekes, Tamas; Teodorescu, Remus

    2012-01-01

    the power to balance it. High efficient bidirectional converter for the battery storage is required due high system cost and because the power is processed twice. A 1.5kW prototype is designed and built with CoolMOS and SiC diodes, >;95% efficiency has been obtained with 200 kHz hard switching.......Photovoltaic (PV) installation is suited for the residential environment and the generation pattern follows the distribution of residential power consumption in daylight hours. In the cases of unbalance between generation and demand, the Smart PV with its battery storage can absorb or inject...

  2. Clear sky pure water - PV water pumping and desalination

    International Nuclear Information System (INIS)

    Saleh Al-Zahrani; Yaseen Al-Harbi

    2000-01-01

    Providing adequate portable drinking water is becoming a serious problem in remote areas. Saudi Arabia is a very suitable place to use renewable energy such as photovoltaic (PV) energy. For this reason, a PV system was designed and installed along with water pumping and desalination systems in the village of Sadous, about 72 km from Riyadh. The total number of panels is 158, and they give 11.06 kW. The average pumped water from the well is about 18 m 3 /day with total dissolved solids (TDS) greater than 6000 PPM. The average product water is about 5 m 3 /day with TDS less than 300 PPM. (Author)

  3. Quantifying PV module microclimates and translation into accelerated weathering protocols

    Science.gov (United States)

    Phillips, Nancy H.; Scott, Kurt P.

    2014-10-01

    Long term reliability is not well addressed by current standards for PV modules or components, and developing accelerated weathering stress protocols to test the resistance of key components to wear-out is an active area of research. A first step is to understand and quantify the range of actual stresses modules will encounter in the various mounting configurations and in-service environments. In this paper, we use real-world data to benchmark PV module service environments in hot/dry, hot/wet, and temperate environments, with subsequent analysis to translate the microclimate data into a portfolio of practical weathering instrument settings.

  4. Building-integrated PV -- Analysis and US market potential

    International Nuclear Information System (INIS)

    Frantzis, L.; Hill, S.; Teagan, P.; Friedman, D.

    1994-01-01

    Arthur D Little, Inc., in conjunction with Solar Design Associates, conducted a study for the US Department of Energy (DOE), Office of Building Technologies (OBT) to determine the market potential for building-integrated photovoltaics (BIPV). This study defines BIPV as two types of applications: (1) where the PV modules are an integral part of the building, often serving as the exterior weathering skin, and (2) the PV modules are mounted on the existing building exterior. Both of these systems are fully integrated with the energy usage of the building and have potential for significant market penetration in the US

  5. Progress Toward Sequestering Carbon Nanotubes in PmPV

    Science.gov (United States)

    Bley, Richard A.

    2009-01-01

    Sequestration of single-walled carbon nanotubes (SWNTs) in molecules of poly(m-phenylenevinylene-co-2,5-diocty-loxy-p-phenylenevinylene) [PmPV] is a candidate means of promoting dissolution of single-walled carbon nanotubes (SWNTs) into epoxies for making strong, lightweight epoxy-matrix/carbon-fiber composite materials. Bare SWNTs cannot be incorporated because they are not soluble in epoxies. In the present approach, one exploits the tendency of PmPV molecules to wrap themselves around SWNTs without chemically bonding to them.

  6. Spatio-temporal analysis of regional PV generation

    DEFF Research Database (Denmark)

    Nuño Martinez, Edgar; Cutululis, Nicolaos Antonio

    2016-01-01

    Photovoltaic (PV) power is growing in importance worldwide and hence needs to be represented in operation and planning of power system. As opposed to traditional generation technologies, it is characterized by exhibiting both a high variability and a significant spatial dependence. This paper...... presents a fundamental analysis of regional solar generation time series, aiming to potentially facilitate large-scale solar integration. It will focus on characterizing the underlying dependence structure at the system level as well as describing both statistical and temporal properties of regional PV...

  7. Environmental and exergy benefit of nanofluid-based hybrid PV/T systems

    International Nuclear Information System (INIS)

    Hassani, Samir; Saidur, R.; Mekhilef, Saad; Taylor, Robert A.

    2016-01-01

    Highlights: • Environmental and ExPBT analysis of different PV/T configurations is presented. • The exergy payback time of nanofluid-based hybrid PV/T system is about 2 years. • Nanofluid-based hybrid PV/T system is a reliable solution for pollution prevention. • Nanofluid-based hybrid PV/T system is highly recommended at high solar concentration. - Abstract: Photovoltaic/thermal (PV/T) solar systems, which produce both electrical and thermal energy simultaneously, represent a method to achieve very high conversion rates of sunlight into useful energy. In recent years, nanofluids have been proposed as efficient coolants and optical filter for PV/T systems. Aim of this paper is to theoretically analyze the life cycle exergy of three different configurations of nanofluids-based PV/T hybrid systems, and compare their performance to a standard PV and PV/T system. Electrical and thermal performance of the analyzed solar collectors was investigated numerically. The life cycle exergy analysis revealed that the nanofluids-based PV/T system showed the best performance compared to a standard PV and PV/T systems. At the optimum value of solar concentration C, nanofluid-based PV/T configuration with optimized optical and thermal properties produces ∼1.3 MW h/m 2 of high-grade exergy annually with the lowest exergy payback time of 2 years, whereas these are ∼0.36, ∼0.79 MW h/m 2 and 3.48, 2.55 years for standard PV and PV/T systems, respectively. In addition, the nanofluids-based PV/T system can prevent the emissions of about 448 kg CO 2 eq m −2 yr −1 . Overall, it was found that the nanofluids-based PV/T with optimized optical and thermal properties has potential for further development in a high-concentration solar system.

  8. Task 9. PV deployment in developing countries. Institutional framework and financial instruments for PV deployment in developing countries

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-09-15

    This report for the International Energy Agency (IEA) made by Task 9 of the Photovoltaic Power Systems (PVPS) programme takes a look at the institutional framework and financial instruments necessary for PV deployment in developing countries. This guide describes the institutional and financial aspects that need to be addressed to ensure that a long term sustainable (and profitable) PV market is established in developing countries. The guide details main fundamental functions that need to be performed such as the agents needed to perform the functions and their differing roles within the framework, the relationships between these agents and the financial instruments available. It is stated that the majority of the aspects recommended in this guide can be adopted to two main PV deployment models: direct sales and rural electrification and development programmes. It is noted that both approaches will have to be tailored and adapted to local conditions.

  9. PV solar electricity industry: Market growth and perspective

    International Nuclear Information System (INIS)

    Hoffmann, Winfried

    2006-01-01

    The photovoltaic (PV) solar electricity market has shown an impressive 33% growth per year since 1997 until today with market support programs as the main driving force. The rationales for this development and the future projections towards a 100 billion | industry in the 2020s, by then only driven by serving cost-competitively customer needs are described. The PV market, likely to have reached about 600MW in the year 2003, is discussed according to its four major segments: consumer applications, remote industrial electrification, developing countries, and grid-connected systems. While in the past, consumer products and remote industrial applications used to be the main cause for turnover in PV, in recent years the driving forces are more pronounced in the grid-connected systems and by installations in developing countries. Examples illustrating the clear advantage of systems using PV over conventional systems based, e.g., on diesel generators in the rural and remote electrification sector are discussed. For the promotion of rural electrification combined with the creation of local business and employment, suitable measures are proposed in the context of the PV product value chain. The competitiveness of grid-connected systems is addressed, where electricity generating costs for PV are projected to start to compete with conventional utility peak power quite early between 2010 and 2020 if time-dependent electricity tariffs different for bulk and peak power are assumed. The most effective current-pulling force for grid-connected systems is found to be the German Renewable Energy (EEG) Feed-in Law where the customers are focusing on yield, performance, and long-life availability. The future growth in the above-defined four market segments are discussed and the importance of industry political actions in order to stimulate the markets either in grid-connected systems by feed-in tariff programs as well as for off-grid rural developing country applications by long

  10. Dynamic Model Validation of PV Inverters Under Short-Circuit Conditions: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Muljadi, E.; Singh, M.; Bravo, R.; Gevorgian, V.

    2013-03-01

    Photovoltaic (PV) modules have dramatically decreased in price in the past few years, spurring the expansion of photovoltaic deployment. Residential and commercial rooftop installations are connected to the distribution network; large-scale installation PV power plants (PVPs) have benefited from tax incentives and the low cost of PV modules. As the level penetration of PV generation increases, the impact on power system reliability will also be greater. Utility power system planners must consider the role of PV generation in power systems more realistically by representing PV generation in dynamic stability analyses. Dynamic models of PV inverters have been developed in the positive sequence representation. NREL has developed a PV inverter dynamic model in PSCAD/EMTDC. This paper validates the dynamic model with an actual hardware bench test conducted by Southern California Edison's Distributed Energy Resources laboratory. All the fault combinations -- symmetrical and unsymmetrical -- were performed in the laboratory. We compare the simulation results with the bench test results.

  11. Photovoltaic (PV) Pricing Trends: Historical, Recent, and Near-Term Projections

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Barbose, Galen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wiser, Ryan [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Darghouth, Naim [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Goodrich, Alan [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2012-11-30

    The installed capacity of global and U.S. photovoltaic (PV) systems has soared in recent years, driven by declining PV prices and government incentives. The U.S. Department of Energy’s (DOE) SunShot Initiative aims to make PV cost competitive without incentives by reducing the cost of PV-generated electricity by about 75% between 2010 and 2020. This summary report—based on research at Lawrence Berkeley National Laboratory (LBNL) and the National Renewable Energy Laboratory (NREL)—examines progress in PV price reductions to help DOE and other PV stakeholders manage the transition to a market-driven PV industry, and to provide clarity surrounding the wide variety of potentially conflicting data available about PV system prices.

  12. Simulation of transcontinental wind and solar PV generation time series

    DEFF Research Database (Denmark)

    Nuño Martinez, Edgar; Maule, Petr; Hahmann, Andrea N.

    2018-01-01

    The deployment of Renewable Energy Sources (RES) is driving modern power systems towards a fundamental green transition. In this regard, there is a need to develop models to accurately capture the variability of wind and solar photovoltaic (PV) power, at different geographical and temporal scales...

  13. Industrial PV activities worldwide; Die weltweiten industriellen Photovoltaik-Aktivitaeten

    Energy Technology Data Exchange (ETDEWEB)

    Schmid, J. [Institut fuer Solare Energieversorgungstechnik (ISET), Kassel (Germany); Raeuber, A. [Kassel Univ. (Gesamthochschule) (Germany). Inst. fuer Elektrische Energietechnik; Krengel, U. [Projektgesellschaft Solare Energiesysteme mbH, Freiburg (Germany)

    1999-07-01

    PV systems with a total capacity of about 150 MW are currently being installed every year throughout the world (Germany: 14 MW). Growth rates of the past years were between 10% nd 40%. PV technology uses low-maintenance, static system components which can be integrated in buildings in many different ways. In remote areas, there is no alternative to PV. The contribution outlines the technology, its applications, sales and cost figures of these past few years, and current trends in technological development. [German] Derzeit werden jaehrlich weltweit Photovoltaik-Anlagen mit einer Gesamtleistung von ca. 150 MW (Deutschland 14 MW) installiert, wobei die Zuwachsraten in den vergangenen Jahren zwischen 10% und 40% lagen. Die Photovoltaik (PV) hat besondere Vorteile durch ausschliesslich wartungsarme, statische Systemkomponenten, die sich in vielfaeltiger Weise auch in Gebaeude integrieren lassen. Fuer eine grosse Anzahl netzferner Anwendungen hat sich die photovoltaische Energieversorgung schon heute als konkurrenzlose Alternative etabliert. Dargestellt werden die Entwicklung der Technik, der Anwendungen, des Absatzes und der Kosten der vergangenen Jahre sowie die zukuenftig zu erwartenden Tendenzen in der Technologieentwicklung. (orig.)

  14. PV Systems Reliability Final Technical Report: Ground Fault Detection

    Energy Technology Data Exchange (ETDEWEB)

    Lavrova, Olga [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flicker, Jack David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Johnson, Jay [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-01-01

    We have examined ground faults in PhotoVoltaic (PV) arrays and the efficacy of fuse, current detection (RCD), current sense monitoring/relays (CSM), isolation/insulation (Riso) monitoring, and Ground Fault Detection and Isolation (GFID) using simulations based on a Simulation Program with Integrated Circuit Emphasis SPICE ground fault circuit model, experimental ground faults installed on real arrays, and theoretical equations.

  15. Comparative assessment of PV plant performance models considering climate effects

    DEFF Research Database (Denmark)

    Tina, Giuseppe; Ventura, Cristina; Sera, Dezso

    2017-01-01

    . The methodological approach is based on comparative tests of the analyzed models applied to two PV plants installed respectively in north of Denmark (Aalborg) and in the south of Italy (Agrigento). The different ambient, operating and installation conditions allow to understand how these factors impact the precision...

  16. Design of fibre reinforced PV concepts for building integrated applications

    NARCIS (Netherlands)

    Reinders, Angelina H.M.E.; de Wit, H.; de Boer, Andries; Ossenbrink Sinke, W.; Helm, P.

    2009-01-01

    Fibre reinforced polymers present an interesting encapsulation medium for PV-modules. Glass fibres can provide increased strength and stiffness to thin polymer layers overcoming the brittleness and limited deformability of glass-panes. Glass fibre reinforced polymers allows for transparency over a

  17. Velocity Curve Analysis of the Spectroscopic Binary Stars PV Pup ...

    Indian Academy of Sciences (India)

    ity for the primary and secondary components of PV Pup, HD 141929, EE Cet and. V921 Her, respectively. The solid closed curves are the result of the nonlinear regres- sion of equation (14), which their good coincidence with the measured data yields to derive the optimized parameters K, e and ω. Figures show that also ...

  18. Best practices for mitigating soiling risk on PV power plants

    KAUST Repository

    AlDowsari, A.

    2015-09-24

    Solar power generates proven, predictable and economical energy and new innovations have made solar PV power plants easy to deploy, integrate and maintain. Areas with large solar energy potential are among the dustiest in the world. At first glance, solar would be a natural fit in many of these environments but humidity, airborne dust, and wind of these regions often bring high soiling rates that can accumulate to reduce performance by up to 10% per month on average, where soiling can be a major loss factor that affects the energy yield for PV plants especially in humid and dusty climates. Therefore, to achieve the desired performance ratio and obtain stable generation, mitigation solutions are proposed to overcome dust issues that affect the performance of PV plants. This makes PV module cleaning a key component for long-term plant performance and sustainable profitability. In this paper, a review of the mechanisms and mitigation solutions to overcome soiling on solar installations using real-world testing and verification is investigated with emphasis on dry type cleaning methods. © 2014 IEEE.

  19. Luminescence Imaging Strategies for Drone-Based PV Array Inspection

    DEFF Research Database (Denmark)

    Benatto, Gisele Alves dos Reis; Riedel, Nicholas; Mantel, Claire

    2017-01-01

    The goal of this work is to develop outdoor defect detection imaging and understand fully its challenges and limitations. The imaging is based on luminescence strategies that will be used for fast and accurate UAV-based inspection system for PV power plants. We studied electroluminescence (EL...

  20. Luminescence imaging strategies for drone-based PV array inspection

    DEFF Research Database (Denmark)

    Benatto, Gisele Alves dos Reis; Riedel, Nicholas; Mantel, Claire

    2017-01-01

    The goal of this work is to perform outdoor defect detection imaging that will be used in a fast, accurate and automatic drone-based survey system for PV power plants. The imaging development focuses on techniques that do not require electrical contact, permitting automatic drone inspections to b...

  1. Environmental impacts of PV systems -- Ground-based vs BIPV

    International Nuclear Information System (INIS)

    Baumann, A.E.; Hill, R.; Hynes, K.M.

    1997-01-01

    This study is part of the ExternE program of the European Commission on the external costs of the photovoltaic (PV) fuel cycle. The objective of this paper is the quantitative evaluation of the main environmental impacts of two selected PV systems--the ground-based 1MWp system in Toledo, Spain and the 40 kWp building integrated facade in Newcastle upon Tyne, NE England, using the methodology of life cycle analysis (LCA). Both systems use silicon wafer technology at present, but the Newcastle facade was also studied with the incorporation CdTe modules. The results of the LCA show that atmospheric emissions are the priority impacts with respect to the assessed PV systems. Comparing Si wafer systems, the CO 2 emissions were 88 t/GWh for the Toledo PV plant and 143t/GWh for the BIPV facade. If the facade had used electrodeposited CdTe, the CO 2 emissions would fall to about 50t/GWh

  2. Annual Prediction Output of an RADTIRC-PV Module

    Directory of Open Access Journals (Sweden)

    Daria Freier

    2018-03-01

    Full Text Available The number of solar photovoltaic (PV installations has been increasing worldwide but the high capital cost of installation continues to be the main challenge, particularly in many developing countries. The solar concentrator, a device that focuses the sunlight onto a small area, has the potential to minimize the use of expensive PV material while maintaining the system’s performance, ultimately bringing down its overall cost. This study aims to predict the annual electrical output of a specific concentrator design called the rotationally asymmetrical dielectric totally internally reflecting concentrator (RADTIRC. The aforementioned design is assumed to be installed in Berlin/Brandenburg, Germany. First, a short review of concentrators is provided. Next, a description of the RADTIRC and the previous research that revolved around it are provided. Afterwards, the key parameters that are needed to determine the annual electrical output of the RADTIRC are explained before presenting the results of the simulations. It was found that the yearly energy yield was increased by a factor of 2.29 when the RADTIRC-PV module was used when compared with the non-concentrating PV module.

  3. Performance Evaluation of PV Panel Under Dusty Condition

    Directory of Open Access Journals (Sweden)

    Abhishek Kumar Tripathi

    2017-11-01

    Full Text Available The performance of PV panel depends on the incoming sunlight on its surface. The accumulated airborne dust particles on panel surface creates a barrier in the path of sunlight and panel surface, which significantly reduces the amount of solar radiation falling on the panel surface. The present study shows a significant reduction in short circuit current and power output of PV panel due to dust deposition on its surface, whereas the reduction in open circuit voltage is not much prominent. This study has been carried in the field as well as in the laboratory. The reduction in maximum power output of PV panel for both the studies ensures a linear relation with the dust deposition on its surface. In the field study, the reduction in the power output due to 12.86gm of dust deposition on the panel surface was 43.18%, whereas in the laboratory study it was 44.75% due to 11gm of dust deposition Article History: Received July 10th 2017; Received in revised form Sept 15th 2017x; Accepted 1st Oct 2017; Available online How to Cite This Article: Tripathi, A.K., Aruna, M. and Murthy, Ch.,S.N. (2017. Performance Evaluation of PV Panel Under Dusty Condition. International Journal of Renewable Energy Develeopment, 6(3, 225-233. https://doi.org/10.14710/ijred.6.3.225-233

  4. Luminescence Imaging Strategies for Drone-Based PV Array Inspection

    DEFF Research Database (Denmark)

    Benatto, Gisele Alves dos Reis; Riedel, Nicholas; Mantel, Claire

    2017-01-01

    The goal of this work is to develop outdoor defect detection imaging and understand fully its challenges and limitations. The imaging is based on luminescence strategies that will be used for fast and accurate UAV-based inspection system for PV power plants. We studied electroluminescence (EL) ac...

  5. Comparing critical success factors for PV between three regions

    International Nuclear Information System (INIS)

    Groenendaal, B.J.; Roosmalen, J.A.M. van

    2000-01-01

    As a research method the project team has chosen to survey the opinion of PV experts and persons involved in the implementation of PV. Therefore, a questionnaire was sent to about 300 persons spread among 3 regions America, Europe and Asia. The returned questionnaires have been statistical analysed with the software tool SPSS. The used analytical methods can be divided in a comparing method (Mann-Whitney test) and ranking methods (Friedman test and the medal classification test). General conclusions are that there is a significant difference in answers between America and Europe about the significance of 'cost reduction'. Also Asia is significant different from America and Europe for the factor 'technical' reliability. There is a significant difference about the status of financing between America and Europe versus Asia. All the regions have a different opinion about the status of RD and D'. Also the status of 'the PV network' is significant different between Asia and America. America and Europe rank 'financial aspects' and 'cost reduction' as the most significant aspects while Asia rank 'specialist knowledge' and 'the PV network' as the most significant. All regions rank 'specialist knowledge' having the worst status and rank 'environmental merits' and 'technical reliability' having the best status. Finally Europe and Asia differ significant about which aspect is the most important for the factors 'internationalisation and other activities'. Europe finds 'harmonisation of policy' the most important internationalisation aspect and Asia prefers 'development aid'. Asia prefers 'pioneering activities' and Europe prefers 'initiatives by social organisations' as most important other activity. (au)

  6. PV industry growth and module reliability in Thailand

    Science.gov (United States)

    Chenvidhya, Dhirayut; Seapan, Manit; Sangpongsanont, Yaowanee; Chenvidhya, Tanokkorn; Limsakul, Chamnan; Songprakorp, Roongrojana

    2015-09-01

    The PV applications in Thailand are now installed more than 1.2 GWp cumulatively. It is due to the National Renewable Energy Program and its targets. In the latest Alternative Energy Development Plan (AEDP), the PV electricity production target has increased from 2 GWp to 3 GWp. With this rapid growth, customers and manufacturers seek for module standard testing. So far over one thousands of PV modules per annum have been tested since 2012. The normal tests include type approval test according to TIS standard, acceptance test and testing for local standard development. For type test, the most module failure was found during damp heat test. For annual evaluation test, the power degradation and delamination of power was found between 0 to 6 percent from its nameplate after deployment of 0 to 5 years in the field. For thin-film module, the degradation and delamination was found in range of 0 to 13 percent (about 5 percent on average) from its nameplate for the modules in operation with less than 5 years. However, for the PV modules at the reference site on campus operated for 12 years, the power degradation was ranging from 10 to 15 percent. Therefore, a long term performance assessment needs to be considered to ensure the system reliability.

  7. Tools for PV (photovoltaic) plant operators: Nowcasting of passing clouds

    Czech Academy of Sciences Publication Activity Database

    Paulescu, M.; Badescu, V.; Brabec, Marek

    2013-01-01

    Roč. 54, č. 1 (2013), s. 104-112 ISSN 0360-5442 R&D Projects: GA MŠk LD12009 Institutional support: RVO:67985807 Keywords : PV (photovoltaic) plants * Sunshine number * Nowcasting * ARIMA (Autoregressive Integrated Moving Average) modeling Subject RIV: JE - Non-nuclear Energetics, Energy Consumption ; Use Impact factor: 4.159, year: 2013

  8. ECO-TOURISM SUSTAINABILITY THROUGH PV TECHNOLOGY: A COMPREHENSIVE REVIEW

    Directory of Open Access Journals (Sweden)

    ARAVIND C. V

    2013-12-01

    Full Text Available Through the Economic Transformation program the Malaysian Government aims to consider tourism as one of the major contributors to the country’s economy and as an industry that imbibe on the principles of environmental responsibility and sustainable development. The growing challenges in the prevention of expansion in agriculture, forestry and aquaculture, and over-exploitation of the natural resources, have made ecotourism extremely popular as a solution for developing tourism sites. Ecotourism attracts many people who wish not only to explore natural wonders but also to protect them for future generations. Most of the ecotourism sites are presumably situated far from the conventional energy resources and thus transporting electricity to those areas are discussed as inefficient and unsustainable. However, solar Photo-voltaic (PV system is clean and alternative energy to suffice the energy demands of eco-tourist sites. This paper puts statements of the energy demand in global and its impact on the traditional fossil fuels and proposes PV as an alternative renewable technology pertaining to the eco-tourism application. The paper especially focuses on solar PV systems which not only could supply the energy demand of tourist sites but can also maintain the image of the ecotourism. A case of a model lodge is used for the study, through the energy demand analysis. A comprehensive review on the PV architecture is presented that derive interest in the implementation of such structure for the case presented.

  9. Selecting Solar. Insights into Residential Photovoltaic (PV) Quote Variation

    Energy Technology Data Exchange (ETDEWEB)

    Davidson, Carolyn [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-10-01

    This analysis leverages available data from EnergySage, an online solar marketplace, to offer the first data-driven characterization of quote variation faced by prospective PV customers, lending early insight into the decisions customers face once they have initial buy-in.

  10. Leaf Roof - Designing Luminescent Solar Concentrating PV Roof Tiles

    NARCIS (Netherlands)

    Reinders, Angelina H.M.E.; Doudart de la Gree, G.; Papadopoulos, A..; Rosemann, A.; Debije, M.G.; Cox, M.; Krumer, Zachar

    2016-01-01

    The Leaf Roof project on the design features of PV roof tiles using Luminescent Solar Concentrator (LSC) technology [1] has resulted in a functional prototype. The results are presented in the context of industrial product design with a focus on the aesthetic aspects of LSCs [2]. This paper outlines

  11. Microgrid-Ready Solar PV - Planning for Resiliency

    Energy Technology Data Exchange (ETDEWEB)

    Booth, Samuel S [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-17

    This fact sheet provides background information on microgrids with suggested language for several up-front considerations that can be added to a solar project procurement or request for proposal (RFP) that will help ensure that PV systems are built for future microgrid connection.

  12. Development of solar energy for efficient PV application systems

    International Nuclear Information System (INIS)

    Said, Aziz

    2006-01-01

    It is essential to increase research, development, awareness for the application of solar energy as an important source of life. The cost of PV systems has decreased due to the improvement in techniques of manufacturing and performance. In reality, photovoltaic is one technology that allows the production of electricity with only two components: technological, which is the PV module and environmental, which is the sun. The knowledge of the components market represents a critical parameters in establishing sustainable industrial applications on different activity sectors. This paper illustrates the advantages of using photovoltaic in rural area and their economic and environmental impact. In regions where petroleum or other fossil fuels are not available, and where these remote area are not connected to the electrical grid, there is a strong and increasing demand for the technologies related to photovoltaic application systems. Water extracting and pumping, telecommunication and lighting, irrigation systems, electrical driven cars and trucks represent some of these important applications. The paper also develops critical skills for the most useful PV application in Egypt and provide to the industry a development forecast for the new technology. Then an initiation contacts and cooperation on PV application between industries specially in North Africa Middle East in order to improve the reliability and to get cheaper systems.(Author)

  13. Angle Resolved Performance Measurements on PV Glass and Modules

    DEFF Research Database (Denmark)

    Juutilainen, Line Tollund; Thorsteinsson, Sune; Poulsen, Peter Behrensdorff

    2016-01-01

    The angular response of PV-modules has significant impact on the energy production. This is especially pronounced in BIPV where installation angles often are far from optimal. Nevertheless, a gain in energy yield may be obtained by choosing a proper glass as superstrate. In this work we present t...

  14. A Mistake Based Approach Probing Students' Understanding of PV ...

    Indian Academy of Sciences (India)

    There are several concepts in molecular thermodynamics whicheasily befuddle students. PV-type work done, presents onesuch example. Classifying the systematic mistakes made bystudents in response to a concept-based question on workdone in thermodynamics, and sharing them across a publicforum results in a ...

  15. PVSOFT99 -PHOTOVOL TAlC (PV) SYSTEM SIZING AND ...

    African Journals Online (AJOL)

    storage). Accurate system sizing is therefore very important for proper ·utilization of the PV technology. The sizing problem is compounded by the fact that the energy source,' the solar radiation, is a variable source wliose properties can not be precisely controlled. Thus a good sizing procedure is always accompanied by.

  16. Optimization of PV array inclination in India using ANN estimator ...

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 40; Issue 5. Optimization of PV array inclination in India using ANN estimator: Method comparison study ... Although different non-linear, empirical models have been proposed by different researchers in India, they have too many constraints and needs complex and rigorous computational ...

  17. Performance enhancement of PV cells through micro-channel cooling

    Directory of Open Access Journals (Sweden)

    Muzaffar Ali

    2015-11-01

    Full Text Available Efficiency of a PV cell is strongly dependent on its surface temperature. The current study is focused to achieve maximum efficiency of PV cells even in scorching temperatures in hot climates like Pakistan where the cell surface temperatures can even rise up to around 80 ℃. The study includes both the CFD and real time experimental investigations of a solar panel using micro channel cooling. Initially, CFD analysis is performed by developing a 3D model of a Mono-Crystalline cell with micro-channels to analyze cell surface temperature distribution at different irradiance and water flow rates. Afterwards, an experimental setup is developed for performance investigations under the real conditions of an open climate of a Pakistan's city, Taxila. Two 35W panels are manufactured for the experiments; one is based on the standard manufacturing procedure while other cell is developed with 4mm thick aluminum sheet having micro-channels of cross-section of 1mm by 1mm. The whole setup also includes different sensors for the measurement of solar irradiance, cell power, surface temperature and water flow rates. The experimental results show that PV cell surface temperature drop of around 15 ℃ is achieved with power increment of around 14% at maximum applied water flow rate of 3 LPM. Additionally, a good agreement is also found between CFD and experimental results. Therefore, that study clearly shows that a significant performance improvement of PV cells can be achieved through the proposed cell cooling technique.

  18. Current limitations of trend curve analysis for the prediction of reactor PV embrittlement

    International Nuclear Information System (INIS)

    Gold, R.; McElroy, W.N.

    1986-02-01

    In operating light water reactor (LWR) commercial power plants, neutron radiation induces embrittlement of the pressure vessel (PV) and its support structures. As a consequence, LWR-PV integrity is a primary safety consideration. LWR-PV integrity is a significant economic consideration since the PV and its support structures are nonreplaceable power plant components and embrittlement of these components can therefore limit the effective operating lifetime of the plant

  19. Development of outdoor luminescence imaging for drone-based PV array inspection

    DEFF Research Database (Denmark)

    Benatto, Gisele Alves dos Reis; Riedel, Nicholas; Thorsteinsson, Sune

    2017-01-01

    This work has the goal to examined experimentally PV module imaging methods under natural light conditions, that will be used in a fast, accurate and automatic drone-based inspection system for PV power plants.......This work has the goal to examined experimentally PV module imaging methods under natural light conditions, that will be used in a fast, accurate and automatic drone-based inspection system for PV power plants....

  20. INVESTIGATION WITH MODAL ANALYSIS OF EFFECTS OF HIGH PV PENETRATION ON POWER SYSTEM VOLTAGE STABILITY

    OpenAIRE

    YILDIRIM, Burak

    2017-01-01

    This paper shows the effects of high PVintegration on the power system voltage stability. PV power plant was appliedto the IEEE 30 bus test system. Modal analysis method is used to show theeffect of PV integration on power system voltage stability. The power rate ofsynchronous generator in the IEEE 30 bus system is increased to show the powersystem stability effect of high PV penetration and then the PV generation withthe same power rate is connected appropriate bus in power system. The modal...

  1. Solar PV Manufacturing Cost Model Group: Installed Solar PV System Prices (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Goodrich, A. C.; Woodhouse, M.; James, T.

    2011-02-01

    EERE's Solar Energy Technologies Program is charged with leading the Secretary's SunShot Initiative to reduce the cost of electricity from solar by 75% to be cost competitive with conventional energy sources without subsidy by the end of the decade. As part of this Initiative, the program has funded the National Renewable Energy Laboratory (NREL) to develop module manufacturing and solar PV system installation cost models to ensure that the program's cost reduction targets are carefully aligned with current and near term industry costs. The NREL cost analysis team has leveraged the laboratories' extensive experience in the areas of project finance and deployment, as well as industry partnerships, to develop cost models that mirror the project cost analysis tools used by project managers at leading U.S. installers. The cost models are constructed through a "bottoms-up" assessment of each major cost element, beginning with the system's bill of materials, labor requirements (type and hours) by component, site-specific charges, and soft costs. In addition to the relevant engineering, procurement, and construction costs, the models also consider all relevant costs to an installer, including labor burdens and overhead rates, supply chain costs, and overhead and materials inventory costs, and assume market-specific profits.

  2. Rooftop PV system. PV:BONUS Phase 3B, final technical report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-11-01

    Under the PV:BONUS Program, ECD and United Solar developed, demonstrated and commercialized two new lightweight, flexible BIPV modules specifically designed as replacements for conventional asphalt shingles and standing seam metal roofing. These modules can be economically and aesthetically integrated into new residential and commercial buildings, and can be used to address the even larger roofing-replacement market. An important design feature of these modules, which minimizes the installation and balance-of-system costs, is their ability to be installed by conventional roofing contractors without special training. The modules are fabricated from high-efficiency, triple-junction spectrum-splitting a-Si alloy solar cells developed by ECD and United Solar. These cells are produced on thin, flexible stainless steel substrates and encapsulated with polymer materials. The Phase 3 program began in August 1995. The principal tasks and goals of this program, which have all been successfully completed by ECD and United Solar, are described in the body and appendices of this report.

  3. PV value analysis: Progress report on PV-Compact Coordinating Council's consensus research agenda

    International Nuclear Information System (INIS)

    Oppenheim, J.

    1995-01-01

    A survey of published and ongoing valuation research indicates that grid-connected photovoltaic (PV) technology is at or close to cost-effectiveness, from the utility or end-user point of view, in an increasing but carefully selected array of distributed utility applications. This conclusion is based on conventional analyses of utility avoided costs (energy, effective load carrying capability, and transmission and distribution costs including line losses) and customer benefits (energy and demand bill savings, tax benefits). It may provide the basis for regulatory review of utility transmission or distribution investments to test prudence or usefulness. The conclusion would be stronger with consideration of the values of risk mitigation, power quality, strategic value to utilities, and satisfaction of customer preference. Further work would therefore be useful in quantifying these factors. The economic conclusions prevail irrespective of the structure of the utility industry. However, the analysis is site-specific so its broad application depends on development of easily operated models and other analytical tools for use in the field and by the regulatory process

  4. A new hybrid bee pollinator flower pollination algorithm for solar PV parameter estimation

    DEFF Research Database (Denmark)

    Ram, J. Prasanth; Babu, T. Sudhakar; Dragicevic, Tomislav

    2017-01-01

    The inaccurate I-V curve generation in solar PV modeling introduces less efficiency and on the other hand, accurate simulation of PV characteristics becomes a mandatory obligation before experimental validation. Although many optimization methods in literature have attempted to extract accurate PV...

  5. Developing High PV Penetration Cases for Frequency Response Study of U.S. Western Interconnection

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Jin; Zhang, Yingchen; Veda, Santosh; Elgindy, Tarek; Liu, Yilu

    2017-05-11

    Recent large penetrations of solar photovoltaic (PV) generation and the inertial characteristics of inverter-based generation technologies have caught the attention of those in the electric power industry in the United States. This paper presents a systematic approach to developing test cases of high penetrations of PV for the Western Interconnection. First, to examine the accuracy of the base case model, the Western Electricity Coordinating Council (WECC) model is validated by using measurement data from synchronized phasor measurement units. Based on the 2022 Light Spring case, we developed four high PV penetration cases for the WECC system that are of interest to the industry: 5% PV+15 % wind, 25% PV+15% wind, 45% PV+15% wind, 65% PV+15% wind). Additionally, a method to project PV is proposed that is based on collected, realistic PV distribution information, including the current and future PV power plant locations and penetrations in the WECC system. Both the utility-scale PV plant and residential rooftop PV are included in this study.

  6. A novel quasi-master-slave control frame for PV-storage independent microgrid

    DEFF Research Database (Denmark)

    Yang, Jian; Yuan, Wenbin; Sun, Yao

    2018-01-01

    In microgrid, photovoltaic (PV) and storage are always combined as a droop-controlled ideal source, which is not very practical. Alternatively, this paper introduces a PV-storage independent system via allocating the PV-storage separately. For this structure, a novel quasi-master-slave control...

  7. Evaluating the Technical and Economic Performance of PV Plus Storage Power Plants: Report Summary

    Energy Technology Data Exchange (ETDEWEB)

    Denholm, Paul L. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Eichman, Joshua D. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-08-28

    The decreasing costs of both PV and energy storage technologies have raised interest in the creation of combined PV plus storage systems to provide dispatchable energy and reliable capacity. In this study, we examine the tradeoffs among various PV plus storage configurations and quantify the impact of configuration on system net value.

  8. Method for Load Sharing and Power Management in a Hybrid PV/Battery Source Islanded Microgrid

    DEFF Research Database (Denmark)

    Karimi, Yaser; Oraee, Hashem; Guerrero, Josep M.

    2016-01-01

    This paper presents a decentralized load sharing and power management method for an islanded microgrid composed of PV units, battery units and hybrid PV/battery units. The proposed method performs all the necessary tasks such as load sharing among the units, battery charging and discharging and PV...

  9. Household photovoltaic market in Xining, Qingha province, China: the role of local PV business

    International Nuclear Information System (INIS)

    Ling, S.; Boardman, B.

    2002-01-01

    This paper assesses the present and future market for household photovoltaic (PV) systems in rural Northwest China, especially from the PV commerce at Xining, Qinghai Province. This unsubsidised free market is now met by the emerging PV industry in China, which includes cell and module manufacturers, and PV system distributors and assemblers. For widespread deployment of such a renewable energy technology, the development of a local free market seems more successful than donor- or 'government subsidy'-driven programmes. Presently, there is a thriving infant PV industry in Northwest China, mostly centred in Xining. Xining-based PV sales companies have extensive networks for selling, marketing and servicing household PV systems for rural farmers and nomads. Small systems are now ordinary items on sale in local shops. Based on interviews and fieldwork observations with seven major PV sales companies in Xining, the household PV market is assessed from the present business operations of these companies. Detail of primary sources is given with the aim of archiving seminal progress in the history of photovoltaic power. The results suggest that although the household PV market will continue to grow, current government and international sponsored PV programmes can create both opportunities and barriers for the infant PV market an industry in China. (author)

  10. Methodology for the optimal design of tansformerless grid-connected PV interters

    DEFF Research Database (Denmark)

    Koutroulis, E.; Blaabjerg, Frede

    2012-01-01

    inverter, such that the PV inverter levelised cost of the generated electricity is minimised. The proposed method constitutes a systematic design process, which is capable to explore the impact of the PV inverter configuration on the trade-off between the PV inverter manufacturing cost and the power losses...

  11. Smoothing out the volatility of South Africa's wind and PV energy resources

    CSIR Research Space (South Africa)

    Bofinger, S

    2015-10-01

    Full Text Available Solar PV & wind are the cheapest new-build options per kWh in South Africa. By 2020, a mix of PV, wind and flexible gas (LNG-based) costs the same as new coal, even without any value given to excess wind/PV energy. South Africa has abundant solar...

  12. DOE Request for Information (RFI) DE-FOA-0000153 PV Manufacturing Initiative

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2010-02-01

    This draft report summarizes the results of the U.S. Department of Energy PV Manufacturing Request for Information (RFI), DE-FOA-0000153, that was released in September 2009. The PV Manufacturing Initiative is intended to help facilitate the development of a strong PV manufacturing industry in the United States.

  13. Effect of Thermoelectric Cooling (TEC module and the water flow heatsink on Photovoltaic (PV panel performance

    Directory of Open Access Journals (Sweden)

    Amelia A.R.

    2017-01-01

    Full Text Available Photovoltaic (PV panel suffers in low conversion efficiency of the output performance affected by the elevated operating temperature of the PV panel. It is important to keep the PV panel to operate at low temperature. To address this issue, this paper proposes the cooling system using thermoelectric cooling (TEC and water block heatsink for enhancing the PV panel output performance. These both types cooling system were designed located on the back side of the PV panel to cool down the operating temperature of the PV panel. To evaluate the function for the existing cooling systems, the experiment was subsequently performed for PV panel without and with different design of the cooling system in outdoor weather conditions. By comparing the experimental results, it is concluded that by the hybrid cooling system which combining TEC module and the water block heatsink could improve the output performance of the PV panel. By the reduction temperature of the PV panel by 16.04 %, the average output power of the PV panel has been boosted up from 8.59 W to 9.03 W. In short, the output power of the PV panel was enhanced by the reduction of the operating temperature of the PV panel.

  14. Real Time Photovoltaic Array Simulator for Testing Grid-Connected PV Inverters

    DEFF Research Database (Denmark)

    Sera, Dezso; Valentini, Massimo; Raducu, Alin

    2008-01-01

    In this paper a real time flexible PV array simulator is presented. It is a system that can simulate different PV panel arrays in specific environmental conditions. To evaluate performance of the Maximum Power Point Tracking (MPPT) of grid-connected Photovoltaic (PV) inverters only measurements...

  15. Effect of Thermoelectric Cooling (TEC) module and the water flow heatsink on Photovoltaic (PV) panel performance

    Science.gov (United States)

    Amelia, A. R.; Jusoh, MA; Shamira Idris, Ida

    2017-11-01

    Photovoltaic (PV) panel suffers in low conversion efficiency of the output performance affected by the elevated operating temperature of the PV panel. It is important to keep the PV panel to operate at low temperature. To address this issue, this paper proposes the cooling system using thermoelectric cooling (TEC) and water block heatsink for enhancing the PV panel output performance. These both types cooling system were designed located on the back side of the PV panel to cool down the operating temperature of the PV panel. To evaluate the function for the existing cooling systems, the experiment was subsequently performed for PV panel without and with different design of the cooling system in outdoor weather conditions. By comparing the experimental results, it is concluded that by the hybrid cooling system which combining TEC module and the water block heatsink could improve the output performance of the PV panel. By the reduction temperature of the PV panel by 16.04 %, the average output power of the PV panel has been boosted up from 8.59 W to 9.03 W. In short, the output power of the PV panel was enhanced by the reduction of the operating temperature of the PV panel.

  16. Evaluating the Technical and Economic Performance of PV Plus Storage Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Denholm, Paul L. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Eichman, Joshua D. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-08-17

    The decreasing costs of both PV and energy storage technologies have raised interest in the creation of combined PV plus storage systems to provide dispatchable energy and reliable capacity. In this study, we examine the tradeoffs among various PV plus storage configurations and quantify the impact of configuration on system net value.

  17. Developing High PV Penetration Cases for Frequency Response Study of U.S. Western Interconnection: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Jin; Zhang, Yingchen; Veda, Santosh; Elgindy, Tarek; Liu, Yilu

    2017-04-11

    Recent large penetrations of solar photovoltaic (PV) generation and the inertial characteristics of inverter-based generation technologies have caught the attention of those in the electric power industry in the United States. This paper presents a systematic approach to developing test cases of high penetrations of PV for the Western Interconnection. First, to examine the accuracy of the base case model, the Western Electricity Coordinating Council (WECC) model is validated by using measurement data from synchronized phasor measurement units. Based on the 2022 Light Spring case, we developed four high PV penetration cases for the WECC system that are of interest to the industry: 5% PV+15 % wind, 25% PV+15% wind, 45% PV+15% wind, 65% PV+15% wind). Additionally, a method to project PV is proposed that is based on collected, realistic PV distribution information, including the current and future PV power plant locations and penetrations in the WECC system. Both the utility-scale PV plant and residential rooftop PV are included in this study.

  18. Defining Bankability for Each Step of a PV Project Using IECRE

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, Sarah

    2016-07-12

    How can a PV customer know whether a PV plant is 'good'? IECRE was created to provide a cost-effective way to identify 'good' PV plants. This presentation describes the motivation, strategy, and status of the IECRE effort as of July, 2016.

  19. PV inverter test setup for European efficiency, static and dynamic MPPT efficiency evaluation

    DEFF Research Database (Denmark)

    Sera, Dezso; Teodorescu, Remus; Valentini, Massimo

    2008-01-01

    (Denmark) on a commercial transformerless PV inverter. Thanks to the available experimental test setups, that provide the required high measuring accuracy, and the developed PV simulator, which is required for MPPT performance evaluation, PV Inverters can be pretested before being tested by accredited...

  20. Integrated Three-Port DC-DC Converter for Photovoltaic (PV) Battery Stand-alone Systems

    DEFF Research Database (Denmark)

    Ouyang, Ziwei; Andersen, Michael A. E.

    2016-01-01

    Several power sources such as PV solar arrays and battery are often used to manage the power flow for a photovoltaic (PV) based stand-alone power system due to the fluctuation nature of solar energy resource, and deliver a continuous power to the users in an appropriate form. Traditionally, three...... for PV and battery stand-alone system....

  1. Experimental comparison of PV-smoothing controllers using distributed generators

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Jay Dean; Ellis, Abraham; Denda, Atsushi; Morino, Kimio; Hawkins, John N.; Arellano, Brian; Shinji, Takao; Ogata, Takao; Tadokoro, Masayuki

    2014-02-01

    The power output variability of photovoltaic systems can affect local electrical grids in locations with high renewable energy penetrations or weak distribution or transmission systems. In those rare cases, quick controllable generators (e.g., energy storage systems) or loads can counteract the destabilizing effects by compensating for the power fluctuations. Previously, control algorithms for coordinated and uncoordinated operation of a small natural gas engine-generator (genset) and a battery for smoothing PV plant output were optimized using MATLAB/Simulink simulations. The simulations demonstrated that a traditional generation resource such as a natural gas genset in combination with a battery would smooth the photovoltaic output while using a smaller battery state of charge (SOC) range and extending the life of the battery. This paper reports on the experimental implementation of the coordinated and uncoordinated controllers to verify the simulations and determine the differences in the controllers. The experiments were performed with the PNM PV and energy storage Prosperity site and a gas engine-generator located at the Aperture Center at Mesa Del Sol in Albuquerque, New Mexico. Two field demonstrations were performed to compare the different PV smoothing control algorithms: (1) implementing the coordinated and uncoordinated controls while switching off a subsection of the PV array at precise times on successive clear days, and (2) comparing the results of the battery and genset outputs for the coordinated control on a high variability day with simulations of the coordinated and uncoordinated controls. It was found that for certain PV power profiles the SOC range of the battery may be larger with the coordinated control, but the total amp-hours through the battery-which approximates battery wear-will always be smaller with the coordinated control.

  2. Impact of PID on industrial rooftop PV-installations

    Science.gov (United States)

    Buerhop, Claudia; Fecher, Frank W.; Pickel, Tobias; Patel, Tirth; Zetzmann, Cornelia; Camus, Christian; Hauch, Jens; Brabec, Christoph J.

    2017-08-01

    Potential induced degradation (PID) causes severe damage and financial losses even in modern PV-installations. In Germany, approximately 19% of PV-installations suffer from PID and resulting power loss. This paper focuses on the impact of PID in real installations and how different evaluated time intervals influence the performance ratio (PR) and the determined degradation rate. The analysis focuses exemplarily on a 314 kWp PV-system in the Atlantic coastal climate. IR-imaging is used for identifying PID without operation interruption. Historic electric performance data are available from a monitoring system for several years on system level, string level as well as punctually measured module string IV- curves. The data sets are combined for understanding the PID behavior of this PV plant. The number of PID affected cells within a string varies strongly between 1 to 22% with the string position on the building complex. With increasing number of PID-affected cells the performance ratio decreases down to 60% for daily and monthly periods. Local differences in PID evolution rates are identified. An average PR-reduction of -3.65% per year is found for the PV-plant. On the string level the degradation rate varied up to 8.8% per year depending on the string position and the time period. The analysis reveals that PID generation and evolution in roof-top installations on industrial buildings with locally varying operation conditions can be fairly complex. The results yield that local operating conditions, e.g. ambient weather conditions as well as surrounding conditions on an industrial building, seem to have a dominating impact on the PID evolution rate.

  3. Consequences of Reducing the Cost of PV Modules on a PV Wind Diesel Hybrid System with Limited Sizing Components

    Directory of Open Access Journals (Sweden)

    Jones S. Silva

    2012-01-01

    Full Text Available The use of renewable resources for power supply in family homes has passed the stage of utopia to became a reality, with limits set by technical and economic parameters. This paper presents the results of a project originated from the initiative of a middle-class family to achieve energy independence at home. The starting point was the concept of home with “zero energy” in which the total energy available is equal to the energy consumed. The solution devised to meet the energy demand of the residence in question is a PV wind diesel hybrid system connected to the grid, with the possibility of energy storage in batteries and in the form of heating water and the environment of the house. As a restriction, the family requested that the system would represent little impact to the lifestyle and landscape. This paper aims to assess the consequences of reductions in the cost of the PV modules on the optimization space, as conceived by the software Homer. The results show that for this system, a 50% reduction in the cost of PV modules allows all viable solutions including PV modules.

  4. Field Demonstration of Using Advanced PV Inverter Functionality to Mitigate the Impacts of High-Penetration PV Grid Integration on the Distribution System

    Energy Technology Data Exchange (ETDEWEB)

    Mather, Barry; Gebeyehu, Araya

    2015-06-14

    This paper describes a field demonstration that was completed to show the ability of currently installed PV inverters to implement advanced PV inverter functionality and that such functionality was effective at reducing the voltage-related PV impacts of high-penetration PV integration. A distribution circuit was instrumented and then tested for a two week period using off-unity power factor operation. Specifically, an inductive power factor of -0.95 was demonstrated. The results show that the PV inverters were capable of such operation and that the use of off-unity power factor operation was highly effective at reducing the voltage-related impacts of the PV systems interconnected to the circuits used in the demonstration. The impacts of using off-unity power factor operation - resulting in additional reactive current flow on the distribution circuit - are also presented and analyzed.

  5. Integrating High Penetrations of PV into Southern California: Year 2 Project Update; Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Mather, B.; Neal, R.

    2012-08-01

    Southern California Edison (SCE) is well into a five-year project to install a total of 500 MW of distributed photovoltaic (PV) energy within its utility service territory. Typical installations to date are 1-3 MW peak rooftop PV systems that interconnect to medium-voltage urban distribution circuits or larger (5 MW peak) ground-mounted systems that connect to medium-voltage rural distribution circuits. Some of the PV system interconnections have resulted in distribution circuits that have a significant amount of PV generation compared to customer load, resulting in high-penetration PV integration scenarios. The National Renewable Energy Laboratory (NREL) and SCE have assembled a team of distribution modeling, resource assessment, and PV inverter technology experts in order to investigate a few of the high-penetration PV distribution circuits. Currently, the distribution circuits being studied include an urban circuit with a PV penetration of approximately 46% and a rural circuit with a PV penetration of approximately 60%. In both cases, power flow on the circuit reverses direction, compared to traditional circuit operation, during periods of high PV power production and low circuit loading. Research efforts during year two of the five-year project were focused on modeling the distribution system level impacts of high-penetration PV integrations, the development and installation of distribution circuit data acquisition equipment appropriate for quantifying the impacts of high-penetration PV integrations, and investigating high-penetration PV impact mitigation strategies. This paper outlines these research efforts and discusses the following activities in more detail: the development of a quasi-static time-series test feeder for evaluating high-penetration PV integration modeling tools; the advanced inverter functions being investigated for deployment in the project's field demonstration and a power hardware-in-loop test of a 500-kW PV inverter implementing a

  6. Results from measurements on the PV-VENT systems at Lundebjerg[DENMARK

    Energy Technology Data Exchange (ETDEWEB)

    Oestergaard Jensen, S.

    2001-05-01

    The objective of the PV-VENT project was research, development, and tests in the following areas: 1. Develop and illustrate different ways of architectural integration of solar energy systems with combined PV power production and pre-heating of ventilation air in buildings, 2. Investigate the potential in pre-heating fresh air to the building by cooling the PV-panels with the fresh air and further to determine how much this cooling will increase the electrical performance of the PV-panels, 3. Develop and test air to air heat exchangers with an efficiency of 80% or above, 4. Develop and test fans and ventilation systems with an overall fan power demand of about 35 W, 5. Develop and test a direct coupling of the PV-panels to the fans in order to avoid the losses in an inverter, 6. Develop and test different ventilation systems utilizing the abovementioned features. Three different ways of integrating PV-panels with pre-heating of fresh air to the building have been demonstrated in Lundebjerg: a large PV-gable with amorphous PV-panels, a PV-facade with polycrystalline (c-Si) PV-panels and solar ventilation chimneys with polycrystalline (c-Si) PV-panels. Especially the latter feature, the solar ventilation chimney is a new and interesting concept as it allows for increased PV areas although the orientation of the building is not optimal for utilization of solar energy, as was the case in Lundebjerg. It is believed that the PV-VENT project has added important information and experience to the field of combining PV and ventilation systems. Information and experience that future systems of this type may benefit from. Several of the components from the project are believed to be able to contribute to set the standards for future PV and ventilation systems. Several of the components from the project is today commercial available and are used in ordinary building projects. (BA)

  7. A Novel Frequency Restoring Strategy of Hydro-PV Hybrid Microgrid

    DEFF Research Database (Denmark)

    Wei, Feng; Kai, Sun; Guan, Yajuan

    2014-01-01

    The conventional PV systems based on the voltage inverters only inject dispatched power to the utility grid when they work at a grid-connected mode in the hydro-PV hybrid microgrid. Due to the droop method employed for load sharing between generators, as well as the enormous inertia of system....... The existence of frequency steady-state error and the slow active power/frequency dynamic response are inevitable. Therefore, a novel frequency restoring strategy for the hydro-PV hybrid microgrid based on the improved hierarchical control of PV systems is proposed in this paper. The output active power of PV...

  8. A MPPT Algorithm Based PV System Connected to Single Phase Voltage Controlled Grid

    Science.gov (United States)

    Sreekanth, G.; Narender Reddy, N.; Durga Prasad, A.; Nagendrababu, V.

    2012-10-01

    Future ancillary services provided by photovoltaic (PV) systems could facilitate their penetration in power systems. In addition, low-power PV systems can be designed to improve the power quality. This paper presents a single-phase PV systemthat provides grid voltage support and compensation of harmonic distortion at the point of common coupling thanks to a repetitive controller. The power provided by the PV panels is controlled by a Maximum Power Point Tracking algorithm based on the incremental conductance method specifically modified to control the phase of the PV inverter voltage. Simulation and experimental results validate the presented solution.

  9. Residential Solar PV Planning in Santiago, Chile: Incorporating the PM10 Parameter

    Directory of Open Access Journals (Sweden)

    Gustavo Cáceres

    2014-12-01

    Full Text Available This paper addresses an economic study of the installation of photovoltaic (PV solar panels for residential power generation in Santiago, Chile, based on the different parameters of a PV system, such as efficiency. As a performance indicator, the Levelized Cost of Energy (LCOE was used, which indicates the benefit of the facility vs. the current cost of electrical energy. In addition, due to a high level of airborne dusts typically associated with PM10, the effect of the dust deposition on PV panels’ surfaces and the effect on panel performance are examined. Two different scenarios are analyzed: on-grid PV plants and off-grid PV plants.

  10. Solar Photovoltaic Economic Development: Building and Growing a Local PV Industry, August 2011 (Book)

    Energy Technology Data Exchange (ETDEWEB)

    2011-08-01

    The U.S. photovoltaic (PV) industry is forecast to grow, and it represents an opportunity for economic development and job creation in communities throughout the United States. This report helps U.S. cities evaluate economic opportunities in the PV industry. It serves as a guide for local economic development offices in evaluating their community?s competitiveness in the solar PV industry, assessing the viability of solar PV development goals, and developing strategies for recruiting and retaining PV companies to their areas.

  11. Design Optimization of Transformerless Grid-Connected PV Inverters Including Reliability

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2013-01-01

    This paper presents a new methodology for optimal design of transformerless photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal switching frequency as well as the optimal values and types of the PV inverter components is calculated...... that compared to the nonoptimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE....

  12. A Software Tool for Optimal Sizing of PV Systems in Malaysia

    Directory of Open Access Journals (Sweden)

    Tamer Khatib

    2012-01-01

    Full Text Available This paper presents a MATLAB based user friendly software tool called as PV.MY for optimal sizing of photovoltaic (PV systems. The software has the capabilities of predicting the metrological variables such as solar energy, ambient temperature and wind speed using artificial neural network (ANN, optimizes the PV module/ array tilt angle, optimizes the inverter size and calculate optimal capacities of PV array, battery, wind turbine and diesel generator in hybrid PV systems. The ANN based model for metrological prediction uses four meteorological variables, namely, sun shine ratio, day number and location coordinates. As for PV system sizing, iterative methods are used for determining the optimal sizing of three types of PV systems, which are standalone PV system, hybrid PV/wind system and hybrid PV/diesel generator system. The loss of load probability (LLP technique is used for optimization in which the energy sources capacities are the variables to be optimized considering very low LLP. As for determining the optimal PV panels tilt angle and inverter size, the Liu and Jordan model for solar energy incident on a tilt surface is used in optimizing the monthly tilt angle, while a model for inverter efficiency curve is used in the optimization of inverter size.

  13. Overview of PV activities in Japan: current status and future prospects

    International Nuclear Information System (INIS)

    Ikki, O.; Ohigashi, T.; Kaizuka, I.; Matsukawa, H.

    2004-01-01

    In Japan, activities for dissemination of PV systems have expanded among the national and local governments, industries, academic circles, nonprofit organizations (NPOs), and consumers ever since the Japanese Government laid out the Basic Guidelines for New Energy Introduction in 1994. Particularly, the continuous dissemination programs by the Ministry of Economy, Trade, and Industry (METI) based on the size of PV market has greatly contributed Japan PV industries and the successful creation of the initial market of PV systems. Cumulative installed PV capacity increased from 31.2 MW in 1994 to 859.6 MW in 2003, and 1 GW level is already in sight for 2004. As a result, solar cell/ module manufactures, housing industry, utilities, METI and other ministries and agencies, local governments, NPOs, end-users, etc. are actively promoting deployment of PV systems and the PV market is activated toward achieving 4,820 MW of the target capacity for 2010. The purpose of this paper is to provide an overview of the dissemination process of PV systems by sector and current status of Japan PV market and to forecast the future development to establish the self-sustainable PV market from the perspective of measures and policies, systems, the industrial structure and the PV market. (authors)

  14. Innovation and technology transfer through global value chains: Evidence from China's PV industry

    International Nuclear Information System (INIS)

    Zhang, Fang; Gallagher, Kelly Sims

    2016-01-01

    China's success as a rapid innovation follower in the infant Photovoltaic (PV) industry surprised many observers. This paper explores how China inserted itself into global clean energy innovation systems by examining the case of the solar PV industry. The paper decomposes the global PV industrial value chain, and determines the main factors shaping PV technology transfer and diffusion. Chinese firms first entered PV module manufacturing through technology acquisition, and then gradually built their global competitiveness by utilizing a vertical integration strategy within segments of the industry as well as the broader PV value chain. The main drivers for PV technology transfer from the global innovation system to China are global market formation policy, international mobilization of talent, the flexibility of manufacturing in China, and belated policy incentives from China's government. The development trajectory of the PV industry in China indicates that innovation in cleaner energy technologies can occur through both global and national innovation processes, and knowledge exchange along the global PV value chain. - Highlights: •The value chain analytical approach is synergized with the theories of technology transfer and innovation systems. •A detailed review of how China integrated itself into the global solar PV innovation system is provided. •Four main factors shape PV technology transfer to China across various value chain segments. •Innovation in cleaner energy technologies is a combination of global and national innovation processes.

  15. Dynamic Characteristics Analysis and Stabilization of PV-Based Multiple Microgrid Clusters

    DEFF Research Database (Denmark)

    Zhao, Zhuoli; Yang, Ping; Wang, Yuewu

    2018-01-01

    As the penetration of PV generation increases, there is a growing operational demand on PV systems to participate in microgrid frequency regulation. It is expected that future distribution systems will consist of multiple microgrid clusters. However, interconnecting PV microgrids may lead to system...... interactions and instability. To date, no research work has been done to analyze the dynamic behavior and enhance the stability of microgrid clusters considering the dynamics of the PV primary sources and dc links. To fill this gap, this paper presents comprehensive modeling, analysis, and stabilization of PV......-based multiple microgrid clusters. A detailed small-signal model for PV-based microgrid clusters considering local adaptive dynamic droop control mechanism of the voltage-source PV system is developed. The complete dynamic model is then used to access and compare the dynamic characteristics of the single...

  16. An Emulated PV Source Based on an Unilluminated Solar Panel and DC Power Supply

    Directory of Open Access Journals (Sweden)

    Zhongfu Zhou

    2017-12-01

    Full Text Available This paper provides a review on various PV simulator technologies as well as presents a novel equivalent photovoltaic (PV source that was constructed by using un-illuminated solar panels and a DC power supply that operates in current source mode. The constructed PV source was used for testing photovoltaic converters and various maximum power point tracking (MPPT algorithms required for capturing the maximum possible output power. The mathematical model and electrical characteristics of the constructed PV source were defined and analyzed in detail in the paper. The constructed PV source has the advantages of high bandwidth over the switching circuit based PV simulators. The constructed PV source has been used for testing various power electronics converters and various control techniques effectively in laboratory environments for researchers and university students.

  17. How PV system ownership can impact the market value of residential homes

    Energy Technology Data Exchange (ETDEWEB)

    Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Johnson, Jamie L. [Energy Sense Finance, LLC, Punta Gorda, FL (United States)

    2014-01-01

    There are multiple ways for a homeowner to obtain the electricity generating and savings benefits offered by a photovoltaic (PV) system. These include purchasing a PV system through various financing mechanisms, or by leasing the PV system from a third party with multiple options that may include purchase, lease renewal or PV system removal. The different ownership options available to homeowners presents a challenge to appraisal and real estate professionals during a home sale or refinance in terms of how to develop a value that is reflective of the PV systems operational characteristics, local market conditions, and lender and underwriter requirements. This paper presents these many PV system ownership options with a discussion of what considerations an appraiser must make when developing the contributory value of a PV system to a residential property.

  18. Experimental comparison of two PV direct-coupled solar water heating systems with the traditional system

    International Nuclear Information System (INIS)

    Ji, Jie; Wang, Yanqiu; Yuan, Weiqi; Sun, Wei; He, Wei; Guo, Chao

    2014-01-01

    Highlights: • A design approach of PV-coupled solar water heating system (SWHS) is presented. • Two different designs of PV modules are proposed and investigated. • A comparative test rig of PV-coupled SWHS and traditional SWHS is set up. • A flow rate increasing with solar irradiation is recommended. - Abstract: Simple and reliable, PV direct-coupled DC pumps are promising in solar water heating systems (SWHS). However, there is limited experimental data on the performance comparison of PV-coupled SWHS with traditional SWHS. Hence in this study, a comparative test rig is set up to measure and analyze the performance of the PV-coupled SWHS and the traditional system under the same conditions. The experimental results show that on sunny days the PV-coupled SWHS has similar daily thermal efficiency as the traditional SWHS, and slightly higher efficiency after improving the design of the PV module. Under low irradiation, the PV-coupled SWHS gains much more heat than the traditional SWHS, which indicates the potential of the PV-coupled SWHS having much higher efficiency than the traditional SWHS on cloudy days. In order to improve the performance of the PV-coupled SWHS, two different designs of PV module are proposed, and their influence on the pump startup characteristics, the flow rate profile, and the thermal efficiency of the system is investigated. It is found that the modified design of the PV module can reduce the requirement of PV cells and increase the efficiency of the system

  19. High-Penetration PV Integration Handbook for Distribution Engineers

    Energy Technology Data Exchange (ETDEWEB)

    Seguin, Rich [Electrical Distribution Design, Blacksburg, VA (United States); Woyak, Jeremy [Electrical Distribution Design, Blacksburg, VA (United States); Costyk, David [Electrical Distribution Design, Blacksburg, VA (United States); Hambrick, Josh [Electrical Distribution Design, Blacksburg, VA (United States); Mather, Barry [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-01-01

    This handbook has been developed as part of a five-year research project which began in 2010. The National Renewable Energy Laboratory (NREL), Southern California Edison (SCE), Quanta Technology, Satcon Technology Corporation, Electrical Distribution Design (EDD), and Clean Power Research (CPR) teamed together to analyze the impacts of high-penetration levels of photovoltaic (PV) systems interconnected onto the SCE distribution system. This project was designed specifically to leverage the experience that SCE and the project team would gain during the significant installation of 500 MW of commercial scale PV systems (1-5 MW typically) starting in 2010 and completing in 2015 within SCE’s service territory through a program approved by the California Public Utility Commission (CPUC).

  20. Development of a monitoring system for a PV solar plant

    International Nuclear Information System (INIS)

    Forero, N.; Hernandez, J.; Gordillo, G.

    2006-01-01

    The aim of this paper is to introduce a system developed for monitoring PV solar plants using a novel procedure based on virtual instrumentation. The measurements and processing of the data are made using high precision I/O modular field point (FP) devices as hardware, a data acquisition card as software and the package of graphic programming, LabVIEW. The system is able to store and display both the collected data of the environmental variables and the PV plant electrical output parameters, including the plant I-V curve. A relevant aspect of this work is the development of a unit that allows automatic measuring of the solar plant I-V curve using a car battery as power supply. The system has been in operation during the last two years and all its units have functioned well

  1. Exploiting PV technology for basic need provision in Nigeria

    International Nuclear Information System (INIS)

    Gyoh, L.; Gyoh, S.

    2004-01-01

    Transitional economies are confronted with ever declining standard of living and low per capita income. Development institutions around the world have come to realize the strategic importance of Sustainable Energy as a Basic Need in the development process. Despite the efforts made by emerging democracies to eradicate poverty, there are still millions of people without access to electricity. Unreliable energy supply currently presents a constant obstacle to many poverty alleviation programmes. Against this background, some states government in Nigeria are exploiting the unique advantage offered by PV technology in the provision of Basic Needs. This study appraises some of the scheme in which the authors have been heavily involved with. This paper identifies some of the strategic policies that might accelerate the successful implementation of PV technology as a poverty alleviation tool in terms of electricity provision in transitional economies. (authors)

  2. Selecting Solar: Insights into Residential Photovoltaic (PV) Quote Variation

    Energy Technology Data Exchange (ETDEWEB)

    Davidson, Carolyn [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-10-01

    Before investing in a system, a prospective PV customer must not only have initial concept 'buy in,' but also be able to evaluate the tradeoffs associated with different system parameters. Prospective customers might need to evaluate disparate costs for each system attribute by comparing multiple bids. The difficulty of making such an evaluation with limited information can create a cognitive barrier to proceeding with the investment. This analysis leverages recently available data from EnergySage, an online solar marketplace, to offer the first data-driven characterization of quote variation faced by prospective PV customers, lending early insight into the decisions customers face once they have initial buy-in.

  3. Smart PV grid to reinforce the electrical network

    Science.gov (United States)

    AL-Hamad, Mohamed Y.; Qamber, Isa S.

    2017-11-01

    Photovoltaic (PV) became the new competitive energy resources of the planet and needs to be engaged in grid to break up the congestion in both Distribution and Transmission systems. The objective of this research is to reduce the load flow through the distribution and transmission equipment by 20%. This reduction will help in relief networks loaded equipment's in all networks. Many projects are starting to develop in the GCC countries and need to be organized to achieve maximum benefits from involving the Renewable Energy Sources (RES) in the network. The GCC countries have a good location for solar energy with high intensity of the solar radiation and clear sky along the year. The opportunities of the solar energy is to utilize and create a sustainable energy resource for this region. Moreover, the target of this research is to engage the PV technology in such a way to lower the over loaded equipment and increases the electricity demand at the consumer's side.

  4. PV modules, using color solar cells, designed for building

    Energy Technology Data Exchange (ETDEWEB)

    Ishikawa, N.; Yamashita, H.; Goda, S. [Daido Hoxan Inc., Chitose, Hokkaido (Japan). Chitose Research Lab.] [and others

    1994-12-31

    The designs and structures of a photovoltaic module to be installed in a curtain wall were examined with the object of sharply reducing PV power generation costs. As for the design, solar cells of different colors were produced and an opinion survey of designers and other construction-related persons was conducted. Renderings based on color solar cells were prepared using computer graphics. In general, the output of cells decreases for colors other than shades of dark blue. However, there is a good possibility that greater importance will be put on design, including color and surface condition, than on output. In this case, the market share may expand and as a result, the cost may drop. As for the structure, various materials that can be used for a building-material-integrated-module were investigated and methods to install PV modules into building materials were examined. Moreover, experimental module samples fitted with stainless steel sheets and aluminum-sash frames were made.

  5. Design and control of a standalone PV water pumping system

    Directory of Open Access Journals (Sweden)

    Essam E. Aboul Zahab

    2017-09-01

    Full Text Available Water resources are vital for satisfying human needs. However, almost one-fifth of the world’s population – about 1.2 billion people – live in areas where water is physically rare. One quarter of the global population also live in developing countries that face water shortages. This paper presents standalone PV water pumping system. Photovoltaic (PV is the main power source, and lead acid batteries are used as energy storage system, to supply a water pump driven by a BLDC motor. The proposed control strategy consists of three control units. The first unit is to control the speed and hysteresis current controller for BLDC motor. The maximum power point tracking (MPPT is the second control unit, and the battery charging/discharging system is controlled by the third controller. The simulation results show the effectiveness and the good efficiency of the proposed system.

  6. Maximizing Solar Energy Capture Through Multi-Azimuth PV Arrays

    Science.gov (United States)

    Dahl, T. S.

    2013-12-01

    By orienting photovoltaic (PV) arrays in multiple directions, significantly greater energy capture can be realized in high latitude locations. Conventional wisdom dictates orienting PV panels south (in the northern hemisphere), but multi-azimuth arrays can confer several advantages during the summer months: - Nearly even power production over a large part of the day (20+ hours) - Reduced issues with power quality in grid interactive systems - Support higher loads in independent, off-grid systems - Reduced energy storage (battery) requirements in off-grid systems This poster will present two multi-azimuth systems, one a grid-interactive system deployed at Summit Station, Greenland; the second an independent, off-grid system supporting a science project near Toolik Field Station, Alaska.

  7. High Penetration PV: How High Can We Go?

    Energy Technology Data Exchange (ETDEWEB)

    2016-01-01

    Brochure highlighting NREL's partnership with SolarCity and Hawaiian Electric (HECO) to increase the penetration of solar photovoltaics on the electricity grid. To better understand the potential impact of transient overvoltages due to load rejection, NREL collaborated with SolarCity and HECO to run a series of tests measuring the magnitude and duration of load rejection overvoltage events and demonstrating the ability of advanced PV inverters to mitigate their impacts.

  8. Pv rural electrification programme at the Bolivian high plateau

    Energy Technology Data Exchange (ETDEWEB)

    Lorenzo, E.; Aguilera, J. [Instituto de Energia Solar, ETSI Telecomunicacion, (Spain)

    1995-12-31

    Since 1988 the Institute of Solar Energy of the Universidad Politecnica de Madrid is carrying out a pv rural electrification programme at the Bolivian high plateau. This programme has been focused in three aspects: the domestic electrification, users participation and transfer technology. At present, there are about 1,500 electrified dwellings distributed in the Bolivian high plateau. We have got deep knowledge about life style and organization of the aymara Indians who are the inhabitants of the working zone. We think that this knowledge can be very useful for a large scale introduction of PV solar energy in this region. Finally, we present a new way to transfer PV technology to developing countries. Thanks to this programme a group of aymara Indians is able to manufacture charge regulators and electronic ballast to use in the PV installations of the programme. [Espanol] Desde 1988 el Instituto de Energia Solar de la Universidad Politecnica de Madrid esta llevando a cabo un programa fotovoltaico de electrificacion rural en la altiplanicie Boliviana. Este programa ha sido enfocado a tres aspectos: la electrificacion domestica, la participacion de los usuarios y la transferencia de la tecnologia. Actualmente, hay alrededor de 1500 conjuntos habitacionales electrificados distribuidos en la altiplanicie Boliviana. Hemos obtenido un profundo conocimiento del estilo de vida y de la organizacion de los indios aymara que son los habitantes de la zona de trabajo. Pensamos que este conocimiento puede ser muy util para una introduccion en gran escala de la energia solar fotovoltaica en esta region. Finalmente, presentamos una nueva forma de transferir la tecnologia fotovoltaica a paises en desarrollo. Gracias a este programa un grupo de indios aymara pueden fabricar reguladores de carga y balastros electronicos para ser usados en instalaciones fotovoltaicas del programa.

  9. Commercial breaks: building the market for PV in Africa

    International Nuclear Information System (INIS)

    Hankins, M.

    2001-01-01

    The article focuses on the huge potential market for off-grid photovoltaics in Africa, in the sub-Saharan region in particular. However, so far the potential market remains largely untapped and several multimillion-dollar projects aimed at developing the market have been disappointing. The result has been a reduction in the activities of PV companies in Africa. The article seeks reasons for the lack of success and offers suggestions for improving the situation

  10. On the Impact of Partial Shading on PV Output Power

    DEFF Research Database (Denmark)

    Sera, Dezso; Baghzouz, Yahia

    2008-01-01

    It is a well-documented fact that partial shading of a photovoltaic array reduces it output power capability. However, the relative amount of such degradation in energy production cannot be determined in a straight forward manner, as it is often not proportional to the shaded area. This paper...... is illustrated by measurements on a commercial 70 W panel, and a 14.4 kW PV array....

  11. MPC of Single Phase Inverter for PV System

    OpenAIRE

    Irtaza M. Syed; Kaamran Raahemifar

    2014-01-01

    This paper presents a model predictive control (MPC) of a utility interactive (UI) single phase inverter (SPI) for a photovoltaic (PV) system at residential/distribution level. The proposed model uses single-phase phase locked loop (PLL) to synchronize SPI with the grid and performs MPC control in a dq reference frame. SPI model consists of boost converter (BC), maximum power point tracking (MPPT) control, and a full bridge (FB) voltage source inverter (VSI). No PI regula...

  12. Model Predictive Control of Three Phase Inverter for PV Systems

    OpenAIRE

    Irtaza M. Syed; Kaamran Raahemifar

    2015-01-01

    This paper presents a model predictive control (MPC) of a utility interactive three phase inverter (TPI) for a photovoltaic (PV) system at commercial level. The proposed model uses phase locked loop (PLL) to synchronize the TPI with the power electric grid (PEG) and performs MPC control in a dq reference frame. TPI model consists of a boost converter (BC), maximum power point tracking (MPPT) control, and a three-leg voltage source inverter (VSI). The operational model of ...

  13. Sizing PV-wind hybrid energy system for lighting

    Directory of Open Access Journals (Sweden)

    Mustafa Engin

    2012-09-01

    Full Text Available Sizing of wind and photovoltaic generators ensures lower operational costs and therefore, is considered as an important issue. An approach for sizing along with a best management technique for a PV-wind hybrid system with batteries is proposed in this paper, in which the best size for every component of the system could be optimized according to the weather conditions and the load profile. The average hourly values for wind speed and solar radiation for Izmir, Turkey has been used in the design of the systems, along with expected load profile. A hybrid power model is also developed for battery operation according to the power balance between generators and loads used in the software, to anticipate performances for the different systems according to the different weather conditions. The output of the program will display the performance of the system during the year, the total cost of the system, and the best size for the PV-generator, wind generator, and battery capacity. Using proposed procedure, a 1.2 kWp PV-wind hybrid system was designed for Izmir, and simulated and measured results are presented.

  14. Measurement uncertainty analysis techniques applied to PV performance measurements

    International Nuclear Information System (INIS)

    Wells, C.

    1992-10-01

    The purpose of this presentation is to provide a brief introduction to measurement uncertainty analysis, outline how it is done, and illustrate uncertainty analysis with examples drawn from the PV field, with particular emphasis toward its use in PV performance measurements. The uncertainty information we know and state concerning a PV performance measurement or a module test result determines, to a significant extent, the value and quality of that result. What is measurement uncertainty analysis? It is an outgrowth of what has commonly been called error analysis. But uncertainty analysis, a more recent development, gives greater insight into measurement processes and tests, experiments, or calibration results. Uncertainty analysis gives us an estimate of the I interval about a measured value or an experiment's final result within which we believe the true value of that quantity will lie. Why should we take the time to perform an uncertainty analysis? A rigorous measurement uncertainty analysis: Increases the credibility and value of research results; allows comparisons of results from different labs; helps improve experiment design and identifies where changes are needed to achieve stated objectives (through use of the pre-test analysis); plays a significant role in validating measurements and experimental results, and in demonstrating (through the post-test analysis) that valid data have been acquired; reduces the risk of making erroneous decisions; demonstrates quality assurance and quality control measures have been accomplished; define Valid Data as data having known and documented paths of: Origin, including theory; measurements; traceability to measurement standards; computations; uncertainty analysis of results

  15. Energy Yield of Tracking PV Systems in Jordan

    Directory of Open Access Journals (Sweden)

    A. Al Tarabsheh

    2012-01-01

    Full Text Available This paper analyzes the energy yield of photovoltaic (PV modules mounted on fixed tilt, one-axis, and two-axis tracking system towards maximizing the annual energy production. The performance evaluation of the proposed design of the tracking systems is carried via simulating the global radiation averages using METEONORM software and depicting the simulation results in figures using MATLAB software. The one-axis system is simulated by either fixing the azimuth angle while optimizing the inclination angles or fixing the inclination angle while optimizing the azimuth angles; simulation results show an increase in energy yield of 5.87% and 20.12% compared to that of fixed tilt system, respectively. In the two-axis system, optimization of both azimuth and inclination angles is carried out simultaneously which resulted in 30.82% improvement in energy yield. Therefore, 30% improvement in energy yield is directly reflected as saving in PV system cost due to reduction of the PV modules surface area.

  16. Pv rural electrification in Kiribati: A case study

    Energy Technology Data Exchange (ETDEWEB)

    Hurry, Suresh [Energy and Atmosphere Programme, SEED/BPPS UNDP, New York (United States)

    1995-12-31

    In collaboration with the Japan International Cooperation Agency (JICA), United Nations Development Programme (UNDP) participated in the implementation of a photovoltaic (PV) rural electrification project in Kiribati. Under this project, assistance was provided to the Kiribati Solar Energy Company (SEC) in order to enable it to provide electricity service as a micro utility in a effective manner. The assistance provided included installation of 55 PV-based solar home systems and one community system. In addition, the assistance focussed on technical training of SEC personnel on PV systems and management training on accounting, billing, spare parts inventory, etcetera. [Espanol] En colaboracion con la Japan International Cooperation Agency (JICA), el Programa de las Naciones Unidas para el Desarrollo (PNUD) participo en la puesta en practica de un proyecto de electrificacion rural fotovoltaico en Kiribati. Dentro de este proyecto, se proporciono ayuda a la Kiribati Solar Energy Company (SEC) para ponerla en condicion de suministrar el servicio electrico, en una forma efectiva, como una micro empresa electrica. La ayuda proporcionada incluyo la instalacion de 55 sistemas domesticos solares fotovoltaicos y un sistema comunitario. Adicionalmente, la ayuda se enfoco al entrenamiento tecnico del personal de SEC en sistemas fotovoltaicos y en el entrenamiento administrativo en contabilidad, facturacion, inventariado de partes de repuesto, etc.

  17. Comparative Study Between Wind and Photovoltaic (PV) Systems

    Science.gov (United States)

    Taha, Wesam

    This paper reviews two renewable energy systems; wind and photovoltaic (PV) systems. The common debate between the two of them is to conclude which one is better, in terms of cost and efficiency. Therefore, comparative study, in terms of cost and efficiency, is attempted. Regarding total cost of both, wind and PV systems, many parameters must be taken into consideration such as availability of energy (either wind or solar), operation and maintenance, availability of costumers, political influence, and the components used in building the system. The main components and parameters that play major role in determining the overall efficiency of wind systems are the wind turbine generator (WTG), gearbox and control technologies such as power, and speed control. On the other hand, in grid-connected PV systems (GCPVS), converter architecture along with maximum power point tracking (MPPT) algorithm and inverter topologies are the issues that affects the efficiency significantly. Cost and efficiency analyses of both systems have been carried out based on the statistics available till today and would be useful in the progress of renewable energy penetration throughout the world.

  18. Overcoming PV grid issues in the urban areas

    Energy Technology Data Exchange (ETDEWEB)

    Ehara, T.

    2009-10-15

    This report for the International Energy Agency (IEA) made by Task 10 of the Photovoltaic Power Systems (PVPS) programme takes a look at grid issues in urban photovoltaic electricity and how to overcome them. The mission of the Photovoltaic Power Systems Programme is to enhance the international collaboration efforts which accelerate the development and deployment of photovoltaic solar energy as a significant and sustainable renewable energy option. The objective of Task 10 is stated as being to enhance the opportunities for wide-scale, solution-oriented application of photovoltaics in the urban environment. The paper discusses the goal of mainstreaming PV systems in the urban environment. In this report, PV grid interconnection issues and countermeasures based on the latest studies are identified and summarised. Appropriate and understandable information is provided for all possible stakeholders. Possible impacts and benefits of PV grid interconnection are identified, technical measures designed to eliminate negative impacts and enhance possible benefits are presented. The status of research and demonstration projects is introduced and the latest outcomes are summarised. Recommendations and conclusions based on the review process are summarised and presented.

  19. Economics of PV power supply for Libyan remote areas

    International Nuclear Information System (INIS)

    La-azebi, I.F.; Kagilik, A.S.; Bara, M.F.

    2000-01-01

    The electrical power supplies of remote and isolated areas has been and is still an issue for electric power companies worldwide. Usually there are three ways of supplying these remote areas mainly, the general grid, the Diesel generators, and photovoltaic power supply. The use of one of these systems instead of the other depend, on the availability, reliability, and cost. There are some isolated areas, which can t be supplied from the general grid as they are far away from it and economically not visible, so the electric power is needed of such isolated areas will be supplied either by Diesel generators or photovoltaics. The use of diesel generator demands a constant fuel supply, and maintenance staff, which also may not be available in small villages. Therefore the PV generators in such cases are considered an ideal solution of supplying these areas. In Libya, a national program has been started to supply small villages and other loads in remote and isolated areas, with electricity using PV power supply. This paper presents an economical comparison between the two different alternatives of electric supply systems to be used in remote areas: Diesel generators and PV systems. (Author)

  20. Neutron spectral characterization of the PCA-PV benchmark facility

    International Nuclear Information System (INIS)

    Stallmann, F.W.; Kam, F.B.K.; Fabry, A.

    1980-01-01

    The Pool Critical Assembly (PCA) at the Oak Ridge National Laboratory is being used to generate the PCA-PV benchmark neutron field. A configuration consisting of steel blocks and water gaps is used to simulate the thermal shield pressure vessel configurations in power reactors. The distances between the steel blocks can be changed so that the penetration of neutrons through water and steel can be determined and compared for many different configurations. Easy access and low flux levels make it possible to conduct extensive measurements using active and passive neutron dosimetry, which are impossible to perform in commercial reactors. The clean core and simple geometry facilitates neutron transport calculations which can be validated in detail by comparison with measurements. A facility which has the same configuration of water and steel as the PCA-PV facility but contains test specimens for materials testing, will be irradiated in the higher fluxes at the Oak Ridge Research Reactor. Using the results from the PCA-PV facility, the correlation between neutron flux-fluences and radiation damage in steel can be established. This facility is being discussed in a separate paper

  1. Thin film PV manufacturing. Materials costs and their optimization

    Energy Technology Data Exchange (ETDEWEB)

    Zweibel, K. [National Renewable Energy Laboratory, Thin Film PV Partnership, 1617 Cole Boulevard, 80401 Golden, CO (United States)

    2000-08-31

    Thin film PV technologies face a number of hurdles as they advance towards low-cost goals that would make them competitive with traditional sources of electricity. The US Department of Energy cost goal for thin films is about $0.33/W{sub p}, which corresponds to module efficiencies of about 15% and module manufacturing costs of about $50/m{sup 2}. Past papers have provided a framework for examining thin film efficiencies and manufacturing costs, especially those costs for equipment, labor, materials, utilities, and others. Although materials costs appear to be a large fraction of the total, we have not yet broken them down in enough detail to seek significant improvement. In the future, with more mature thin film production, materials costs such as those from semiconductor layers, contacts, pottants, substrates, and electrical interconnection will dominate total module cost. This paper (1) breaks down the materials costs into two broad categories (active and inactive materials) and then (2) investigates the issues associated with reducing their costs much below today's levels. Materials will likely be such an overwhelming cost-driver for mature manufacturing of thin film PV that issues associated with their optimization should be examined as soon as possible in order to meet the DOE long-term goals for PV module costs.

  2. Performance of a directly-coupled PV water pumping system

    International Nuclear Information System (INIS)

    Mokeddem, Abdelmalek; Midoun, Abdelhamid; Kadri, D.; Hiadsi, Said; Raja, Iftikhar A.

    2011-01-01

    Highlights: → Directly coupled PV water pumping system installed and performance studied. → Configured for two static heads, operate without electronic control and auxiliary power. → The system attains steady state soon after any abrupt change. → Cost effective and useful for low head communicating wells system. - Abstract: This paper describes the experimental study carried out to investigate the performance of a simple, directly coupled dc photovoltaic (PV) powered water pumping system. The system comprises of a 1.5 kWp PV array, dc motor and a centrifugal pump. The experiment was conducted over a period of 4 months and the system performance was monitored under different climatic conditions and varying solar irradiance with two static head configurations. Although the motor-pump efficiency did not exceed 30%, which is typical for directly-coupled photovoltaic pumping systems, such a system is clearly suitable for low head irrigation in the remote areas, not connected to the national grid and where access to water comes as first priority issue than access to technology. The system operates without battery and complex electronic control, therefore not only the initial cost is low but also maintenance, repairing and replacement cost can be saved. The study showed that directly coupled system attains steady state soon after any abrupt change.

  3. Differential interactions between Curtobacterium flaccumfaciens pv. flaccumfaciens and common bean.

    Science.gov (United States)

    Valdo, S C D; Wendland, A; Araújo, L G; Melo, L C; Pereira, H S; Melo, P G; Faria, L C

    2016-11-21

    Bacterial wilt of common bean caused by Curtobacterium flaccumfaciens pv. flaccumfaciens is an important disease in terms of economic importance. It reduces grain yield by colonizing xylem vessels, subsequently impeding the translocation of water and nutrients to the superior plant parts. The existence of physiological races in C. flaccumfaciens pv. flaccumfaciens has not so far been reported. The objective of the present investigation was to identify physiological races, evaluate differential interaction, and select resistant genotypes of common bean. Initially, 30 genotypes of common bean were inoculated with eight isolates exhibiting different levels of aggressiveness, under controlled greenhouse conditions. Disease was assessed 15 days after inoculation. The existence of differential interactions between C. flaccumfaciens pv. flaccumfaciens isolates and common bean genotypes were identified by utilizing partial diallel analysis. The most aggressive isolates were BRM 14939 and BRM 14942 and the least aggressive isolates were BRM 14941 and BRM 14946. The genotypes IPA 9, Ouro Branco, and Michelite were selected as more resistant among the test isolates. The genotypes IAC Carioca Akytã, BRS Notável, Pérola, IAC Carioca Aruã, and Coquinho contributed more to the isolate x genotype interaction according to the ecovalence method of estimation, and were, therefore, indicated as differentials. Based on these results, it was possible to conclude that physiological races of the pathogen exist, to select resistant genotypes, and to propose a set of differentials.

  4. Rooftop PV system. Final technical progress report, Phase II

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-08-01

    Under this four-year PV:BONUS Program, ECD and United Solar are developing and demonstrating two new lightweight flexible building integrated Photovoltaic (BIPV) modules specifically designed as exact replacements for conventional asphalt shingles and standing seam metal roofing. These modules can be economically and aesthetically integrated into new residential and commercial buildings, and address the even larger roofing replacement market. The modules are designed to be installed by roofing contractors without special training which minimizes the installation and balance of system costs. The modules will be fabricated from high-efficiency, multiple-junction a-Si alloy solar cells developed by ECD and United Solar. Under the Phase I Program, which ended in March 1994, we developed two different concept designs for rooftop PV modules: (1) the United Solar overlapping (asphalt shingle replacement) shingle-type modules and (2) the ECD metal roof-type modules. We also developed a plan for fabricating, testing and demonstrating these modules. Candidate demonstration sites for our rooftop PV modules were identified and preliminary engineering designs for these demonstrations were developed; a marketing study plan was also developed. The major objectives of the Phase II Program, which started in June 1994 was (1) to develop, test, and qualify these new rooftop modules; (2) to develop mechanical and electrical engineering specifications for the demonstration projects; and (3) to develop a marketing/commercialization plan.

  5. Sizing procedures for sun-tracking PV system with batteries

    Science.gov (United States)

    Nezih Gerek, Ömer; Başaran Filik, Ümmühan; Filik, Tansu

    2017-11-01

    Deciding optimum number of PV panels, wind turbines and batteries (i.e. a complete renewable energy system) for minimum cost and complete energy balance is a challenging and interesting problem. In the literature, some rough data models or limited recorded data together with low resolution hourly averaged meteorological values are used to test the sizing strategies. In this study, active sun tracking and fixed PV solar power generation values of ready-to-serve commercial products are recorded throughout 2015-2016. Simultaneously several outdoor parameters (solar radiation, temperature, humidity, wind speed/direction, pressure) are recorded with high resolution. The hourly energy consumption values of a standard 4-person household, which is constructed in our campus in Eskisehir, Turkey, are also recorded for the same period. During sizing, novel parametric random process models for wind speed, temperature, solar radiation, energy demand and electricity generation curves are achieved and it is observed that these models provide sizing results with lower LLP through Monte Carlo experiments that consider average and minimum performance cases. Furthermore, another novel cost optimization strategy is adopted to show that solar tracking PV panels provide lower costs by enabling reduced number of installed batteries. Results are verified over real recorded data.

  6. Tropical field performance of dual-pass PV tray dryer

    Science.gov (United States)

    Iskandar, A. Noor; Ya'acob, M. E.; Anuar, M. S.

    2017-09-01

    Solar Photovoltaic technology has become the preferable solution in many countries around the globe to solve the ever increasing energy demand of the consumers. In line with the consumer need, food processing technology has huge potentials of integration with the renewable energy resources especially in drying process which consumes the highest electricity loads. Traditionally, the solar dryer technology was applied in agriculture and food industries utilizing the sun's energy for drying process, but this is highly dependable on the weather condition and surrounding factors. This work shares some field performance of the new design of portable dual-pass PV tray dryer for drying crops in an enclosed system. The dual-pass PV tray dryer encompass a lightweight aluminium box structure with dimensions of 1.1m (L) x 0.6m (W) x 0.2m (H) and can hold a load capacity of 300g - 3kg of crop depending on the types of the crops. Experiments of field performance monitoring were conducted in October -November 2016 which justifies a considerable reduction in time and crops quality improvement when using the dual-pass PV tray dryer as compared to direct-sun drying.

  7. Performance analysis of PV plants: Optimization for improving profitability

    International Nuclear Information System (INIS)

    Díez-Mediavilla, M.; Alonso-Tristán, C.; Rodríguez-Amigo, M.C.; García-Calderón, T.; Dieste-Velasco, M.I.

    2012-01-01

    Highlights: ► Real PV production from two 100 kW p grid-connected installations is conducted. ► Data sets on production were collected over an entire year. ► Economic results highlight the importance of properly selecting the system components. ► Performance of PV plants is directly related to improvements of all components. - Abstract: A study is conducted of real PV production from two 100 kW p grid-connected installations located in the same area, both of which experience the same fluctuations in temperature and radiation. Data sets on production were collected over an entire year and both installations were compared under various levels of radiation. The installations were assembled with mono-Si panels, mounted on the same support system, and the power supply was equal for the inverter and the measurement system; the same parameters were also employed for the wiring, and electrical losses were calculated in both cases. The results, in economic terms, highlight the importance of properly selecting the system components and the design parameters for maximum profitability.

  8. Combining ability for common bacterial blight resistance in snap and dry bean (Phaseolus vulgaris L.

    Directory of Open Access Journals (Sweden)

    Roberto dos Santos Trindade

    2014-11-01

    Full Text Available Common bacterial blight (CBB, which is caused by Xanthomonas axonopodis pv. phaseoli (Xap, is the main bacterial disease in snap beans and controlling this disease using resistant cultivars is still a challenge. This work aimed to study the combining ability for CBB resistance in Phaseolus vulgaris genotypes. Six parents (two genotypes of CBB-resistant dry bean and four susceptible snap bean accessions were crossed in a complete diallel scheme without reciprocals to estimate the general and specific ability to Xap resistance. CBB resistance was evaluated by the inoculation with two Xap isolates, and its severity was evaluated based on the four following resistance components: area under the disease progress curve; scores in the leaves; latent period and diameter of pod lesion. Differences between the two isolates were observed considering all the disease components. Besides pathogen variability, significant GCA and SCA indicate that additive and non-additive effects are involved in Xap-resistance control for the evaluated genotypes, implying that CBC resistance is a trait with complex inheritance. For breeding purposes, the result demonstrates the need to apply breeding methods that are focused on advanced generations selection.

  9. Antagonism of Bacillus spp. against Xanthomonas campestris pv. campestris

    Directory of Open Access Journals (Sweden)

    Leila Monteiro

    2005-01-01

    Full Text Available The antagonism of eight Bacillus isolates was investigated against nine strains of Xanthomonas campestris pv. campestris (causal agent of crucifers black rot to assess the role of lipopeptides in this process. Antimicrobial and hemolytic (surfactant activity tests were performed in vitro using agar diffusion methods. Antibiosis and hemolysis were positive for four Bacillus isolates against all X. campestris pv. campestris strains. The correlation observed between antimicrobial and hemolytic activities indicated that lipopeptides were involved in the antibiosis mechanism of the studied antagonists. Fermentation studies were carried out with the isolates that showed highest antimicrobial and hemolytic activities, to follow up growth and production of bioactive and surfactant compounds. Production of bioactive and surfactant compounds was observed during the late growth phase of the Bacillus isolates.Investigação sobre o antagonismo de oito isolados de Bacillus: B. subtilis R14, B. megaterium pv. cerealis RAB7, B. megaterium pv. cerealis C211, B. megaterium C116, Bacillus sp. RAB9, B. cereus C240, Bacillus sp. C11 e B. cereus C210, contra nove linhagens de X. campestris pv. campestris (bactéria responsável pela podridão negra das crucíferas foi realizada para se verificar a participação de lipopeptídeos neste mecanismo. Testes de atividades antimicrobiana e hemolítica (surfactante foram realizados, utilizando-se o método de difusão em ágar. Antibiose e hemólise foram positivas para quatro isolados de Bacillus: R14, RAB7, C116 e C210. A correlação observada entre as atividades antimicrobiana e a hemolítica indica que lipopeptídeos estão envolvidos no mecanismo de antibiose dos isolados investigados. As fermentações foram realizadas com os isolados que demonstraram melhores resultados nos testes de atividades antimicrobiana e hemolítica: R14, RAB7 e C116, para acompanhar o crescimento e a produção de compostos bioativos e

  10. PV-Developer. A Concept Paper. Version 4.0

    International Nuclear Information System (INIS)

    2001-10-01

    The market for Photovoltaic Energy systems is developing very rapidly with annual growth rates in the range of 20-40%. The growth creates new business opportunities for project development. The markets are immature and the competitiveness of PV is increasing, whereby it is important to develop the business concept within the next few years if the long-term aim is to become a major player in the field of PV-project development. Like in the field of wind energy, which has grown to a large-scale business area within the last decade, the long-term perspectives of photovoltaic energy will depend upon the market development, interest groups and stake holders. The solar power developers might be catalysts for high growth rates like in the wind energy field. The concern for global warming leads the international energy policies in favour of renewable energy incentives followed by the technological development of PV-equipment, which constantly improves the cost level of PV-produced electricity. The markets for PV-systems are geographically widespread and the way to implement systems goes to a large extent via financing from international governmental as well as non-governmental lateral and bilateral aid organisations. Lead times to develop projects are counted in years, and the time from the first project idea to the final commissioning of the installed plants might take 3-5 years. More specific studies of market segments and business opportunities, development of market penetration and design of strategy must be carried out. Organisation seems to be a major issue as the complexity of the projects and the project location in 3rd world countries as well as in the industrialised countries combined with high proportion of donor funding will require a high level of organisation and coordination. In general a detailed study should be made in order to create a business plan. The business plan must contain budgets, volume estimates, sensitivity analyses, organisational proposals

  11. Theoretical analysis and experimental study on the PV-IESAHP system

    Science.gov (United States)

    Wu, Xingying

    2017-05-01

    Solar photovoltaic/thermal integration (PV/T) and heat pump are very important techniques for energy conservation and carbon reduction. A practical design for an integrated PV/T and heat pump system is presented, the integrated system is called the Photovoltaic-Indirect Expansion Solar Assisted Heat Pump (PV-IESAHP) system, which uses the heat energy supplied by PV/T as an evaporating heat source and can achieve high coefficient of performance(COP). It is essential to master the completed design idea and thermodynamic analysis method for the integration of PV/T and heat pump. In this study a kind of theoretical and matching performance model of the PV-IESAHP system is established, and a series of experiments were conducted to study the performance of the heat-pipe type PV/T experimental system and heat hump experimental system. Moreover, energy and energy analyses were used to investigate the performance of the systems. The results show that the COP of the PV-IESAHP system is about 4.0, and the energy efficiency about 0.05, which not only implies that the PV-IESAHP system has a significant energy-saving potential, but also will provide a theoretical basis for the application and parameters design of the PV-IESAHP system in the future.

  12. Passive cooling of standalone flat PV module with cotton wick structures

    International Nuclear Information System (INIS)

    Chandrasekar, M.; Suresh, S.; Senthilkumar, T.; Ganesh karthikeyan, M.

    2013-01-01

    Highlights: • A simple passive cooling system is developed for standalone flat PV modules. • 30% Reduction in module temperature is observed with developed cooling system. • 15.61% Increase in output power of PV module is found with developed cooling system. • Module efficiency is increased by 1.4% with cooling arrangement. • Lower thermal degradation due to narrow range of temperature characteristics. - Abstract: In common, PV module converts only 4–17% of the incoming solar radiation into electricity. Thus more than 50% of the incident solar energy is converted as heat and the temperature of PV module is increased. The increase in module temperature in turn decreases the electrical yield and efficiency of the module with a permanent structural damage of the module due to prolonged period of thermal stress (also known as thermal degradation of the module). An effective way of improving efficiency and reducing the rate of thermal degradation of a PV module is to reduce the operating temperature of PV module. This can be achieved by cooling the PV module during operation. Hence in the present work, a simple passive cooling system with cotton wick structures is developed for standalone flat PV modules. The thermal and electrical performance of flat PV module with cooling system consisting of cotton wick structures in combination with water, Al 2 O 3 /water nanofluid and CuO/water nanofluid are investigated experimentally. The experimental results are also compared with the thermal and electrical performance of flat PV module without cooling system

  13. On-line monitoring system of PV array based on internet of things technology

    Science.gov (United States)

    Li, Y. F.; Lin, P. J.; Zhou, H. F.; Chen, Z. C.; Wu, L. J.; Cheng, S. Y.; Su, F. P.

    2017-11-01

    The Internet of Things (IoT) Technology is used to inspect photovoltaic (PV) array which can greatly improve the monitoring, performance and maintenance of the PV array. In order to efficiently realize the remote monitoring of PV operating environment, an on-line monitoring system of PV array based on IoT is designed in this paper. The system includes data acquisition, data gateway and PV monitoring centre (PVMC) website. Firstly, the DSP-TMS320F28335 is applied to collect indicators of PV array using sensors, then the data are transmitted to data gateway through ZigBee network. Secondly, the data gateway receives the data from data acquisition part, obtains geographic information via GPS module, and captures the scenes around PV array via USB camera, then uploads them to PVMC website. Finally, the PVMC website based on Laravel framework receives all data from data gateway and displays them with abundant charts. Moreover, a fault diagnosis approach for PV array based on Extreme Learning Machine (ELM) is applied in PVMC. Once fault occurs, a user alert can be sent via E-mail. The designed system enables users to browse the operating conditions of PV array on PVMC website, including electrical, environmental parameters and video. Experimental results show that the presented monitoring system can efficiently real-time monitor the PV array, and the fault diagnosis approach reaches a high accuracy of 97.5%.

  14. A Non-Modeling Exploration of Residential Solar Photovoltaic (PV) Adoption and Non-Adoption

    Energy Technology Data Exchange (ETDEWEB)

    Moezzi, Mithra [Portland State Univ., Portland, OR (United States); Ingle, Aaron [Portland State Univ., Portland, OR (United States); Lutzenhiser, Loren [Portland State Univ., Portland, OR (United States); Sigrin, Benjamin O. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-09-01

    Although U.S. deployment of residential rooftop solar photovoltaic (PV) systems has accelerated in recent years, PV is still installed on less than 1 percent of single-family homes. Most research on household PV adoption focuses on scaling initial markets and modeling predicted growth rather than considering more broadly why adoption occurs. Among the studies that have investigated the characteristics of PV adoption, most collected data from adopters, sometimes with additional non-adopter data, and rarely from people who considered but did not adopt PV. Yet the vast majority of Americans are non-adopters, and they are a diverse group - understanding their ways of evaluating PV adoption is important. Similarly, PV is a unique consumer product, which makes it difficult to apply findings from studies of other technologies to PV. In addition, little research addresses the experience of households after they install PV. This report helps fill some of these gaps in the existing literature. The results inform a more detailed understanding of residential PV adoption, while helping ensure that adoption is sufficiently beneficial to adopters and even non-adopters.

  15. Distributed solar radiation fast dynamic measurement for PV cells

    Science.gov (United States)

    Wan, Xuefen; Yang, Yi; Cui, Jian; Du, Xingjing; Zheng, Tao; Sardar, Muhammad Sohail

    2017-10-01

    To study the operating characteristics about PV cells, attention must be given to the dynamic behavior of the solar radiation. The dynamic behaviors of annual, monthly, daily and hourly averages of solar radiation have been studied in detail. But faster dynamic behaviors of solar radiation need more researches. The solar radiation random fluctuations in minute-long or second-long range, which lead to alternating radiation and cool down/warm up PV cell frequently, decrease conversion efficiency. Fast dynamic processes of solar radiation are mainly relevant to stochastic moving of clouds. Even in clear sky condition, the solar irradiations show a certain degree of fast variation. To evaluate operating characteristics of PV cells under fast dynamic irradiation, a solar radiation measuring array (SRMA) based on large active area photodiode, LoRa spread spectrum communication and nanoWatt MCU is proposed. This cross photodiodes structure tracks fast stochastic moving of clouds. To compensate response time of pyranometer and reduce system cost, the terminal nodes with low-cost fast-responded large active area photodiode are placed besides positions of tested PV cells. A central node, consists with pyranometer, large active area photodiode, wind detector and host computer, is placed in the center of the central topologies coordinate to scale temporal envelope of solar irradiation and get calibration information between pyranometer and large active area photodiodes. In our SRMA system, the terminal nodes are designed based on Microchip's nanoWatt XLP PIC16F1947. FDS-100 is adopted for large active area photodiode in terminal nodes and host computer. The output current and voltage of each PV cell are monitored by I/V measurement. AS62-T27/SX1278 LoRa communication modules are used for communicating between terminal nodes and host computer. Because the LoRa LPWAN (Low Power Wide Area Network) specification provides seamless interoperability among Smart Things without the

  16. EcPV2 DNA in equine genital squamous cell carcinomas and normal genital mucosa.

    Science.gov (United States)

    Bogaert, Lies; Willemsen, Anouk; Vanderstraeten, Eva; Bracho, Maria A; De Baere, Cindy; Bravo, Ignacio G; Martens, Ann

    2012-07-06

    Squamous cell carcinoma (SCC) represents the most common genital malignant tumor in horses. Similar to humans, papillomaviruses (PVs) have been proposed as etiological agents and recently Equine papillomavirus type 2 (EcPV2) has been identified in a subset of genital SCCs. The goals of this study were (1) to determine the prevalence of EcPV2 DNA in tissue samples from equine genital SCCs, penile intraepithelial neoplasia (PIN) and penile papillomas, using EcPV2-specific PCR, (2) to examine the prevalence of latent EcPV2 infection in healthy genital mucosa and (3) to determine genetic variability within EcPV2 and to disentangle phylogenetic relationships of EcPV2 among PVs. EcPV2 DNA was detected in all but one penile SCC (15/16), in all PIN lesions (8/8) and penile papillomas (4/4). Additionally, EcPV2 DNA was demonstrated in one of two metastasized lymph nodes, one contact metastasis in the mouth, two vaginal and one anal lesion. In healthy horses, EcPV2 DNA was detected in 10% (4/39) of penile swabs but in none of vulvovaginal swabs (0/20). This study confirms the presence of EcPV2 DNA in equine genital SCCs and shows its involvement in anal lesions, a lymph node and contact metastases. Latent EcPV2 presence was also shown in normal male genital mucosa. We found that different EcPV2 variants cocirculate among horses and that EcPV2 is related to the Delta+Zeta PVs and is only a very distant relative of high-risk human PVs causing genital cancer. Thus, similar viral tropism and similar malignant outcome of the infection do not imply close evolutionary relationship. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. Very Thin Flexible Coupled Inductors for PV Module Integrated GaN Converter

    DEFF Research Database (Denmark)

    Acanski, Milos; Ouyang, Ziwei; Popovic-Gerber, Jelena

    2012-01-01

    proposed with more granular power processing by means of distributed maximum power point tracking (DMPPT). This is achieved by adjoining a MPPT unit to each PV module in the PV array. This paper presents a step further in the distributed power tracking approach, with a concept of very low profile power......As the PV energy penetrates into the urban area, shortcomings of the conventional centralized PV system architectures become more pronounced under the influence of urban environment with shading, soiling and orientation mismatch issues. To overcome these limitations new PV system architectures were...... converter integrated directly into a low cost flexible PV module. Additional problems arise in this case, specifically in magnetics design, due to the requirements for very low profile flexible construction and limited thermal headroom. Overcoming these limitations presents a challenge, but can lead...

  18. Photovoltaics (PV) as an Eligible Measure in Residential PACE Programs: Benefits and Challenges (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    Coughlin, J.

    2010-06-01

    Property Assessed Clean Energy (PACE) financing is one of several new financial models broadening access to clean energy by addressing the barrier of initial capital cost. The majority of the PACE programs in the market today include PV as an eligible measure. PV appeals to homeowners as a way to reduce utility bills, self-generate sustainable power, increase energy independence and demonstrate a commitment to the environment. If substantial state incentives for PV exist, PV projects can be economic under PACE, especially when partnered with good net metering policies. At the same time, PV is expensive relative to other eligible measures with a return on investment horizon that might exceed program targets. This fact sheet reviews the benefits and potential challenges of including PV in PACE programs.

  19. Grid Integration of PV Power based on PHIL testing using different Interface Algorithms

    DEFF Research Database (Denmark)

    Craciun, Bogdan-Ionut; Kerekes, Tamas; Sera, Dezso

    2013-01-01

    Photovoltaic (PV) power among all renewable energies had the most accelerated growth rate in terms of installed capacity in recent years. Transmission System Operators (TSOs) changed their perspective about PV power and started to include it into their planning and operation, imposing PV systems...... to be more active in grid support. Therefore, a better understanding and detailed analysis of the PV systems interaction with the grid is needed; hence power hardware in the loop (PHIL) testing involving PV power became an interesting subject to look into. To test PV systems for grid code (GC) compliance...... and supply of ancillary services, first the grid has to be simulated using PHIL, but in order to achieve it, different interface algorithms (IA) had to be evaluated in terms of system stability and signal accuracy....

  20. A Simple and Efficient MPPT Method for Low-Power PV Cells

    Directory of Open Access Journals (Sweden)

    Maria Teresa Penella

    2014-01-01

    Full Text Available Small-size PV cells have been used to power sensor nodes. These devices present limited computing resources and so low complexity methods have been used in order to extract the maximum power from the PV cells. Among them, the fractional open circuit voltage (FOCV method has been widely proposed, where the maximum power point of the PV cell is estimated from a fraction of its open circuit voltage. Here, we show a generalization of the FOCV method that keeps its inherent simplicity and improves the tracking efficiency. First, a single-diode model for PV cells was used to compute the tracking efficiency versus irradiance. Computations were carried out for different values of the parameters involved in the PV cell model. The proposed approach clearly outperformed the FOCV method, specially at low irradiance, which is significant for powering sensor nodes. Experimental tests performed with a 500 mW PV panel agreed with these results.

  1. Wide-band gap devices in PV systems - opportunities and challenges

    DEFF Research Database (Denmark)

    Sintamarean, Nicolae Cristian; Eni, Emanuel-Petre; Blaabjerg, Frede

    2014-01-01

    have an important role in the cost reduction. To increase the efficiency of PV systems, most of solutions for PV inverters have moved to three-level (3L) structures reaching typical efficiencies of 98% due to low switching losses of 600V Si IGBT or MOSFET and reduced core losses in the filter......The recent developments in wide band-gap devices based GaN and SiC is showing a high impact on the PV-inverter technology, which is strongly influenced by efficiency, power density and cost. Besides the high efficiency of PV inverters, also the mechanical size, the compactness and simple structure......) three-phase PV-inverter topologies in terms of efficiency, thermal loading distribution and costs. Moreover the above mentioned PV-inverters are built and tested in laboratory in order to validate the obtained results....

  2. Delta Power Control Strategy for Multi-String Grid-Connected PV Inverters

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Blaabjerg, Frede

    2016-01-01

    With a still increasing penetration level of grid-connected PV systems, more advanced active power control functionalities have been introduced in certain grid regulations. A delta power constraint, where a portion of the active power from the PV panels is reserved during operation, is required...... for grid support (e.g., during frequency deviation). In this paper, a cost-effective solution to realize delta power control for grid-connected PV systems is presented, where the residential/commercial multi-string PV inverter configuration is adopted. This control strategy is a combination of Maximum...... for the entire PV system is achieved. Simulations and experiments have been performed on a 3-kW single-phase grid-connected PV system. The results have confirmed the effectiveness of the delta power control strategy, where the power reserve according to the delta power constraint is achieved under several...

  3. Very Thin Flexible Coupled Inductors for PV Module Integrated GaN Converter

    DEFF Research Database (Denmark)

    Acanski, Milos; Ouyang, Ziwei; Popovic-Gerber, Jelena

    2012-01-01

    As the PV energy penetrates into the urban area, shortcomings of the conventional centralized PV system architectures become more pronounced under the influence of urban environment with shading, soiling and orientation mismatch issues. To overcome these limitations new PV system architectures were...... proposed with more granular power processing by means of distributed maximum power point tracking (DMPPT). This is achieved by adjoining a MPPT unit to each PV module in the PV array. This paper presents a step further in the distributed power tracking approach, with a concept of very low profile power...... converter integrated directly into a low cost flexible PV module. Additional problems arise in this case, specifically in magnetics design, due to the requirements for very low profile flexible construction and limited thermal headroom. Overcoming these limitations presents a challenge, but can lead...

  4. Designing PV Incentive Programs to Promote Performance: A Reviewof Current Practice

    Energy Technology Data Exchange (ETDEWEB)

    Barbose, Galen; Wiser, Ryan; Bolinger, Mark

    2007-06-01

    Increasing levels of financial support for customer-sited photovoltaic (PV) systems, provided through publicly-funded incentive programs, has heightened concerns about the long-term performance of these systems. Given the barriers that customers face to ensuring that their PV systems perform well, and the responsibility that PV incentive programs bear to ensure that public funds are prudently spent, these programs should, and often do, play a critical role in ensuring that PV systems receiving incentives perform well. To provide a point of reference for assessing the current state of the art, and to inform program design efforts going forward, we examine the approaches to encouraging PV system performance used by 32 prominent PV incentive programs in the U.S. We identify eight general strategies or groups of related strategies that these programs have used to address performance issues, and highlight important differences in the implementation of these strategies among programs.

  5. NREL PV working with industry, first quarter 2000; pulling out all the stops

    Energy Technology Data Exchange (ETDEWEB)

    Moon, S.; Poole, L.; Cook, G.

    2000-05-03

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The First Quarter, 2000, issue offers an in-depth look at the PV Program's Five Year Plan and the PV industry's progress in developing a 20-year roadmap. The editorialist is Roger Little, President and CEO of Spire Corporation and a member of the NCPV Advisory Board.

  6. Distributed Solar PV for Electricity System Resiliency: Policy and Regulatory Considerations (Brochure)

    Energy Technology Data Exchange (ETDEWEB)

    2014-11-01

    Distributed Solar PV systems have the potential of increasing the grid's resiliency to unforeseen events, such as extreme weather events and attacks. This paper presents the role that distributed PV can play in electric grid resiliency, introduces basic system design requirements and options, and discusses the regulatory and policy options for supporting the use of distributed PV for the purpose of increased electricity resiliency.

  7. Transformer operating conditions under introduction of PV and EVs in an eco-district

    OpenAIRE

    Dang , Xuan-Linh; Petit , Marc; Codani , Paul

    2015-01-01

    International audience; —An analysis of the operating conditions of a power transformer with the introduction of photovoltaic (PV) panels and Electric Vehicles (EV) in an eco-district is conducted. The study focuses on: (a) determining the optimal transformer sizing when there is neither PV nor EV; and (b) characterizing the overloading periods of the transformer induced by the penetration of PV sources and EVs in the district. We compare two EV integration strategies: they are either conside...

  8. Using Residential Solar PV Quote Data to Analyze the Relationship Between Installer Pricing and Firm Size

    Energy Technology Data Exchange (ETDEWEB)

    O' Shaughnessy, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-05-19

    We use residential solar photovoltaic (PV) quote data to study the role of firm size in PV installer pricing. We find that large installers (those that installed more than 1,000 PV systems in any year from 2013 to 2015) quote higher prices for customer-owned systems, on average, than do other installers. The results suggest that low prices are not the primary value proposition of large installers.

  9. Grid Support in Large Scale PV Power Plants using Active Power Reserves

    OpenAIRE

    Craciun, Bogdan-Ionut

    2014-01-01

    Photovoltaic (PV) systems are in the 3rd place in the renewable energy market, after hydro and wind power. The increased penetration of PV within the electrical power system has led to stability issues of the entire grid in terms of its reliability, availability and security of the supply. As a consequence, Large scale PV Power Plants (LPVPPs) operating in Maximum Power Point (MPP) are not supporting the electrical network, since several grid triggering events or the increased number of downw...

  10. Final Technical Report: Advanced Measurement and Analysis of PV Derate Factors.

    Energy Technology Data Exchange (ETDEWEB)

    King, Bruce Hardison [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Burton, Patrick D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hansen, Clifford [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Christian Birk [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    The Advanced Measurement and Analysis of PV Derate Factors project focuses on improving the accuracy and reducing the uncertainty of PV performance model predictions by addressing a common element of all PV performance models referred to as “derates”. Widespread use of “rules of thumb”, combined with significant uncertainty regarding appropriate values for these factors contribute to uncertainty in projected energy production.

  11. Using Residential Solar PV Quote Data to Analyze the Relationship Between Installer Pricing and Firm Size

    Energy Technology Data Exchange (ETDEWEB)

    O' Shaughnessy, Eric; Margolis, Robert

    2017-05-18

    We use residential solar photovoltaic (PV) quote data to study the role of firm size in PV installer pricing. We find that large installers (those that installed more than 1,000 PV systems in any year from 2013 to 2015) quote higher prices for customer-owned systems, on average, than do other installers. The results suggest that low prices are not the primary value proposition of large installers.

  12. Market dynamics, innovation, and transition in China's solar photovoltaic (PV) industry

    DEFF Research Database (Denmark)

    Zou, Hongyang; Du, Huibin; Ren, Jingzheng

    2017-01-01

    China’s photovoltaic (PV) industry has undergone dramatic development in recent years and is now the global market leader in terms of newly added capacity. However, market diffusion and adoption in China is not ideal. This paper examines the blocking and inducement mechanisms of China’s PV indust...... mechanisms and offset functional innovation deficiencies. In addition, policy implications are proposed for promoting the development of the PV industry in China....

  13. Building integrated multi PV/T/A solar system

    International Nuclear Information System (INIS)

    Ami Elazari

    2000-01-01

    Previous development in solar energy for residential applications proved that there is merit in further development and improvement of combined electricity and hot water and hot air collectors. The justification stems from the fact that waste heat is generated when PV cells are producing electricity but it decrease its efficiency dramatically, and any effective way to cool the cells can improve their efficiency and long while the heat that generated from this cooling process could be stored and used as standard solar hot water/air system. The core unit comprises of integrated PV cells mounted on a flat-plate collector for water and air, hot water storage tank hot air inlet pips to the house electric battery bank, inverter, connecting cables and controller. Double-glazing serving as solar trap to triple the amount of sun ray reaching the PV cells and other technical innovation make the system more cost effective and cost benefit for stand alone and grid connected domestic application. Two way interconnection with the electric grid like in all the roof top program may bring it to economic viability by selling excess electricity during the costly peak hours while buying low cost electricity during the night off-peak hours, and free electricity from the sun plus free hot water and hot air for domestic use as by-product. A basic domestic two-collector system may deliver up to 4 kWh of electricity and 12000 kcal of hot water and air daily. Some 22 systems are currently operating at various locations in Israel, some for 8 years with very good results. (Author)

  14. Measurement uncertainty analysis techniques applied to PV performance measurements

    Energy Technology Data Exchange (ETDEWEB)

    Wells, C

    1992-10-01

    The purpose of this presentation is to provide a brief introduction to measurement uncertainty analysis, outline how it is done, and illustrate uncertainty analysis with examples drawn from the PV field, with particular emphasis toward its use in PV performance measurements. The uncertainty information we know and state concerning a PV performance measurement or a module test result determines, to a significant extent, the value and quality of that result. What is measurement uncertainty analysis? It is an outgrowth of what has commonly been called error analysis. But uncertainty analysis, a more recent development, gives greater insight into measurement processes and tests, experiments, or calibration results. Uncertainty analysis gives us an estimate of the I interval about a measured value or an experiment`s final result within which we believe the true value of that quantity will lie. Why should we take the time to perform an uncertainty analysis? A rigorous measurement uncertainty analysis: Increases the credibility and value of research results; allows comparisons of results from different labs; helps improve experiment design and identifies where changes are needed to achieve stated objectives (through use of the pre-test analysis); plays a significant role in validating measurements and experimental results, and in demonstrating (through the post-test analysis) that valid data have been acquired; reduces the risk of making erroneous decisions; demonstrates quality assurance and quality control measures have been accomplished; define Valid Data as data having known and documented paths of: Origin, including theory; measurements; traceability to measurement standards; computations; uncertainty analysis of results.

  15. Measurement uncertainty analysis techniques applied to PV performance measurements

    Energy Technology Data Exchange (ETDEWEB)

    Wells, C.

    1992-10-01

    The purpose of this presentation is to provide a brief introduction to measurement uncertainty analysis, outline how it is done, and illustrate uncertainty analysis with examples drawn from the PV field, with particular emphasis toward its use in PV performance measurements. The uncertainty information we know and state concerning a PV performance measurement or a module test result determines, to a significant extent, the value and quality of that result. What is measurement uncertainty analysis It is an outgrowth of what has commonly been called error analysis. But uncertainty analysis, a more recent development, gives greater insight into measurement processes and tests, experiments, or calibration results. Uncertainty analysis gives us an estimate of the I interval about a measured value or an experiment's final result within which we believe the true value of that quantity will lie. Why should we take the time to perform an uncertainty analysis A rigorous measurement uncertainty analysis: Increases the credibility and value of research results; allows comparisons of results from different labs; helps improve experiment design and identifies where changes are needed to achieve stated objectives (through use of the pre-test analysis); plays a significant role in validating measurements and experimental results, and in demonstrating (through the post-test analysis) that valid data have been acquired; reduces the risk of making erroneous decisions; demonstrates quality assurance and quality control measures have been accomplished; define Valid Data as data having known and documented paths of: Origin, including theory; measurements; traceability to measurement standards; computations; uncertainty analysis of results.

  16. The microcomputer-based expert system in CAD-PV

    International Nuclear Information System (INIS)

    Wang, Y.; Qin, S.

    1987-01-01

    As a branch of artificial intelligence, expert system has been revealed day after day in more and more engineering scopes since the successful applications of MYCIN in diagnosis and DENDRAL in the molecular structure of organic compounds etc.. But in the design scope of pressure vessel, as we know, only a few papers have so far been published with respect to the expert system. The necessity and feasibility of accompanying CAD-PV with expert system attracted more scholars to engage in. Although many countries, including China, have regularized the design standards or codes for pressure vessel, but of which no one can solve all of the problems concerning the various practical occasions and experiences. In general, the more domain knowledges a design engineer possesses of, the better decision will be made by him. By virtue of the expert system any less experienced engineer could make the optimum decision in design as well as a skilled senior engineer in addition to the application of design code. It is the due significance for developing high level expert system as an intelligence assistant in the plan option of CAD-PV. In this paper we attempt to introduce a specified software JACKPV used in the design procedure of jacketed pressure vessel as an intelligence front in CAD-PV. JACKPV consists of the function of expert system based on the personal computer IBM-PC/XT with the language PASCAL in its program. It was proved that an ordinary CAD software could be effectively improved while equipped with expert system. (orig.)

  17. 5bv.3.21 PV led engine

    DEFF Research Database (Denmark)

    Thorsteinsson, Sune; Poulsen, Peter Behrensdorff; Dam-Hansen, Carsten

    PV-powered lighting systems, light to light systems (L2L), offer outdoor lighting where it is elsewhere cumbersome to enable lighting. Application of these systems at high latitudes, where the difference in day length between summer and winter is large and the solar energy is less requires smart...... dimming functions for reliable lighting.In this work we have build a laboratory to characterize these systems up to 200 WP from “nose totail” in great detail to support improvement of the systems and to make accurate field performance predictions....

  18. PV power and profit? Electrifying rural South Africa

    International Nuclear Information System (INIS)

    Karottki, R.; Banks, D.

    2000-01-01

    This article traces the background to the implementation of a programme of sustainable off-grid energy services delivered to rural areas through private-public partnership. The implementation of the school photovoltaic (PV) electrification programme, electrification of rural clinics, the solar electrification of rural households on a large scale through a joint venture between Shell Renewables and the national utility ESKOM, and the electrification of widely scattered homesteads are discussed. Details are given of the financial support from the government and the National Electricity Regulator, the development of a national standard for Solar Home Systems, identification of target regions, the regulatory framework, and the opportunities for business and for real improvement. (UK)

  19. Spectrally-Selective Photonic Structures for PV Applications

    Directory of Open Access Journals (Sweden)

    Benedikt Bläsi

    2010-01-01

    Full Text Available We review several examples of how spectrally-selective photonic structures may be used to improve solar cell systems. Firstly, we introduce different spectrally-selective structures that are based on interference effects. Examples shown include Rugate filter, edge filter and 3D photonic crystals such as artificial opals. In the second part, we discuss several examples of photovoltaic (PV concepts that utilize spectral selectivity such as fluorescence collectors, upconversion systems, spectrum splitting concepts and the intermediate reflector concept. The potential of spectrally selective filters in the context of solar cells is discussed.

  20. Pseudomonas savastanoi pv. savastanoi: some like it knot.

    Science.gov (United States)

    Ramos, Cayo; Matas, Isabel M; Bardaji, Leire; Aragón, Isabel M; Murillo, Jesús

    2012-12-01

    Pseudomonas savastanoi pv. savastanoi is the causal agent of olive (Olea europaea) knot disease and an unorthodox member of the P. syringae complex, causing aerial tumours instead of the foliar necroses and cankers characteristic of most members of this complex. Olive knot is present wherever olive is grown; although losses are difficult to assess, it is assumed that olive knot is one of the most important diseases of the olive crop. The last century witnessed a large number of scientific articles describing the biology, epidemiology and control of this pathogen. However, most P. savastanoi pv. savastanoi strains are highly recalcitrant to genetic manipulation, which has effectively prevented the pathogen from benefitting from the scientific progress in molecular biology that has elevated the foliar pathogens of the P. syringae complex to supermodels. A number of studies in recent years have made significant advances in the biology, ecology and genetics of P. savastanoi pv. savastanoi, paving the way for the molecular dissection of its interaction with other nonpathogenic bacteria and their woody hosts. The selection of a genetically pliable model strain was soon followed by the development of rapid methods for virulence assessment with micropropagated olive plants and the analysis of cellular interactions with the plant host. The generation of a draft genome of strain NCPPB 3335 and the closed sequence of its three native plasmids has allowed for functional and comparative genomic analyses for the identification of its pathogenicity gene complement. This includes 34 putative type III effector genes and genomic regions, shared with other pathogens of woody hosts, which encode metabolic pathways associated with the degradation of lignin-derived compounds. Now, the time is right to explore the molecular basis of the P. savastanoi pv. savastanoi-olive interaction and to obtain insights into why some pathovars like it necrotic and why some like it knot

  1. Photovoltaic solar panel for a hybrid PV/thermal system

    Energy Technology Data Exchange (ETDEWEB)

    Zakharchenko, R.; Licea-Jimenez, L.; Perez-Garcia, S.A.; Perez-Robles, J.F.; Gonzalez-Hernandez, J.; Vorobiev, Y. [CINVESTAV-Queretaro, (Mexico); Vorobiev, P. [Universidad Autonoma de Queretaro, (Mexico). Facultad de Ingenieria; Dehesa-Carrasco, U. [Instituto Tec. Del Istmo, Oaxaco (Mexico). Dep. de Ingenieria Electromecanica

    2004-05-01

    The hybrid PV-thermal system was studied, with the photovoltaic panel (PVP) area much smaller than that of the solar collector. Performance of the different panels in the system was investigated, in particular, those made of crystalline (c-) Si, {alpha}-Si and CuInSe{sub 2} as well as different materials and constructions for the thermal contact between the panel and the collector. Our conclusion is that the PVP for application in a hybrid system needs a special design providing efficient heat extraction from it. PVP was designed and made. Its study has shown that this design provides the high electrical and thermal efficiency of the hybrid system. (author)

  2. New Barrier Coating Materials for PV Module Backsheets: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Barber, G. D.; Jorgensen, G. J.; Terwilliger, K.; Glick, S. H.; Pern, J.; McMahon, T. J.

    2002-05-01

    This conference paper describes the high moisture barrier high resistivity coatings on polyethylene terepthalate (PET) have been fabricated and characterized for use in PV module back sheet applications. These thin film barriers exhibit water vapor transmission rates (WVTR) as low as 0.1 g/m2-day at 37.8 C and have shown excellent adhesion (> 10 N/mm) to both ethylene vinyl acetate (EVA) and PET even after filtered xenon arc lamp UV exposure. The WVTR and adhesion values for this construction are compared to and shown to be superior to candidate polymeric backsheet materials.

  3. NREL PV Working With Industry, Fourth Quarter 2000

    Energy Technology Data Exchange (ETDEWEB)

    Poole, L.

    2000-12-26

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The fourth quarter contains an article that is a followup to the IEEE PVSC conference held in Alaska in September 2000, an article about two new R and D initiatives, and an article on cooperative research efforts between the NCPV and the Solar Buildings and Concentrating Solar Power programs. The editorialist is Jim Rannels, Director of the Office of Power Technologies.

  4. Precursor Report of Data Needs and Recommended Practices for PV Plant Availability Operations and Maintenance Reporting.

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Roger R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Photovoltaic and Distributed Systems Integration; Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States). Photovoltaic and Distributed Systems Integration; Balfour, John R. [High Performance PV, Phoenix, AZ (United States)

    2015-01-01

    Characterizing the factors that affect reliability of a photovoltaic (PV) power plant is an important aspect of optimal asset management. This document describes the many factors that affect operation and maintenance (O&M) of a PV plant, identifies the data necessary to quantify those factors, and describes how data might be used by O&M service providers and others in the PV industry. This document lays out data needs from perspectives of reliability, availability, and key performance indicators and is intended to be a precursor for standardizing terminology and data reporting, which will improve data sharing, analysis, and ultimately PV plant performance.

  5. How to Estimate Demand Charge Savings from PV on Commercial Buildings

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Bird, Lori A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-09-28

    Rooftop photovoltaic (PV) systems are compensated through retail electricity tariffs - and for commercial and industrial customers, these are typically comprised of three components: a fixed monthly charge, energy charges, and demand charges. Of these, PV's ability to reduce demand charges has traditionally been the most difficult to estimate. In this fact sheet we explain the basics of demand charges, and provide a new method that a potential customer or PV developer can use to estimate a range of potential demand charge savings for a proposed PV system. These savings can then be added to other project cash flows, in assessing the project's financial performance.

  6. Performance monitoring of different module technologies and design configurations of PV system in South Africa

    CSIR Research Space (South Africa)

    Roro, Kittessa T

    2016-06-01

    Full Text Available Performance monitoring of different module technologies and design configurations of PV system in South Africa Presentation at the EU PVSEC 2016 Munich, 22 June 2016 Dr Kittessa Roro Cell: +27 825495131 Email: KRoro@csir.co.za 1 Agenda Polycrystalline... Procurement Programme (REIPPPP) 5 At present, more than 1 000 MW of PV are operational in South Africa Pipeline of PV projects in the REIPPPP for large, utility-scale PV 398 417 626 2 291 435 415 Operational 1 043 Under construction Awaiting...

  7. Comparative Analysis and Considerations for PV Interconnection Standards in the United States and China

    Energy Technology Data Exchange (ETDEWEB)

    None

    2017-01-01

    The main objectives of this report are to evaluate China's photovoltaic (PV) interconnection standards and the U.S. counterparts and to propose recommendations for future revisions to these standards. This report references the 2013 report Comparative Study of Standards for Grid-Connected PV System in China, the U.S. and European Countries, which compares U.S., European, and China's PV grid interconnection standards; reviews various metrics for the characterization of distribution network with PV; and suggests modifications to China's PV interconnection standards and requirements. The recommendations are accompanied by assessments of four high-penetration PV grid interconnection cases in the United States to illustrate solutions implemented to resolve issues encountered at different sites. PV penetration in China and in the United States has significantly increased during the past several years, presenting comparable challenges depending on the conditions of the grid at the point of interconnection; solutions are generally unique to each interconnected PV installation or PV plant.

  8. A Current Sensorless MPPT Control Method for a Stand-Alone-Type PV Generation System

    Science.gov (United States)

    Itako, Kazutaka; Mori, Takeaki

    In this paper, a current sensorless MPPT control method for a stand-alone-type PV generation system is proposed. This control method offers advantages of the simplified hardware configuration and the low cost, by using only one sensor to measure the PV output voltage. In the application to stand-alone-type with a battery load, the experimental results show that the estimated values of PV output current are accurate, and the use of the proposed MPPT control increases the PV generated energy by 16.3% compared to the conventional system. Furthermore, it is clarified that the proposed method has extremely high UUF (Useful utilization factor) of 98.7%.

  9. Characterisation of PV CIS module by artificial neural networks. A comparative study with other methods

    International Nuclear Information System (INIS)

    Almonacid, F.; Rus, C.; Hontoria, L.; Munoz, F.J.

    2010-01-01

    The presence of PV modules made with new technologies and materials is increasing in PV market, in special Thin Film Solar Modules (TFSM). They are ready to make a substantial contribution to the world's electricity generation. Although Si wafer-based cells account for the most of increase, technologies of thin film have been those of the major growth in last three years. During 2007 they grew 133%. On the other hand, manufacturers provide ratings for PV modules for conditions referred to as Standard Test Conditions (STC). However, these conditions rarely occur outdoors, so the usefulness and applicability of the indoors characterisation in standard test conditions of PV modules is a controversial issue. Therefore, to carry out a correct photovoltaic engineering, a suitable characterisation of PV module electrical behaviour is necessary. The IDEA Research Group from Jaen University has developed a method based on artificial neural networks (ANNs) to electrical characterisation of PV modules. An ANN was able to generate V-I curves of si-crystalline PV modules for any irradiance and module cell temperature. The results show that the proposed ANN introduces a good accurate prediction for si-crystalline PV modules performance when compared with the measured values. Now, this method is going to be applied for electrical characterisation of PV CIS modules. Finally, a comparative study with other methods, of electrical characterisation, is done. (author)

  10. Pyranometers and Reference Cells: Part 2: What Makes the Most Sense for PV Power Plants?; Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Meydbray, J.; Riley, E.; Dunn, L.; Emery, K.; Kurtz, S.

    2012-10-01

    As described in Part 1 of this two-part series, thermopile pyranometers and photovoltaic (PV) reference cells can both be used to measure irradiance; however, there are subtle differences between the data that are obtained. This two-part article explores some implications of uncertainty and subtleties of accurately measuring PV efficiency in the field. Part 2 of the series shows how reference cells can be used to more confidently predict PV performance, but how this could best be accomplished if historic irradiance data could be available in PV-technology-specific formats.

  11. Modeling of PV Systems Based on Inflection Points Technique Considering Reverse Mode

    Directory of Open Access Journals (Sweden)

    Bonie J. Restrepo-Cuestas

    2013-11-01

    Full Text Available This paper proposes a methodology for photovoltaic (PV systems modeling, considering their behavior in both direct and reverse operating mode and considering mismatching conditions. The proposed methodology is based on the inflection points technique with a linear approximation to model the bypass diode and a simplified PV model. The proposed mathematical model allows to evaluate the energetic performance of a PV system, exhibiting short simulation times in large PV systems. In addition, this methodology allows to estimate the condition of the modules affected by the partial shading since it is possible to know the power dissipated due to its operation at the second quadrant.

  12. Methods and Strategies for Overvoltage Prevention in Low Voltage Distribution Systems with PV

    DEFF Research Database (Denmark)

    Hashemi Toghroljerdi, Seyedmostafa; Østergaard, Jacob

    2016-01-01

    to handle a high share of PV power. This paper provides an in-depth review of methods and strategies proposed to prevent overvoltage in LV grids with PV, and discusses the effectiveness, advantages, and disadvantages of them in detail. Based on the mathematical framework presented in the paper......, the overvoltage caused by high PV penetration is described, solutions to facilitate higher PV penetration are classified, and their effectiveness, advantages, and disadvantages are illustrated. The investigated solutions include the grid reinforcement, electrical energy storage application, reactive power...

  13. Concentrating Photovoltaics: Collaborative Opportunities within DOEs CSP and PV Programs; Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Mehos, M.; Lewandowski, A.; Symko-Davies, M.; Kurtz, S.

    2001-10-01

    Presented at the 2001 NCPV Program Review Meeting: DOEs Concentrating Solar Power program is investigating the viability of concentrating PV converters as an alternative to thermal conversion devices.

  14. Dynamic response evaluation of sensorless MPPT method for hybrid PV-DFIG wind turbine system

    Directory of Open Access Journals (Sweden)

    Danvu Nguyen

    2016-01-01

    Full Text Available This research proposes a sensorless Maximum Power Point Tracking (MPPT method for a hybrid Photovoltaic-Wind system, which consists of Photovoltaic (PV system and Doubly-Fed Induction Generator (DFIG Wind Turbine. In the hybrid system, the DC/DC converter output of the PV system is directly connected to the DC-link of DFIG’s back-to-back converter. Therefore, the PV inverter and its associated circuit can be removed in this structure. Typically, the PV power is monitored by using PV current sensor and PV voltage sensor for MPPT. In this paper, the powers of converters on grid side and rotor side of DFIG are used to estimate the PV power without the PV current sensor. That can efficiently reduce the cost of the hybrid system. The detailed analysis of the sensorless MPPT method, which includes derived equations and operation response, is also presented in this paper. In addition, an overview of PV-DFIG research in literature is stated to supply comprehensive knowledge of related research.

  15. PV market in Germany and activities of the metropolitan utility of Karlsruhe

    International Nuclear Information System (INIS)

    Weissmueller, G.; Lewald, N.

    2001-01-01

    The introduction of the Renewable Energy Law in Germany in combination with the 100,000 roof program lead to an explosion of the market for grid-connected PV systems, with all possible effects such as the formation of new PV companies, job creation and the installation of a huge number of PV systems. But there is also one negative aspect: higher prices for the modules due to production bottle-necks. The Municipal Utility of Karlsruhe (SWK) commits itself to the sector of renewable energy especially PV. Some of these activities are also described in the paper

  16. Terms, Trends, and Insights: PV Project Finance in the United States, 2017

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, David J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Schwabe, Paul D [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-23

    This brief is a compilation of data points and market insights that reflect the state of the project finance market for solar photovoltaic (PV) assets in the United States as of the third quarter of 2017. This information can generally be used as a simplified benchmark of the costs associated with securing financing for solar PV as well as the cost of the financing itself (i.e., the cost of capital). This work represents the second DOE sponsored effort to benchmark financing costs across the residential, commercial, and utility-scale PV markets, as part of its larger effort to benchmark the components of PV system costs.

  17. Decade of PV Industry R and D Advances in Silicon Module Manufacturing

    Energy Technology Data Exchange (ETDEWEB)

    Symko-Davis, M.; Mitchell, R.L.; Witt, C.E.; Thomas, H.P. [National Renewable Energy Laboratory; King, R.[U.S. Department of Energy; Ruby, D.S. [Sandia National Laboratories

    2001-01-18

    The US Photovoltaic (PV) industry has made significant technical advances in crystalline silicon (Si) module manufacturing through the PV Manufacturing R and D Project during the past decade. Funded Si technologies in this project have been Czochralski, cast polycrystalline, edge-defined film-fed growth (EFG) ribbon, string ribbon, and Si-film. Specific R and D Si module-manufacturing categories that have shown technical growth and will be discussed are in crystal growth and processing, wafering, cell fabrication, and module manufacturing. These R and D advancements since 1992 have contributed to a 30% decrease in PV manufacturing costs and stimulated a sevenfold increase in PV production capacity.

  18. Evaluation of a PV-integrated building application in a well-controlled outdoor test environment

    Energy Technology Data Exchange (ETDEWEB)

    Bloem, J.J. [European Commission, DG Joint Research Centre, Institute for Environment and Sustainability, I-21020 Ispra (Italy)

    2008-02-15

    This paper presents the assessment of experimental data for electrical and thermal performance evaluation of photovoltaic (PV) systems integrated as cladding components into the building envelope, giving input to modelling and analysis work. From the experience gained in several EU research projects, an improved design for a common Test Reference Environment (TRE) has been developed. This specific design of the PV module and TRE makes it possible to study, through electrical and thermal energy flow analysis, the effect on electrical performance of using different materials for PV modules and the construction design of claddings. The results for a glass-glass PV module with forced ventilation are presented. (author)

  19. Assessing the influence of the temporal resolution of electrical load and PV generation profiles on self-consumption and sizing of PV-battery systems

    International Nuclear Information System (INIS)

    Beck, T.; Kondziella, H.; Huard, G.; Bruckner, T.

    2016-01-01

    Highlights: • MILP optimization model for operation and investment of PV-battery systems. • Use of high resolution (10 s) electrical household load and PV generation profiles. • Analysis of influence of temporal resolution on self-consumption and optimal sizing. • Electrical load profile characteristics influence required temporal resolution. - Abstract: The interest in self-consumption of electricity generated by rooftop photovoltaic systems has grown in recent years, fueled by decreasing levelized costs of electricity and feed-in tariffs as well as increasing end customer electricity prices in the residential sector. This also fostered research on grid-connected PV-battery storage systems, which are a promising technology to increase self-consumption. In this paper a mixed-integer linear optimization model of a PV-battery system that minimizes the total discounted operating and investment costs is developed. The model is employed to study the effect of the temporal resolution of electrical load and PV generation profiles on the rate of self-consumption and the optimal sizing of PV and PV-battery systems. In contrast to previous studies high resolution (10 s) measured input data for both PV generation and electrical load profiles is used for the analysis. The data was obtained by smart meter measurements in 25 different households in Germany. It is shown that the temporal resolution of load profiles is more critical for the accuracy of the determination of self-consumption rates than the resolution of the PV generation. For PV-systems without additional storage accurate results can be obtained by using 15 min solar irradiation data. The required accuracy for the electrical load profiles depends strongly on the load profile characteristics. While good results can be obtained with 60 s for all electrical load profiles, 15 min data can still be sufficient for load profiles that do not exhibit most of their electricity consumption at power levels above 2 k

  20. Quantification, challenges and outlook of PV integration in the power system: a review by the European PV Technology Platform

    DEFF Research Database (Denmark)

    Alet, Pierre-Jean; Baccaro, Federica; De Felice, Matteo

    2015-01-01

    Integration in the power system has become a limiting factor to the further development of photovoltaics. Proper quantification is needed to evaluate both issues and solutions; the share of annual electricity demand is widely used but we found that some of the metrics which are related to power...... networks. Forecasting, storage, and combination with other renewable sources are interdependent solutions to solve the intermittency issue. Finally, we found that PV is also an opportunity to reduce some investment required to upgrade existing power networks. Through integration with micro-grids and hybrid...

  1. Assuring long-term reliability of concentrator PV systems

    Science.gov (United States)

    McConnell, R.; Garboushian, V.; Brown, J.; Crawford, C.; Darban, K.; Dutra, D.; Geer, S.; Ghassemian, V.; Gordon, R.; Kinsey, G.; Stone, K.; Turner, G.

    2009-08-01

    Concentrator PV (CPV) systems have attracted significant interest because these systems incorporate the world's highest efficiency solar cells and they are targeting the lowest cost production of solar electricity for the world's utility markets. Because these systems are just entering solar markets, manufacturers and customers need to assure their reliability for many years of operation. There are three general approaches for assuring CPV reliability: 1) field testing and development over many years leading to improved product designs, 2) testing to internationally accepted qualification standards (especially for new products) and 3) extended reliability tests to identify critical weaknesses in a new component or design. Amonix has been a pioneer in all three of these approaches. Amonix has an internal library of field failure data spanning over 15 years that serves as the basis for its seven generations of CPV systems. An Amonix product served as the test CPV module for the development of the world's first qualification standard completed in March 2001. Amonix staff has served on international standards development committees, such as the International Electrotechnical Commission (IEC), in support of developing CPV standards needed in today's rapidly expanding solar markets. Recently Amonix employed extended reliability test procedures to assure reliability of multijunction solar cell operation in its seventh generation high concentration PV system. This paper will discuss how these three approaches have all contributed to assuring reliability of the Amonix systems.

  2. Sizing and Simulation of PV-Wind Hybrid Power System

    Directory of Open Access Journals (Sweden)

    Mustafa Engin

    2013-01-01

    Full Text Available A sizing procedure is developed for hybrid system with the aid of mathematical models for photovoltaic cell, wind turbine, and battery that are readily present in the literature. This sizing procedure can simulate the annual performance of different kinds of photovoltaic-wind hybrid power system structures for an identified set of renewable resources, which fulfills technical limitations with the lowest energy cost. The output of the program will display the performance of the system during the year, the total cost of the system, and the best size for the PV-generator, wind generator, and battery capacity. Security lightning application is selected, whereas system performance data and environmental operating conditions are measured and stored. This hybrid system, which includes a PV, wind turbine, inverter, and a battery, was installed to supply energy to 24 W lamps, considering that the renewable energy resources of this site where the system was installed were 1700 Wh/m2/day solar radiation and 3.43 m/s yearly average wind speed. Using the measured variables, the inverter and charge regulator efficiencies were calculated as 90% and 98%, respectively, and the overall system’s electrical efficiency is calculated as 72%. Life cycle costs per kWh are found to be $0.89 and LLP = 0.0428.

  3. An Economic Analysis of Residential PV System for Adiyaman, Turkey

    Directory of Open Access Journals (Sweden)

    Haci SOGUKPINAR

    2015-07-01

    Full Text Available Solar energy constitutes the main source of all energy sources and it is one of the most important renewable energy sources in terms of huge potential. As with other energy sources not just in certain places in the world, everywhere have the potential where the sun rises and set. Turkey is located on the sunny area and solar energy generation is quite rich in potential. Together with the substantial increase in the efficiency of photovoltaic cells, generating electricity from solar energy is becoming increasingly common. Especially in places where no grid connection, photovoltaic cells is very useful in supplying the energy needs. In this study, Turkey's solar energy potential was analyzed, and PV systems to meet the electricity needs of a home were analyzed economically. Consequently, to meet the electricity needs of a house in Adiyaman conditions that require a surface area of 24 m2 with a PV system, and this system was determined to be able to amortize itself in 10 years.

  4. Transforming PV installations toward dispatchable, schedulable energy solutions

    Energy Technology Data Exchange (ETDEWEB)

    Scharf, Mesa [AE Solar Energy, Inc., Ft. Collins, Co (United States)

    2015-06-15

    The Advanced Energy led SEGIS-AC program represents an industry partnership driven collaborative effort to continue to lower the barriers to increasing penetration of PV on the grid while also lowering overall system cost consistent with the Department of Energy SunShot Initiative. The SEGIS-AC program follows the DOE sponsored three year SEGIS program, which had similar high level goals, but with a broader exploratory scope. In SEGIS-AC, the team carries forward a new communications based islanding detection technology developed during the SEGIS program. Advanced utility interactive controls are further developed, and a storage inverter system is developed focused on intermittency mitigation due to cloud induced transients. Communications based island detection coupled with advanced controls and a storage system are shown to improve utility distribution feeder performance and to enable increased solar PV penetration levels. By the conclusion of the program, multiple utilities and customers have expressed awareness and desire to make use of the technologies developed and demonstrated under this program. This factor has led the Advanced Energy led team to deem the program an overall success. The report following details the technologies developed and demonstrated, as well as industry engagement.

  5. Hydrogen Production from Optimal Wind-PV Energies Systems

    International Nuclear Information System (INIS)

    T Tafticht; K Agbossou

    2006-01-01

    Electrolytic hydrogen offers a promising alternative for long-term energy storage of renewable energies (RE). A stand-alone RE system based on hydrogen production has been developed at the Hydrogen Research Institute and successfully tested for automatic operation with designed control devices. The system is composed of a wind turbine, a photovoltaic (PV) array, an electrolyzer, batteries for buffer energy storage, hydrogen and oxygen storage tanks, a fuel cell, AC and DC loads, power conditioning devices and different sensors. The long-term excess energy with respect to load demand has been sent to the electrolyser for hydrogen production and then the fuel cell has utilised this stored hydrogen to produce electricity when there were insufficient wind and solar energies with respect to load requirements. The RE system components have substantially different voltage-current characteristics and they are integrated on the DC bus through power conditioning devices for optimal operation by using the developed Maximum Power Point Tracking (MPPT) control method. The experimental results show that the power gain obtained by this method clearly increases the hydrogen production and storage rate from wind-PV systems. (authors)

  6. Optical investigation of a sun simulator for concentrator PV applications.

    Science.gov (United States)

    Rapp, Christoph; Straub, Volker; van Rooyen, De Wet; Thor, Wei Yi; Siefer, Gerald; Bett, Andreas W

    2015-09-21

    In photovoltaics (PV), sun simulators are used to reproduce outdoor conditions in a lab environment such as irradiance level, light uniformity and spectral distribution. Concentrator (C)PV applications additionally require the sun simulators to provide rays with an angular distribution similar to that of the sun rays. However, different factors in CPV sun simulator setups make it difficult to achieve the perfect sun like angular distribution. This is mainly caused by the unavailability of appropriate light sources. Therefore, we investigated in this work, to which deviations such a non-ideal light source can lead and which impact is expected at the measurement of a CPV module. For this, two ray tracing models are presented - one for the simulation of natural sunrays, another one for the simulation of sun simulator conditions. The models are validated based on measurements and subsequently used to simulate the impact on a typical CPV module with silicone-on-glass Fresnel lenses. Here, significant deviations to outdoor conditions are found.

  7. Temperature Dependences on Various Types of Photovoltaic (PV) Panel

    International Nuclear Information System (INIS)

    Audwinto, I A; Leong, C S; Sopian, K; Zaidi, S H

    2015-01-01

    Temperature is one of the key roles in PV technology performance, since with the increases of temperature the open-circuit voltage will drop accordingly so do the electrical efficiency and power output generation. Different types of Photovoltaic (PV) panels- silicon solar panels and thin film solar panels; mono-crystalline, poly-crystalline, CIS, CIGS, CdTe, back-contact, and bi-facial solar panel under 40°C to 70°C approximately with 5°C interval have been comparatively analyzed their actual performances with uniformly distribution of light illumination from tungsten halogen light source, ±500W/m 2 . DC-Electronic Load and Data Logger devices with “Lab View” data program interface were used to collect all the necessary parameters in this study. Time needed to achieve a certain degree of temperature was recorded. Generally, each of the panels needed 15 minutes to 20 minutes to reach 70°C. Halogen based light source is not compatible in short wave-length in response to thin-film solar cell. Within this period of times, all the panels are facing a performance loss up to 15%. Other parameters; P max , V max , I max , V oc , I sc , R serries , R shunt , Fillfactor were collected as study cases. Our study is important in determining Photovoltaic type selection and system design as for study or industrial needed under different temperature condition. (paper)

  8. Newer Concepts in Mars Exploration; LORPEX and PV Enhanced Aerobots

    Science.gov (United States)

    Ramohalli, Kumar; Natale, Guy; Marcozzi, Massimiliano; Greene, Jack; Duke, Vanessa

    2002-01-01

    This paper describes two new concepts in Mars Exploration, both of which involve the utilization of in-situ resources. In the first invention, we describe a Locally Refueled Planetary Explorer (LORPEX) which has practically unlimited range and life since it "lives off the land/atmosphere" by extracting fuel and oxidizer from the atmosphere, and possibly water at a later stage, as a source of hydrogen. The robot has been built and demonstrated to the media, including one science show in Pasadena. In the second invention, the concept is to obviate the difficulty of finding a suitable, lightweight substrate to bond the photovoltaic cells to; if we have an aerobot anyway for covering vast terrains, the balloon surface provides an ideal substrate for the PV cells at a minimal additional mass. Because of the truly large areas, and because sun-pointing is no longer a factor, the power availability is constant and represents at least a ten-fold increase over comparable/competing technologies; when this is combined with the minimum mass, the advantages should be apparent. Both of these technologies, LORPEX and PV-Enhanced Aerobots, won NASA NTR awards.

  9. Curtobacterium flaccumfaciens pv. flaccumfaciens: etiology, detection and control strategies

    Directory of Open Access Journals (Sweden)

    Giseli Valentini

    2010-12-01

    Full Text Available The diseases caused by bacteria present a phytopathological and agricultural problem in various economic crops. The Curtobacterium wilt caused by Curtobacterium fl accumfaciens pv. fl accumfaciens has become a threat to the cultivation of beans (Phaseolus vulgaris L.. The disease statement for the Brazilian territory occurred in 1995 and today the pathogen is distributed in various Brazilian producing regions. Transmission is primarily via contaminated seed, which imposes great diffi culties and limitations on the control of these bacteria. After plant infection, the only way to control it is the eradication of infected plants. The alternatives for the control of this disease are the use of healthy seeds, crop rotation and resistant varieties. The use of resistant varieties is the most effi cient and economical solution for the farmer. The most important research to support the development of bean cultivars resistant to C. fl accumfaciens pv. fl accumfaciens is the identifi cation of sources of genetic resistance and the study of mechanisms of genetic resistance to disease.

  10. Harmonic analysis and suppression in hybrid wind & PV solar system

    Science.gov (United States)

    Gupta, Tripti; Namekar, Swapnil

    2018-04-01

    The growing demand of electricity has led to produce power through non-conventional source of energy such as solar energy, wind energy, hydro power, energy through biogas and biomass etc. Hybrid system is taken to complement the shortcoming of either sources of energy. The proposed system is grid connected hybrid wind and solar system. A 2.1 MW Doubly fed Induction Generator (DFIG) has been taken for analysis of wind farm whose rotor part is connected to two back-to-back converters. A 250 KW Photovoltaic (PV) array taken to analyze solar farm where inverter is required to convert power from DC to AC since electricity generated through solar PV is in the form of DC. Stability and reliability of the system is very important when the system is grid connected. Harmonics is the major Power quality issue which degrades the quality of power at load side. Harmonics in hybrid system arise through the use of power conversion unit. The other causes of harmonics are fluctuation in wind speed and solar irradiance. The power delivered to grid must be free from harmonics and within the limits specified by Indian grid codes. In proposed work, harmonic analysis of the hybrid system is performed in Electrical Transient Analysis program (ETAP) and single tuned harmonic filter is designed to maintain the utility grid harmonics within limits.

  11. A control strategy for PV stand-alone applications

    Science.gov (United States)

    Slouma, S.; Baccar, H.

    2015-04-01

    This paper proposes a stand-alone photovoltaic (PV) system study in domestic applications. Because of the decrease in power of photovoltaic module as a consequence of changes in solar radiation and temperature which affect the photovoltaic module performance, the design and control of DC-DC buck converter was proposed for providing power to the load from a photovoltaic source.In fact, the control of this converter is carried out with integrated MPPT (Maximum Power Point Tracking) algorithm which ensures a maximum energy generated by the PV arrays. Moreover, the output stage is composed by a battery energy storage system, dc-ac inverter, LCL filter which enables higher efficiency, low distortion ac waveforms and low leakage currents. The control strategy adopted is cascade control composed by two regulation loops.Simulations performed with PSIM software were able to validate the control system.The realization and testing of the photovoltaic system were achieved in the Photovoltaic laboratory of the Centre for Research and Energy Technologies at the Technopark Borj Cedria. Experimental results verify the effeciency of the proposed system.

  12. Power Electronic System for Multi-MW PV sites

    DEFF Research Database (Denmark)

    Paasch, Kasper

    .4%. A portable IV-scanning instrument for the fast long term characterization of solar panels was developed as part of the project. Each second a sweep of the IV-characteristics of a solar panel is performed and the result stored for later analysis. The instrument is based on an active load, is optimized...... a distance of 160 m. In parallel a string based inverter configuration was established with solar panels at the same locations. An analysis of irradiation data recorded during the test period showed that non-uniform irradiance due to moving clouds is expected to influence the PV plants for less than 4...... MPPT. The analysis is based on a comparative investigation of non-uniform irradiation events caused by moving clouds during a period of one year. A set-up for the long term recording of data from the 2.1 MW Danfoss Solar Park in Nordborg (DK) and the 62 kW PV plant at the University of Southern Denmark...

  13. Fire risk related to the use of PV systems in building facades

    Directory of Open Access Journals (Sweden)

    Mazziotti Lamberto

    2016-01-01

    Full Text Available Nowadays the use of photovoltaic (PV systems in buildings is not only related to the solar energy conversion into electrical one, but these PV modules or panels could also be used with aesthetic features or, even more, as thermal protection systems in building facades. Thanks to the technical development of the photovoltaic industry, PV system can easily be architectonically integrated into building construction elements such as roofs, vertical façade components, both with opaque or transparent surfaces. Furthermore, PV construction facades elements could also be provided by openings like doors or windows. Accident analysis show that the use of PV systems as construction elements could increase the risk of fire in buildings. In fact, international and National data report a growing number of fire caused by PV system applied or integrated in buildings. The Italian National Fire Service, that is the Authority having jurisdiction for fire safety in buildings (in Italy, in 2012 has released a Guideline in order to asses and mitigate the risk of fire when a PV system is put in place on a building as a façade or as a roof. The Guideline addresses not only the reduction of the PV fire ignitions causes and the aspects related to the fire spread due to the combustible parts that constitute PV modules or panels, but also take into account the safety of both the maintenance personnel and the rescue teams. This paper focuses on the fire safety aspects related to the use of fire PV panels and systems in building facades, showing some interesting experimental data related to the fire behaviour of these components and underlining the factors that promote the spread of fire, like the high operating temperature of the PV system itself.

  14. Induction of Callose Deposition in Tobacco (Nicotiana tabacum by Bacterial Lipopolysaccharide Pseudomonas syringae pv. tabaci and Pseudomonas syringae pv. glycinea

    Directory of Open Access Journals (Sweden)

    Pipit Marianingsih

    2014-12-01

    Full Text Available Lipopolysaccharide (LPS is a major component of outer-membrane gram-negative bacteria, and it can act as a Pathogen-Associated Molecular Pattern (PAMP for perception of pathogens by plants. LPS can be recognized by plants, triggering certain plant defense-related responses, including callose deposition. This study investigated induction of callose deposition by bacterial LPS in tobacco. Tobacco leaves were infiltrated with 400 μg/mL and 800 μg/mL LPS extracted from Pseudomonas syringae pv. tabaci (Pta and Pseudomonas syringae pv. glycinea (Pgl and incubated for 24 h or 48 h. To detect callose deposition, tobacco leaves were cleared in lactophenol solution, stained with aniline blue, and visualized by fluorescence microscopy. Results showed that LPS from Pgl induced more callose deposition in tobacco leaves than did that from Pta. In addition, a Pearson correlation test revealed that incubation period was the most significant factor in callose deposition, followed by the type of LPS bacteria. However, LPS concentration was not significantly corelated to callose deposition in tobacco leaves.

  15. PV Diesel island systems remote from the network: modelling and simulation; Netzferne PV-Diesel-Inselsysteme: Modellierung und Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Dumbs, C. [Ecole des Mines de Paris, 06 - Sophia Antipolis (France). Centre d`Energetique]|[Ecole des Mines de Paris, 06 - Sophia Antipolis (France). Centre de Mathematiques Apliquees; Maizi, N. [Ecole des Mines de Paris, 06 - Sophia Antipolis (France). Centre de Mathematiques Apliquees; Neirac, F. [Ecole des Mines de Paris, 06 - Sophia Antipolis (France). Centre d`Energetique

    1998-12-01

    The simulation program for PV Diesel hybrid systems introduced here serves for the design and simulation of photo-voltaic electricity supply systems with storage batteries. It makes possible the detailed calculation of the currents and voltages between the system components and therefore the detailed accurate simulation of the method of operation of an island system. The use of a short step-width of simulation (1 to 10 minute average values) is the precondition for a detailed analysis of the individual components and their mutual collaboration in the overall system. The user has the possibility of fitting measuring instruments for monitoring the system variables at all junctions. By successive variation of certain parameters and repeated simulation, a simulation-supported optimisation of the design process can already be achieved today. [Deutsch] Das hier vorgestellte Simulationsprogramm fuer netzferne PV-Diesel Hybridsysteme dient der Auslegung und Simulation von Photovoltaik-Stromversorgungssystemen mit Batteriespeicher. Derzeit ermoeglicht es eine detaillierte Berechnung der Stroeme und Spannungen zwischen den Systemkomponenten und damit eine detailgenaue Simulation der Funktionsweise eines Inselsystems. Die Verwendung einer kurzen Simulationsschrittweite (1- bis 10-minuetige Mittelwerte) stellt die Voraussetzung fuer eine detaillierte Analyse der Einzelkomponenten sowie deren gegenseitiges Zusammenwirken im Gesamtsystem dar. Der Benutzer hat die Moeglichkeit, an allen Verbindungspunkten des Systems Messinstrumente zur Ueberwachung der Systemvariablen anzubringen. Durch sukzessives Variieren bestimmter Parameter und die wiederholte Simulation laesst sich damit schon heute eine simulationsgestuetzte Optimierung des Auslegungsprozesses erreichen. (orig./RHM)

  16. Determining the Impact of Steady-State PV Fault Current Injections on Distribution Protection

    Energy Technology Data Exchange (ETDEWEB)

    Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Grijalva, Santiago [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-05-01

    This report investigates the fault current contribution from a single large PV system and the impact it has on existing distribution overcurrent protection devices. Assumptions are made about the modeling of the PV system under fault to perform exhaustive steady - state fault analyses throughout distribution feeder models. Each PV interconnection location is tested to determine how the size of the PV system affects the fault current measured by each protection device. This data is then searched for logical conditions that indicate whether a protection device has operated in a manner that will cause more customer outages due to the addition of the PV system. This is referred to as a protection issue , and there are four unique types of issues that have been identified in the study. The PV system size at which any issues occur are recorded to determine the feeder's PV hosting capacity limitations due to interference with protection settings. The analysis is carried out on six feeder models. The report concludes with a discussion of the prevalence and cause of each protection issue caused by PV system fault current.

  17. The performance of a combined solar photovoltaic (PV) and thermoelectric generator (TEG) system

    DEFF Research Database (Denmark)

    Bjørk, Rasmus; Nielsen, Kaspar Kirstein

    2015-01-01

    The performance of a combined solar photovoltaic (PV) and thermoelectric generator (TEG) system is examined using an analytical model for four different types of commercial PVs and a commercial bismuth telluride TEG. The TEG is applied directly on the back of the PV, so that the two devices have...

  18. Solar PV powered mobile cellular base station: Models and use cases in South Africa

    CSIR Research Space (South Africa)

    Aderemi, BA

    2017-09-01

    Full Text Available cells. To this end, solar PV powered base stations have become important integration into a mobile cellular network. Thus, this article exploits the use of solar PV powered mobile cellular base station systems in South Africa. It was also found through...

  19. Storage Application in Smart Grid with High PV and EV Penetration

    DEFF Research Database (Denmark)

    Hashemi Toghroljerdi, Seyedmostafa; Yang, Guangya; Østergaard, Jacob

    2013-01-01

    grids with residential PVs and Electric Vehicles (EVs). The effect of EV home charging on EESS capacity in high PV penetration is also addressed. The results indicate that increasing the EV penetration in the network can decrease the EESS capacity need. This decrease is highest in situations with low PV...

  20. Assessment of MPPT Techniques During the Faulty Conditions of PV System

    Directory of Open Access Journals (Sweden)

    Bhukya Krishna Naick

    2018-01-01

    Full Text Available The contribution of Distributed Generation (DG systems like wind energy systems and solar Photovoltaic (PV systems on the generation of electricity has increased. Out of these DG systems, the PV systems have gained wide popularity, because of the availability of solar energy throughout the day. Depending on the size of PV installations, a large number of PV modules can be interconnected in the form of series and parallel connection. Since a large number of modules are interconnected, it is possible for the faults in a PV array to occur due to the failure of protection system, which can cause damage to the PV module and also the decrease in the output power. This paper presents the tracking of a maximum power point under the faulty conditions of 12x5 PV array. The fault conditions that have been considered in the PV array are open circuit fault, line to ground, line to line and failure of bypass diodes. Perturb and observe, incremental conductance and fuzzy logic controller are the maximum power point tracking techniques that have been implemented. For each of the fault conditions, the results have been presented in terms of the maximum power tracked, tracking time and tracking efficiency.