Directory of Open Access Journals (Sweden)
Tamires Ribeiro
2016-12-01
Full Text Available The aim of this study was to evaluate the resistance of 58 common bean lines against common bacterial blight (Xanthomonas axonopodis pv. phaseoli and bacterial wilt (Curtobacterium flaccumfaciens pv. flaccumfaciens. The experimental design consisted of completely randomized blocks, with four replications per pathogen. The results were subjected to variance analysis by the F test at 1% probability. Significant differences between the treatments indicated different resistance levels among the lines against both pathogens. According to the Scott-Knott test, six lines were resistant to Xanthomonas axonopodis pv. phaseoli, 14 moderately resistant, and 38 susceptible. To Curtobacterium flaccumfaciens pv. flaccumfaciens, 11 lines were resistant, 26 moderately resistant and 21 susceptible. Among these, the lines Pr10-3-4/1, Pr10-5-2/1 and Pr10-5- 2/2 of the black bean group and C10-2-4/2 of the Carioca group were resistant to both major bacterial diseases affecting common bean in Brazil.
Robène, Isabelle; Perret, Marion; Jouen, Emmanuel; Escalon, Aline; Maillot, Marie-Véronique; Chabirand, Aude; Moreau, Aurélie; Laurent, Annie; Chiroleu, Frédéric; Pruvost, Olivier
2015-07-01
Bacterial blight of onion is an emerging disease threatening world onion production. The causal agent Xanthomonas axonopodis pv. allii is seed transmitted and a reliable and sensitive tool is needed to monitor seed exchanges. A triplex quantitative real-time PCR assay was developed targeting two X. axonopodis pv. allii-specific markers and an internal control chosen in 5.8S rRNA gene from Alliaceae. Amplification of at least one marker indicates the presence of the bacterium in seed extracts. This real-time PCR assay detected all the 79 X. axonopodis pv. allii strains tested and excluded 85.2% of the 135 non-target strains and particularly all 39 saprophytic and pathogenic bacteria associated with onion. Cross-reactions were mainly obtained for strains assigned to nine phylogenetically related X. axonopodis pathovars. The cycle cut-off was estimated statistically at 36.3 considering a risk of false positive of 1%. The limit of detection obtained in at least 95% of the time (LOD 95%) was 5×10(3) CFU/g (colony forming unit/g). The sensitivity threshold was found to be 1 infected seed in 32,790 seeds. This real-time PCR assay should be useful for preventing the long-distance spread of X. axonopodis pv. allii via contaminated seed lots and determining the epidemiology of the bacterium. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Carvalho Flávia Maria de Souza
2005-01-01
Full Text Available Xanthomonas axonopodis pv. citri strains that cause disease in citrus were investigated by pulsed field and plasmid profile analysis. For the first method, genomic DNA was digested by the rare-cutting enzymes Xba I and Vsp I. The strains evaluated were collected in seven different States of Brazil and in Argentina, Bolivia, Paraguay and Uruguay. Genetic variability was found among strains of X. axonopodis pv. citri from different geographical areas Argentina, Bolivia and Uruguay, with similarities varying from 0.62 to 0.83. However, the strains collected in Brazil, despite being from different States, have shown a genetic similarity ranging from 0.83 to 1.00. Cluster analysis showed a relationship between genomic similarity and geographical origin of the strains. Plasmids were observed in all strains, with a total of five different plasmids, with sizes between 57.7 and 83.0 kilobases. The 72.6 kb plasmid was the most frequent, present in 15 out of 22 strains, while the 68.1 kb plasmid was observed in two strains only. Although the plasmid diversity detected in the present study was not very great, the X. axonopodis pv. citri strains evaluated showed a considerable degree of diversity with regard to this extrachromosomal genetic element.
International Nuclear Information System (INIS)
Souza, C. S.; Ferreira, L. C. S.; Thomas, L.; Barbosa, J. A. R. G.; Balan, A.
2009-01-01
The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. Maltose-binding protein is the periplasmic component of the ABC transporter responsible for the uptake of maltose/maltodextrins. The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. The crystal belonged to the primitive hexagonal space group P6 1 22, with unit-cell parameters a = 123.59, b = 123.59, c = 304.20 Å, and contained two molecules in the asymetric unit. It diffracted to 2.24 Å resolution
Activity of Antarctic fungi extracts against phytopathogenic bacteria.
Purić, J; Vieira, G; Cavalca, L B; Sette, L D; Ferreira, H; Vieira, M L C; Sass, D C
2018-06-01
This study aims to obtain secondary metabolites extracts from filamentous fungi isolated from soil and marine sediments from Antarctic ecosystems and to assess its potential antibacterial activity on Xanthomonas euvesicatoria and Xanthomonas axonopodis pv. passiflorae (phytopathogenic bacteria causing diseases in pepper and tomato and passionfruit, respectively). Among the 66 crude intracellular and extracellular extracts obtained from fungi recovered from soil and 79 obtained from marine sediment samples, 25 showed the ability to prevent the growth of X. euvesicatoria in vitro and 28 showed the ability to prevent the growth of X. axonopodis pv. passiflorae in vitro. Intracellular and extracellular extracts from soil fungi inhibited around 97% of X. euvesicatoria and 98% of X. axonopodis pv. passiflorae at 2·1 mg ml -1 . The average inhibition rates against X. euvesicatoria and X. axonopodis pv. passiflorae for intracellular and extracellular extracts from marine sediments fungi were around 96 and 97%, respectively, at 3·0 mg ml -1 . Extracts containing secondary metabolites with antimicrobial activity against X. euvesicatoria and X. axonopodis pv. passiflorae were obtained, containing possible substitutes for the products currently used to control these phytopathogens. Micro-organisms from extreme ecosystems, such as the Antarctic ecosystem, need to survive in harsh conditions with low temperatures, low nutrients and high UV radiation. Micro-organisms adapt to these conditions evolving diverse biochemical and physiological adaptations essential for survival. All this makes these micro-organisms a rich source of novel natural products based on unique chemical scaffolds. Discovering novel bioactive compounds is essential because of the rise in antibiotic-resistant micro-organisms and the emergence of new infections. Fungi from Antarctic environments have been proven to produce bioactive secondary metabolites against various micro-organisms, but few studies
Energy Technology Data Exchange (ETDEWEB)
Cary,; Bruce, R [Santa Fe, NM; Stubben, Christopher J [Los Alamos, NM
2011-03-22
The invention provides highly sensitive and specific assays for the major citrus pathogens Xylella fastidiosa and Xanthomonas axonopodis, including a field deployable multiplexed assay capable of rapidly assaying for both pathogens simultaneously. The assays are directed at particular gene targets derived from pathogenic strains that specifically cause the major citrus diseases of citrus variegated chlorosis (Xylella fastidiosa 9a5c) and citrus canker (Xanthomonas axonopodis pv citri). The citrus pathogen assays of the invention offer femtomole sensitivity, excellent linear dynamic range, and rapid and specific detection.
Directory of Open Access Journals (Sweden)
Valente eAritua
2015-10-01
Full Text Available Common bacterial blight is a devastating seed-borne disease of common beans that also occurs on other legume species including lablab and Lima beans. We sequenced and analysed the genomes of 26 isolates of Xanthomonas axonopodis pv. phaseoli and X. fuscans subsp. fuscans, the causative agents of this disease, collected over four decades and six continents. This revealed considerable genetic variation within both taxa, encompassing both single-nucleotide variants and differences in gene content, that could be exploited for tracking pathogen spread. The bacterial isolate from Lima bean fell within the previously described Genetic Lineage 1, along with the pathovar type isolate (NCPPB 3035. The isolates from lablab represent a new, previously unknown genetic lineage closely related to strains of X. axonopodis pv. glycines. Finally, we identified more than 100 genes that appear to have been recently acquired by Xanthomonas axonopodis pv. phaseoli from X. fuscans subsp. fuscans.
International Nuclear Information System (INIS)
Santacruz, C. P.; Balan, A.; Ferreira, L. C. S.; Barbosa, J. A. R. G.
2006-01-01
The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222 1, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222 1 , with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress
Energy Technology Data Exchange (ETDEWEB)
Santacruz, C. P.; Balan, A.; Ferreira, L. C. S. [Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil); Barbosa, J. A. R. G., E-mail: joao@lnls.br [Centro de Biologia Molecular e Estrutural (CeBiMe), Laboratório Nacional de Luz Síncrotron (LNLS), CP 6192, Campinas, SP 13084-971 (Brazil); Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil)
2006-03-01
The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222{sub 1,} with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222{sub 1}, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress.
Directory of Open Access Journals (Sweden)
Roberto Luis Portz
2006-07-01
Full Text Available A bacteriose (Xanthomonas axonopodis pv. manihotis e a doenca de maior importancia economica na cultura da mandioca. Para estudar a variabilidade genetica desta bacteria no Oeste do Parana, foram realizados levantamentos em Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa e Pato Bragado. Os isolados foram caracterizados em relacao a atividade de amilase, ƒ¿ e ƒÀ-esterase e agressividade. Dos 61 materiais vegetais coletados, obtiveram-se 19 isolados da bacteria, com maior incidencia para variedades de mesa em relacao aqueles para industria. Manivas provenientes de Pato Bragado, Entre Rios do Oeste e Mercedes apresentaram incidencias de 10, 27 e 10%, respectivamente, valores inferiores aos de Marechal Candido Rondon (50% e Nova Santa Rosa (58%. Os isolados foram agrupados em cinco, seis e 12 grupos em relacao a capacidade amilolitica, agressividade e isoenzimas de esterase, respectivamente. Nao houve relacao entre atividade de amilase e agressividade. Isolados de Marechal Candido Rondon foram mais agressivos que os provenientes das outras regioes. O agrupamento com base em esterase permitiu verificar que isolados provenientes de Entre Rios do Oeste, Nova Santa Rosa e Mercedes apresentaram alto grau de similaridade. Estes resultados indicam haver diferenciacaoentre os isolados da bacteria presentes nos municipios amostrados.The bacterial blight (Xanthomonas axonopodis pv. manihotis is the most important disease of cassava. To study the genetic variability of pathogen in the West of Parana, a research was carried out at Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa and Pato Bragado. The isolates were characterized to amylase activity, ƒ¿ and ƒÀ-esterase and aggressiveness. From 61 collected materials, were obtained 19 bacterial isolates, with larger incidence for varieties of human consume than those for industry. Stems from Pato Bragado, Entre Rios do Oeste and Mercedes
Efect of aqueous extract from turmeric (Curcuma longa L.) in Xanthomonas axonopodis pv. manihotis.
Odair Josà Kuhn
2003-01-01
The cassava bacterial blight caused by Xanthomonas axonopodis pv. manihotis is the most importance disease of the culture and it is distributed in all the places where it is cultivated. Infected stems constitute themselves in the principal way of the bacterium dissemination to new cultivation areas. The chemical control of phytobacteria is difficult due to the products shortage, as well as, the existing ones are used exclusively in plantations of high economic value. By the other hand, the al...
Insights into xanthomonas axonopodis pv. Citri biofilm through proteomics
Zimaro, Tamara
2013-08-07
Background: Xanthomonas axonopodis pv. Citri (X. a. pv. Citri) causes citrus canker that can result in defoliation and premature fruit drop with significant production losses worldwide. Biofilm formation is an important process in bacterial pathogens and several lines of evidence suggest that in X. a. pv. Citri this process is a requirement to achieve maximal virulence since it has a major role in host interactions. In this study, proteomics was used to gain further insights into the functions of biofilms. Results: In order to identify differentially expressed proteins, a comparative proteomic study using 2D difference gel electrophoresis was carried out on X. a. pv. Citri mature biofilm and planktonic cells. The biofilm proteome showed major variations in the composition of outer membrane proteins and receptor or transport proteins. Among them, several porins and TonB-dependent receptor were differentially regulated in the biofilm compared to the planktonic cells, indicating that these proteins may serve in maintaining specific membrane-associated functions including signaling and cellular homeostasis. In biofilms, UDP-glucose dehydrogenase with a major role in exopolysaccharide production and the non-fimbrial adhesin YapH involved in adherence were over-expressed, while a polynucleotide phosphorylase that was demonstrated to negatively control biofilm formation in E. coli was down-regulated. In addition, several proteins involved in protein synthesis, folding and stabilization were up-regulated in biofilms. Interestingly, some proteins related to energy production, such as ATP-synthase were down-regulated in biofilms. Moreover, a number of enzymes of the tricarboxylic acid cycle were differentially expressed. In addition, X. a. pv. Citri biofilms also showed down-regulation of several antioxidant enzymes. The respective gene expression patterns of several identified proteins in both X. a. pv. Citri mature biofilm and planktonic cells were evaluated by
Directory of Open Access Journals (Sweden)
Popović Tatjana
2012-01-01
Full Text Available Bean production is threaten by phytopathogenic bacteria causing agents of blights, Xanthomonas axonopodis pv. phaseoli (Xap and Pseudomonas savastanoi pv. phaseolicola (Psp. Since there is no satisfactory chemical control for the disease, the recommended measures are preventive and include use of healthy seed, crop rotation, deep plowing and use of resistant cultivars. In this work we involved a detection method for isolation of Xap and Psp from bean seed to semi-selective medium Milk Agar Tween (MT. On this medium, Xap formed yellow, mucoid and convex colonies with two hydrolysis zones (less milk and more enlightened, and Psp formed whitish-cream, flat and round colonies. The identification of Xap and Psp was confirmed using the ELISA and PCR. Due to its selectivity, easy preparation and possibility of simultaneous detection of bacteria Xap and Psp, MT medium can be recommended for routine test of seed health for local seed or seed from import.
The molybdate-binding protein (ModA) of the plant pathogen Xanthomonas axonopodis pv. citri.
Balan, Andrea; Santacruz, Carolina P; Moutran, Alexandre; Ferreira, Rita C C; Medrano, Francisco J; Pérez, Carlos A; Ramos, Carlos H I; Ferreira, Luís C S
2006-12-01
The modABC operon of phytopathogen Xanthomonas axonopodis pv. citri (X. citri) encodes a putative ABC transporter involved in the uptake of the molybdate and tungstate anions. Sequence analyses showed high similarity values of ModA orthologs found in X. campestris pv. campestris (X. campestris) and Escherichia coli. The X. citri modA gene was cloned in pET28a and the recombinant protein, expressed in the E. coli BL21 (DE3) strain, purified by immobilized metal affinity chromatography. The purified protein remained soluble and specifically bound molybdate and tungstate with K(d) 0.29+/-0.12 microM and 0.58+/-0.14 microM, respectively. Additionally binding of molybdate drastically enhanced the thermal stability of the recombinant ModA as compared to the apoprotein. This is the first characterization of a ModA ortholog expressed by a phytopathogen and represents an important tool for functional, biochemical and structural analyses of molybdate transport in Xanthomonas species.
Energy Technology Data Exchange (ETDEWEB)
Hilario, Eduardo; Teixeira, Elaine Cristina; Pedroso, Gisele Audrei; Bertolini, Maria Célia [Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil); Medrano, Francisco Javier, E-mail: fjmedrano@yahoo.com [Departamento de Cristalografia de Proteínas, Centro de Biologia Molecular Estrutural, Laboratório Nacional de Luz Síncrotron, Caixa Postal 6192, CEP 13084-971, Campinas-SP (Brazil); Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil)
2006-05-01
XAC1151, a small heat-shock protein from X. axonopodis pv. citri belonging to the α-crystallin family, was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The hspA gene (XAC1151) from Xanthomonas axonopodis pv. citri encodes a protein of 158 amino acids that belongs to the small heat-shock protein (sHSP) family of proteins. These proteins function as molecular chaperones by preventing protein aggregation. The protein was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The crystal belongs to the rhombohedral space group R3, with unit-cell parameters a = b = 128.7, c = 55.3 Å. The crystal structure was solved by molecular-replacement methods. Structure refinement is in progress.
Arrieta-Ortiz, Mario L; Rodríguez-R, Luis M; Pérez-Quintero, Álvaro L; Poulin, Lucie; Díaz, Ana C; Arias Rojas, Nathalia; Trujillo, Cesar; Restrepo Benavides, Mariana; Bart, Rebecca; Boch, Jens; Boureau, Tristan; Darrasse, Armelle; David, Perrine; Dugé de Bernonville, Thomas; Fontanilla, Paula; Gagnevin, Lionel; Guérin, Fabien; Jacques, Marie-Agnès; Lauber, Emmanuelle; Lefeuvre, Pierre; Medina, Cesar; Medina, Edgar; Montenegro, Nathaly; Muñoz Bodnar, Alejandra; Noël, Laurent D; Ortiz Quiñones, Juan F; Osorio, Daniela; Pardo, Carolina; Patil, Prabhu B; Poussier, Stéphane; Pruvost, Olivier; Robène-Soustrade, Isabelle; Ryan, Robert P; Tabima, Javier; Urrego Morales, Oscar G; Vernière, Christian; Carrere, Sébastien; Verdier, Valérie; Szurek, Boris; Restrepo, Silvia; López, Camilo; Koebnik, Ralf; Bernal, Adriana
2013-01-01
Xanthomonas axonopodis pv. manihotis (Xam) is the causal agent of bacterial blight of cassava, which is among the main components of human diet in Africa and South America. Current information about the molecular pathogenicity factors involved in the infection process of this organism is limited. Previous studies in other bacteria in this genus suggest that advanced draft genome sequences are valuable resources for molecular studies on their interaction with plants and could provide valuable tools for diagnostics and detection. Here we have generated the first manually annotated high-quality draft genome sequence of Xam strain CIO151. Its genomic structure is similar to that of other xanthomonads, especially Xanthomonas euvesicatoria and Xanthomonas citri pv. citri species. Several putative pathogenicity factors were identified, including type III effectors, cell wall-degrading enzymes and clusters encoding protein secretion systems. Specific characteristics in this genome include changes in the xanthomonadin cluster that could explain the lack of typical yellow color in all strains of this pathovar and the presence of 50 regions in the genome with atypical nucleotide composition. The genome sequence was used to predict and evaluate 22 variable number of tandem repeat (VNTR) loci that were subsequently demonstrated as polymorphic in representative Xam strains. Our results demonstrate that Xanthomonas axonopodis pv. manihotis strain CIO151 possesses ten clusters of pathogenicity factors conserved within the genus Xanthomonas. We report 126 genes that are potentially unique to Xam, as well as potential horizontal transfer events in the history of the genome. The relation of these regions with virulence and pathogenicity could explain several aspects of the biology of this pathogen, including its ability to colonize both vascular and non-vascular tissues of cassava plants. A set of 16 robust, polymorphic VNTR loci will be useful to develop a multi-locus VNTR analysis
Mayer, Lauri; Vendruscolo, Claire Tondo; Silva, Wladimir Padilha da; Moura, Andrea Bittencourt
2008-01-01
Goma xantana é um heteropolissacarídeo bacteriano sintetizado por várias espécies do gênero Xanthomonas. Devido principalmente às suas excelentes propriedades reológicas, encontra diversas aplicações na indústria alimentícia, petrolífera, cosmética e em produtos farmacêuticos. Este trabalho objetivou a produção, a análise da viscosidade, do comportamento reológico e a composição química da goma xantana produzida por sete cepas de Xanthomonas axonopodis pv. phaseoli. A produção de xantana vari...
International Nuclear Information System (INIS)
Peyrou, M.; Del Campo, R.; Russi, P.; Mara, H.; Rigamonti, N.; Larrechart, L.; Perez, E.
2012-01-01
Xanthomonas axonopodis pv. ci tri (X ac) produces citrus canker disease in all citrus commercial species. The bacteria can be disseminated through vegetative propagation material in asymptomatic form. To optimize bacteria detection techniques applicable to asymptomatic citrus plant tissue routine analysis, ELISA, Immunofluorescence, Pcr, qRT P CR and host plant inoculation (bioassay) diagnostic techniques were compared. Tests were made from decimal dilutions between 108 uf6.ml-1 and 102 ufc.mL-1 using a pure culture of 49b strain.The detection level obtained was 1.8 x 102 ufc.mL-1 using Inmunofluorescence; 1.8x104 ufc.mL-1 with indirect ELISA, 1.8 x 103 ufc.mL-1 by means of PCR; 10 ufc.mL-1 through of qRT P CR and 230 ufc.mL-1 in sour orange inoculated plants. The experiment was repeated at least three times for each technique. Considering this result, and taking into account that sensitivity, practicity and cost, are important when a great number of plants need to be tested, the PCR and inoculation in host plants were those that met the best characteristics to be evaluated in asymptomatic plant material
International Nuclear Information System (INIS)
Guzzo, Cristiane R.; Nagem, Ronaldo A. P.; Galvão-Botton, Leonor M. P.; Guimarães, Beatriz G.; Medrano, Francisco J.; Barbosa, João A. R. G.; Farah, Chuck S.
2005-01-01
The first crystallographic study of a member of the YaeQ family of proteins, which are conserved in a small group of Gram-negative bacteria, most of which are animal or plant pathogens, is reported. Diffraction data were collected to 1.9 Å resolution and an interpretable electron-density map was obtained. Xanthomonas axonopodis pv. citri YaeQ (XAC2396) is a member of a family of bacterial proteins conserved in several Gram-negative pathogens. Here, the cloning, expression, purification and crystallization of the 182-residue (20.6 kDa) YaeQ protein are described. Recombinant YaeQ containing selenomethionine was crystallized in space group P2 1 and crystals diffracted to 1.9 Å resolution at a synchrotron source. The unit-cell parameters are a = 39.75, b = 91.88, c = 48.03 Å, β = 108.37°. The calculated Matthews coefficient suggests the presence of two YaeQ molecules in the asymmetric unit. Initial experimental phases were calculated by the multiple-wavelength anomalous dispersion technique and an interpretable electron-density map was obtained
Balan, Andrea; Santacruz-Pérez, Carolina; Moutran, Alexandre; Ferreira, Luís Carlos Souza; Neshich, Goran; Gonçalves Barbosa, João Alexandre Ribeiro
2008-02-01
In Xanthomonas axonopodis pv. citri (Xac or X. citri), the modA gene codes for a periplasmic protein (ModA) that is capable of binding molybdate and tungstate as part of the ABC-type transporter required for the uptake of micronutrients. In this study, we report the crystallographic structure of the Xac ModA protein with bound molybdate. The Xac ModA structure is similar to orthologs with known three-dimensional structures and consists of two nearly symmetrical domains separated by a hinge region where the oxyanion-binding site lies. Phylogenetic analysis of different ModA orthologs based on sequence alignments revealed three groups of molybdate-binding proteins: bacterial phytopathogens, enterobacteria and soil bacteria. Even though the ModA orthologs are segregated into different groups, the ligand-binding hydrogen bonds are mostly conserved, except for Archaeglobus fulgidus ModA. A detailed discussion of hydrophobic interactions in the active site is presented and two new residues, Ala38 and Ser151, are shown to be part of the ligand-binding pocket.
Medina, Cesar Augusto; Reyes, Paola Andrea; Trujillo, Cesar Augusto; Gonzalez, Juan Luis; Bejarano, David Alejandro; Montenegro, Nathaly Andrea; Jacobs, Jonathan M; Joe, Anna; Restrepo, Silvia; Alfano, James R; Bernal, Adriana
2018-03-01
Xanthomonas axonopodis pv. manihotis (Xam) causes cassava bacterial blight, the most important bacterial disease of cassava. Xam, like other Xanthomonas species, requires type III effectors (T3Es) for maximal virulence. Xam strain CIO151 possesses 17 predicted T3Es belonging to the Xanthomonas outer protein (Xop) class. This work aimed to characterize nine Xop effectors present in Xam CIO151 for their role in virulence and modulation of plant immunity. Our findings demonstrate the importance of XopZ, XopX, XopAO1 and AvrBs2 for full virulence, as well as a redundant function in virulence between XopN and XopQ in susceptible cassava plants. We tested their role in pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) and effector-triggered immunity (ETI) using heterologous systems. AvrBs2, XopR and XopAO1 are capable of suppressing PTI. ETI suppression activity was only detected for XopE4 and XopAO1. These results demonstrate the overall importance and diversity in functions of major virulence effectors AvrBs2 and XopAO1 in Xam during cassava infection. © 2017 BSPP AND JOHN WILEY & SONS LTD.
DEFF Research Database (Denmark)
Champion, Elise; Remaud-Simeon, Magali; Skov, Lars Kobberøe
2009-01-01
Glycoside hydrolase family 13 (GH-13) mainly contains starch-degrading or starch-modifying enzymes. Sucrose hydrolases utilize sucrose instead of amylose as the primary glucosyl donor. Here, the catalytic properties and X-ray structure of sucrose hydrolase from Xanthomonas campestris pv. campestris...... of GH-13. Comparisons with structures of the highly similar sucrose hydrolase from X. axonopodis pv. glycines most notably showed that residues Arg516 and Asp138, which form a salt bridge in the X. axonopodis sucrose complex and define part of the subsite -1 glucosyl-binding determinants...
Vernière, C J; Gottwald, T R; Pruvost, O
2003-07-01
ABSTRACT Experimental inoculations of Xanthomonas axonopodis pv. citri in different tissues of Tahiti lime and Pineapple sweet orange were conducted monthly under natural conditions on Réunion Island. The interactions between a set of environmental and epidemic variables associated with disease expression and 184 different factor combinations were investigated to determine the parameters needed to explain Asiatic citrus canker (ACC) disease expression. Area under the disease progress curve (AUDPC), inoculation date (Id), fruit and leaf age ratings (FAR and LAR), and number of days during the first 2 weeks postinoculation for which the temperature was less than 14 degrees C (T(min)) or more than 28 degrees C (T(max)) were retained by principal component analysis and canonical correlation analysis as the most meaningful epidemic and environmental variables, respectively. AUDPC as the strongest dependent variable and combinations of the environmental variables as independent variables were used in multiple regression analyses. Tissue age rating at the time of infection was a good predictor for disease resulting from spray inoculation on fruits and leaves and also on fruits following a wound inoculation. Temperature, as expressed by T(min) or T(max), was also a significant factor in determining disease development described by AUDPC. Mature green stems were highly susceptible after wounding, similarly to leaves, but buds and leaf scars expressed the lowest susceptibility. These variations in disease expression according to the tissues will have different impacts on ACC epidemiology.
Directory of Open Access Journals (Sweden)
Sung Pae Chang
2016-08-01
Full Text Available Xanthomonas axonopodis pv. glycines (Xag is a necrotrophic bacterial pathogen of the soybean that causes bacterial pustules and is a nonhost pathogen of the chili pepper. In the current study, chili pepper fruit wound inoculated in planta with Xag 8ra formed necrotic lesions on the fruit surface and induced several structural and chemical barriers systemically in the fruit tissue. The initial defense response included programmed cell death of necrotizing and necrotized cells, which was characterized by nuclear DNA cleavage, as detected by TUNEL-confocal laser scanning microscopy (CLSM, and phosphatidylserine exposure on cell walls distal to the infection site, as detected by Annexin V FLUOS-CLSM. These two responses may facilitate cell killing and enhance transportation of cell wall materials used for cell wall thickening, respectively. The cells beneath the necrotic tissue were enlarged and divided to form periclinal cell walls, resulting in extensive formation of several parallel boundary layers at the later stages of infection, accompanying the deposition of wall fortification materials for strengthening structural defenses. These results suggest that nonhost resistance of chili pepper fruit against the nonhost necrotrophic pathogen Xag 8ra is activated systematically from the initial infection until termination of the infection cycle, resulting in complete inhibition of bacterial pathogenesis by utilizing organ-specific in situ physiological events governed by the expression of genes in the plant fruit organ.
Li, Wenbin; Brlansky, Ronald H; Hartung, John S
2006-05-01
Herbaria are important resources for the study of the origins and dispersal of plant pathogens, particularly bacterial plant pathogens that incite local lesions in which large numbers of pathogen genomes are concentrated. Xanthomonas axonopodis pv. citri (Xac), the causal agent of citrus bacterial canker disease, is a notable example of such a pathogen. The appearance of novel strains of the pathogen in Florida and elsewhere make it increasingly important to understand the relationships among strains of this pathogen. USDA-ARS at Beltsville, Maryland maintains approximately 700 herbarium specimens with citrus canker disease lesions up to 90 years old, originally collected from all over the world, and so is an important resource for phytogeographic studies of this bacterium. Unfortunately, DNA in herbarium specimens is degraded and may contain high levels of inhibitors of PCR. In this study, we compared a total of 23 DNA isolation techniques in combination with 31 novel primer pairs in order to develop an efficient protocol for the analysis of Xac DNA in herbarium specimens. We identified the most reliable extraction method, identified in terms of successful amplification by our panel of 31 primer pairs. We also identified the most robust primer pairs, identified as successful in the largest number of extracts prepared by different methods. We amplified Xac genomic sequences up to 542 bp long from herbarium samples up to 89 years old. Primers varied in effectiveness, with some primer pairs amplifying Xac DNA from a 1/10,000 dilution of extract from a single lesion from a citrus canker herbarium specimen. Our methodology will be useful to identify pathogens and perform molecular analyses of bacterial and possibly fungal genomes from herbarium specimens.
La proteína PthB de Xanthomonas axonopodis pv. manihotis es autoactiva en ensayos de doble hibrido
Directory of Open Access Journals (Sweden)
Juliana Gil
2011-01-01
Full Text Available La bacteriosis vascular de yuca producida por la bacteria Xanthomonas axonopodis pv. manihotis (Xam es uno de los factores limitantes para la producción de yuca. Dentro de los primeros factores de patogenicidad identificados en esta bacteria se encuentra el gen pthB. La proteína PthB pertenece a la familia de efectores PthA/AvrBs3, que se caracterizan por presentar dominios NLS (Nuclear Localization Signal y un dominio AAD (Acidic Activation Domain, lo cual sugiere que estas proteínas actúan como factores de transcripción. La identificación de las proteínas de yuca que interactúan con PthB permitiría dar luces sobre la función de esta proteína en la patogenicidad de esta bacteria. En este trabajo se clonó pthB en una fusión traduccional con el BD (Binding Domain del factor de transcripción GAL4. Después de transformar este constructo en una cepa de levadura, se observó autoactivación de los genes reporteros, incluso a concentraciones altas de 3-AT. La eliminación del primer, segundo o de los dos NLS y del AAD no eliminaron la capacidad de autoactivación de los genes reporteros mediada por PthB. Estos resultados indican la imposibilidad de su utilización en un tamizaje de una librería de ADNc de yuca para identificar las proteínas que interactúan con PthB.
MICROSPOROGÉNESIS DE TRES ESPECIES DEL SUBGÉNERO PASSIFLORA (PASSIFLORA, PASSIFLORACEAE DE PARAGUAY
Directory of Open Access Journals (Sweden)
Claudia Pereira Sühsner
2016-01-01
Full Text Available El presente trabajo tuvo por objeto caracterizar cariológicamente las especies del género Passiflora L., subgénero Passiflora, del Distrito Félix Pérez Cardozo, Guairá, Paraguay. Por primera vez, se da a conocer el número cromosómico en meiosis 2n = 9II para P. alata Curtis y P. caerulea L. También, se confirma el número cromosómico de 2n = 9II para P. edulis Sims. El comportamiento meiótico en todas las especies estudiadas fue normal, con segregación regular de los cromosomas. La asociación cromosómica frecuentemente encontrada en diacinesis y metafase I fue de bivalentes. Las pocas irregularidades meióticas observadas consistieron en cromosomas rezagados en anafase I y fases asincrónicas en meiosis II, sin embargo, la viabilidad de polen es alta, entre 78,83% y 98,6%. Los resultados confirman x = 9 como número básico para el subgénero Passiflora. Este estudio es una importante contribución al conocimiento sobre la citogenética de las especies de Passiflora subg Passiflora de Paraguay.
Evolutionary history of the plant pathogenic bacterium Xanthomonas axonopodis.
Directory of Open Access Journals (Sweden)
Nadia Mhedbi-Hajri
Full Text Available Deciphering mechanisms shaping bacterial diversity should help to build tools to predict the emergence of infectious diseases. Xanthomonads are plant pathogenic bacteria found worldwide. Xanthomonas axonopodis is a genetically heterogeneous species clustering, into six groups, strains that are collectively pathogenic on a large number of plants. However, each strain displays a narrow host range. We address the question of the nature of the evolutionary processes--geographical and ecological speciation--that shaped this diversity. We assembled a large collection of X. axonopodis strains that were isolated over a long period, over continents, and from various hosts. Based on the sequence analysis of seven housekeeping genes, we found that recombination occurred as frequently as point mutation in the evolutionary history of X. axonopodis. However, the impact of recombination was about three times greater than the impact of mutation on the diversity observed in the whole dataset. We then reconstructed the clonal genealogy of the strains using coalescent and genealogy approaches and we studied the diversification of the pathogen using a model of divergence with migration. The suggested scenario involves a first step of generalist diversification that spanned over the last 25,000 years. A second step of ecology-driven specialization occurred during the past two centuries. Eventually, secondary contacts between host-specialized strains probably occurred as a result of agricultural development and intensification, allowing genetic exchanges of virulence-associated genes. These transfers may have favored the emergence of novel pathotypes. Finally, we argue that the largest ecological entity within X. axonopodis is the pathovar.
Directory of Open Access Journals (Sweden)
Ottado Jorgelina
2010-03-01
Full Text Available Abstract Background Plant natriuretic peptides (PNPs belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival. Results Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 α subunit, maturase K, and α- and β-tubulin. Conclusions We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence.
Garavaglia, Betiana S; Thomas, Ludivine; Zimaro, Tamara; Gottig, Natalia; Daurelio, Lucas D; Ndimba, Bongani; Orellano, Elena G; Ottado, Jorgelina; Gehring, Christoph A
2010-01-01
Background: Plant natriuretic peptides (PNPs) belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP) uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival.Results: Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 ? subunit, maturase K, and ?- and ?-tubulin.Conclusions: We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence. 2010 Garavaglia et al; licensee BioMed Central Ltd.
Garavaglia, Betiana S
2010-03-21
Background: Plant natriuretic peptides (PNPs) belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP) uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival.Results: Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 ? subunit, maturase K, and ?- and ?-tubulin.Conclusions: We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence. 2010 Garavaglia et al; licensee BioMed Central Ltd.
Una nueva especie de Passiflora, subgénero Passiflora (Passifloraceae del oeste de Colombia
Directory of Open Access Journals (Sweden)
Gerlach Gϋnter
2000-12-01
Full Text Available A new species of Passiflora from Colombia is here described: Passiflora chocoensis. It is closely related to P. menispermifolia, but differs by its sparsely spreading hairs, the finer texture of the leaves, its larger and cordate bracts, the number of petiolar glands and the lack of glands on the stipules and bracts.Se describe una nueva especie de Passiflora de Colombia: P. chocoensis, la cual tiene un parentesco cercano con P. menispermifolia, diferenciándose de ésta por su indumento ligero de pocos pelos dispersos, la textura de las hojas más fina, el mayor tamaño de sus brácteas en forma de corazón, la cantidad de glándulas en los pecíolos, al igual que por la ausencia de las glándulas en las brácteas y estípulas.
International Nuclear Information System (INIS)
Veeramohan, R.; Haron, N.W.
2015-01-01
Taxonomic studies of four selected Passiflora species; Passiflora edulis Sims (Passion fruit), Passiflora coccinea Aubl. (Scarlet passion flower), Passiflora foetida L. (Stinking passion flower) and Passiflora incarnata L. (Fragrant passion flower) were carried out to distinguish their morphological characteristics. Macromorphological characters on the leaves, flowers and fruits of all four Passiflora species were observed under a binocular microscope and they varied characteristically in terms of colour, texture and shape of flowers, leaves and fruits. Jeol JSM-7500F Scanning Electron Microscope was used to observe the micromorphological characters such as stomata, trichomes, and leaf surface indumentum of each Passiflora species. Micromorphologically, each species varied in types and sizes of stomata, epidermal. (author)
Directory of Open Access Journals (Sweden)
Gilmara Alvarenga Fachardo Oliveira
2013-10-01
Full Text Available The aim of this study was to evaluate the selected 41 SSR markers developed for yellow passion fruit (Passiflora edulis f. flavicarpa Sims. for their transferability to 11 different Passiflora species. Twenty-one SSR were successfully amplified in 10 wild species of passion fruit producing 101 bands. All the markers were amplifiable for at least one species. The mean transferability was 68,8%, ranging from 15,4% (primer PE11 to 100 % (PE13, PE18, PE37, PE41 and PE88. Transferability was higher for the species from the Passiflora subgenus than for those from the Decaloba and Dysosmia subgenus. The results indicated a high level of nucleotide sequence conservation of the primer regions in the species evaluated, and consequently, they could potentially be used for the establishment of molecular strategies for use in passion fruit breeding and genetics.
PASSIOMA: Exploring Expressed Sequence Tags during Flower Development in Passiflora spp.
Directory of Open Access Journals (Sweden)
Lucas Cutri
2012-01-01
Full Text Available The genus Passiflora provides a remarkable example of floral complexity and diversity. The extreme variation of Passiflora flower morphologies allowed a wide range of interactions with pollinators to evolve. We used the analysis of expressed sequence tags (ESTs as an approach for the characterization of genes expressed during Passiflora reproductive development. Analyzing the Passiflora floral EST database (named PASSIOMA, we found sequences showing significant sequence similarity to genes known to be involved in reproductive development such as MADS-box genes. Some of these sequences were studied using RT-PCR and in situ hybridization confirming their expression during Passiflora flower development. The detection of these novel sequences can contribute to the development of EST-based markers for important agronomic traits as well as to the establishment of genomic tools to study the naturally occurring floral diversity among Passiflora species.
International Nuclear Information System (INIS)
Silva, Lorena M.A.; Alves Filho, Elenilson G.; Choze, Rafael; Liao, Luciano M.; Alcantara, Glaucia B.
2012-01-01
Xanthomonas axonopodis (Xac) bacterium causes one of the most feared and untreatable diseases in citriculture: citrus canker. To understand the response mechanisms of orange trees when attacked by Xac, leaves and fruits of Citrus sinensis were directly evaluated by HRMAS NMR (high resolution magic angle spinning nuclear magnetic resonance) spectroscopy. This technique allows the analysis of samples without laborious pre-treatments and also allows access to important information about chemical composition of samples. The orange tree leaves and fruit peels investigated in this study demonstrated the biochemical changes caused by Xac. Aided by chemometric analysis, the HRMAS NMR results show relevant changes in amino acids, carbohydrates, organic acids and terpenoids content. (author)
Directory of Open Access Journals (Sweden)
Flávia Santos Faria
2010-03-01
Full Text Available O subgênero Decaloba, ao qual pertencem as espécies de Passiflora L. com flores pequenas, é pouco estudado do ponto de vista reprodutivo, o qual pode contribuir para esclarecimento das relações filogenéticas no gênero Passiflora. O objetivo deste trabalho foi estudar a biologia reprodutiva e a polinização de populações de duas espécies desse subgênero, P. capsularis e P. pohlii, ocorrentes no estado de Minas Gerais. Determinou-se a receptividade do estigma, viabilidade dos grãos de pólen e a concentração do néctar. Foram realizadas polinizações controladas para verificar o sistema reprodutivo. Foram registrados os visitantes florais e a carga polínica. As flores de ambas as espécies abrem à noite; em P. pohlii a antese iniciou-se por volta das 3 h e a senescência ocorreu por volta das 11 h, já em P. capsularis, a abertura se deu no mesmo horário, mas a senescência ocorreu por volta das 14h. A concentração do néctar e viabilidade do pólen foram, respectivamente, 34,88 ± 7,66% e 80 ± 0,15% em P. pohlii e 22,33 ± 5,82% e 92 ± 0,06% em P. capsularis. Passiflora pohlii é alógama e autoincompatível, enquanto que P. capsularis é autógama e autocompatível. Passiflora pohlii teve como polinizadores três espécies de abelhas do gênero Ptiloglossa (Colletidae, enquanto que em P. capsularis os visitantes florais observados foram considerados pilhadores de pólen e néctar. A antese noturna encontrada nas espécies de Passiflora estudadas sugere haver uma relação evolutiva entre espécies de Passiflora subg. Decaloba e himenópteros com hábito noturno, especialmente abelhas do gênero Ptiloglossa.The subgenus Decaloba (Passifloraceae is poorly studied on reproductive aspects, which may help our understanding on phylogenetic relationships in the genus. The purpose of this work was to study the reproductive biology and pollination of Passiflora pohlii and P. capsularis, two species belonging to this subgenus with
Directory of Open Access Journals (Sweden)
Rosemary Corrêa Costa
2017-05-01
e as avaliações foram realizadas pela contagem do número de colônias do patógeno. Nos ensaios em casade-vegetação a aplicação dos tratamentos foi realizada 7 dias antes da inoculação de X. axonopodis pv. passiflorae para as formulações e extratos e 2 dias antes da inoculação para os produtos químicos. As avaliações de severidade da doença foram realizadas em intervalos de 48 horas. Os produtos oxitetraciclina, fluazinam, mancozeb, oxicloreto de cobre, Fitoforce Cobre e Fitoforce Plus inibiram totalmente o crescimento in vitro da bactéria. Em casa-de-vegetação, todos os tratamentos reduziram significativamente a severidade da mancha bacteriana com reduções entre 54 e 62%, com exceção do Fitoforce Plus que apresentou porcentagem de controle abaixo de 50%.
Effect of a medicinal plant (Passiflora incarnata L) on sleep.
Guerrero, Fructuoso Ayala; Medina, Graciela Mexicano
2017-01-01
Extracts of the plant Passiflora incarnata L. (Passifloraceae) were administered intraperitoneally in order to test its effects on sleep. Experiments were carried out on chronically implanted male adult wistar rats to obtain cerebral (EEG), ocular (EOG) and muscular (EMG) activities throughout their states of vigilance. Polygraphic recordings were taken during 9 continuous hours before and after the extract administration (500 mg/kg). Passiflora incarnata induced a significant increment in the total sleep time ( p sleep (SWS). Concomitantly, a significant decrement in wakefulness (W) was observed ( p sleep showed a decreasing tendency, since both its frequency and mean duration were reduced. The extracts obtained from Passiflora incarnata can be considered as appropriated sleep inducers.
Genetic variability assessment in the genus Passiflora by SSR markers
Directory of Open Access Journals (Sweden)
Claudia Lougon Paiva
2014-09-01
Full Text Available The genus Passiflora encompasses many species that are endemic to the Brazilian territory, including some with economic value. Studies on genetic diversity in this genus are fundamental because they allow understanding genetic variability and distance. The present study aimed to determine the genetic variability and distances among 10 species of the genus Passiflora by using microsatellite markers (Simple Sequence Repeat, SSR. Twenty-eight heterologous microsatellite markers were tested, but only 12 were used in the diversity analysis because they amplified in at least 80% of the species. A clear separation was observed among the subgenuses studied, as well as wide variation among the accessions of Passiflora. This knowledge enables breeders to explore diversity and transfer favorable alleles found in wild species.
Directory of Open Access Journals (Sweden)
Paulo Roberto Peres Kiihl
2011-06-01
Full Text Available Almost 90% of species of the genus Passiflora are native to the American continent, with high commercial value due to the fact that some species are used for human food while others have ornamental and medical qualities. Passiflora serrato-digitata is one of the species that integrates the Paraná Agronomic Institute germoplasm bank at its experimental base in Londrina, PR, Brazil. Collected flower buds were fixed in ethanol/acetic acid (3:1 v/v for 24h, transferred to 70% alcohol and stored under refrigeration. Slides were prepared by the squashing technique and stained with 1.0% propionic carmine; they were analyzed under an optic microscope. Irregularities in the chromosome segregation process of P. serrato-digitata have been verified by meiotic behavior analysis. These comprised precocious migration to poles in metaphase I and II, non-oriented chromosomes in metaphase plate in metaphase I and II, laggard chromosomes in anaphase I and II towards the formation of micronucleus in telophase I and II, and microspores in tetrads. Chromosome stickiness was another irregularity reported in the Passiflora genus for the first time. These irregularities which also contributed to the formation of monads, dyads and triads, resulted in normal imbalanced 2n and 4n microspores. According to the observed Meiotic Index of 71.83%, this species is not meiotically stable.Cerca de 90% das espécies do gênero Passiflora são nativas das Américas, sendo que aproximadamente 200 espécies são nativas do Brasil. Possuem grande importância comercial, pois algumas espécies são utilizadas na alimentação humana, outras apresentam propriedades medicinais e ornamentais. A espécie Passiflora serrato-digitata faz parte do banco de germoplasma do Instituto Agronômico do Paraná - IAPAR, estação experimental de Londrina, PR. Botões florais colhidos foram fixados em etanol/ácido acético (3:1 v/v por 24 horas, transferidos para álcool a 70% e acondicionado sob
An orientin derivative isolated from Passiflora tripartita var. mollissima
Ramos, Freddy A.; Castellanos, Leonardo; López, César; Palacios, Lizeth; Duque, Carmenza; Pacheco, Ricardo; Guzmán, Antonio
2010-01-01
Passiflora tripartita var. mollisima (banana passion fruit) is an edible fruit widespread in the Andean highlands of Colombia and Ecuador. The fruit is used for juices as well as for the sedative properties of the leaves. As a contribution to the chemical characterization of this species, a new compound, 4'- methoxyluteolin-8-C-6”acetylglucopyranoside, was isolated from the ethanolic extract of Passiflora tripartita var. mollisima leaves and identified by spectroscopical data (NMR, MS, UV).
Genetic Diversity in Passiflora Species Assessed by Morphological and ITS Sequence Analysis
Directory of Open Access Journals (Sweden)
Shiamala Devi Ramaiya
2014-01-01
Full Text Available This study used morphological characterization and phylogenetic analysis of the internal transcribed spacer (ITS region of nuclear ribosomal DNA to investigate the phylogeny of Passiflora species. The samples were collected from various regions of East Malaysia, and discriminant function analysis based on linear combinations of morphological variables was used to classify the Passiflora species. The biplots generated five distinct groups discriminated by morphological variables. The group consisted of cultivars of P. edulis with high levels of genetic similarity; in contrast, P. foetida was highly divergent from other species in the morphological biplots. The final dataset of aligned sequences from nine studied Passiflora accessions and 30 other individuals obtained from GenBank database (NCBI yielded one most parsimonious tree with two strongly supported clades. Maximum parsimony (MP tree showed the phylogenetic relationships within this subgenus Passiflora support the classification at the series level. The constructed phylogenic tree also confirmed the divergence of P. foetida from all other species and the closeness of wild and cultivated species. The phylogenetic relationships were consistent with results of morphological assessments. The results of this study indicate that ITS region analysis represents a useful tool for evaluating genetic diversity in Passiflora at the species level.
2008-01-01
pathogens also have been detected and identified by numerous nucleic acid-based techniques, including Southern blot hybridization and direct nucleotide...Xanthomonas axonopodis pv. vitians FB-1309; ATCC19320 Lettuce ; USA 1 Xanthomonas axonopodis sp. alfalfae XA129; Med. 2 Alfalfa; Sudan 1 Xanthomonas
Directory of Open Access Journals (Sweden)
Flavia Guzzo
2004-02-01
Full Text Available The genus Passiflora comprises hundred species, mainly native of the South American tropics and rainforests, which are grouped into 21 subgenera. Some species are widely studied for their economic importance and are chiefly cultivated for production of fruit juice. To obtain a continuous source of material for a screening of secondary metabolites, zygotic embryo culture was attempted for 62 Passiflora species, starting from seeds mainly collected in the wild. Twenty nine of these species produced calli, which had very different growth rates. Plants were successfully regenerated from calli of 13 different species. For 25 of the responsive species this is the first report of in vitro culture.O gênero Passiflora compõe centenas de espécies, a maioria de origem dos trópicos e das florestas da América do Sul, as quais são agrupadas em 21 subgêneros. Algumas espécies foram intensamente estudadas por sua importância econômica e são cultivadas principalmente para a produção de suco de fruta. Cultura de 29 espécies de Passiflora foram obtidos a partir de embriões zigóticos e de culturas de endosperma. Foram obtidos diferentes tipos de calos de crescimento, de tal forma que plantas foram regeneradas a partir de calos de 13 espécies diferentes. Não haviam sido ainda relatadas culturas in vitro para 25 das espécies trabalhadas.
Kwak, A Min; Min, Kyeong Jin; Lee, Sang Yeop
2015-01-01
Culture filtrates of six different edible mushroom species were screened for antimicrobial activity against tomato wilt bacteria Ralstonia solanacearum B3. Hericium erinaceus, Lentinula edodes (Sanjo 701), Grifola frondosa, and Hypsizygus marmoreus showed antibacterial activity against the bacteria. Water, n-butanol, and ethyl acetate extracts of spent mushroom substrate (SMS) of H. erinaceus exhibited high antibacterial activity against different phytopathogenic bacteria: Pectobacterium carotovorum subsp. carotovorum, Agrobacterium tumefaciens, R. solanacearum, Xanthomonas oryzae pv. oryzae, X. campestris pv. campestris, X. axonopodis pv. vesicatoria, X. axonopodis pv. citiri, and X. axonopodis pv. glycine. Quantitative real-time PCR revealed that water extracts of SMS (WESMS) of H. erinaceus induced expressions of plant defense genes encoding β-1,3-glucanase (GluA) and pathogenesis-related protein-1a (PR-1a), associated with systemic acquired resistance. Furthermore, WESMS also suppressed tomato wilt disease caused by R. solanacearum by 85% in seedlings and promoted growth (height, leaf number, and fresh weight of the root and shoot) of tomato plants. These findings suggest the WESMS of H. erinaceus has the potential to suppress bacterial wilt disease of tomato through multiple effects including antibacterial activity, plant growth promotion, and defense gene induction. PMID:26539048
Directory of Open Access Journals (Sweden)
JAMILE DA SILVA OLIVEIRA
Full Text Available ABSTRACT The aim of this study was to characterize Passiflora spp. accessions and its genetic diversity based on quantitative morphological descriptors of flowers and fruits. The study was conducted at Embrapa Cerrados, Planaltina-DF. Fifteen Passiflora spp. accessions were characterized using 14 quantitative morphological descriptors. Genetic distances among accessions were estimated based on Mahalanobis’ generalized distance. Cluster analysis via dendrogram and graphic dispersion was analyzed. The relative contribution of characters for accession divergence was also calculated. The morphoagronomic characterization based on quantitative descriptors of flowers and fruits contributed to the differentiation of Passiflora spp. accessions, serving as an important tool for variability quantification. This information is useful to perform Passiflora spp. characterization and genetic diversity studies.
Effect of a medicinal plant (Passiflora incarnata L on sleep
Directory of Open Access Journals (Sweden)
Fructuoso Ayala Guerrero
Full Text Available INTRODUCTION: Extracts of the plant Passiflora incarnata L. (Passifloraceae were administered intraperitoneally in order to test its effects on sleep. METHOD: Experiments were carried out on chronically implanted male adult wistar rats to obtain cerebral (EEG, ocular (EOG and muscular (EMG activities throughout their states of vigilance. Polygraphic recordings were taken during 9 continuous hours before and after the extract administration (500 mg/kg. RESULTS: Passiflora incarnata induced a significant increment in the total sleep time (p<0.05. This increment was due to an increase in the time spent by animals in slow wave sleep (SWS. Concomitantly, a significant decrement in wakefulness (W was observed (p<0.05. In contrast, time spent in rapid eye movement (REM sleep showed a decreasing tendency, since both its frequency and mean duration were reduced. CONCLUSIONS: The extracts obtained from Passiflora incarnata can be considered as appropriated sleep inducers.
BOTANICAL AND PHYTOCHEMICAL APPROACH ON PASSIFLORA SPP. – NEW NUTRACEUTICAL CROP IN ROMANIA
Directory of Open Access Journals (Sweden)
Tatiana Eugenia SESAN
2016-12-01
Full Text Available It has been performed a complex investigation – morpho-anatomical, physiological, taxonomical and phytochemical one – of Passiflora nutraceutical plants from Hofigal S.A., in the frame of project PN-II-PCCA-2013-4-0995, contract 160 (MAIA/2014. Anatomic analysis of leaf lamina, petiole and stem, provided data with taxonomical importance, leading to the conclusion that plant material belongs to Passiflora caerulea L., in concordance with world monographers of Passiflora genus: VANDERPLANK (2000 and ULMAN & MacDOUGAL (2004. Physiological investigation referred to the following parameters: coefficient k, leaf area index (LAI, chlorophyll fluorescence, stomatal conductance and yield of green plant biomass. Phytochemical investigation consisted in analyzing active principles (polyphenols, flavonoids content, in correlation with their antioxidant activity and determination of cytotoxicity of Passiflora extracts in NCTC cell line. At 10-150 µg/ml concentrations, it was recorded a normal cell morphology. At concentrations over 250 µg/ml, the plant extract become cytotoxic, altering the cell membrane structure, cells viability and proliferation.
de Castro, Érika C P; Zagrobelny, Mika; Cardoso, Márcio Z; Bak, Søren
2018-02-01
Heliconiines are called passion vine butterflies because they feed exclusively on Passiflora plants during the larval stage. Many features of Passiflora and heliconiines indicate that they have radiated and speciated in association with each other, and therefore this model system was one of the first examples used to exemplify coevolution theory. Three major adaptations of Passiflora plants supported arguments in favour of their coevolution with heliconiines: unusual variation of leaf shape within the genus; the occurrence of yellow structures mimicking heliconiine eggs; and their extensive diversity of defence compounds called cyanogenic glucosides. However, the protection systems of Passiflora plants go beyond these three features. Trichomes, mimicry of pathogen infection through variegation, and production of extrafloral nectar to attract ants and other predators of their herbivores, are morphological defences reported in this plant genus. Moreover, Passiflora plants are well protected chemically, not only by cyanogenic glucosides, but also by other compounds such as alkaloids, flavonoids, saponins, tannins and phenolics. Heliconiines can synthesize cyanogenic glucosides themselves, and their ability to handle these compounds was probably one of the most crucial adaptations that allowed the ancestor of these butterflies to feed on Passiflora plants. Indeed, it has been shown that Heliconius larvae can sequester cyanogenic glucosides and alkaloids from their host plants and utilize them for their own benefit. Recently, it was discovered that Heliconius adults have highly accurate visual and chemosensory systems, and the expansion of brain structures that can process such information allows them to memorize shapes and display elaborate pre-oviposition behaviour in order to defeat visual barriers evolved by Passiflora species. Even though the heliconiine-Passiflora model system has been intensively studied, the forces driving host-plant preference in these
Araya, Susan; Martins, Alexandre M; Junqueira, Nilton T V; Costa, Ana Maria; Faleiro, Fábio G; Ferreira, Márcio E
2017-07-21
The Passiflora genus comprises hundreds of wild and cultivated species of passion fruit used for food, industrial, ornamental and medicinal purposes. Efforts to develop genomic tools for genetic analysis of P. edulis, the most important commercial Passiflora species, are still incipient. In spite of many recognized applications of microsatellite markers in genetics and breeding, their availability for passion fruit research remains restricted. Microsatellite markers in P. edulis are usually limited in number, show reduced polymorphism, and are mostly based on compound or imperfect repeats. Furthermore, they are confined to only a few Passiflora species. We describe the use of NGS technology to partially assemble the P. edulis genome in order to develop hundreds of new microsatellite markers. A total of 14.11 Gbp of Illumina paired-end sequence reads were analyzed to detect simple sequence repeat sites in the sour passion fruit genome. A sample of 1300 contigs containing perfect repeat microsatellite sequences was selected for PCR primer development. Panels of di- and tri-nucleotide repeat markers were then tested in P. edulis germplasm accessions for validation. DNA polymorphism was detected in 74% of the markers (PIC = 0.16 to 0.77; number of alleles/locus = 2 to 7). A core panel of highly polymorphic markers (PIC = 0.46 to 0.77) was used to cross-amplify PCR products in 79 species of Passiflora (including P. edulis), belonging to four subgenera (Astrophea, Decaloba, Distephana and Passiflora). Approximately 71% of the marker/species combinations resulted in positive amplicons in all species tested. DNA polymorphism was detected in germplasm accessions of six closely related Passiflora species (P. edulis, P. alata, P. maliformis, P. nitida, P. quadrangularis and P. setacea) and the data used for accession discrimination and species assignment. A database of P. edulis DNA sequences obtained by NGS technology was examined to identify microsatellite repeats in
Directory of Open Access Journals (Sweden)
Luís Carlos Bernacci
2001-08-01
Full Text Available Passiflora ischnoclada foi descrita com base em apenas uma coleta. O único exemplar conhecido estava depositado no herbário de Berlin-Dahlem (B, mas foi destruído. A sinonimização da espécie em P. jilekii Wawra havia sido proposta, com base apenas em sua descrição original, mas, outro exemplar da coleção-tipo foi localizado no herbário do Instituto de Botânica (SP e P. ischnoclada foi recoletada na mesma área, quase um século depois. Foi possível comprovar a validade da espécie e seu posicionamento na série Laurifoliae e complementar sua descrição, acrescentando caracteres das flores e do fruto imaturo.The description of Passiflora ischnoclada was based on the type collection. The only mentioned material was deposited in the Berlin-Dahlem herbarium (B and was destroyed. The synonimization of P. ischnoclada under P. jilekii was proposed according to that description. Recently another material from the type collection was found in the SP herbarium and the species was collected again in the type locality. In this work the reestablishment of P. ischnoclada is proposed as well as the position of the species in the series Laurifoliae is discussed, and the description of the species is complemented, with adding characters of the flowers and the immature fruit.
Wang, Cong; Xu, Feng-Qing; Shang, Jian-Hua; Xiao, Huai; Fan, Wei-Wei; Dong, Fa-Wu; Hu, Jiang-Miao; Zhou, Jun
2013-07-30
Various species of genus Passiflora have been used as traditional folk medicines owing to their sedative and anti-hypertensive properties. Passiflora edulis Sims most widely grown in the warm temperate for their fragrant fruits and their twigs and leaves are used as a folk medicine for treating both anxiety and nervousness in American countries. The present study was to evaluate the antidepressant-like effect and the active components of this plant. The alcohol extracts of the stems (PES, 10 and 2 g/kg of the plant materials) and leaves (PEL, 10 and 2 g/kg of the plant materials) of Passiflora edulis Sims were orally administered to mice for 7 day. The animals were tested in the forced swim test (FST) and tail suspension test (TST). After behavioral assay of ethanol extract, phytochemical research of the stems and leaves (5.7 kg) of Passiflora edulis Sims were developed and further bioactive verification of monomeric compounds were conducted. There are mainly cycloartane triterpenoids and their saponins isolated from this plant, including two new cycloartane triterpenoid saponins named cyclopassifloside ХII (1) and ХIII (2), together with six known cycloartane triterpenoids, cyclopassifloic acids B and E, cyclopassiflosides II, VI, IX and XI. The ethanol extract of Passiflora edulis Sims together with isolated compounds cyclopassiflosides IX and XI may possess antidepressant-like effect. Cycloartane triterpenoid was one of the main compositions of Passiflora edulis Sims and possess antidepressant-like activity. Crown Copyright © 2013. Published by Elsevier Ireland Ltd. All rights reserved.
Rocha, Diego Ismael
2011-01-01
O presente estudo teve como objetivo descrever, através de análises anatômicas e ultraestruturais, o processo de regeneração in vitro de Passiflora cincinnata Masters, via embriogênese somática, a partir de embriões zigóticos e de Passiflora edulis Sims, via organogênese, a partir de explantes radiculares. Embriões zigóticos maduros de P. cincinnata foram colocados em meio de indução MS suplementado com 18,1 μM de 2,4-D e 4,4 μM de BAP. Embriões somáticos originaram-se a partir de z...
Vieira, Lorena Melo
2011-01-01
O presente estudo teve como objetivos caracterizar a expressão do gene ASYMMETRIC LEAVES1 (AS1), via hibridização in situ, durante a regeneração in vitro de segmentos radiculares de Passiflora edulis Sims, espécie comercialmente cultivada, e estabelecer um protocolo reproduzível via organogênese in vitro em Passiflora setacea, espécie silvestre. Explantes radiculares de P. edulis foram cultivados em meio MS, para indução de organogênese de ramos, suplementado com 2,35 μM de BA. Para dete...
Directory of Open Access Journals (Sweden)
Carlos Bernard M. Cerqueira-Silva
2014-08-01
Full Text Available Despite the ecological and economic importance of passion fruit (Passiflora spp., molecular markers have only recently been utilized in genetic studies of this genus. In addition, both basic genetic researches related to population studies and pre-breeding programs of passion fruit remain scarce for most Passiflora species. Considering the number of Passiflora species and the increasing use of these species as a resource for ornamental, medicinal, and food purposes, the aims of this review are the following: (i to present the current condition of the passion fruit crop; (ii to quantify the applications and effects of using molecular markers in studies of Passiflora; (iii to present the contributions of genetic engineering for passion fruit culture; and (iv to discuss the progress and perspectives of this research. Thus, the present review aims to summarize and discuss the relationship between historical and current progress on the culture, breeding, and molecular genetics of passion fruit.
Efficiency of ITS Sequences for DNA Barcoding in Passiflora (Passifloraceae
Directory of Open Access Journals (Sweden)
Giovanna Câmara Giudicelli
2015-04-01
Full Text Available DNA barcoding is a technique for discriminating and identifying species using short, variable, and standardized DNA regions. Here, we tested for the first time the performance of plastid and nuclear regions as DNA barcodes in Passiflora. This genus is a largely variable, with more than 900 species of high ecological, commercial, and ornamental importance. We analyzed 1034 accessions of 222 species representing the four subgenera of Passiflora and evaluated the effectiveness of five plastid regions and three nuclear datasets currently employed as DNA barcodes in plants using barcoding gap, applied similarity-, and tree-based methods. The plastid regions were able to identify less than 45% of species, whereas the nuclear datasets were efficient for more than 50% using “best match” and “best close match” methods of TaxonDNA software. All subgenera presented higher interspecific pairwise distances and did not fully overlap with the intraspecific distance, and similarity-based methods showed better results than tree-based methods. The nuclear ribosomal internal transcribed spacer 1 (ITS1 region presented a higher discrimination power than the other datasets and also showed other desirable characteristics as a DNA barcode for this genus. Therefore, we suggest that this region should be used as a starting point to identify Passiflora species.
Cerqueira-Silva, Carlos Bernard M.; Santos, Elisa S. L.; Jesus, Onildo N.; Vieira, João G. P.; Mori, Gustavo M.; Corrêa, Ronan X.; Souza, Anete P.
2014-01-01
Passiflora species are distributed throughout Latin America, and Brazil and Colombia serve as the centers of diversity for this genus. We performed cross-species amplification to evaluate 109 microsatellite loci in 14 Passiflora species and estimated the diversity and genetic structure of Passiflora cincinnata, Passiflora setaceae and Passiflora edulis. A total of 127 accessions, including 85 accessions of P. edulis, a commercial species, and 42 accessions of 13 wild species, were examined. The cross-species amplification was effective for obtaining microsatellite loci (average cross-amplification of 70%). The average number of alleles per locus (five) was relatively low, and the average diversity ranged from 0.52 in P. cincinnata to 0.32 in P. setacea. The Bayesian analyses indicated that the P. cincinnata and P. setacea accessions were distributed into two groups, and the P. edulis accessions were distributed into five groups. Private alleles were identified, and suggestions for core collections are presented. Further collections are necessary, and the information generated may be useful for breeding and conservation. PMID:25514245
Biological activities and phytochemical profile of Passiflora mucronata from the Brazilian restinga
Directory of Open Access Journals (Sweden)
Marlon H. de Araujo
Full Text Available ABSTRACT In general, Passiflora species have been reported for their folk medicinal use as sedative and anti-inflammatory. However, P. caerulea has already been reported to treat pulmonary diseases. Severe pulmonary tuberculosis, generally caused by Mycobacterium tuberculosis strains resistant to multiple drugs, can lead to deleterious inflammation and high mortality, encouraging new approaches in drug discovery. Thus, the aim of this work was to evaluate the Passiflora mucronata Lam., Passifloraceae, potential for tuberculosis treatment. Specifically, related to antimycobacterial activity and anti-inflammatory related effects (based on inhibition of nitric oxide, tumor necrosis factor-alpha production and antioxidant potential, as well as the chemical profile of P. mucronata. High performance liquid chromatography coupled with diode-array ultraviolet and mass spectrometer analyses of crude hydroalcoholic extract and ethyl acetate fraction showed the presence of flavonoids. Ethyl acetate fraction showed to be as antioxidant as Ginkgo biloba standard extract with EC50 of 14.61 ± 1.25 µg/ml. One major flavonoid isolated from ethyl acetate fraction was characterized as isoorientin. The hexane fraction and its main isolated compound, the triterpene β-amyrin, exhibited significant growth inhibitory activity against Mycobacterium bovis BCG (MIC50 1.61 ± 1.43 and 3.93 ± 1.05 µg/ml, respectively. In addition, Passiflora mucronata samples, specially hexane and dichloromethane fractions, as well as pure β-amyrin, showed a dose-related inhibition of lipopolysaccharide (LPS-induced nitric oxide production. In conclusion, Passiflora mucronata presented relevant biological potential and should be considered for further studies using in vivo pulmonary tuberculosis model.
Directory of Open Access Journals (Sweden)
Maikol Yohanny Santamaría Galindo
2014-03-01
Full Text Available Resumen. Las moscas del género Dasiops Rondani constituyen la plaga más limitante en cultivos de pasifloras en Colombia, por lo que el reconocimiento de especies es importante para la toma de decisiones de vigilancia y control. Se caracterizaron los síntomas y daños producidos por moscas Dasiops spp.. en botones florales y frutos de maracuyá (Passiflora edulis f. flavicarpa Sims, gulupa (Passiflora edulis f. edulis Sims, granadilla (Passiflora ligularis Juss y curuba (Passiflora tripartita var. mollissima Nielsen y Jorgensen. En botones florales de maracuyá, gulupa y granadilla con longitud mayor a 1 cm, la infestación se manifestó con amarillamiento y arrugamiento general. En frutos de gulupa y granadilla, la infestación se evidenció por arrugamiento del epicarpio en frutos inmaduros. En curuba, la infestación en frutos se caracterizó por un estrechamiento en la parte basal, apical o media del fruto. La infestación en botones florales estuvo entre 0,0 y 9,9% en tanto que en frutos presentó un rango entre 0,3 y 28,5%. No obstante, en maracuyá y gulupa se registraron botones florales infestados pero sin los síntomas descritos; en tanto que en gulupa y granadilla se observó el mismo fenómeno en frutos. Este estudio provee a agricultores y técnicos herramientas para el reconocimiento de infestación por moscas Dasiops spp. en cultivos de pasifloras como elemento fundamental para la toma decisiones para la vigilancia y control fitosanitario. / Abstract. The flies of the gender Dasiops Rondani are the most limiting plague in pasifloras crops in Colombia, thus species identification is important for decision making for monitoring and control. The symptoms and damage caused by Dasiops spp. flies in flower buds and fruits of yellow passion fruit (Passiflora edulis f. flavicarpa Sims, purple passion fruit (Passiflora edulis f. edulis Sims, sweet passion fruit (Passiflora ligularis Juss and banana passion fruit (Passiflora tripartita
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 97 ... Query: 99 ... VARAMQYIDTHLYEPVSVAHLAQAACMSRFHFARVFRDAVGASPM...EYLRLRRLERAQAML 158 ... VARAMQYIDTHLYEPVSVAHLAQAACMSRFHFARVFRDAVGASPME...YLRLRRLERAQAML Sbjct: 1 ... VARAMQYIDTHLYEPVSVAHLAQAACMSRFHFARVFRDAVGASPMEYLRLRRLERAQAML 60 ...
Cyanohydrin glycosides of Passiflora
DEFF Research Database (Denmark)
Jaroszewski, Jerzy W; Olafsdottir, Elin S; Wellendorph, Petrine
2002-01-01
this glycoside co-occurs with simple beta-D-glucopyranosides: tetraphyllin A, deidaclin, tetraphyllin B, volkenin, epivolkenin and taraktophyllin. P. citrina contains passicapsin, a rare glycoside with the 2,6-dideoxy-beta-D-xylo-hexopyranosyl moiety, while P. herbertiana contains tetraphyllin A, deidaclin...... Passiflora species. These alpha-hydroxyamides, presumably formed during processing of the plant material, behave as cyanogenic compounds when treated with commercial Helix pomatia crude enzyme preparation. Thus, the enzyme preparation appears to contain an amide dehydratase, which converts alpha......-hydroxyamides to cyanohydrins that liberate cyanide; this finding is of interest in connection with analysis of plant tissues and extracts using Helix pomatia enzymes....
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available as ... axonopodis pv. citri str. 306] ... Length = 221 ... Query: 40 ... VLATDAHGYLENQQLPDSVQLVPPPPQ...DGSAALANDEAVAKAMLALRGTPRWELAAQDAV 99 ... VLATDAHGYLENQQLPDSVQLVPPPPQDGSAAL...ANDEAVAKAMLALRGTPRWELAAQDAV Sbjct: 3 ... VLATDAHGYLENQQLPDSVQLVPPPPQDGSAALANDEAVAKAMLALRGTPRWELAAQDAV 62 ... Quer
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AC4077 ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 150 ... Query: 744 VRPVRPEDDA...LFRAFFARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARSIALVAIDPR 803 ... VRPVRPEDDALFRAF...FARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARSIALVAIDPR Sbjct: 1 ... VRPVRPEDDALFRAFFARVTDEDLRLRFFQSVKHFSHEFIARLTQLDYARS
Morfoanatomia de folhas e caules de Passiflora edulis Sims, Passifloraceae
Directory of Open Access Journals (Sweden)
Josseara Beraldo
Full Text Available Passiflora edulis Sims, espécie vegetal empregada na medicina popular e amplamente cultivada no território nacional, tem suas folhas e seus caules, muitas vezes utilizados como adulterante de amostras comerciais da droga vegetal oficializada no país também conhecida como maracujá, Passiflora alata Curtis. Caracteres morfoanatômicos de folhas e de caules de P. edulis, foram descritos e documentados. Dentre os caracteres auxiliares na distinção entre a droga oficial e os órgãos aéreos de P. edulis podem-se destacar o contorno da lâmina foliar, a forma da nervura mediana em secção transversal, o número e a localização de nectários extraflorais e, o indumento
Farag, Mohamed A; Otify, Asmaa; Porzel, Andrea; Michel, Camilia George; Elsayed, Aly; Wessjohann, Ludger A
2016-05-01
Passiflora incarnata as well as some other Passiflora species are reported to possess anxiolytic and sedative activity and to treat various CNS disorders. The medicinal use of only a few Passiflora species has been scientifically verified. There are over 400 species in the Passiflora genus worldwide, most of which have been little characterized in terms of phytochemical or pharmacological properties. Herein, large-scale multi-targeted metabolic profiling and fingerprinting techniques were utilized to help gain a broader insight into Passiflora species leaves' chemical composition. Nuclear magnetic resonance spectroscopy (NMR) and mass spectrometry (MS) spectra of extracted components derived from 17 Passiflora accessions and from different geographical origins were analyzed using multivariate data analyses. A total of 78 metabolites were tentatively identified, that is, 20 C-flavonoids, 8 O-flavonoids, 21 C, O-flavonoids, 2 cyanogenic glycosides, and 23 fatty acid conjugates, of which several flavonoid conjugates are for the first time to be reported in Passiflora spp. To the best of our knowledge, this study provides the most complete map for secondary metabolite distribution within that genus. Major signals in (1)H-NMR and MS spectra contributing to species discrimination were assigned to those of C-flavonoids including isovitexin-2″-O-xyloside, luteolin-C-deoxyhexoside-O-hexoside, schaftoside, isovitexin, and isoorientin. P. incarnata was found most enriched in C-flavonoids, justifying its use as an official drug within that genus. Compared to NMR, LC-MS was found more effective in sample classification based on genetic and/ or geographical origin as revealed from derived multivariate data analyses. Novel insight on metabolite candidates to mediate for Passiflora CNS sedative effects is also presented.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein ... B [Xanthomonas axonopodis pv. citri str. 306] ... Length = 101 ... Query: 9 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 68 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD Sbjct: 1 ... TSHRPYLLRALVEWINDNGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 60 ...
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tein ... B [Xanthomonas axonopodis pv. citri str. 306] ... Length = 101 ... Query: 9 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 68 ... TSHRPYLLRALVEWIND...NGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD Sbjct: 1 ... TSHRPYLLRALVEWINDNGMTPHVLVDAGLPGVQVPASAVKDGRVVLNIAERAVVGLQVD 60 ...
Directory of Open Access Journals (Sweden)
Carlos B. M. Cerqueira-Silva
2014-02-01
Full Text Available Premise of the study: We developed the first microsatellites for Passiflora setacea and characterized new sets of markers for P. edulis and P. cincinnata, enabling further genetic diversity studies to support the conservation and breeding of passion fruit species. Methods and Results: We developed 69 microsatellite markers and, in conjunction with assessments of cross-amplification using primers available from the literature, present 43 new polymorphic microsatellite loci for three species of Passiflora. The mean number of alleles per locus was 3.1, and the mean values of the expected and observed levels of heterozygosity were 0.406 and 0.322, respectively. Conclusions: These microsatellite markers will be valuable tools for investigating the genetic diversity and population structure of wild and commercial species of passion fruit (Passiflora spp. and may be useful for developing conservation and improvement strategies by contributing to the understanding of the mating system and hybridization within the genus.
Directory of Open Access Journals (Sweden)
Livia C. T. Scorza
2017-02-01
Full Text Available Abstract Background Passiflora (passionflowers makes an excellent model for studying plant evolutionary development. They are mostly perennial climbers that display axillary tendrils, which are believed to be modifications of the inflorescence. Passionflowers are also recognized by their unique flower features, such as the extra whorls of floral organs composed of corona filaments and membranes enclosing the nectary. Although some work on Passiflora organ ontogeny has been done, the developmental identity of both Passiflora tendrils and the corona is still controversial. Here, we combined ultrastructural analysis and expression patterns of the flower meristem and floral organ identity genes of the MADS-box AP1/FUL clade to reveal a possible role for these genes in the generation of evolutionary novelties in Passiflora. Results We followed the development of structures arising from the axillary meristem from juvenile to adult phase in P. edulis. We further assessed the expression pattern of P. edulis AP1/FUL homologues (PeAP1 and PeFUL, by RT-qPCR and in situ hybridization in several tissues, correlating it with the developmental stages of P. edulis. PeAP1 is expressed only in the reproductive stage, and it is highly expressed in tendrils and in flower meristems from the onset of their development. PeAP1 is also expressed in sepals, petals and in corona filaments, suggesting a novel role for PeAP1 in floral organ diversification. PeFUL presented a broad expression pattern in both vegetative and reproductive tissues, and it is also expressed in fruits. Conclusions Our results provide new molecular insights into the morphological diversity in the genus Passiflora. Here, we bring new evidence that tendrils are part of the Passiflora inflorescence. This points to the convergence of similar developmental processes involving the recruitment of genes related to flower identity in the origin of tendrils in different plant families. The data obtained also
Directory of Open Access Journals (Sweden)
Marcelo Fideles Braga
2006-08-01
Full Text Available Em ambiente com nebulização controlada, estacas herbáceas com um par de folhas, contendo 2 ou 3 nós, foram testadas quanto ao enraizamento, utilizando-se de bandeja de poliestireno com célula de 95cm³ e saco plástico de 15x25x0,02cm com 1.730 cm³. Foram testadas estacas de Passiflora actinia, P. serrato-digitata e P. setacea. Observou-se que P. serrato-digitata apresentou 94,3% de estacas enraizadas com brotos e 2,4% de mortalidade; enquanto P. actinia e P. setacea apresentaram, respetivamente, 30,5% e 28,6% de estacas enraizadas com brotos e 56,8% e 60,7% de mortalidade. A alta mortalidade das estacas foi atribuída ao estado fenológico das matrizes de P. actinia e P. setacea e ao ataque de larvas de bradisia (Bradysia spp. Estacas com dois e três nós não apresentaram diferenças significativas, e o recipiente saco plástico de 1.730 cm³ proporcionou melhor desenvolvimento das mudas.Steam cuttings of three wild Passiflora species where tested for rooting in a mist regulated greenhouse. Cuttings with two or three buds were used with two kinds of containers: polystyrene trays with 95 cm³ cells and perforated plastic bags of 15x25x0.02cm, with 1,730 cm³. Passiflora serrato-digitata was the best, with 94.3% of rooted cuttings with shoots e only 2.4% of death cuttings. P. actinia and P. setacea showed , respectivelly, 30.5% and 28.6% of rooted cuttings and 56.8% and 60.7%, of death cuttings. The high death were attribute to phenological phases of P. actinia and P. setacea or injury caused by fungus-gnat larvae (Bradysia spp.. Cuttings with two or three buds didn't show differences among them. Plastic bags proporcioned the best results, increasing rooted cuttings and plant development.
Nectar production and bee visits in two cultivated species of Passiflora L. (Passifloraceae)
Varassin, Isabela Galarda; Ximenes, Brunna Maria Setti; Moreira, Priscila Ambrósio; Zanon, Mireille Maria Franco; Elbl, Paula; Löwenberg-Neto, Peter; Melo, Gabriel Augusto Rodrigues
2012-01-01
A atividade dos polinizadores é afetada pela disponibilidade de recursos. Flores que produzem mais néctar podem ser mais visitadas e assim apresentar maior produção de frutos. O efeito da produção de néctar na atividade dos polinizadores foi testado em duas espécies cultivadas de maracujá, Passiflora alata Curtis e Passiflora edulis Sims, em Morretes, Paraná. Botões foram ensacados e o néctar acumulado das flores foi coletado em intervalos de 1 h. Em P. alata o volume e a concentração de solu...
Epiphytic bacteria from various bean genotypes and their potential ...
African Journals Online (AJOL)
Naturally occurring epiphytic non-pathogeni bacteria were isolated from reproductive tissue of various bean genotypes grown in the field and screened for both in vitro and in vivo antagonism to Xanthomonas axonopodis pv. phaseoli (formely X. campestris pv phaseoli). Of the 22 potential bacterial antagonists screened in ...
Directory of Open Access Journals (Sweden)
Yu-Jie Zhang
2016-09-01
Full Text Available Previous studies have shown that fruits have different effects on alcohol metabolism and alcohol-induced liver injury. The present work selected three fruits and aimed at studying the effects of Syzygium samarangense, Passiflora edulis and Solanum muricatum on alcohol-induced liver injury in mice. The animals were treated daily with alcohol and fruit juices for fifteen days. Chronic treatment with alcohol increased the levels of aspartate transaminase (AST, alanine transaminase (ALT, total bilirubin (TBIL, triglyceride (TG, malondialdehyde (MDA, and decreased total protein (TP. Histopathological evaluation also showed that ethanol induced extensive fat droplets in hepatocyte cytoplasm. Syzygium samarangense and Passiflora edulis normalized various biochemical parameters. Solanum muricatum increased the level of ALT and induced infiltration of inflammatory cells in the liver. These results strongly suggest that treatment with Syzygium samarangense and Passiflora edulis could protect liver from the injury of alcohol, while Solanum muricatum could aggravate the damage.
Directory of Open Access Journals (Sweden)
Luís Carlos Bernacci
2003-08-01
Full Text Available O maracujazeiro-doce (Passiflora alata Curtis é uma espécie nativa da América do Sul, especialmente do Brasil, cujo cultivo tem se expandido em função do preço alcançado pelos frutos. Vários trabalhos de pesquisa foram realizados com esta espécie, quase todos com imprecisões na citação do nome científico. Com o objetivo de avaliar a extensão desses equívocos e identificar a forma cientificamente correta de citar a espécie, foram investigados o autor e a data de publicação do nome científico do maracujá-doce, em estudos taxonômicos. Concluiu-se que a espécie deve ser citada como Passiflora alata Curtis, conforme publicado originalmente em 1788, no periódico Botanical Magazine.The author, data and publication of the scientific name of the sweet passion-fruit had been investigated. A series of mistakes occurred in relation to the correct citation of the species. The aim of the present paper was to evaluate the problems and identify the scientific correct form of Passiflora alata nomenclature. The species must be cited as Passiflora alata Curtis and was published originally in 1788, in the Botanical Magazine.
Chemical composition of hydroethanolic extracts from five species of the Passiflora genus
Directory of Open Access Journals (Sweden)
Marna E Sakalem
2012-09-01
Full Text Available The diversified genus Passiflora is well distributed all over Brazil, and many species have been long used as medicinal plants, mainly against anxiety disturbances. This effect has been attributed to its rich flavonoid composition. Flavonoids’ main class, flavonoid glycosides, has presented central action, particularly as sedative-hypnotic, anxiolytic and analgesic. The objective of the present study was to make a phytochemical screening of five little studied Passiflora species, in order to evaluate their phenolic composition. For this aim, HPLC-DAD-ESI-MS/MS was used. After the preparation of the hydroalcoholic extracts, each species was evaluated by direct injection electrospray ionization (ESI and tandem mass spectrometry. Although belonging to the same genus, the composition of each species presented particularities; this justifies the importance of studies aiming for the phenolic composition of different Passiflora species. Flavones C-glycosides were detected in all extracts, and are found as the main constituents in P. vitifolia, P. coccinea, P. bahiensis and P. sidifolia. In this last one, flavone-6,8-di-C-glycoside, apigenin-6-C-rhamnosyl-8-C-arabinoside are present in high content. Cyclopassiflosides were found in high content together with cyanogenic glycosides in P. quadrangularis, while in P. coccinea, besides flavones-C-glycosides were also found procyanidins.
Chemical composition of hydroethanolic extracts from five species of the Passiflora genus
Directory of Open Access Journals (Sweden)
Marna E Sakalem
2012-12-01
Full Text Available The diversified genus Passiflora is well distributed all over Brazil, and many species have been long used as medicinal plants, mainly against anxiety disturbances. This effect has been attributed to its rich flavonoid composition. Flavonoids’ main class, flavonoid glycosides, has presented central action, particularly as sedative-hypnotic, anxiolytic and analgesic. The objective of the present study was to make a phytochemical screening of five little studied Passiflora species, in order to evaluate their phenolic composition. For this aim, HPLC-DAD-ESI-MS/MS was used. After the preparation of the hydroalcoholic extracts, each species was evaluated by direct injection electrospray ionization (ESI and tandem mass spectrometry. Although belonging to the same genus, the composition of each species presented particularities; this justifies the importance of studies aiming for the phenolic composition of different Passiflora species. Flavones C-glycosides were detected in all extracts, and are found as the main constituents in P. vitifolia, P. coccinea, P. bahiensis and P. sidifolia. In this last one, flavone-6,8-di-C-glycoside, apigenin-6-C-rhamnosyl-8-C-arabinoside are present in high content. Cyclopassiflosides were found in high content together with cyanogenic glycosides in P. quadrangularis, while in P. coccinea, besides flavones-C-glycosides were also found procyanidins.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... axonopodis pv. citri str. 306] ... Length = 131 ... Query: 1 ... MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHD...GYVV 60 ... MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHD...GYVV Sbjct: 1 ... MNVLIREATEGDAAAIELLTMVAFMRAERSRHDEHQVIAGLRQDGALALSLVADHDGYVV 60 ... Query: 121 AFFRRLGFAVE 131 ... AFFRRLGFAVE Sbjct: 121 AFFRRLGFAVE 131
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ter ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 125 ... Query: 66 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 125 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG Sbjct: 1 ... ELTVGDVMISRSQMVSLPVEARFIDLMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 60 ... Query: 186 EQIVG 190 ... EQIVG Sbjct: 121 EQIVG 125
ORF Alignment: NC_006834 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ter ... [Xanthomonas axonopodis pv. citri str. 306] ... Length = 125 ... Query: 72 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 131 ... ELTVGDVMISRSQMVSLPVEARFID...LMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG Sbjct: 1 ... ELTVGDVMISRSQMVSLPVEARFIDLMKQVVESGHSRFPVHGENKDEVLGILLAKDLLRG 60 ... Query: 192 EQIVG 196 ... EQIVG Sbjct: 121 EQIVG 125
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr
Effect of a medicinal plant (Passiflora incarnata L) on sleep
Guerrero, Fructuoso Ayala; Medina, Graciela Mexicano
2017-01-01
INTRODUCTION: Extracts of the plant Passiflora incarnata L. (Passifloraceae) were administered intraperitoneally in order to test its effects on sleep. METHOD: Experiments were carried out on chronically implanted male adult wistar rats to obtain cerebral (EEG), ocular (EOG) and muscular (EMG) activities throughout their states of vigilance. Polygraphic recordings were taken during 9 continuous hours before and after t...
Directory of Open Access Journals (Sweden)
Mariana da Silva Paula
2010-03-01
Full Text Available O cultivo comercial do maracujá é afetado por diversos problemas fitossanitários, os quais contribuem para quebras de produção e significativa redução da vida útil dos plantios. Em algumas situações, a incidência de doenças pode inviabilizar o cultivo do maracujá. Fontes de resistência a distintas doenças têm sido identificadas em acessos de espécies de Passiflora. Neste trabalho, buscou-se avaliar a diversidade genética de acessos de oito espécies silvestres (P. setacea, P. nitida, P. serratodigitata, P. caerulea, P. gibertii, P. odontophyla, P. edulis e P. coccinea e de um híbrido interespecífico (P. setacea x P. coccinea, utilizando marcadores moleculares análogos a genes de resistência (RGAs. Verificou-se uma grande diversidade no perfil eletroforético de RGAs nos acessos de Passiflora, permitindo a anotação de 96 amplicons polimórficos entre, pelo menos, um par de acessos. Os níveis de dissimilaridade genética (calculados exclusivamente com os marcadores RGAs variaram entre 0,40 e 0,89 nos acessos das espécies de Passiflora avaliadas. A análise de sequência de um subgrupo destes amplicons obtidos com primers RGAs indicou que estas bandas correspondem a regiões genômicas que contêm segmentos (motivos com identidade aos encontrados em genes de resistência previamente caracterizados em outras espécies vegetais. Desta forma, os dados indicam a existência de um repertório variado de marcadores do tipo RGA em Passiflora que podem ser potencialmente úteis em sistemas de caracterização molecular de germoplasma e em programas de melhoramento genético visando à resistência a doenças nesta cultura.The commercial cultivation of passion fruit can be affected by many diseases, which might induce sever fruit yield losses and significant life cycle reduction of the crop. In some situations disease incidence can make the passion fruit production not economically viable. Sources of resistance against several
Building Integrated PV and PV/Hybrid Products - The PV:BONUS Experience: Preprint
Energy Technology Data Exchange (ETDEWEB)
Thomas, H.; Pierce, L. K.
2001-10-01
Presented at the 2001 NCPV Program Review Meeting: Successes and lessons learned from PV:BONUS (Building Opportunities in the United States in PV). This program has funded the development of PV or PV/hybrid products for building applications.
Directory of Open Access Journals (Sweden)
Douglas de Almeida Pereira
2015-09-01
Full Text Available Primer pairs that access microsatellite loci, initially constructed through the genome of Passiflora edulis Sims flavicarpa and P. alata, were tested concerning their ability to access microsatellite loci in ‘somnus’ passion fruit tree (P. setacea individuals. Seven out of the thirty one primer pairs tested were able to access DNA polymorphism in the genome of this wild Passiflora species, by evaluating six natural populations, located in a transition area between the biomes Caatinga and Cerrado, in the state of Bahia, Brazil. The number of alleles/loci was small, oscillating from 1 to 4. The average heterozygosity observed per locus in all populations ranged from 0.13 to 0.40. There was transference of heterologous microsatellite primer pairs from the Passiflora genus to ‘somnus’ passion fruit tree, constituting a new set of primers that access random co-dominant locus in this species, useful for conservationist purposes and pre-improvement of ‘somnus’ passion fruit tree.
Occurrence and Characterisation of Xanthomonas axonopodis pv ...
African Journals Online (AJOL)
Soybean bacterial pustule disease was studied during the flowering and at pod maturation, in thirty four sites of the main soybean cultivation areas in eight districts of the Guinea Savanna in Benin. Twenty and 10 soybean plants were randomly inspected for incidence and severity, respectively, on two diagonals through the ...
Landscape Distance and Connectivity Effects on Pollination of Passiflora incarnata L.
Energy Technology Data Exchange (ETDEWEB)
Cunningham, A.F.
2000-05-05
To test the effect of landscape distance and habitat corridors on pollen-mediated gene flow between fragmentary plant populations, principle investigator used fluorescent dye as a pollen analog, unique tags on pollinators and known allozyme markers using experimental and wildtype Passiflora incarnata at Savannah River Site. Results indicate no significant effect of a corridor on pollen-mediated gene flow.
ORF Alignment: NC_003919 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...
Energy Technology Data Exchange (ETDEWEB)
Giese, H.; Viotto, M. [Inst. fuer Solare Energieversorgungstechnik (ISET) e.V., Kassel (Germany); Esser, M.; Pukrop, D. [Univ. Oldenburg (Germany). Abt. Energie- und Halbleiterforschung; Stellbogen, D. [Zentrum fuer Sonnenergie- und Wasserstoff-Forschung, Stuttgart (Germany)
1997-12-31
PV-CAD provides PV system planners with a practice-oriented tool for an efficient design of PV facades. Being compatible with the standard programmes of the architects` and electrical engineering sectors it can be used on already existing systems and allows the user to draw on previously acquired knowedge. Its open interfaces permit the integration of further design tools. PV CAD works under Microsoft Windows for which it has the necessary graphic user interface. Its compliance to PC standards opens up a wide range of applications and permits its use also on inexpensive computers. Thanks to its promotion by the Federal Ministry for Education, Science, Research, and Technology under the research project ``Computer programmes for the design of photovoltaic facades`` PV-CAD is available at a moderate price. PV-CAD permits an efficient planning of solar facades and therefore has the potential to stimulate the use of PV on buildings. (orig.) [Deutsch] Mit PV-CAD steht dem Anlagenplaner ein anwendungsorientiertes Werkzeug zur Verfuegung, das eine rationelle Auslegung von PV-Fassaden ermoeglicht. Die Kompatibilitaet zu Standardprogrammen aus dem Architektur- und Elektrosektor erlaubt die Nutzung bereits vorhandener Systeme und damit erworbener Kenntnisse. Offene Schnittstellen gestatten die Einbindung weiterer Entwurfswerkzeuge. PV-CAD arbeitet unter Microsoft-Windows und verfuegt ueber die entsprechende grafische Benutzerschnittstelle. Die Kompatibilitaet zum PC-Standard eroeffnet eine sehr breite Anwenderbasis und ermoeglicht den Einsatz des Programms auch auf preiswerten Rechnern. Aufgrund der Foerderung durch das Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie im Rahmen des Forschungsprojekts `Rechnerprogramm zur Auslegung von Photovoltaik-Fassaden` steht PV-CAD preiswert zur Verfuegung. PV-CAD ermoeglicht eine effiziente Planung von Solarfassaden und kann daher dem PV-Einsatz in Gebaeuden weitere Impulse geben. (orig.)
PV-WEB: internet-based PV information tool
International Nuclear Information System (INIS)
Cowley, P.
2003-01-01
This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members
PV-WEB: internet-based PV information tool
Energy Technology Data Exchange (ETDEWEB)
Cowley, P
2003-07-01
This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members.
Sindt, Nathan M.; Robison, Faith; Brick, Mark A.; Schwartz, Howard F.; Heuberger, Adam L.; Prenni, Jessica E.
2018-02-01
Matrix-assisted desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) is a fast and effective tool for microbial species identification. However, current approaches are limited to species-level identification even when genetic differences are known. Here, we present a novel workflow that applies the statistical method of partial least squares discriminant analysis (PLS-DA) to MALDI-TOF-MS protein fingerprint data of Xanthomonas axonopodis, an important bacterial plant pathogen of fruit and vegetable crops. Mass spectra of 32 X. axonopodis strains were used to create a mass spectral library and PLS-DA was employed to model the closely related strains. A robust workflow was designed to optimize the PLS-DA model by assessing the model performance over a range of signal-to-noise ratios (s/n) and mass filter (MF) thresholds. The optimized parameters were observed to be s/n = 3 and MF = 0.7. The model correctly classified 83% of spectra withheld from the model as a test set. A new decision rule was developed, termed the rolled-up Maximum Decision Rule (ruMDR), and this method improved identification rates to 92%. These results demonstrate that MALDI-TOF-MS protein fingerprints of bacterial isolates can be utilized to enable identification at the strain level. Furthermore, the open-source framework of this workflow allows for broad implementation across various instrument platforms as well as integration with alternative modeling and classification algorithms.
ORF Alignment: NC_003921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance
ORF Alignment: NC_003921 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance
Anatomia comparada da antera de espécies de Passiflora L.(Passifloraceae) do Rio Grande do Sul
Greta Aline Dettke
2009-01-01
Passiflora L. é o maior dos gêneros de Passifloraceae, com cerca de 530 espécies, e ocorre predominantemente no continente americano. Compreende trepadeiras herbáceas ou lenhosas com gavinhas, raramente ervas, arbustos ou pequenas árvores. A sistemática de Passiflora, assim como de Passifloraceae, não está ainda bem resolvida, pois são frágeis os limites de circunscrição de vários subgêneros, seções e séries e a última revisão sistemática dos gêneros americanos data do século passado. Esta cl...
NCBI nr-aa BLAST: CBRC-TNIG-22-0185 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TNIG-22-0185 ref|NP_642362.1| putative manganese transport protein MntH [Xanth...omonas axonopodis pv. citri str. 306] sp|Q8PKX1|MNTH_XANAC Probable manganese transport protein mntH gb|AAM36898.1| manga
Wagacha, John M.; Dossaji, Saifuddin F.
2016-01-01
The objective of this study was to determine the chemical composition and antibacterial activity of essential oils (EOs) of Tagetes minuta against three phytopathogenic bacteria Pseudomonas savastanoi pv. phaseolicola, Xanthomonas axonopodis pv. phaseoli, and Xanthomonas axonopodis pv. manihotis. The essential oils were extracted using steam distillation method in a modified Clevenger-type apparatus while antibacterial activity of the EOs was evaluated by disc diffusion method. Gas chromatography coupled to mass spectrometry (GC/MS) was used for analysis of the chemical profile of the EOs. Twenty compounds corresponding to 96% of the total essential oils were identified with 70% and 30% of the identified components being monoterpenes and sesquiterpenes, respectively. The essential oils of T. minuta revealed promising antibacterial activities against the test pathogens with Pseudomonas savastanoi pv. phaseolicola being the most susceptible with mean inhibition zone diameters of 41.83 and 44.83 mm after 24 and 48 hours, respectively. The minimum inhibitory concentrations and minimum bactericidal concentrations of the EOs on the test bacteria were in the ranges of 24–48 mg/mL and 95–190 mg/mL, respectively. These findings provide a scientific basis for the use of T. minuta essential oils as a botanical pesticide for management of phytopathogenic bacteria. PMID:27721831
Directory of Open Access Journals (Sweden)
Valdir Zucareli
2014-10-01
Full Text Available The present work aimed to evaluate the initial growth and leaf mineral levels in passion fruit trees (Passiflora edulis f. flavicarpa Deg., P. edulis f. edulis Sims. and P. alata Dryander grafted onto Passiflora cincinnata. To obtain seedlings, seeds were sown in plastic bags (500 mL and hypocotyl grafting was performed when seedlings reached the stage of two fully expanded leaves. Fifteen days after grafting, plants were transplanted to 10L pots filled with previously limed and fertilized soil. Each pot contained two plants and corresponded to one plot. For each commercial species studied as rootstock, experimental design was completely randomized, in 3x5 (plant type x time of harvest factorial arrangement, with four replicates of two plants per plot and five destructive harvests. Plant types were ungrafted P. cincinnata, ungrafted commercial passion fruit tree and commercial passion fruit tree grafted onto P. cincinnata. The first harvest was performed at 15 days after transplanting and the remaining ones at 14-day intervals (60, 74, 88, 102 and 116 DAS. At each harvest, the number of leaves per plant was counted, and leaf area, stem length, and stem, root, leaf and total dry matter were estimated. At the last harvest, the mineral composition (macro and micronutrients of plants was analyzed. In general, it was observed that grafting onto P. cincinnata did not interfere negatively with the initial development and mineral levels of commercial passion fruit trees, and this interference varied according to the used canopy.
PV and PV/hybrid products for buildings
Energy Technology Data Exchange (ETDEWEB)
Thomas, H. P.; Hayter, S. J.; Martin, R. L., Pierce, L. K.
2000-05-15
Residential, commercial, and industrial buildings combined are the largest consumers of electricity in the United States and represent a significant opportunity for photovoltaic (PV) and PV/hybrid systems. The U.S. Department of Energy (DOE) is conducting a phased research and product development program, Building Opportunities in the United States for Photovoltaics (PV:BONUS), focused on this market sector. The purpose of the program is to develop technologies and foster business arrangements integrating cost-effective PV or hybrid products into buildings. The first phase was completed in 1996 and a second solicitation, PV:BONUS2, was initiated during 1997. These projects are resulting in a variety of building-integrated products. This paper summarizes the recent progress of the seven firms and collaborative teams currently participating in PV:BONUS2 and outlines planned work for the final phase of their work.
de Carvalho, Mariana Veras Oliveira; de Lacerda de Oliveira, Lívia; Melo, Lauro; Costa, Ana Maria
2018-05-08
Passiflora setacea D.C is a passion fruit species native from Brazilian savannah characterized by naturally sweet sensory characteristics. Sensory quality of the pulp can be affected by growing environment. The effect of training systems (trellis or espalier), seasons (the weather conditions in periods of drought and rain) and addition of seeds to the juice (25%) were evaluated, with emphasis on the sensory quality of Passiflora setacea nectars. Training systems of P. setacea plantation did not influence flavor or aroma of nectars. Season had an effect on texture attributes. Although training system and season had impact on pH, TSS, TA, polyphenolics and condensed tannins content, these environment factors had no influence on acceptance. Seeds addition had a negative effect on overall liking. Frequency of consumption of passion fruit and functional food did not influence nectar preference whereas being neophilic or having higher level of knowledge about functional foods favored greater acceptance of P. setacea nectars. Passiflora setacea nectar is a potential functional beverage, due its bioactive contents. Training system and season had no influence on acceptance as isolated factors. However, there was an interaction between these factors, which could be considered to market projection, as well as the addition of seeds. This article is protected by copyright. All rights reserved.
Directory of Open Access Journals (Sweden)
Shawn Krosnick
2013-06-01
Full Text Available Passiflora kwangtungensis is a critically endangered Chinese species known from Guangxi, Guangdong, and Jiangxi Provinces. The species belongs to Passiflora subgenus Decaloba, supersection Disemma, section Octandranthus. Field observations decreased rapidly during the 1970s to 1980s, and it was suspected that this species might have been extirpated due to repeated deforestation events throughout southern China. In recent years, however, small isolated populations of this species have been rediscovered in Hunan Province, representing new locality records for P. kwangtungensis. New herbarium collections, color photographs, and silica gel collections have provided an unexpected opportunity to examine the evolutionary significance of this species. The current study presents a revised morphological description of P. kwangtungensis based on fresh material, along with an updated distribution map. Using nrITS sequence data, preliminary insights into the phylogenetic position of P. kwangtungensis are presented. Molecular data support the placement of P. kwangtungensis within supersection Disemma section Octandranthus. However, the exact placement of P. kwangtungensis within this lineage is unclear. The nrITS data suggest that P. kwangtungensis may be sister to a clade containing Passiflora from China, Nepal, India, and Southeast Asia. Morphologically, P. kwangtungensis displays the most similarity P. geminiflora (Nepal, India and P. henryi (China. Lastly, conservation status and recommendations are made for P. kwangtungensis following the IUCN Red List Criteria, where this species is classified as CR C1+C2a(i; D.
DEFF Research Database (Denmark)
Pinheiro de Castro, Érika Cristina; Zagrobelny, Mika; Cardoso, Márcio Z.
2018-01-01
, are morphological defences reported in this plant genus. Moreover, Passiflora plants are well protected chemically, not only by cyanogenic glucosides, but also by other compounds such as alkaloids, flavonoids, saponins, tannins and phenolics. Heliconiines can synthesize cyanogenic glucosides themselves...
Directory of Open Access Journals (Sweden)
Carolina Fernandes Ribas Martins
2015-12-01
Full Text Available abstract This study was conducted to evaluate the effects of the ethanolic extract of Passiflora edulis leaves on blood glucose, protein glycation, NADPH oxidase activity and macrophage phagocytic capacity after Candida albicans exposure in diabetic rats. The Passiflora edulis Sims leaves were dried to 40°C, powdered, extracted by maceration in 70% ethanol, evaporated under reduced pressure and lyophilised. The biochemical tests performed were total phenolic content (TP as determined by the Folin-Ciocalteu assay, trapping potential DPPH assay and total iron-reducing potential. Diabetes was induced by alloxan injection. Protein glycation was determined by AGE and fructosamine serum concentrations. Extract-treated diabetic animals demonstrated lower fructosamine concentrations compared with the diabetic group. Our results suggest that ethanolic Passiflora edulis Sims leaf extraction may have beneficial effects on diabetes and may improve glycaemic control in diabetic rats.
Caracterização de preparações extrativas obtidas de Passiflora alata Curtis
Directory of Open Access Journals (Sweden)
ANDREAS S. L. MENDEZ
2011-06-01
Full Text Available O presente trabalho teve como objetivo fazer uma análise comparativa da qualidade de preparações extrativas obtidas de Passiflora alata Curtis, além de descrever esse processo. O extrato líquido foi obtido por refluxo utilizando água como solvente em proporção 1:10. A preparação líquida foi submetida à secagem em spray dryer utilizando aerosil® e fosfato de cálcio como adjuvantes tecnológicos. A eficiência de extração foi avaliada através da determinação do resíduo seco e do teor de flavonoides totais por técnica de espectrofotometria no UV. O extrato seco foi avaliado quanto à viabilidade tecnológica a partir da determinação das características de granulometria e da estabilidade em ambientes de umidade relativa controlada. O teor de flavonoides totais para o extrato seco apresentou redução quando comparado à solução extrativa, indicando possível influência do processo de secagem na composição do material. Os resultados de caracterização tecnológica demonstraram que o processo de secagem utilizado garante uma uniformidade de tamanho particular, embora seja observada uma tendência de higroscopicidade do material em ambientes de elevada umidade relativa. As técnicas empregadas se mostraram viáveis para uso em ensaios quali-quantitativos aplicados à determinação da qualidade dos extratos desenvolvidos. Palavras-chave: Passiflora alata Curtis; Preparações extrativas; Spray-drying; Flavonoides totais; Caracterização tecnológica. ABSTRACT Characterization of extracts prepared from Passiflora alata Curtis This paper describes a process to prepare liquid and dried aqueous extracts from aerial parts of Passiflora alata Curtis (sweet passionfruit and reports a comparative analysis of the extractive preparations obtained. The extractive solution was obtained by refluxing the plant material with water in the proportion 1:10 (w/v. The aqueous extract was dried in a spray-dryer, with Aerosil® and calcium
Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso
2017-01-01
. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact on the overall PV energy cost, due to the increased maintenance for the PV inverters. This paper...... evaluates the lifetime of PV inverters considering the PV array sizing and installation sites, e.g., Denmark and Arizona. The results reveal that the PV array sizing has a considerable impact on the PV inverter lifetime and reliability, especially in Denmark, where the average solar irradiance level...
Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso; Blaabjerg, Frede
2017-01-01
In order to enable a more wide-scale utilization of PV systems, the cost of PV energy has to be comparable with other energy sources. Oversizing the PV array is one common approach to reduce the cost of PV energy, since it increases the PV energy yield during low solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact...
Directory of Open Access Journals (Sweden)
Reinel José Fernández Barbosa
2009-06-01
Full Text Available Fusarium oxysporum Schlecht f. sp passiflorae causa la marchitez del maracuyá (Passiflora edulis Sims var. Flavicarpa, afectando su rendimiento. En la búsqueda de alternativas para su control se realizó la presente investigación con el objetivo de determinar la capacidad antagónica de 6 aislamientos de Trichoderma harzianum sobre dicho patógeno. Se evaluaron 3 aislamientos comerciales (TCC-001, TCC-005 y TCC-006 y 3 aislamientos nativos de suelo cultivado con palma de aceite en el Centro de Investigación Caribia de Corpoica (TCN-009, TCN-010, TCN-014. Se hizo la prueba in vitro empleando la técnica de cultivo dual en platos Petri con Agar Sabouraud. Se evaluó competencia por nutrientes y espacio, micoparasitismo y porcentaje de inhibición del crecimiento radial (PICR, por 10 días a 28 ºC. Se estableció un diseño completamente aleatorio, con 13 tratamientos y 3 repeticiones. Todos los aislamientos de T. harzianum superaron en crecimiento a F. oxysporum con radios de de 7,42 cm en cultivo dual. Mientras que el patógeno mostró un radio de 1,99 cm. TCN-009 y TCC-006 expresaron los mejores radios al crecer 4 veces mas rápido que F. oxysporum y reducir 3 veces menos el RCP con respecto al testigo, sin diferencias significativas entre estos tratamientos (P=0,0001; además, produjeron el mayor PICR a los 10 días con valores de 64,61 y 65,91%, respectivamente. No hubo diferencias significativas al comparar los aislamientos comerciales y nativos; sin embargo, por la naturaleza autóctona TCN-009, resulta ser a nivel in vitro, el aislamiento mas promisorio en el biocontrol de F. oxysporum por hallarse en condiciones agroclimáticas similares en la Zona Bananera Colombiana.Fusarium oxysporum Schlecht f. sp passiflorae cause withering of the passion fruit (Passiflora edulis Sims var. Flavicarpa, affecting their performance. In the search of alternatives for its control was carried out the present investigation with the objective of
Symptoms of abnormal proliferation of shoots resulting in formation of witches’ broom growths were observed in diseased plants of passion fruit (Passiflora edulis f. flavicarpa Deg.) in Brazil. RFLP analysis of 16S rRNA gene sequences amplified in polymerase chain reactions containing template DNAs...
Improvement of common bacterial blight resistance in South African ...
African Journals Online (AJOL)
Common bacterial blight (CBB) caused by Xanthomonas axonopodis pv. phaseoli is an important seed-borne disease of dry beans in South Africa. Development of resistant cultivars is considered the best control measurement for the disease. Backcross breeding was used to improve BB resistance in the small white ...
2485-IJBCS-Article-Dr Zinsou Valerien
African Journals Online (AJOL)
hp
Thowthampitak J. 2008. RpfF gene of. Xanthomonas axonopodis pv. glycines involved in the regulation of virulence factor production and epiphytic fitness of bacterial pustule pathogen on soybean leaves. PhD thesis, Kasetsart. University, p. 139. Wrather JA, Sleper DA, Stevens WE,. Shannon JG, Wilson RF. 2003. Planting.
Directory of Open Access Journals (Sweden)
Marco Scortichini
2010-11-01
Full Text Available Forty-five Xanthomonas arboricola pv. juglandis (Xaj strains originating from Juglans regia cultivation in different countries were molecularly typed by means of MultiLocus Sequence Typing (MLST, using acnB, gapA, gyrB and rpoD gene fragments. A total of 2.5 kilobases was used to infer the phylogenetic relationship among the strains and possible recombination events. Haplotype diversity, linkage disequilibrium analysis, selection tests, gene flow estimates and codon adaptation index were also assessed. The dendrograms built by maximum likelihood with concatenated nucleotide and amino acid sequences revealed two major and two minor phylotypes. The same haplotype was found in strains originating from different continents, and different haplotypes were found in strains isolated in the same year from the same location. A recombination breakpoint was detected within the rpoD gene fragment. At the pathovar level, the Xaj populations studied here are clonal and under neutral selection. However, four Xaj strains isolated from walnut fruits with apical necrosis are under diversifying selection, suggesting a possible new adaptation. Gene flow estimates do not support the hypothesis of geographic isolation of the strains, even though the genetic diversity between the strains increases as the geographic distance between them increases. A triplet deletion, causing the absence of valine, was found in the rpoD fragment of all 45 Xaj strains when compared with X. axonopodis pv. citri strain 306. The codon adaptation index was high in all four genes studied, indicating a relevant metabolic activity.
PV potential and potential PV rent in European regions
DEFF Research Database (Denmark)
Hansen, Anders Chr.; Thorn, Paul
2013-01-01
The paper provides a GIS based model for assessing the potentials of photovoltaic electricity in Europe by NUTS 2 regions. The location specific energy potential per PV-‐panel area is estimated based on observations of solar irradiation, conversion efficiency, levelised costs and the social value...... of PV-‐electricity. Combined with the potential density of PV-‐panel area based on land cover and environental restrictions, the PV energy potential and the potential PV ressource rent is calculated. These calculations enbable the model to estimate the regional patterns at NUTS 2 level...
International Nuclear Information System (INIS)
Nunes, Endson S.; Vieira, Maria L.C.; Lourencao, Andre L.; Piedade, Sonia M.S.
2008-01-01
This note is the first report of Bemisia tabaci (Gennadius) biotype B colonizing passionvine in Brazil. We examined the colonization of nine Passiflora species by a wild B type population under greenhouse conditions. P. amethystina Mikan was the most preferred species for oviposition and colonization, whereas P. suberosa L., P. coriacea Juss. and two commercially cultivated species, P. alata Curtis and P. edulis Sims f. flavicarpa Degener, were mostly uncolonised. P. morifolia Mast., P. cincinnata Mast., P. foetida L. and P. caerulea L. showed intermediate levels of colonization. Such differential colonization might suggest some degree of resistance by certain Passiflora species or oviposition preference by B. tabaci. (author)
Energy Technology Data Exchange (ETDEWEB)
Nunes, Endson S.; Vieira, Maria L.C. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Genetica]. E-mail: esnunes@carpa.ciagri.usp.br; mlcvieir@esalq.usp.br; Brown, Judith K. [University of Arizona, Tucson, AZ (United States). Dept. of Plant Sciences]. E-mail: jbrown@Ag.arizona.edu; Moreira, Adriana G.; Rezende, Jorge A.M. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Entomologia, Fitopatologia e Zoologia Agricola]. E-mails: agmoreir@esalq.usp.br; amrezen@esalq.usp.br; Watson, Gillian [California Dept. of Food and Agriculture, Sacramento, CA (United States)]. E-mail: gwatson@cdfa.ca.gov; Lourencao, Andre L. [Instituto Agronomico, Campinas, SP (Brazil). Centro de Pesquisa e Desenvolvimento de Fitossanidade]. E-mail: andre@iac.sp.gov.br; Piedade, Sonia M.S. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Ciencias Exatas]. E-mail: jsoniamsp@esalq.usp.br
2008-11-15
This note is the first report of Bemisia tabaci (Gennadius) biotype B colonizing passionvine in Brazil. We examined the colonization of nine Passiflora species by a wild B type population under greenhouse conditions. P. amethystina Mikan was the most preferred species for oviposition and colonization, whereas P. suberosa L., P. coriacea Juss. and two commercially cultivated species, P. alata Curtis and P. edulis Sims f. flavicarpa Degener, were mostly uncolonised. P. morifolia Mast., P. cincinnata Mast., P. foetida L. and P. caerulea L. showed intermediate levels of colonization. Such differential colonization might suggest some degree of resistance by certain Passiflora species or oviposition preference by B. tabaci. (author)
Londoño Aramburo, Jennifer
2012-01-01
El maracuyá amarillo Passiflora edulis Sims var flavicarpa Degener, representa un renglón importante en la fruticultura colombiana, por su aceptación en el mercado nacional y por su potencial de exportación. El departamento del Valle del Cauca es considerado como el de mayor participación en la producción nacional de esta fruta, a pesar que los cultivos presentan alta incidencia de una enfermedad vascular conocida como secadera, causado por el hongo Fusarium oxysporum f. sp. passiflorae.
EFEITO ANTIBIÓTICO DO PRÓPOLIS SOBRE BACTÉRIAS FITOPATOGÊNICAS
BIANCHINI, L.; BEDENDO, I.P.
1998-01-01
O efeito antibiótico de extrato aquoso de própolis, em várias concentrações, foi avaliado para cinco espécies de bactérias fitopatogênicas. Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis e Xanthomonas axonopodis pv. phaseoli foram completamente inibidas em meio de cultura contendo 10% de extrato de própolis. Erwinia chrysanthemi foi parcialmente inibida, enquanto Pseudomonas syringae pv. tabaci se mostrou insensível ao extrato, desenvolvendo colônias idênticas àquel...
França, Juliany M; Venial, Lucimara R; Costa, Eloá B; Schmildt, Edilson R; Schmildt, Omar; Bernardes, Paula M; Tatagiba, Sandro D; Lopes, José C; Ferreira, Marcia F S; Alexandre, Rodrigo S
2018-01-01
Genetic diversity allows identification of potential intraspecific genotypes in the genus Passiflora. The objective of this study was to examine the morphological and genetic diversity of auxin-induced Passiflora mucronata. The experiments were arranged in a complete randomized block design, with a 9 x 2 factorial arrangement (nine genotypes x presence and absence of auxin, indole-3-butyric acid (IBA)), with four replicates of 16 cuttings. The rooting and vegetative growth responses were variable. Genotype 5 was more responsive in the absence of IBA and genotypes 3, 8 and 9 were more responsive in the presence of IBA. Auxin increased rooting rate and percentage, reducing the average time of root protrusion in eight days. IBA also contributed to increase photosynthesis and dry root and shoot mass in 55.55 and 44.44% of the genotypes, respectively. The highest relative contribution to phenotypic diversity in the absence of auxin was rate (38.75%) and percentage (20.27%) of rooting, whereas in the presence of auxin was stomatal conductance (23.19%) and root dry mass (20.91%). Similarity was found for phenotypic and molecular divergence in the presence of IBA, in which genotypes 1 and 6; genotypes 5, 8 and 9; and genotype 3 were clustered in distinct groups.
Caracterización molecular de materiales cultivados de gulupa (Passiflora edulis f. edulis
Directory of Open Access Journals (Sweden)
Jairo Hernán Moreno-Osorio
2009-12-01
Full Text Available Molecular characterization of cultivated materials of gulupa (Passiflora edulis f. edulis. Objective. To evaluate through RAM(Random Amplified Microsatellites molecular markers the genetic diversity of cultivated materials of gulupa (Passiflora edulis f. edulis,collected in the departments of Boyacá, Cundinamarca and Huila. Materials and methods. Young and healthy leaves were collected fromcrop fields of gulupa for DNA extraction and characterization through RAM molecular markers, according to Hantula’s protocol (1996.Binary data of the type presence/absence were collected from the electrophoretic profiles. Data were analyzed with NTSYS- pc- 2.0statistical package, obtaining a similarity matrix using the Dice coefficient. Results. RAM markers were efficient in detecting polymorphismin this species. Four universal primers were used that produced 88.8% of polymorphism. In general terms, with the RAM molecularmarkers a high genetic diversity was detected in the areas where gulupa is cultivated in Colombia. In the present study no geographicalrelatedness was found with the accessions evaluated for department or locality. Conclusions. The materials of gulupa evaluated in thisstudy showed a high genetic diversity (0.291-1, probably due to the propagation method, its diverse provenances and the short time ofestablishment of the culture in Colombia.
Morfología de Passiflora: una guía para la descripción de sus especies
Directory of Open Access Journals (Sweden)
Miguel Macgayver Bonilla Morales
2015-03-01
Full Text Available Las pasifloras son un grupo de plantas que tienen uso desde periodos precolombinos por el sabor de sus frutos, sin embargo, en los últimos siglosse han encontrado compuestos de importancia farmacéutica para la salud humana. Desde esta perspectiva, conocer las especies mediante sus caracteres morfológicos permitirá explorar la variabilidadexistente a nivel intra e inter especifico, y también definir a futuro su importancia económicapor su uso potencial. Por tal motivo, el objetivo de esta investigación fue definir e ilustrar los caracteres morfológicos más utilizados en Passiflora L. para estudios de diversidad, caracterización y taxonomía en Colombia. De esta manera, se establecieron los ítems de hábito, raíz, tallo, estípula,hoja, flor, inflorescencia, fruto y semilla con sus respectivas descripciones que relacionan la taxonomía actual de Passiflora. Adicional, se añadióun componente de polinización que determinó las principales relaciones florísticas y polinizadores como insectos, aves y mamíferos. Se concluyeque el entendimiento de las estructuras morfológicas en Passiflora servirá de guía para trabajos de caracterización de germoplasma y revisionestaxonómicas como eje para describir nuevas especies.
Sozo, Jenny Sumara; Cruz, Daniel Cuzziol; Pavei, Ana Flavia; Pereira, Isadora Medeiros da Costa; Wolfart, Marcia; Ramlov, Fernanda; Fiuza Montagner, Daiane; Maraschin, Marcelo; Viana, Ana Maria
2016-01-01
We have developed reproducible micropropagation, callus culture, phytochemical, and antioxidant analysis protocols for the wild passion fruit species P. tenuifila, and P. setacea, native to the Brazilian endangered biomes Atlantic Forest, Cerrado, and Caatinga, by using seeds and explants from seedlings and adult plants. Genotype and explant origin-linked differences are visible amongst the Passiflora species concerning callus production, total phenolics, and antioxidant activity. The protocols developed for screening phytochemicals and antioxidants in P. tenuifila and P. setacea callus extracts have shown their potential for phenolic production and antioxidant activity. The high level of phenolic compounds seems to account for the antioxidant activity of methanolic extracts of P. tenuifila derived from 45-day-old immature seed callus. The methanolic extracts of callus derived from P. setacea seedling leaf node and cotyledonary node explants have shown the highest antioxidant activity despite their lower content of phenolics, as compared to cotyledon callus extracts. The optimized micropropagation and callus culture protocols have great potential to use cell culture techniques for further vegetative propagation, in vitro germplasm conservation, and secondary metabolite production using biotic and abiotic elicitors.
Cardozo Gutiérrez Rito Hernán
1988-01-01
The trials made on banana passion fruit seeds germination (Passiflora mollisima(HBK) Bailey, under laboratory specifications show that the testa delays the water absortion and it is the critic factor on the germination. AG3 increases the germination remarkably and strengthens the effects of the scarification considerably.
Los ensayos de la germinación de semilla de curuba (Passiflora mollisima (HBK) Bailey en condiciones de ...
Varassin,Isabela Galarda; Ximenes,Brunna Maria Setti; Moreira,Priscila Ambrósio; Zanon,Mireille Maria Franco; Elbl,Paula; Löwenberg-Neto,Peter; Melo,Gabriel Augusto Rodrigues
2012-01-01
A atividade dos polinizadores é afetada pela disponibilidade de recursos. Flores que produzem mais néctar podem ser mais visitadas e assim apresentar maior produção de frutos. O efeito da produção de néctar na atividade dos polinizadores foi testado em duas espécies cultivadas de maracujá, Passiflora alata Curtis e Passiflora edulis Sims, em Morretes, Paraná. Botões foram ensacados e o néctar acumulado das flores foi coletado em intervalos de 1 h. Em P. alata o volume e a concentração de solu...
Directory of Open Access Journals (Sweden)
Jorge de Medeiros
2010-11-01
Full Text Available Os polietilenoglicóis (PEG são polímeros hidrossolúveis capazes de reduzir a constante dielétrica de solventes como a água, e assim são utilizados como cossolventes para solubilização de diferentes fármacos. Atualmente, o PEG tem sido empregado satisfatoriamente na obtenção de extratos de matérias-primas vegetais por favorecer a extração de substâncias com polaridades semelhantes às extraídas pelos solventes hidroetanólicos. O objetivo deste trabalho foi avaliar o efeito da concentração e da massa molar de PEG (400 e 4000 g/mol sobre a extração de flavonoides totais a partir de Passiflora edulis Sims, Passifloraceae, (maracujá e de cumarina a partir da Mikania glomerata Spreng., Asteraceae, (guaco. Este estudo revelou que o aumento da concentração de PEG promoveu um aumento na capacidade extrativa de flavonoides totais e cumarina a partir da Passiflora edulis e Mikania glomerata respectivamente, comportamento atribuído a alterações da constante dielétrica. Apesar de elevar a capacidade extrativa, os líquidos extratores contendo PEG exigiram elevada relação planta:solvente para alcançar teores extrativos semelhante ao solvente hidroetanólico utilizado, com exceção da extração de flavonoides totais com PEG 4000 g/mol a partir da Passilfora edulis.Polyethylene glycols (PEG are hydrosoluble polymers able to reducing dielectric constant of solvents like water and thus are used as cosolvents to enhance the aqueous solubility of several drugs. Actually, the PEG have been successful applied to obtain extracts of plant raw material once can facilitate the extraction of substances with polarities similar to those extracted by hydroethanol solvents. In this study, the objective was to evaluate the effect of PEG concentration and molecular weight (400 and 4000 g/mol on the extraction of total flavonoids from Passiflora edulis Sims, Passifloraceae, and coumarin from Mikania glomerata Spreng., Asteraceae. The results
Interband cascade (IC) photovoltaic (PV) architecture for PV devices
Yang, Rui Q.; Tian, Zhaobing; Mishima, Tetsuya D.; Santos, Michael B.; Johnson, Matthew B.; Klem, John F.
2015-10-20
A photovoltaic (PV) device, comprising a PV interband cascade (IC) stage, wherein the IC PV stage comprises an absorption region with a band gap, the absorption region configured to absorb photons, an intraband transport region configured to act as a hole barrier, and an interband tunneling region configured to act as an electron barrier. An IC PV architecture for a photovoltaic device, the IC PV architecture comprising an absorption region, an intraband transport region coupled to the absorption region, and an interband tunneling region coupled to the intraband transport region and to the adjacent absorption region, wherein the absorption region, the intraband transport region, and the interband tunneling region are positioned such that electrons will flow from the absorption region to the intraband transport region to the interband tunneling region.
An Analysis of Open World PvP in LOTRO's PvMP as a Case Study for PvP Games
Directory of Open Access Journals (Sweden)
Toh Weimin
2014-11-01
Full Text Available This article focuses on the analysis of emergent gameplay, based on a case study of the author's subjective gameplay experience of Player versus Monster Player (PvMP in The Lord of the Rings Online (LOTRO. The argument presented here is that although there is a core system of Player versus Player (PvP which LOTRO shares with other online games, each type of online game has a specific kind of PvP system which attracts players to engage in the gameplay. For instance, the open world sandbox type of PvP attracts certain players to play in LOTRO's PvMP. One of the main aims of this study is thus to investigate some of the core systems of PvP gameplay in open world sandbox PvP. In this article, LOTRO is shown to offer unique opportunities for studying emergent gameplay in open world games, with particular relevance to PvP studies. Two of the core systems of PvP discussed include the design of the simple gameplay rules to support emergent gameplay, and the community's attitudes towards player's behaviours. The types of emergent gameplay discussed include free play versus negotiated fair play, the players' utilisation of strategies in open world PvP to support collaborative and competitive gameplay, and the changing dynamics of open ended gameplay. It is hoped that the analysis provided in this article would form the basis of future work on a more general framework for understanding PvP in other online games.
Fire resistant PV shingle assembly
Lenox, Carl J.
2012-10-02
A fire resistant PV shingle assembly includes a PV assembly, including PV body, a fire shield and a connection member connecting the fire shield below the PV body, and a support and inter-engagement assembly. The support and inter-engagement assembly is mounted to the PV assembly and comprises a vertical support element, supporting the PV assembly above a support surface, an upper interlock element, positioned towards the upper PV edge, and a lower interlock element, positioned towards the lower PV edge. The upper interlock element of one PV shingle assembly is inter-engageable with the lower interlock element of an adjacent PV shingle assembly. In some embodiments the PV shingle assembly may comprise a ventilation path below the PV body. The PV body may be slidably mounted to the connection member to facilitate removal of the PV body.
PV/T slates - Laboratory measurements; PV/T-Schiefer. Labormessungen
Energy Technology Data Exchange (ETDEWEB)
Kropf, S.
2003-07-01
This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with an experimental outdoor set-up and reviews in-situ measurements made on a prototype of a ventilated PV-tile system (PV/T-Slates). The report describes the configuration and construction of the experimental PV-tiled roof and the measurement system used to measure its electrical and thermal performance. The results of the measurements made are presented in detail in graphical form. The influence of various factors such as air-slit width and mounting angle are discussed.
Tryptophan-Containing Cyclic Decapeptides with Activity against Plant Pathogenic Bacteria
Directory of Open Access Journals (Sweden)
Cristina Camó
2017-10-01
Full Text Available A library of 66 cyclic decapeptides incorporating a Trp residue was synthesized on solid phase and screened against the phytopathogenic bacteria Pseudomonas syringae pv. syringae, Xanthomonas axonopodis pv. vesicatoria, and Erwinia amylovora. The hemolytic activity of these peptides was also evaluated. The results obtained were compared with those of a collection of Phe analogues previously reported. The analysis of the data showed that the presence of the Trp improved the antibacterial activity against these three pathogens. In particular, 40 to 46 Trp analogues displayed lower minimum inhibitory concentration (MIC values than their corresponding Phe counterparts. Interestingly, 26 Trp-containing sequences exhibited MIC of 0.8 to 3.1 μM against X. axonopodis pv. vesicatoria, 21 peptides MIC of 1.6 to 6.2 μM against P. syringae pv. syringae and six peptides MIC of 6.2 to 12.5 μM against E. amylovora. Regarding the hemolysis, in general, Trp derivatives displayed a percentage of hemolysis comparable to that of their Phe analogues. Notably, 49 Trp-containing cyclic peptides showed a hemolysis ≤ 20% at 125 μM. The peptides with the best biological activity profile were c(LKKKLWKKLQ (BPC086W and c(LKKKKWLLKQ (BPC108W, which displayed MIC values ranging from 0.8 to 12.5 μM and a hemolysis ≤ 8% at 125 μM. Therefore, it is evident that these Trp sequences constitute promising candidates for the development of new agents for use in plant protection.
Directory of Open Access Journals (Sweden)
Kriti Tyagi
Full Text Available Plasmodium vivax is most wide spread and a neglected malaria parasite. There is a lack of information on parasite biology of this species. Genome of this parasite encodes for the largest number of tryptophan-rich proteins belonging to 'Pv-fam-a' family and some of them are potential drug/vaccine targets but their functional role(s largely remains unexplored. Using bacterial and yeast two hybrid systems, we have identified the interacting partners for two of the P. vivax tryptophan-rich antigens called PvTRAg36.6 and PvTRAg56.2. The PvTRAg36.6 interacts with early transcribed membrane protein (ETRAMP of P.vivax. It is apically localized in merozoites but in early stages it is seen in parasite periphery suggesting its likely involvement in parasitophorous vacuole membrane (PVM development or maintenance. On the other hand, PvTRAg56.2 interacts with P.vivax merozoite surface protein7 (PvMSP7 and is localized on merozoite surface. Co-localization of PvTRAg56.2 with PvMSP1 and its molecular interaction with PvMSP7 probably suggest that, PvTRAg56.2 is part of MSP-complex, and might assist or stabilize the protein complex at the merozoite surface. In conclusion, the PvTRAg proteins have different sub cellular localizations and specific associated functions during intra-erythrocytic developmental cycle.
Tyagi, Kriti; Hossain, Mohammad Enayet; Thakur, Vandana; Aggarwal, Praveen; Malhotra, Pawan; Mohmmed, Asif; Sharma, Yagya Dutta
2016-01-01
Plasmodium vivax is most wide spread and a neglected malaria parasite. There is a lack of information on parasite biology of this species. Genome of this parasite encodes for the largest number of tryptophan-rich proteins belonging to ‘Pv-fam-a’ family and some of them are potential drug/vaccine targets but their functional role(s) largely remains unexplored. Using bacterial and yeast two hybrid systems, we have identified the interacting partners for two of the P. vivax tryptophan-rich antigens called PvTRAg36.6 and PvTRAg56.2. The PvTRAg36.6 interacts with early transcribed membrane protein (ETRAMP) of P.vivax. It is apically localized in merozoites but in early stages it is seen in parasite periphery suggesting its likely involvement in parasitophorous vacuole membrane (PVM) development or maintenance. On the other hand, PvTRAg56.2 interacts with P.vivax merozoite surface protein7 (PvMSP7) and is localized on merozoite surface. Co-localization of PvTRAg56.2 with PvMSP1 and its molecular interaction with PvMSP7 probably suggest that, PvTRAg56.2 is part of MSP-complex, and might assist or stabilize the protein complex at the merozoite surface. In conclusion, the PvTRAg proteins have different sub cellular localizations and specific associated functions during intra-erythrocytic developmental cycle. PMID:26954579
Directory of Open Access Journals (Sweden)
Dandara A.F. Figueiredo
Full Text Available ABSTRACT Effects of treatment with the bark flour of Passiflora edulis Sims, Passifloraceae, were evaluated. Adult male Wistar rats were treated for 30 days (130 mg/kg, p.o. with the albedo flour, flavedo and full bark of P. edulis, corresponding to albedo associated with flavedo. Behavioral response observed after treatment with bark flour P. edulis showed sedative effects by the reduction of exploratory activity and increased duration of immobility in the open field test for the group of animals that received the albedo flour associated with the flavedo. Sedative effects were observed in the absence of motor incoordination or muscle relaxation. Food intake of experimental animals was not changed, but the weight gain was decreased both in animals that received only albedo flour, and in those who received the full bark flour. The full bark flour of Passiflora showed sedative effects, without anxiolytic effect detectable and muscle relaxation or motor incoordination, and reduces body weight gain.
International Nuclear Information System (INIS)
Hammond, B.
1992-01-01
This paper forecasts the photovoltaic (PV) market growth for the 1990s. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market however is highly dependent on a number of market factors such as the cost of conventional energy the cost of PV systems utility acceptance of PV and regulatory controls. Government and institutional regulations, environmental issues, and OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer stand-alone and utility markets
Directory of Open Access Journals (Sweden)
Renata da Costa Chaves
2004-04-01
Full Text Available As doenças provocadas por patógenos do solo em maracujazeiro constituem-se em um dos principais problemas para essa cultura no Brasil. Uma das alternativas de controle dessas doenças seria a utilização de porta-enxertos resistentes. Várias espécies de passifloras nativas vêm apresentando resistência a essas doenças, mas a utilização destas como porta-enxertos oriundos de sementes tem sido dificultada pelas diferenças de diâmetro entre o porta-enxerto e o enxerto da espécie comercial, o que não aconteceria caso fossem utilizadas as estacas herbáceas como porta-enxerto. No presente experimento, utilizaram-se estacas herbáceas retiradas da parte mediana de ramos de plantas de Passiflora setacea (acesso EC-PS 1, P. nitida (acesso EC-PN 1, P. caerulea (acesso EC-PC 1, P. actinia (acesso EC-PA 1 e de um híbrido F1 entre P. setacea x P. edulis f. flavicarpa comercial e tratadas com ácido naftaleno acético (ANA a 500 mg/L e mantidas em câmaras de nebulização. As enxertias do tipo "garfagem lateral no topo" foram efetuadas aos 40; 55 e 70 dias após a coleta e plantio das estacas, utilizando garfos de uma única planta de maracujazeiro-azedo. As avaliações foram efetuadas aos 145 e 150 dias após o plantio das estacas, determinando-se a porcentagem de pegamento da enxertia e de enxertos brotados e o comprimento do broto do enxerto. A produção de mudas por enxertia em estacas herbáceas enraizadas de Passiflora nitida e do híbrido F1 (P. setacea x P. edulis f. flavicarpa foi tecnicamente viável.The soil born diseases cause expressive losses in passion fruit crops in Brazil. The use of resistant rootstocks is an alternative to control these diseases. Several wild species of Passifloraceae have presented resistance to soil born pathogens, but their utilization as rootstock from seeds has been limited mainly by differences of thickness between the rootstock and the graft of the commercial cultivars. These limitations could be
Report on the development of putative functional SSR and SNP markers in passion fruits.
da Costa, Zirlane Portugal; Munhoz, Carla de Freitas; Vieira, Maria Lucia Carneiro
2017-09-06
Passionflowers Passiflora edulis and Passiflora alata are diploid, outcrossing and understudied fruit bearing species. In Brazil, passion fruit cultivation began relatively recently and has earned the country an outstanding position as the world's top producer of passion fruit. The fruit's main economic value lies in the production of juice, an essential exotic ingredient in juice blends. Currently, crop improvement strategies, including those for underexploited tropical species, tend to incorporate molecular genetic approaches. In this study, we examined a set of P. edulis transcripts expressed in response to infection by Xanthomonas axonopodis, (the passion fruit's main bacterial pathogen that attacks the vines), aiming at the development of putative functional markers, i.e. SSRs (simple sequence repeats) and SNPs (single nucleotide polymorphisms). A total of 210 microsatellites were found in 998 sequences, and trinucleotide repeats were found to be the most frequent (31.4%). Of the sequences selected for designing primers, 80.9% could be used to develop SSR markers, and 60.6% SNP markers for P. alata. SNPs were all biallelic and found within 15 gene fragments of P. alata. Overall, gene fragments generated 10,003 bp. SNP frequency was estimated as one SNP every 294 bp. Polymorphism rates revealed by SSR and SNP loci were 29.4 and 53.6%, respectively. Passiflora edulis transcripts were useful for the development of putative functional markers for P. alata, suggesting a certain level of sequence conservation between these cultivated species. The markers developed herein could be used for genetic mapping purposes and also in diversity studies.
International Nuclear Information System (INIS)
Hacker, R.
2002-01-01
The current status and future prospects of the UK market for solar photovoltaic (PV) electricity are briefly discussed. Through the Department of Trade and Industry (DTI), the UK Government has supported research and development (R and D) into PV for a number of years. This programme has now been extended to demonstrating PV systems on houses. Phase 2 - the domestic field trial programme - aims to monitor the performance of individual systems and the impact on a cluster of systems on the electricity network. New funding had allowed a trebling of the size of this programme, which involves both private developers and housing associations. The DTI is also working to promote PV on commercial buildings, eg the installation of BP Solar PV systems at BP petrol stations. The PV industry in the UK is technically strong and is working to overcome the barriers in the UK to greater uptake of the technology (including cost, conservatism, legal requirements and metering practices). Improvements are expected in a number of recent initiatives in the electricity industry to boost PV use and the PV industry is lobbying for PV to be included in the Enhanced Capital Allowances (ECA) scheme
Building opportunities in the U.S. for PV (PV:BONUS): A progress report
International Nuclear Information System (INIS)
Taylor, R.W.
1994-01-01
Five contract teams are developing photovoltaic (PV) products that will have a significant impact on building-integrated PV systems. The product lines that these teams are pursuing include roofing materials, building facade materials, PV integrated into modular homes, ac-PV modules, and utility-dispatchable PV systems. The objective of these efforts is to develop product and market opportunities that can provide for the introduction of PV into the buildings market sector at higher allowable installed systems costs than conventional ground- or roof-mounted systems. Each of the teams has a unique approach, and synergistic opportunities among teams are beginning to emerge. This paper reviews the product and market development efforts of these teams and describes the links between the product efforts and parallel analytical work to develop PV as a demand-side management option
Insights into xanthomonas axonopodis pv. Citri biofilm through proteomics
Zimaro, Tamara; Thomas, Ludivine; Marondedze, Claudius; Garavaglia, Betiana S; Gehring, Christoph A; Ottado, Jorgelina; Gottig, Natalia
2013-01-01
in adherence were over-expressed, while a polynucleotide phosphorylase that was demonstrated to negatively control biofilm formation in E. coli was down-regulated. In addition, several proteins involved in protein synthesis, folding and stabilization were up
Directory of Open Access Journals (Sweden)
Regina de A. O. Chabariberi
Full Text Available Este trabalho apresenta uma modificação dos procedimentos descritos nas Farmacopéias Francesa e Européia para a análise de flavonoides de Passiflora incarnata L., Passifloraceae, por espectrometria UV-Visível e propõe a sua aplicação na determinação dos flavonoides totais das folhas da espinheira-santa (Maytenus aquifolium Mart. e Maytenus ilicifolia (Schrad. Planch., Celastraceae e do maracujá (Passiflora edulis Sims. e Passiflora alata Curtis, Passifloraceae. Os resultados obtidos por espectrometria no UV-Visível foram comparados aos obtidos por cromatografia líquida de alta eficiência (CLAE-UV, encontrando-se resultados estatisticamente similares entre os métodos espectrométrico modificado da Farmacopéia Francesa e CLAE-UV.
Directory of Open Access Journals (Sweden)
Sophie Primot
2005-12-01
Full Text Available Se estudió la variación morfológica entre ocho accesiones de las tres principales especies de curubas cultivadas y silvestres del Valle del Cauca, Passiflora tripartita var. mollissima (curuba de Castilla, Passiflora tarminiana (curuba india y Passiflora mixta (curuba de monte y 11 de sus híbridos, usando el análisis de componentes principales y el método de clasificación del vecino más próximo en 105 caracteres cualitativos y cuantitativos. Siete componentes principales explican 84% de la varianza total. Las clasificaciones sobre los caracteres cualitativos y cuantitativos muestran una clara agrupación por especie. Dentro de P. mixta, se distinguen un tipo poco pubescente, representativo de las plantas silvestres más comunes, y un tipo muy pubescente, con caracteres de domesticación como frutos amarillentos de pulpa colorida, y con una mayor variación morfológica. La clasificación de estos últimos individuos sugiere una introgresión entre P. mixta y Passiflora tripartita var. mollissima. Los híbridos ocupan una posición intermedia entre las especies parentales, pero se diferencian claramente según la dirección del cruzamiento, revelando un efecto maternal sobre la herencia de los caracteres vegetativos y florales. Los primeros análisis del fruto muestran características intermedias en cuanto a forma, color y tolerancia a la antracnosis.Morphological variation was studied in eight accessions from the three most common cultivated and wild species of banana passion fruit in the Cauca Valley, Passiflora tripartita var. mollissima (curuba de Castilla, P. tarminiana (curuba india and P. mixta (curuba de monte, and 11 of their hybrids, using the principal component analysis and neighbor joining cluster analysis on 105 qualitative and quantitative traits. The seven principal components explain 84% of the total variance. The principal component and cluster analyses clearly show the groups accessions by species. Two subgroups are
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-07-01
The integration of PV technology into roofs of houses has become very popular in the United States, Japan, Germany and The Netherlands. There could be a considerable market in the UK for these systems, given the large number of houses that are projected to be built in the next 10 years, and taking account of increased awareness of energy issues. A significant proportion of the market share of annual installed PV is for solar PV systems installed into homes (currently 15%), this is expected to rise to 23% (900MW) by 2010. The grid connected roof and building mounted facade systems represent the fastest growing market for PV systems in Europe. In conclusion, therefore, innovative approached for fixing PV technology onto roofs have been identified for both domestic roofs and for the commercial sector. With reference to production methodologies within the roofing industry, both approaches should be capable of being designed with PV-ready connections suitable for fixing PV modules at a later date. This will help overcome the key barriers of cost of installation, skills required and the lack of retrofit potential. Based on the results of this project, Sustainable Energy together with PV Systems are keen to take forward the full research and development of PV-ready systems for both the domestic and commercial sectors.
Search for alkaloids on callus culture of Passiflora alata
Directory of Open Access Journals (Sweden)
Michelli Wesz Machado
2010-08-01
Full Text Available Preliminary work on Passiflora alata leaves failed to detect harmane alkaloids using LC. The aim of this work was to investigate the production of harmane alkaloids through the cell culture of P. alata, inducing its precursor (L-tryptophan. The leaf explants presented satisfactory results after disinfection, and the callus formation was initiated in MS media with adequate quantities of phytohormones. Sixty days after inoculation, calli were inoculated in the optimized semi-solid MS media, with and without the addition of L-tryptophan (50, 100, 200 mg/L and kept in standard conditions for 90 days. Calli were collected on days 6, 16, 26, 36, and 90, followed by acid-base extraction, and analysed by LC. The results showed an absence of harmane, harmin, harmol, harmalol, and harmaline. With L-tryptophan feeding, two peaks were detected, collected and analysed through positive mode electrospray [ESI(+-MS] and sequential analysis in tandem ESI(+-MS/MS. The spectra obtained were very similar, with a repetition of the more intense ions, and consecutive loss of 68 Da units, attributed to the heterocycle pyrazole. It appeared that this transformation was not related to any enzymatic pathway previously described for the plant from L-tryptophan, and the biosynthesis of β-carboline alkaloids in callus culture of P. alata were not observed in this work.As folhas de varias espécies de Passiflora são utilizadas como ansioliticas e sedativas. Passiflora alata Curtis, Passifloraceae consta em três edições da farmacopéia brasileira, porem não há muitos estudos sobre sua composição química. No passado, enfatizava-se a ação conjunta de alcalóides e flavonóides. Em trabalho anterior, não foi detectada a presença de alcalóides harmanicos através de CLAE. Assim, decidiu-se investigar a produção dos mesmos através de cultivo celular, introduzindo seu precursor metabólico L-triptofano. Os explantes foliares apresentaram resultados satisfatorios
CARACTERÍSTICAS NUTRICIONALES Y ANTIOXIDANTES DE LA FRUTA CURUBA LARGA (Passiflora mollisima Bailey)
CHAPARRO R, DIANA CAROLINA; MALDONADO C, MARIA ELENA; FRANCO L, MARÍA CAMILA; URANGO M, LUZ AMPARO
2015-01-01
La presente revisión muestra el valor nutricional y el impacto para la salud humana del consumo de la fruta curuba larga (Passiflora mollisima Bailey), con base a las características nutricionales y antioxidantes. Pertenece a la familia de las pasifloráceas, es originaria de la zona andina del continente americano y en Colombia se cultiva principalmente en las cordilleras oriental y occidental. Esta fruta es fuente de vitaminas A, C y riboflavina; contiene potasio, fósforo, magnesio, sodio, c...
Sensorless PV Array Diagnostic Method for Residential PV Systems
DEFF Research Database (Denmark)
Sera, Dezso; Spataru, Sergiu; Mathe, Laszlo
2011-01-01
This work proposes a temperature and irradiance sensorless diagnostic method suitable for small residential PV installations, focusing on detection of partial shadows. The method works by detection of failures in crystalline silicone PV arrays by concomitant monitoring of some of their key...
Formulasi Bakteri Endofit Akar Kedelai untuk Pengendalian Pustul Bakteri
Directory of Open Access Journals (Sweden)
Trimurti Habazar
2015-04-01
Full Text Available Two isolates of bacterial endophyte from soybean root were found to be effective to control bacterial pustule caused by Xanthomonas axonopodis pv. glycines. Formulation of the bacterial isolates is required to maintain the effectivity of this bacterial isolates during storage, transportation and application. The aim of this research was to obtain the best carrier for formulation to maintain the effectivity of bacterial endophyte in storage to control bacterial pustule on soybean. Three kind of carrier agent was evaluated for formulation of bacterial endophyte i.e. peat soil, tapioca flour and coconut water + 1% palm oil. Each carrier agent was combined with 5 treatment of storage time i.e. 0, 1, 3, 5 and 7 weeks. Soybean plants was inoculated by. X. axonopodis pv. glycines 2 weeks after planting by rubbing bacterial suspension (106 cel mL-1 on lower surface of leaves. The results showed that all formulas of bacterial endophyte were able to suppress the bacterial pustule on soybean. The best formulations were bacterial endophyte in peat soil stored for 1 and 7 weeks (effectivity rate 79.85% and 77.02% and coconut water + palm oil and storaged for 3 weeks (effectivity rate 77.46%.
City and County Solar PV Training Program, Module 2: Screening and Identifying PV Projects
Energy Technology Data Exchange (ETDEWEB)
Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2018-04-09
When screening and identifying PV projects, cities and counties should understand the different factors that impact the technical and economic potential of a PV project, the steps of the PV screening process, and how to use REopt Lite to screen a site for PV and storage project potential.
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-07-01
Within the international seminar of the Ostbayerisches Technologie-Transfer-Institut e.V. (OTTI) at 11th June, 2012 in Munich (Federal Republic of Germany), the following lectures were held: (1) Technical due diligence (Dietmar Obst); (2) Certification / rating system for large PV plants (Robert Pfatischer); (3) O and M requirements (Lars Rulf); (4) IR photography for large scale systems (Bernhard Weinreich); (5) New market models for PV systems - direct marketing and sales of PV electricity (Martin Schneider); (6) Needs and benefits for plant certification for grid connection and operation (Christoph Luetke-Lengerich); (7) Lare volume module testing / Screening in the field and workshop (Semir Merzoug); (8) Dismantling costs of large scale PV plants (Siegfried Schimpf).
PV Obelisk - Information system with photovoltaics; PV-Obelisk Orientierungssystem mit Photovoltaik
Energy Technology Data Exchange (ETDEWEB)
Ruoss, D.; Rasmussen, J.
2004-07-01
This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed.
Directory of Open Access Journals (Sweden)
Larissa Macedo Winkler
2002-12-01
Full Text Available O maracujá-amarelo (Passiflora edulis f. flavicarpa Deg. é uma das principais espécies cultivadas do gênero Passiflora. Seus frutos são ricos em minerais, vitaminas e apresentam aroma e sabor agradáveis. O presente trabalho teve como objetivos determinar a produção de etileno e atividade enzimática da ACCoxidase (ACCO em maracujá-amarelo colhido em diferentes estádios de maturação. A determinação do estádio de maturação foi realizada com o auxílio de um colorímetro, que, por meio da radiação ultravioleta, estabeleceu valores absolutos da cor dos frutos de cada um dos grupos (I, II e III. A produção de etileno e a atividade da ACCoxidase foram realizadas por cromatografia gasosa. Os frutos do grupo I são predominantemente verdes, de acordo com os valores absolutos da cor obtidos. Os frutos do grupo II são predominantemente, coloridos, ou seja, em um estádio de maturação intermediário, e os frutos do grupo III, totalmente coloridos, apresentando-se, portanto, em início da senescência. Os frutos do grupo I apresentaram atividade da ACCO predominantemente mais elevada do que os frutos do grupo III, ocorrendo também o mesmo comportamento com a produção de etileno, com um valor médio de 7,25 nL. g-1. h-1, bem acima do nível máximo estabelecido para espécies classificadas como fracamente produtoras de etileno (0,5 nL. g-1. h-1. Assim, o maracujá-amarelo difere quanto à produção de etileno e atividade da enzima ACCO, de acordo com o estádio de maturação. A espécie foi considerada, em comparação com outras espécies, como produtora intermediária de etileno. A atividade enzimática da ACCO é mais elevada em frutos predominantemente verdes, mas ela é limitada e necessita de co-fatores enzimáticos para sua atividade máxima.Passion fruit (Passiflora edulis f. flavicarpa Deg. is one of the main cultivated species of Passiflora genus. Its fruits are rich in mineral salts and vitamins and to present
Novel Methods to Determine Feeder Locational PV Hosting Capacity and PV Impact Signatures
Energy Technology Data Exchange (ETDEWEB)
Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Coogan, Kyle [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-05-01
Often PV hosting capacity analysis is performed for a limited number of distribution feeders. For medium - voltage distribution feeders, previous results generally analyze less than 20 feeders, and then the results are extrapolated out to similar types of feeders. Previous hosting capacity research has often focused on determining a single value for the hosting capacity for the entire feeder, whereas this research expands previous hosting capacity work to investigate all the regions of the feeder that may allow many different hosting capacity values wit h an idea called locational hosting capacity (LHC)to determine the largest PV size that can be interconnected at different locations (buses) on the study feeders. This report discusses novel methods for analyzing PV interconnections with advanced simulati on methods. The focus is feeder and location - specific impacts of PV that determine the locational PV hosting capacity. Feeder PV impact signature are used to more precisely determine the local maximum hosting capacity of individual areas of the feeder. T he feeder signature provides improved interconnection screening with certain zones that show the risk of impact to the distribution feeder from PV interconnections.
Dale, Michael; Benson, Sally M
2013-04-02
A combination of declining costs and policy measures motivated by greenhouse gas (GHG) emissions reduction and energy security have driven rapid growth in the global installed capacity of solar photovoltaics (PV). This paper develops a number of unique data sets, namely the following: calculation of distribution of global capacity factor for PV deployment; meta-analysis of energy consumption in PV system manufacture and deployment; and documentation of reduction in energetic costs of PV system production. These data are used as input into a new net energy analysis of the global PV industry, as opposed to device level analysis. In addition, the paper introduces a new concept: a model tracking energetic costs of manufacturing and installing PV systems, including balance of system (BOS) components. The model is used to forecast electrical energy requirements to scale up the PV industry and determine the electricity balance of the global PV industry to 2020. Results suggest that the industry was a net consumer of electricity as recently as 2010. However, there is a >50% that in 2012 the PV industry is a net electricity provider and will "pay back" the electrical energy required for its early growth before 2020. Further reducing energetic costs of PV deployment will enable more rapid growth of the PV industry. There is also great potential to increase the capacity factor of PV deployment. These conclusions have a number of implications for R&D and deployment, including the following: monitoring of the energy embodied within PV systems; designing more efficient and durable systems; and deploying PV systems in locations that will achieve high capacity factors.
EFFECTS OF STORAGE PERIODS AND METHODS OF OVERCOMING DORMANCY IN SEEDS OF PASSIFLORA
Directory of Open Access Journals (Sweden)
Telma Miranda dos Santos
2012-07-01
Full Text Available The aim of this work was to evaluate the effects of storage period and treatement with hot water at 50ºC or scarification on dormancy break down on Passiflora mucronata seeds. The storage periods were 0, 1, 4 and 12 months. The seeds were sown onto Germitest paper roll and incubated in a germination chamber under 20ºC/8h-30ºC/16h alternate temperature, at 16-h photoperiod (fluorescent light at 32 mol m-2 s-1 irradiance. The percent germination was evaluated, and the seeds germinated on moistened Germitest paper rolls in distilled water at a ratio of two and a half times the paper weight. The seeds were transferred to a germination chamber with alternating temperatures of 20-30º C and photoperiod of 16 h until the end of the experiment at 31 days. The experiment was analyzed as completely randomized designed with four replications, in which each plot was constituted by 50 seeds. The storage periods had significant effect on the variable studied, where the higher germination was obtained at freshly harvested seeds. At the first month of evaluation the germination decreased. After 4 and 12 months of storage, no germination was detected. The treatment with hot water at 50º or scarification favored the germination of the Passiflora seeds stored by one and four months, however even with the stimulus of the treatments, the values of final germination were low. The treatments were not efficient to stimulate the seed germination stored by 12 months.
EFEITO ANTIBIÓTICO DO PRÓPOLIS SOBRE BACTÉRIAS FITOPATOGÊNICAS
Directory of Open Access Journals (Sweden)
L. BIANCHINI
1998-01-01
Full Text Available O efeito antibiótico de extrato aquoso de própolis, em várias concentrações, foi avaliado para cinco espécies de bactérias fitopatogênicas. Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis e Xanthomonas axonopodis pv. phaseoli foram completamente inibidas em meio de cultura contendo 10% de extrato de própolis. Erwinia chrysanthemi foi parcialmente inibida, enquanto Pseudomonas syringae pv. tabaci se mostrou insensível ao extrato, desenvolvendo colônias idênticas àquelas observadas em meios livres de própolis. Concentrações menores não foram suficientes para exercer um efeito antimicrobiano desejável sobre as bactérias pertencentes a todas as espécies testadas. Resultados idênticos foram obtidos quando própolis foi incorporado ao meio antes ou após a autoclavagem, demonstrando que a substância ativa presente no extrato não é termosensível. Foi demonstrado, portanto, o uso potencial do própolis como antibiótico para o controle de bactérias fitopatogênicas.The antibiotic effect of aqueous extract of propolis was evaluated in vitro against five species of bacteria. The growth of Agrobacterium tumefaciens, Clavibacter michiganensis subsp. michiganensis and Xanthomonas axonopodis pv. phaseoli was completely inhibited in a medium containing 10% of propolis. Erwinia chrysanthemi was partially inhibited and Pseudomonas syringae pv. tabaci was not affected. Lower concentration of the aqueous extract was not effective to promote a desirable antibiotic action against all bacterial species tested. The active ingredient present in the propolis was thermostable. The potential use of the propolis to control phytopathogenic bacteria was demonstrated.
PV Thermal systems: PV panels supplying renewable electricity and heat
Helden, van W.G.J.; Zolingen, van R.J.C.; Zondag, H.A.
2004-01-01
With PV Thermal panels sunlight is converted into electricity and heat simultaneously. Per unit area the total efficiency of a PVT panel is higher than the sum of the efficiencies of separate PV panels and solar thermal collectors. During the last 20 years research into PVT techniques and concepts
Vich, M.; Romero, R.; Richard, E.; Arbogast, P.; Maynard, K.
2010-09-01
Heavy precipitation events occur regularly in the western Mediterranean region. These events often have a high impact on the society due to economic and personal losses. The improvement of the mesoscale numerical forecasts of these events can be used to prevent or minimize their impact on the society. In previous studies, two ensemble prediction systems (EPSs) based on perturbing the model initial and boundary conditions were developed and tested for a collection of high-impact MEDEX cyclonic episodes. These EPSs perturb the initial and boundary potential vorticity (PV) field through a PV inversion algorithm. This technique ensures modifications of all the meteorological fields without compromising the mass-wind balance. One EPS introduces the perturbations along the zones of the three-dimensional PV structure presenting the local most intense values and gradients of the field (a semi-objective choice, PV-gradient), while the other perturbs the PV field over the MM5 adjoint model calculated sensitivity zones (an objective method, PV-adjoint). The PV perturbations are set from a PV error climatology (PVEC) that characterizes typical PV errors in the ECMWF forecasts, both in intensity and displacement. This intensity and displacement perturbation of the PV field is chosen randomly, while its location is given by the perturbation zones defined in each ensemble generation method. Encouraged by the good results obtained by these two EPSs that perturb the PV field, a new approach based on a manual perturbation of the PV field has been tested and compared with the previous results. This technique uses the satellite water vapor (WV) observations to guide the correction of initial PV structures. The correction of the PV field intents to improve the match between the PV distribution and the WV image, taking advantage of the relation between dark and bright features of WV images and PV anomalies, under some assumptions. Afterwards, the PV inversion algorithm is applied to run
Photovoltaics for Buildings Cutting-Edge PV
International Nuclear Information System (INIS)
Hayter, S. J.; Martin, R. L.
1998-01-01
Photovoltaic (PV) technology development for building-integrated applications (commonly called PV for Buildings) is one of the fastest growing areas in the PV industry. Buildings represent a huge potential market for photovoltaics because they consume approximately two-thirds of the electricity consumed in the US. The PV and buildings industries are beginning to work together to address issues including building codes and standards, integration, after-market servicing, education, and building energy efficiency. One of the most notable programs to encourage development of new PV-for-buildings products is the PV:BONUS program, supported by the US Department of Energy. Demand for these products from building designers has escalated since the program was initiated in 1993. This paper presents a range of PV-for-buildings issues and products that are currently influencing today's PV and buildings markets
International Nuclear Information System (INIS)
Schmidt, F.
2009-01-01
The dawn of 2009 saw several events which caused major turbulence in the global photovoltaic industry. In 2008 the Spanish PV market grew beyond all expectations and even outranked Germany as the world's number one market. However, the promotion scheme was modified and a market cap was introduced in 2009, cutting back the maximum capacity to be installed to about the level of 2007. In addition, the industry is facing an oversupply of PV modules and a harsh recession which is significantly affecting the traditionally strong PV markets. International photovoltaic companies are challenged by a changing market situation: all of a sudden, competition has increased significantly, pushing the customer to the fore. As a result, a consolidation process is expected within the PV industry worldwide. However, the story is not all negative. In the U.S., the election of Barack Obama may be seen as the starting signal for a massive expansion in PV, likely to bring the country to first place globally within the next five years. Furthermore, different markets and market segments are being opened up - especially in Europe - thanks to the gradual arrival of generation parity and new PV support mechanisms. EuPD Research has observed and studied international PV markets since its foundation. The information included in the presentation is based on a wide range of quantitative and qualitative studies that EuPD Research has conducted in the key markets since 2002. Florian Schmidt, EuPD Research's Head of Product Management, will give an overview of the global PV market and how it is developing in this crucial year 2009. Aspects such as technology development, production capacities and the demand side will be included, with a special emphasis on the European PV markets. So far Chinese PV companies have often benefited from the booming PV markets in Europe, above all Germany and Spain. Due to the lack of domestic market, the Chinese industry strongly depends on the export and is
Energy Technology Data Exchange (ETDEWEB)
NONE
2010-07-01
Within the 5th European PV-hybrid and mini-grid conference 29th and 30th April, 2010 in Tarragona (Spain) the following lectures were held: (1) Overview of IEA PVPS Task 11 PV-hybrid systems within mini grids; (2) Photovoltaic revolution for deployment in developing countries; (3) Legal and financial conditions for the sustainable operation of mini-grids; (4) EU instruments to promote renewable energies in developing countries; (5) PV hybridization of diesel electricity generators: Conditions of profitability and examples in differential power and storage size ranges; (6) Education suit of designing PV hybrid systems; (7) Sustainable renewable energy projects for intelligent rural electrification in Laos, Cambodia and Vietnam; (8) Techno-economic feasibility of energy supply of remote villages in Palestine by PV systems, diesel generators and electric grid (Case studies: Emnazeil and Atouf villages); (9) Technical, economical and sustainability considerations of a solar PV mini grid as a tool for rural electrification in Uganda; (10) Can we rate inverters for rural electrification on the basis of energy efficiency?; (11) Test procedures for MPPT charge controllers characterization; (12) Energy storage for mini-grid stabilization; (13) Redox flow batteries - Already an alternative storage solution for hybrid PV mini-grids?; (14) Control methods for PV hybrid mini-grids; (15) Partial AC-coupling in mini-grids; (15) Normative issues of small wind turbines in PV hybrid systems; (16) Communication solutions for PV hybrid systems; (17) Towards flexible control and communication of mini-grids; (18) PV/methanol fuel cell hybrid system for powering a highway security variable message board; (19) Polygeneration smartgrids: A solution for the supply of electricity, potable water and hydrogen as fuel for transportation in remote Areas; (20) Implementation of the Bronsbergen micro grid using FACDS; (21) A revisited approach for the design of PV wind hybrid systems; (22
Directory of Open Access Journals (Sweden)
Isabela Galarda Varassin
2012-03-01
Full Text Available A atividade dos polinizadores é afetada pela disponibilidade de recursos. Flores que produzem mais néctar podem ser mais visitadas e assim apresentar maior produção de frutos. O efeito da produção de néctar na atividade dos polinizadores foi testado em duas espécies cultivadas de maracujá, Passiflora alata Curtis e Passiflora edulis Sims, em Morretes, Paraná. Botões foram ensacados e o néctar acumulado das flores foi coletado em intervalos de 1 h. Em P. alata o volume e a concentração de solutos no néctar aumentaram durante o período de antese, associados com o aumento da temperatura. Em P. edulis, o volume aumentou durante o período diurno da antese, e decresceu após as 18 horas. A concentração de solutos no néctar permaneceu constante. A taxa média de visitação de Xylocopa frontalis (Olivier em P. alata foi de 1,7 visitas/100flores/hora e em P. edulis foi de 6,6 visitas/100flores/hora, sendo constante durante a antese. A taxa média de visitação de Bombus morio (Swederus em P. alata foi de 5,8 visitas/100flores/hora, sendo mais alta no início da antese. A constância das visitas de X. frontalis deve estar associada à produção contínua de néctar em ambas as espécies de maracujazeiros. Como as espécies são xenogâmicas, a manutenção das visitas é importante para propiciar o fluxo de pólen entre indivíduos e assim garantir boa produção de frutos.Pollinator activity is affected by resource availability. Flowers that produce more nectar are visited more, which results in a greater fruit set. The effect of nectar production on pollinator activity was tested in two cultivated species of passion fruit, Passiflora alata Curtis and Passiflora edulis Sims, in Morretes, Paraná. Flower buds were bagged and the accumulated nectar of flowers was collected hourly. The volume and concentration of nectar of P. alata increased during anthesis, which was associated with rising temperatures. The volume of nectar of P
SunShot 2030 for Photovoltaics (PV): Envisioning a Low-Cost PV Future
Energy Technology Data Exchange (ETDEWEB)
Cole, Wesley J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zuboy, Jarrett; Woodhouse, Michael A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-10-01
This presentation summarizes the findings from the report 'SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future.' This presentation was given as a webinar on September 26, 2017.
Economic PV - a shift in thinking
International Nuclear Information System (INIS)
Maycock, P.
1999-01-01
This article argues that photovoltaic (PV) technology is already economically viable contrary to current opinion. A table of world PV module shipments for 1990 to 1998 by market sector is presented, and use of PV modules in consumer electronics such as calculators, battery trickle chargers, and garden lights; in communications and signals (eg. microwave repeaters, cellular communication); and in the residential sector in fluorescent lights, radios etc. are discussed. The early adopters of PV technology, and the value placed on PV devices by consumers are considered. Details of PV manufacturing costs for 1997, and forecasts for 2000 and 2010 are tabulated
PV module mounting method and mounting assembly
Lenox, Carl J.S.; Johnson, Kurt M.
2013-04-23
A method for mounting PV modules to a deck includes selecting PV module layout pattern so that adjacent PV module edges are spaced apart. PV mounting and support assemblies are secured to the deck according to the layout pattern using fasteners extending into the deck. The PV modules are placed on the PV mounting and support assemblies. Retaining elements are located over and secured against the upper peripheral edge surfaces of the PV modules so to secure them to the deck with the peripheral edges of the PV modules spaced apart from the deck. In some examples a PV module mounting assembly, for use on a shingled deck, comprises flashing, a base mountable on the flashing, a deck-penetrating fastener engageable with the base and securable to the deck so to secure the flashing and the base to the shingled deck, and PV module mounting hardware securable to the base.
2010-07-01
... and Pseudomonas syringae pv. tomato specific Bacteriophages. 180.1261 Section 180.1261 Protection of.... vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages. An exemption from the requirement of... syringae pv. tomato specific bacteriophages in or on pepper and tomato. [74 FR 26536, June 3, 2009] ...
Numerical study of PV/T-SAHP system
Institute of Scientific and Technical Information of China (English)
Gang PEI; Jie JI; Ke-liang LIU; Han-feng HE; Ai-guo JIANG
2008-01-01
In order to utilize solar energy effectively and to achieve a higher electrical efficiency by limiting the operating temperature of the photovoltaic (PV) panel, a novel photovoltaic/thermal solar-assisted heat pump (PV/T-SAHP) system was proposed and constructed. The hybrid solar system generates electricity and thermal energy simultaneously. A distributed parameters model of the PV/T-SAHP system was developed and applied to analyze the system dynamic performance in terms of PV action, photothermal action and Rankine cycle processes. The simulation results indicated that the coefficient of performance (COP) of the proposed PV/T-SAHP can be much better than that of the conventional heat pump. Both PV-efficiency and photothermic efficiency have been improved considerably. The results also showed that the performance of this PV/T-SAHP system was strongly influenced by the evaporator area, tube pitch and tilt angle of the PV/T evaporator, which are the key factors in PV/T-SAHP system optimization and PV/T evaporator design.
Design optimization of grid-connected PV inverters
DEFF Research Database (Denmark)
Koutroulis, Eftichios; Blaabjerg, Frede
2011-01-01
The DC/AC inverters are the key elements in grid-connected PV energy production systems. In this paper, new design optimization techniques focused on transformerless (very high efficiency) PV inverters are proposed. They have been developed based on an analysis of the deficiencies of the current......, state-of-the-art PV inverters design technology, which limits the amount of PV energy supplied into the electric grid. The influences of the electric grid regulations and standards and the PV array operational characteristics on the design of grid-connected PV inverters have also been considered....... The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy injected into the electric grid by the optimized PV installation....
A case study of utility PV economics
International Nuclear Information System (INIS)
Wenger, H.; Hoff, T.; Osborn, D.E.
1997-01-01
This paper presents selected results from a detailed study of grid-connected photovoltaic (PV) applications within the service area of the Sacramento Municipal Utility District. The intent is to better understand the economics and markets for grid-connected PV systems in a utility setting. Research results include: Benefits calculations for utility-owned PV systems at transmission and distribution voltages; How the QuickScreen software package can help utilities investigate the viability of distributed PV; Energy production and capacity credit estimates for fixed and tracking PV systems; Economics and rate impacts of net metering residential PV systems; Market potential estimates for residential rooftop PV systems; and Viability and timing of grid-connected PV commercialization paths
Solar PV. Innovators talking; Zon PV. Innovators aan het woord
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-02-15
Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.
Solar PV. Innovators talking; Zon PV. Innovators aan het woord
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-02-15
Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.
Firefighter Safety for PV Systems
DEFF Research Database (Denmark)
Mathe, Laszlo; Sera, Dezso; Spataru, Sergiu
2015-01-01
An important and highly discussed safety issue for photovoltaic (PV) systems is that as long as the PV panels are illuminated, a high voltage is present at the PV string terminals and cables between the string and inverters that is independent of the state of the inverter's dc disconnection switch...
Karosekali, Relly
2012-01-01
Identification Caused of Wilt Disease on Passion Fruit (Passiflora edutis simm) in some Main area at Karo regency. Fusarium wilt disease is a main constraint in passion fruit productivity that spread in Indonesia, especially in some main area at Karo Regency, Nort Sumatera. Attacking of wilt disease caused plant died. Therefore, the interest of farmer to study about plantation of passion fruit is be lessen. The objectives of this research were : (1) to find out some fusarium species that caus...
MORFOANATOMÍA DE LAS GLÁNDULAS EN CUATRO ESPECIES DE PASSIFLORA L. (PASSIFLORACEAE) DE VENEZUELA
JÁUREGUI DAMELIS; GARCÍA MARINA; PÉREZ DELIS
2002-01-01
Se estudió la morfoanatomía de las glándulas secretoras presentes en cuatro especiesde Passiflora: P. foetida var. moritziana, P. oerstedii, P. suberosa y P. tuberosacon el fin de aportar información de valor diagnóstico como apoyo a la sistemáticadel género. Las muestras foliares se procesaron siguiendo técnicas convencionalesusadas tanto para microscopía óptica como para microscopía electrónica de barrido.Los resultados revelan diferencias notorias entre las cuatro especies, en lo referente...
Grid integrated distributed PV (GridPV).
Energy Technology Data Exchange (ETDEWEB)
Reno, Matthew J.; Coogan, Kyle
2013-08-01
This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functions are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in the OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function in the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.
PV/T slates - Pilot project in Steinhausen; PV/T-Schiefer. Pilotprojekt Steinhausen
Energy Technology Data Exchange (ETDEWEB)
Kropf, S.
2003-07-01
This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with a ventilated PV-tile system (PV/T-Slates) mounted on a garden shed in Steinhausen, Switzerland. The installation provides power and heat to the main house. The report describes the construction and operation of this pilot project and the results of measurements made on its electrical and thermal performance. The results of measurements made are presented in detail in graphical form and compared with the results of simulation. Suggestions are made for the optimisation of the system. Figures are presented on energy production and energy flows in graphical form.
Photovoltaics: PV takes off the UK
International Nuclear Information System (INIS)
Noble, Ray; Gregory, Jenny
2000-01-01
Despite historical ups and downs, there is still ambition to bring increasingly efficient photovoltaic (PV) systems to the market. PV for major remote telecommunications systems is now an established part of the market, many mobile phone systems are powered by PV and there is potential for increased use of home solar systems, especially in developing countries. Over the past few years, building-integrated PV (BIPV) has been on the increase. In 1999, global production from PV exceeded 200 MW and the UK installed capacity was greater than 1 MW. BIPV is a fast growing market and its characteristics and advantages are discussed. PV installations at Nottingham University, Greenwich Pavilion, BP Amoco Sunbury, Baglan Bay, BP filling stations, and Sainsbury's are described
Aman, Urooj; Subhan, Fazal; Shahid, Muhammad; Akbar, Shehla; Ahmad, Nisar; Ali, Gowhar; Fawad, Khwaja; Sewell, Robert D E
2016-02-24
Passiflora incarnata is widely used as an anxiolytic and sedative due to its putative GABAergic properties. Passiflora incarnata L. methanolic extract (PI-ME) was evaluated in an animal model of streptozotocin-induced diabetic neuropathic allodynia and vulvodynia in rats along with antinociceptive, anxiolytic and sedative activities in mice in order to examine possible underlying mechanisms. PI-ME was tested preliminary for qualitative phytochemical analysis and then quantitatively by proximate and GC-MS analysis. The antinociceptive property was evaluated using the abdominal constriction assay and hot plate test. The anxiolytic activity was performed in a stair case model and sedative activity in an open field test. The antagonistic activities were evaluated using naloxone and/or pentylenetetrazole (PTZ). PI-ME was evaluated for prospective anti-allodynic and anti-vulvodynic properties in a rat model of streptozotocin induced neuropathic pain using the static and dynamic testing paradigms of mechanical allodynia and vulvodynia. GC-MS analysis revealed that PI-ME contained predominant quantities of oleamide (9-octadecenamide), palmitic acid (hexadecanoic acid) and 3-hydroxy-dodecanoic acid, among other active constituents. In the abdominal constriction assay and hot plate test, PI-ME produced dose dependant, naloxone and pentylenetetrazole reversible antinociception suggesting an involvement of opioidergic and GABAergic mechanisms. In the stair case test, PI-ME at 200 mg/kg increased the number of steps climbed while at 600 mg/kg a significant decrease was observed. The rearing incidence was diminished by PI-ME at all tested doses and in the open field test, PI-ME decreased locomotor activity to an extent that was analagous to diazepam. The effects of PI-ME were antagonized by PTZ in both the staircase and open field tests implicating GABAergic mechanisms in its anxiolytic and sedative activities. In the streptozotocin-induced neuropathic nociceptive model, PI
Energy Technology Data Exchange (ETDEWEB)
Stettler, S.; Toggweiler, P. [Enecolo AG, Moenchaltorf (Switzerland); Ruoss, D.; Schudel, P. [Envision, Lucerne (Switzerland); Kottmann, A.; Steinle, F. [BE Netz AG, Lucerne (Switzerland)
2008-03-15
This final report elaborated for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a project carried out to determine the costs for facility management, to estimate future cost development and to propose activities for the further reduction of the operation and maintenance costs of photovoltaic systems. Information on the cost situation was collected by literature study, as well as in interviews and surveys with photovoltaic (PV) experts and the owners of PV installations. The discussion of the results at a workshop with about 20 Swiss PV experts is noted. The results are presented and discussed. These show that operating costs per kWh decrease with the size of the PV system. Figures are quoted. The major part of the costs are quoted as being those for spare parts, especially for the inverter. The authors are of the opinion that, in future, costs for facility management will further decrease, as they are partly linked to capital and insurance costs. Potential for optimisation is said to exist in several areas of facility management such as, for example, in system monitoring and fast reaction in the case of malfunctions.
Optimization of PV-based energy production by dynamic PV-panel/inverter configuration
DEFF Research Database (Denmark)
Paasch, Kasper; Nymand, Morten; Haase, Frerk
This paper investigates the possible increase in annual energy production of a PV system with more than one MPPT (maximum power point tracker) input channels under Nordic illumination conditions, in case a concept of dynamic switching of the PV panels is used at the inputs of the inverters....
PV integration into a CSP plant
Carvajal, Javier López; Barea, Jose M.; Barragan, Jose; Ortega, Carlos
2017-06-01
This paper describes a preliminary techno-economic analysis of the integration of a PV plant into an optimized Parabolic Trough Plant in order to reduce the online consumptions and thus, increase the net electricity injected into the grid. The idea is to assess the feasibility of such project and see what configuration would be the optimal. An extra effort has been made in terms of modelling as the analysis has to be done to the integrated CSP + PV plant instead of analyzing them independently. Two different technologies have been considered for the PV plant, fix and one-axis tracking. Additionally three different scenarios have been considered for the CSP plant auxiliary consumptions as they are essential for determining the optimal PV plant (the higher the auxiliary consumption the higher the optimal PV plant). As could be expected, the results for all cases with PV show an improvement in terms of electricity generation and also in terms of LCOE with respect to the CSP plant. Such improvement is slightly higher with tracking technology for this specific study. Although this exercise has been done to an already designed CSP plant (so only the PV plant had to be optimized), the methodology could be applied for the optimization of an integrated CSP + PV plant during the design phase.
Energy Technology Data Exchange (ETDEWEB)
Decker, B.; Grimmig, B.; Mencke, D. [Institut fuer Solarenergieforschung GmbH Hameln/Emmerthal (ISFH), Emmerthal (Germany). Gruppe Photovoltaik-Systeme; Stellbogen, D. [Zentrum fuer Sonnenenergie- und Wasserstoff-Forschung Baden-Wuerttemberg (ZSW), Stuttgart (Germany). Fachgebiet Photovoltaische Anlagentechnik
1998-02-01
PV facades can provide several additional functions such as weather protection, thermal insulation, daylighting or sun protection. On the other hand, specific operating conditions for PV facades must be taken into account when selecting components and designing the system. Depending on ventilation conditions, there is a large range of maximum module temperatures. South-oriented PV facades receive about 30% less yearly irradiation than an optimally inclined PV generator, hence reflection losses are approximately 4% higher. The maximum of yearly irradiation lies only in the 400-600 W/m{sup 2} range. Surrounding buildings and/or vegetation can impair performance of the PV-facades. For a south-oriented PV facade an annual yield in the range of 470-560 kwh/kW{sub p}.a has been prodicted which was verified by operating results of eight PV facades. (orig.) [Deutsch] Photovoltaik (PV) Fassaden ermoeglichen neben der Stromerzeugung zusaetzliche Funktionen wie Wetterschutz bzw. Waermedaemmung des Gebaeudes oder Tageslichtnutzung bzw. Sonnenschutz der Innenraeume. Allerdings muessen fassadenspezifische Betriebsbedingungen, bei der Komponentenauswahl und Systemauslegung beruecksichtigt werden. Unterschiedliche Hinterlueftungsbedingungen fuehren zu einer grossen Bandbreite der maximalen Modultemperatur. PV-Suedfassaden empfangen etwa 30% weniger Jahreseinstrahlung als ein optimal geneigter PV-Generator. Die Haelfte der jaehrlichen Einstrahlung trifft mit Einfallswinkeln groesser 50 auf die vertikal angeordneten Module wodurch die Reflexionsverluste um ca. 4% hoeher sind. Das Maximum der Jahreseinstrahlung liegt nur um 400-600 W/m{sup 2} und erreicht selten Werte ueber 800 W/m{sup 2}. Umliegende Gebaeude oder Vegetation koennen zu Teilabschattungen des Generators fuehren. Fuer eine vertikale PV-Suedfassade wird ein Jahresenergieertrag in Hoehe von 470-560 kWh/kW{sub p}.a prognostiziert, der anhand der Betriebsergebnisse von acht PV-Fassadenanlagen verifiziert werden konnte
Dissolution test of herbal medicines containing Passiflora sp.
Directory of Open Access Journals (Sweden)
Ane R. T. Costa
2011-05-01
Full Text Available The dissolution test is an essential tool to assess the quality of herbal medicines in the solid dosage form for oral use. This work aimed to evaluate the dissolution behavior of three herbal medicines in the form of capsules and tablet containing Passiflora, produced with powder or dried extract. Assay of total flavonoids and dissolution methods were validated and obtained results allowed the quantification of flavonoids with precision, accuracy and selectivity. The percentage of total flavonoids found was 2% for capsule A (containing only powder, 0.97% for capsule B (containing only dried extract and 5.5% for tablet. Although the content was lower, the release of flavonoids present in the capsule containing dried extract was 12% higher over 30 min, with dissolved percentage values of 87 and 75, for the capsules containing extract and powder, respectively. The tablet containing dried extract presented dissolution of 76%, despite the higher content of flavonoids, which may be due to pharmacotechnical problems. Obtained data demonstrated the need to implement these tests in the quality control of herbal medicines, confirming the release of the active ingredients that underlie the pharmacological action of these medicines.
Argentieri, Maria Pia; Levi, Marisa; Guzzo, Flavia; Avato, Pinarosa
2015-11-01
The paper describes the flavonoid composition of the aerial parts (young leaves, YL; adult leaves, AL; stems, ST) of Passiflora loefgrenii Vitta, a rare species native to Brazil, where it is traditionally used as food. Antioxidant potential has also been evaluated. To the best of our knowledge, no phytochemical and biological study on this species has been reported previously. Compositional data have been acquired combining HPLC-diode array detector (DAD) and Electrospary ionization-tandem mass spectrometry (ESI-MS/MS) analyses. Antioxidant activity has been evaluated by the 2,2'-di-phenyl-1-picrylhydrazyl method. Glycosylated flavones, with luteolin as the main aglycone, can be regarded as biomarkers for this drug. Qualitative composition of the extracts from YL, AL and ST was similar. The bulk of the constituents was made up by 8-C-ß-glucosyl luteolin (orientin), 7-O-α-rhamnosyl-6-C-ß-glucosyl luteolin and 6-C-α-rhamnosyl luteolin, which totally amounted to 16.57 (73%), 10.77 (74%) and 5.07 (77%) μg/mg in YL, AL and ST, respectively. P. loefgrenii showed a good antioxidant activity (IC50 of 350 μg/ml), higher than generally reported for other passifloras. P. loefgrenii, rich in luteolin glycosides, can be regarded as a good candidate to be explored for therapeutic properties other than the sedative one since it represents a rich source of valuable flavonoids with antioxidant potential. © 2015 Royal Pharmaceutical Society.
The case for better PV forecasting
DEFF Research Database (Denmark)
Alet, Pierre-Jean; Efthymiou, Venizelos; Graditi, Giorgio
2016-01-01
Rising levels of PV penetration mean increasingly sophisticated forecasting technologies are needed to maintain grid stability and maximise the economic value of PV systems. The Grid Integration working group of the European Technology and Innovation Platform – Photovoltaics (ETIP PV) shares the ...
Directory of Open Access Journals (Sweden)
Miguel de Simón-Martín
2017-06-01
Full Text Available It is well known that working photovoltaic (PV plants show several maintenance needs due to wiring and module degradation, mismatches, dust, and PV cell defects and faults. There are a wide range of theoretical studies as well as some laboratory tests that show how these circumstances may affect the PV production. Thus, it is mandatory to evaluate the whole PV plant performance and, then, its payback time, profitability, and environmental impact or carbon footprint. However, very few studies include a systematic procedure to quantify and supervise the real degradation effects and fault impacts on the field. In this paper, the authors first conducted a brief review of the most frequent PV faults and the degradation that can be found under real conditions of operation of PV plants. Then, they proposed and developed an innovative Geographic Information System (GIS application to locate and supervise them. The designed tool was applied to both a large PV plant of 108 kWp and a small PV plant of 9 kWp installed on a home rooftop. For the large PV plant, 24 strings of PV modules were modelized and introduced into the GIS application and every module in the power plant was studied including voltage, current, power, series and parallel resistances, fill factor, normalized PV curve to standard test conditions (STC, thermography and visual analysis. For the small PV installation three strings of PV panels were studied identically. It must be noted that PV modules in this case included power optimizers. The precision of the study enabled the researchers to locate and supervise up to a third part of every PV cell in the system, which can be adequately georeferenced. The developed tool allows both the researchers and the investors to increase control of the PV plant performance, to lead to better planning of maintenance actuations, and to evaluate several PV module replacement strategies in a preventive maintenance program. The PV faults found include hot
Adiabatic Rearrangement of Hollow PV Towers
Directory of Open Access Journals (Sweden)
Eric A Hendricks
2010-10-01
Full Text Available Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV. This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with significant vortex structural and intensity change. The three-dimensional adiabatic rearrangements of two prototypical hurricane-like hollow PV towers (one thick and one thin are examined in an idealized framework. For both hollow towers, dynamic instability causes air parcels with high PV to be mixed into the eye preferentially at lower levels, where unstable PV wave growth rates are the largest. Little or no mixing is found to occur at upper levels. The mixing at lower and middle levels is most rapid for the breakdown of the thin hollow tower, consistent with previous barotropic results. For both hollow towers, this advective rearrangement of PV affects the tropical cyclone structure and intensity in a number of ways. First, the minimum central pressure and maximum azimuthal mean velocity simultaneously decrease, consistent with previous barotropic results. Secondly, isosurfaces of absolute angular momentum preferentially shift inward at low levels, implying an adiabatic mechanism by which hurricane eyewall tilt can form. Thirdly, a PV bridge, similar to that previously found in full-physics hurricane simulations, develops as a result of mixing at the isentropic levels where unstable PV waves grow most rapidly. Finally, the balanced mass field resulting from the PV rearrangement is warmer in the eye between 900 and 700 hPa. The location of this warming is consistent with observed warm anomalies in the eye, indicating that in certain instances the hurricane
Directory of Open Access Journals (Sweden)
Peng Xu
2015-11-01
Full Text Available Photovoltaic (PV semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the overall field system involved 15 stand-alone PV panels and 15 retrofitted PV/T panels. The laboratory testing results demonstrated the PV/T panel could achieve the electrical efficiency of about 16.8% (relatively 5% improvement comparing with the stand-alone PV panel, and yield an extra amount of heat with thermal efficiency of nearly 65%. The field testing results indicated that the hybrid PV/T panel could enhance the electrical return of PV panels by nearly 3.5%, and increase the overall energy output by nearly 324.3%. Further opportunities and challenges were then discussed from aspects of different PV/T stakeholders to accelerate the development. It is expected that such technology could become a significant solution to yield more electricity, offset heating load freely and reduce carbon footprint in contemporary energy environment.
The market for photovoltaic (PV) technology
International Nuclear Information System (INIS)
Frantzis, L.; Vejtasa, K.M.
1993-01-01
This paper describes a study that was intended to provide the Electric Power Research Institute (EPRI) with a market analysis for photovoltaic (PV) technologies under development by EPRI and others. The analysis was to focus on markets and factors leading to significant incremental growth for PV demand, large enough to support more efficient scale PV manufacturing capacity. EPRI anticipates that PV ultimately could provide grid-connected power, however, the 1995--2010 market dynamics are uncertain. The specific objectives of this study, therefore, were to: determine what major future domestic US markets for PV technologies will emerge and provide enough volume to support significant improvements in manufacturing costs through manufacturing economies of scale; provide insight on what is needed to gain acceptance of PV technologies for electric power generation in those major markets; provide insight on when investments in demonstration and manufacturing facilities should be made and what is needed to be successful in each element of the business that these markets could support (e.g., technology development, manufacturing, sales, installation, and service); and provide key insights on the requirements for commercial success of PV in the utility sector
Experimental investigation of PV modules recycling; PV module recycle no jikkenteki kento
Energy Technology Data Exchange (ETDEWEB)
Unagida, H; Kurokawa, K [Tokyo University of Agriculture and Technology, Tokyo (Japan); Sakuta, K; Otani, K; Murata, K [Electrotechnical Laboratory, Tsukuba (Japan)
1997-11-25
Recycling, cost/energy analysis and recovery experiment were made on crystalline silicon PV modules with EVA(ethylene vinyl acetate)-laminated structure. The life of modules is dependent not on performance deterioration of PV cells themselves but on yellowing or poor transmittance of EVA caused by ultraviolet ray, and disconnection between cells by thermal stress. Recovery is carried out in 3 stages of cell, wafer and material. Recovery in the stages of cell and wafer results in considerable reduction of energy and cost. The recovery experiment was carried out using PV module samples prepared by cutting the modules into 25times15mm pieces after removing Al frames from the used modules, peeling back sheets and cutting off EVA. Since a nitric acid process at 70-80degC can dissolve EVA effectively, it is promising for reuse of surface glass and PV cells as they are. This process is also carried out under a condition around room temperature and pressure, contributing to cost reduction and energy saving for recycling. Generation of harmful NOx is only a problem to be solved. 2 refs., 6 figs., 1 tab.
A Practical Irradiance Model for Bifacial PV Modules
Energy Technology Data Exchange (ETDEWEB)
Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford
2017-06-21
A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using ray tracing software.
Power of design - the future of building-integrated PV
International Nuclear Information System (INIS)
Abbate, Cinzia
2001-01-01
This paper discusses strategies to make building integrated photovoltaic (PV) systems more acceptable and to allow PV material to compete with conventional construction material. The history of developments in building integration and difficulties encountered by architects wishing to use PV products are explored, and the Dutch Amersfoot project in Utrecht involving a new suburb of 501 house covered with PV panels is described. Questions raised regarding architectural integration of PV systems, and PV systems and the construction market are discussed. The Italian PV programme, financial and political constraints, and the positioning of PV on existing structures are reported
PSCAD Modules Representing PV Generator
Energy Technology Data Exchange (ETDEWEB)
Muljadi, E.; Singh, M.; Gevorgian, V.
2013-08-01
Photovoltaic power plants (PVPs) have been growing in size, and the installation time is very short. With the cost of photovoltaic (PV) panels dropping in recent years, it can be predicted that in the next 10 years the contribution of PVPs to the total number of renewable energy power plants will grow significantly. In this project, the National Renewable Energy Laboratory (NREL) developed a dynamic modeling of the modules to be used as building blocks to develop simulation models of single PV arrays, expanded to include Maximum Power Point Tracker (MPPT), expanded to include PV inverter, or expanded to cover an entire PVP. The focus of the investigation and complexity of the simulation determines the components that must be included in the simulation. The development of the PV inverter was covered in detail, including the control diagrams. Both the current-regulated voltage source inverter and the current-regulated current source inverter were developed in PSCAD. Various operations of the PV inverters were simulated under normal and abnormal conditions. Symmetrical and unsymmetrical faults were simulated, presented, and discussed. Both the three-phase analysis and the symmetrical component analysis were included to clarify the understanding of unsymmetrical faults. The dynamic model validation was based on the testing data provided by SCE. Testing was conducted at SCE with the focus on the grid interface behavior of the PV inverter under different faults and disturbances. The dynamic model validation covers both the symmetrical and unsymmetrical faults.
Energy Technology Data Exchange (ETDEWEB)
Stich, C.; Becker, G.; Zehner, M. [Fachhochschule Muenchen (Germany). Fachbereich Elektrotechnik; Giesler, B. [Shell Solar GmbH, Muenchen (Germany); Weber, W.; Flade, F. [Solarenergiefoerderverein Bayern e.V., Muenchen (Germany)
2003-07-01
OnToPV is the project of an online tour guide through the PV-plant of the new Munich trade fair. The first focs was to provide an interactive circuit of a PV-plant. Within a virtual tour different areas of the plant should be made accessible over the internet. For this purpose a three-dimensional, multimedia guidance was developed for the PV-plant of the new Munich trade fair with informative diagrams, *.pdf-files and retrievable video-files. In such a way interested internet-users could experience with minimum system requirements, local- and time-independently the PV-plant in its structure and components and could receive different background informations in addition. From the view of the plant operators such an internet project serves on the one hand as an additional source of information where questions could be referred to and on the other hand as sort of advertisement for the technology and the PV-system. In addition the attractiveness of the internet appearance of the plant operator rises and the public awareness of such projects could increase. Seen from the user perspective - such an internet project gives private or business users the possibility to inform themselves interactively, purposefully and with the possibility to move through the plant on their own. Users could utilize the guidance through the plant without overcoming far geographical distances, saving time and money. Perhaps this source of information helps awaking a larger consciousness for renewable energies. The result OnToPV showed the various possibilities offered by projects of this kind in the internet. Ideas of possible extensions as for example the integration of current PV-plant operational data or of a virtual learning platform illustrate the perspectives of the project. Virtual guidance of this kind for various types of power plants are conceivable. (orig.)
PV monitoring at Jubilee Campus - Nottingham University
Energy Technology Data Exchange (ETDEWEB)
Riffat, S.B.; Gan, G.
2002-07-01
This report summarises the results of a project monitoring the efficiency of photovoltaic (PV) modules integrated in the roofs of atria to meet the energy consumption needs of ventilation fans in the academic buildings at the Jubilee Campus of the University of Nottingham. Details are given of the instrumentation of one atrium to allow the monitoring the effectiveness of the ventilation in cooling the PV arrays integrated in the atrium roof, the economic analysis of the benefit of cooling the PV system, and the use of computational fluid dynamics (CFD) modelling to predict the performance of the atrium. The design of the PV system, the calculated system efficiency, the high cost of atrium integrated PV power supplies, the periodic failure of the inverters, and the overheating of the PV array and the atrium space in the summer are discussed.
PV-DSM: Policy actions to speed commercialization
International Nuclear Information System (INIS)
Hoff, T.; Wenger, H.J.; Keane, D.M.
1993-01-01
Pacific Gas and Electric Company (PG ampersand E) recently applied Demand-Side Management (DSM) evaluation techniques to photovoltaic (PV) technology to develop the concept of photovoltaics as a Demand-Side Management option (PV-DSM). The analysis demonstrated that PV-DSM has the potential to be economically attractive. Two criticisms in response to that analysis are that the assumptions of 25 year financing and a 25 year evaluation period are unrealistic. This paper responds to those criticisms and documents the mathematical relationships to calculate the value of PV-DSM from a customer's perspective. It demonstrates how regulatory and government agencies could implement policies to resolve both issues and speed PV commercialization
The possibility of developing hybrid PV/T solar system
Dobrnjac, M.; Zivkovic, P.; Babic, V.
2017-05-01
An alternative and cost-effective solution to developing integrated PV system is to use hybrid photovoltaic/thermal (PV/T) solar system. The temperature of PV modules increases due to the absorbed solar radiation that is not converted into electricity, causing a decrease in their efficiency. In hybrid PV/T solar systems the reduction of PV module temperature can be combined with a useful fluid heating. In this paper we present the possibility of developing a new hybrid PV/T solar system. Hybrid PV/T system can provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation. We developed PV/T prototype consisted of commercial PV module and thermal panel with our original solution of aluminium absorber with special geometric shapes. The main advantages of our combined PV/T system are: removing of heat from the PV panel; extending the lifetime of photovoltaic cells; excess of the removing heat from PV part is used to heat the fluid in the thermal part of the panel; the possibility of using on the roof and facade constructions because less weight.
PV Obelisk - Information system with photovoltaics
International Nuclear Information System (INIS)
Ruoss, D.; Rasmussen, J.
2004-01-01
This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed
The new NOZ-PV: Market-oriented
International Nuclear Information System (INIS)
Ter Horst, E.
1995-01-01
In the proposal for the new National Research Program for Photovoltaics (NOZ-PV) 1995-1999 the focus is on four subjects: solar cell technology, the industrial support, the stimulation of autonomous, favorable applications and markets for PV, and the realization of a training program PV in the Built Areas. The program will be carried out as a market-oriented program. 1 tab., 2 figs
Annual technical report. PV domestic field trial
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-07-01
This report describes progress at the first five sites of the UK photovoltaic (PV) domestic field trial. All five sites are generating electricity, but one has not yet been commissioned and two sites are not yet monitoring performance. The BedZED development has roof-mounted PV modules and PV cells installed in sealed double-glazing. Solar slates/tiles have been installed at the Laing Homes development in Montagu Road, where the designer has sought to minimise the visual impact of the PV system on the roofs. At Hunters Moon, PV modules have been retrofitted and some unforeseen difficulties have arisen. PV is an integral part of the roof design at the state-of-the-art low energy development by Integer Houses at Greenfields. Corn Croft uses a British mounting system to facilitate integration of the modules flush with the roof. Installation issues and the progress of the trial are discussed.
PV in a sports arena; PV im Hexenkessel
Energy Technology Data Exchange (ETDEWEB)
Hoeche, B.
2008-05-19
The German soccer club Werder Bremen is reconstructing its stadium. Apart from higher spectator comfort and a better atmosphere, there will also be PV systems on the roof and external walls of the arena. (orig.)
Directory of Open Access Journals (Sweden)
Marc Strasser
2014-01-01
Full Text Available This paper provides evidence that the leaves and stem of Passiflora serratodigitata L. dry crude extract (DCE, ethylacetate fraction (EAF, and residual water fraction show potential antiulcerogenic activity. Interestingly, the polymeric nanocapsule loaded with EAF had 10-fold more activity than the free EAF. Furthermore, the polymer nanoparticles provided homogeneous colloidal drug delivery systems and allowed overcoming challenges such as poor aqueous solubility as well as the physical-chemical instability of the organic extract, which presented 90% (w/w of the flavonoid content. The entrapment efficiency of the total flavonoid was 90.6 ± 2.5% (w/v for the DCE and 79.9 ± 2.7% (w/v for the EAF. This study shows that nanoencapsulation improves both the physicochemical properties and the efficacy of the herbal formulations. Therefore, free and encapsulated extracts have the potential to be suitable drug design candidates for the therapeutic management of ulcer.
The PV market - Past, present, and future
International Nuclear Information System (INIS)
Hammond, B.
1992-01-01
This paper forecasts the photovoltaic (PV) market growth for the 1900's. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market, however, is highly dependent on a number of market factors such as the cost of conventional energy, the cost of PV systems, utility acceptance of PV, and regulatory controls. Government and institutional regulations, environmental issues, OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer, stand-alone, and utility markets. PV has unique attributes which make it a desirable source of energy in specific applications. It is a renewable source of energy, non-polluting, very reliable, predictable, low maintenance, modular, and has a very low operating cost. The energy source (sunlight) is distributed around the globe. Its limitations are high initial cost, no inherent energy storage, and low energy density
Optimal Design of Modern Transformerless PV Inverter Topologies
DEFF Research Database (Denmark)
Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede
2013-01-01
the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inverter design variables are derived for each PV inverter topology and installation site. The H5, H6, neutral point...... clamped, active-neutral point clamped and conergy-NPC PV inverters designed using the proposed optimization process feature lower levelized cost of generated electricity and lifetime cost, longer mean time between failures and inject more PV-generated energy into the electric grid than their nonoptimized......The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during...
Biología floral de Passiflora foetida (Passifloraceae
Directory of Open Access Journals (Sweden)
María T. Amela García
1998-06-01
Full Text Available Un experimento reproductivo muestra que Passiflora foetida es autocompatible. Observaciones de las características florales y de los visitantes durante la antesis, más el análisis del polen transportado, permitieron identificar el síndrome floral (melitofilia y las funciones de cada visitante. La antesis ocurre desde las 6 hasta las 11 hs. Se identificaron 3 fases florales: 1 estigmas por encima de las anteras, 2 estigmas a la altura de las anteras, 3 estigmas por encima de las anteras; los radii, los pétalos y los sépalos se incurvan. Los estigmas están receptivos durante toda la antesis. La concentración de azúcares del néctar es 34 %. El color predominante en el espectro visible es el blanco. En el espectro UV, los estambres y el gineceo contrastan con el limen y el androginóforo; pueden ser una guía de néctar. Tres especies de himenópteros fueron los visitantes más frecuentes y constantes: Ptiloglossa tarsata (Colletidae siempre contactan las anteras y los estigmas cuando liban, transportan un alto porcentaje de polen de P. foetida y visitan flores en fase 1 y 2; pueden ser considerados los principales polinizadores. Pseudaugochloropsis sp. (Halictidae raramente contactan las anteras o los estigmas cuando perforan el limen para acceder al néctar y visitan flores en fase 2 y 3; son ladrones de néctar que raramente polinizan. Augochlorella sp. (Halictidae recolectan polen sin tocar los estigmas y visitan flores en fase 2 y 3; son hurtadores de polen.A reproductive experiment shows that Passiflora foetida is autocompatible. Observations of floral characteristics and visitors during anthesis, plus the analysis of pollen allowed identification of floral syndrome (melittophily and functions for each visitor. Anthesis occurs from 6 to 11 AM. Three floral phases were identified: 1 stigmas above anthers, 2 stigmas at anther level, 3 stigmas above anthers; radii, petals and sepals become incurved. The stigmas are receptive during the
CARACTERÍSTICAS NUTRICIONALES Y ANTIOXIDANTES DE LA FRUTA CURUBA LARGA (Passiflora mollisima Bailey
Directory of Open Access Journals (Sweden)
DIANA CAROLINA CHAPARRO R
Full Text Available La presente revisión muestra el valor nutricional y el impacto para la salud humana del consumo de la fruta curuba larga (Passiflora mollisima Bailey, con base a las características nutricionales y antioxidantes. Pertenece a la familia de las pasifloráceas, es originaria de la zona andina del continente americano y en Colombia se cultiva principalmente en las cordilleras oriental y occidental. Esta fruta es fuente de vitaminas A, C y riboflavina; contiene potasio, fósforo, magnesio, sodio, cloro, hierro; aporta cantidades moderadas de carbohidratos y calóricas. El contenido de fenoles, flavonoides y carotenoides confiere la capacidad de captar radicales libres causantes del estrés oxidativo, éste relacionado con el origen y desarrollo de enfermedades cardiovasculares, neurodegenerativas y el cáncer.
PV-HYBRID and MINI-GRID. Proceedings
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
Within the 3rd European Conference at the Centre de Congres in Aix en Provence (France) between 11th and 12th May, 2006, the following lessons were held: (1) Small electric networks: European drivers and projects for the integration of RES and DG into the electricity grids of the future (Manuel Sanchez-Jimenez); (2) PV hybrid system within mini grids - IEA PVPS programme (Meuch Konraf); (3) Renewables for the developing world (Alvaro Ponce Plaza); (4) Rural electicity supply using photovoltaic / - Diesel hybrid systems: Attractive for investors in the renewable energy sector? (Andreas Hahn); (5) Economic analysis of stand-alone and grid-connected photovoltaic systems under current tariff structure of Taiwan (Yaw-Juen Wang); (6) Using wind-PV-diesel hybrid system for electrification of remote village in Western Libya (N.M. Kreama); (7) Venezuela's renewable energy program for small towns and rural areas ''Sembrando Luz'' (Jorge Torres); (8) AeroSmart5, the professional, sysem-compatible small-scale wind energy converter will be tested in field tests (Fabian Jochem); (9) Lifetime, test procedures and recommendations for optimal operating strategies for lead-acid-batteries in renewable energy systems - A survey on results from European projects from the 5th framework programme (Rudi Kaiser); (10) Prototype of a reversible fuel cell system for autonomous power supplies (Tom Smolinska); (11) Interconnection management in microgrids (Michel Vandenbergh); (12) Control strategy for a small-scale stand-alone power system based on renewable energy and hydrogen (Harald Miland); (13) Standard renewable electricity supply for people in rural areas - mini-grids in western provinces of China (Michael Wollny); (14) The Brava island a ''100% renewable energy'' project (Jean-Christian Marcel); (15) Breakthrough to a new era of PV-hybrid systems with the help of standardised components communication? (Michael Mueller); (16) Standardized
Environmental impact of PV cell waste scenario.
Bogacka, M; Pikoń, K; Landrat, M
2017-12-01
Rapid growth of the volume of waste from PV cells is expected in the following years. The problem of its utilization seems to be the most important issue for future waste management systems. The environmental impacts of the PV recycling scenario are presented in the manuscript. The analysis is based on the LCA approach and the average data available in specialized databases for silicon standard PV cell is used. The functional unit includes parameters like: efficiency, composition, surface area. The discussion on the environmental impact change due to the location of the PV production and waste processing plants is presented in the manuscript. Additionally, the discussion on the environmental effect of substituting different energy resources with PV cells is presented in the manuscript. The analysis of the PV cell life cycle scenario presented in the article was performed using the SIMA PRO software and data from Ecoinvent 3.0 database together with additional data obtained from other sources. Copyright © 2017 Elsevier Ltd. All rights reserved.
Novel laboratory mouse papillomavirus (MusPV) infection.
Ingle, A; Ghim, S; Joh, J; Chepkoech, I; Bennett Jenson, A; Sundberg, J P
2011-03-01
Most papillomaviruses (PVs) are oncogenic. There are at least 100 different human PVs and 65 nonhuman vertebrate hosts, including wild rodents, which have species-specific PV infections. Florid papillomatosis arose in a colony of NMRI-Foxn1(nu)/Foxn1(nu) (nude) mice at the Advanced Centre for Treatment Research and Education in Cancer in India. Lesions appeared at the mucocutaneous junctions of the nose and mouth. Histologically, lesions were classical papillomas with epidermal hyperplasia on thin fibrovascular stalks in a verrucous pattern. Koilocytotic cells were observed in the stratum granulosum of the papillomatous lesions. Immunohistochemically, these abnormal cells were positive for PV group-specific antigens. With transmission electron microscopy, virus particles were observed in crystalline intranuclear inclusions within keratinocytes. The presence of a mouse PV, designated MusPV, was confirmed by amplification of PV DNA with degenerative primers specific for PVs. This report is the first of a PV and its related disease in laboratory mice.
PV Working with Industry, 2nd Quarter, 2000
Energy Technology Data Exchange (ETDEWEB)
Poole, L.; Moon, S.
2000-06-29
NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The Second Quarter, 2000, issue is titled ``Our Shared PV Future''. It contains a review of several important PV-related meetings held in the prior three months: the NCPV Program Review, the 16 European PV Conference, and year-2000 Earth Day activities in Denver, CO. The editorialist is Paul Maycock, Publisher of PV News.
Grid Integrated Distributed PV (GridPV) Version 2.
Energy Technology Data Exchange (ETDEWEB)
Reno, Matthew J.; Coogan, Kyle
2014-12-01
This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functio ns are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in th e OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function i n the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.
Flexible packaging for PV modules
Dhere, Neelkanth G.
2008-08-01
Economic, flexible packages that provide needed level of protection to organic and some other PV cells over >25-years have not yet been developed. However, flexible packaging is essential in niche large-scale applications. Typical configuration used in flexible photovoltaic (PV) module packaging is transparent frontsheet/encapsulant/PV cells/flexible substrate. Besides flexibility of various components, the solder bonds should also be flexible and resistant to fatigue due to cyclic loading. Flexible front sheets should provide optical transparency, mechanical protection, scratch resistance, dielectric isolation, water resistance, UV stability and adhesion to encapsulant. Examples are Tefzel, Tedlar and Silicone. Dirt can get embedded in soft layers such as silicone and obscure light. Water vapor transmittance rate (WVTR) of polymer films used in the food packaging industry as moisture barriers are ~0.05 g/(m2.day) under ambient conditions. In comparison, light emitting diodes employ packaging components that have WVTR of ~10-6 g/(m2.day). WVTR of polymer sheets can be improved by coating them with dense inorganic/organic multilayers. Ethylene vinyl acetate, an amorphous copolymer used predominantly by the PV industry has very high O2 and H2O diffusivity. Quaternary carbon chains (such as acetate) in a polymer lead to cleavage and loss of adhesional strength at relatively low exposures. Reactivity of PV module components increases in presence of O2 and H2O. Adhesional strength degrades due to the breakdown of structure of polymer by reactive, free radicals formed by high-energy radiation. Free radical formation in polymers is reduced when the aromatic rings are attached at regular intervals. This paper will review flexible packaging for PV modules.
Interharmonics from Grid-Connected PV Systems
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso
2017-01-01
As the penetration level of grid-connected Photovoltaic (PV) systems increases, the power quality is one of the major concerns for system operators and the demands are becoming even stricter. The impact of interharmonics on the grid has been acknowledged in recent research when considering a large......-scale adoption of PV inverters. However, the origins of interharmonics remain unclear. Thus, this paper performs tests on a commercial PV inverter to explore interharmonic generation and more important investigates the mechanism of interharmonic emission. The investigation reveals that the perturbation...... of the solutions. Simulation results indicate that the constant-voltage MPPT method is the most suitable solution to the mitigation of interharmonics introduced by the MPPT operation, as it avoids the perturbation in the PV voltage during operation....
Optimal Solar PV Arrays Integration for Distributed Generation
Energy Technology Data Exchange (ETDEWEB)
Omitaomu, Olufemi A [ORNL; Li, Xueping [University of Tennessee, Knoxville (UTK)
2012-01-01
Solar photovoltaic (PV) systems hold great potential for distributed energy generation by installing PV panels on rooftops of residential and commercial buildings. Yet challenges arise along with the variability and non-dispatchability of the PV systems that affect the stability of the grid and the economics of the PV system. This paper investigates the integration of PV arrays for distributed generation applications by identifying a combination of buildings that will maximize solar energy output and minimize system variability. Particularly, we propose mean-variance optimization models to choose suitable rooftops for PV integration based on Markowitz mean-variance portfolio selection model. We further introduce quantity and cardinality constraints to result in a mixed integer quadratic programming problem. Case studies based on real data are presented. An efficient frontier is obtained for sample data that allows decision makers to choose a desired solar energy generation level with a comfortable variability tolerance level. Sensitivity analysis is conducted to show the tradeoffs between solar PV energy generation potential and variability.
Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.
A Practical Irradiance Model for Bifacial PV Modules: Preprint
Energy Technology Data Exchange (ETDEWEB)
Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford
2017-06-15
A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors (CFs) to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using the RADIANCE ray tracing program.
Multifunctional a-Si PV systems
Energy Technology Data Exchange (ETDEWEB)
Peippo, K; Lund, P; Vartiainen, E [Helsinki Univ. of Technology, Otaniemi (Finland). Advanced Energy Systems
1998-10-01
The optimal use of the various forms of solar energy (passive, active, daylighting, photovoltaics) in buildings calls for an optimal integration of the technologies. As energy conservation potential in space heating may soon be exhausted, electricity efficiency and on-site generation will play an increasing role in energy-conscious building design. There, dispersed PV systems integrated into buildings show a significant market potential, due to a number of benefits: no extra land area is required, PV-array may replace conventional cladding materials and become a building element. Moreover, the produced PV-electricity is more valuable for the building owner than for an electric utility
PV installations, protection and the code
Energy Technology Data Exchange (ETDEWEB)
Silecky, L. [Mersen, Toronto, ON (Canada)
2010-12-15
This article discussed the need for improved standards in Ontario's solar industry to ensure safety for the systems and also safety for the workers. Photovoltaic cells used in solar arrays can now deliver between 50 vDC to 600 vDC. The workings of such a high voltage photocell must be understood in order to understand its protection needs. Since PVs are semiconductors and susceptible to damage from short circuits and overloads, a fast-acting overcurrent protective device (OCPD) should be used. Combiner boxes are also needed to provide a clean method of safely connecting all the wires that are needed in the system, including surge protection and a means of isolation between the PV array and the inverter. Section 50 of the Canadian Electrical Code outlines the requirements for solar PV systems, but it does not mention the protection of DC circuits, including DC fuse protectors which are manufactured to provide a high degree of protection for the PV array. As the photovoltaic (PV) market continues to grow in Ontario, the PV industry also has a responsibility to ensure it is in compliance with codes and standards related to photovoltaic systems. This author suggested that Article 690 of the National Electric Code (NEC) is a good document to use when determining the requirements for PV systems. 3 figs.
Experimental grid connected PV system power analysis
Semaoui, Smail; Abdeladim, Kamel; Arab, Amar Hadj; Boulahchich, Saliha; Amrouche, Said Ould; Yassaa, Noureddine
2018-05-01
Almost 80 % of Algerian territory is appropriate for the exploitation of solar energy. The Algerian energetic strategy provides a substantial injection of PV electricity to the national grid. Currently, about 344 MWp of PV arrays which corresponds approximately to 2,34 km2 of module surfaces, are connected on electricity grid over the national territory. The Algerian Northern regions are characterized by strong pollution and high humidity. These phenomena affect the energetic productivity of PV generator. The objective of our study is to analyze experimental grid connected PV system power in coastal locations. Hence, experiments have been conducted on three identical PV systems to determine the electrical performances. Transformer-less inverters are the most attractive for the ground-based photovoltaic (PV) system due to their efficiencies, reduced cost and weight. Besides, the absence of the galvanic isolation generates problems of capacitive leakage current on the AC side and the degradation of the insulation resistance on the DC side of the inverter. In this work, experimental study of the behavior of single-phase inverters without transformers is presented. The main objective of this work is to study the degradation of the insulation resistance at the input of the inverter, and the capacitive leakage current at the output of the inverter. This study was achieved at the CDER on a rainy day of 15/03/2017, on the first PV plant connected to the low voltage network in Algeria. This investigation can help forecasting the PV array energetic production by taking into account natural conditions.
Medina, Sonia; Collado-González, Jacinta; Ferreres, Federico; Londoño-Londoño, Julián; Jiménez-Cartagena, Claudio; Guy, Alexandre; Durand, Thierry; Galano, Jean-Marie; Gil-Izquierdo, Angel
2017-08-15
The genus Passiflora, comprising about 500 species, is the largest in the Passion flower family. Passiflora edulis Sims f. edulis (gulupa) is one of the most important fruits cultivated in Colombia. In recent years and due to its organoleptic and bioactive properties, its exports have significantly increased. In this work, six new bioactive oxylipins -phytoprostanes - were detected in gulupa shell by a UHPLC-QqQ-MS/MS method: F 1t -phytoprostanes and D 1t -phytoprostanes were the predominant and minor classes, respectively. Moreover, the polyphenol profile of the shell was investigated and we were able to detect and quantify phenolic compounds that have not been described previously, like luteolin-8-C-(2-O-rhamnosyl)hexoside and quercetin-3-O-(6″-acetyl)glucosyl-2″-sinapic acid. Consequently, this study provides new insights into the importance of gulupa shell as a valuable option in the design of new beverages rich in antioxidant phytochemicals, as part of a well-balanced diet, and in the process and quality control of such products. Copyright © 2017 Elsevier Ltd. All rights reserved.
China PV Business and Applications Evaluation
Energy Technology Data Exchange (ETDEWEB)
Sherring, Chris (Sherring Energy Associates)
1999-08-30
This report provides an overview of photovoltaics (PV) business and applications in China. Although more than 70 million people in China are without access to grid electricity, many of the unelectrified regions benefit from considerable renewable resources, including good solar insolation. Current annual PV sales are still modest, however, and are estimated to be between 2.0 and 2.5 megawatts. This and other significant PV data, including information regarding the current status of key aspects of Chinese businesses, markets, and distribution channels, are included in the report. Detailed company profiles of Chinese business organizations and summaries of visits made to these companies (as well as to more remote sites in Inner Mongolia to examine PV usage by the end-use customer) in September-October 1998 are also presented.
Robust PV Degradation Methodology and Application
Energy Technology Data Exchange (ETDEWEB)
Jordan, Dirk [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Deline, Christopher A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kimball, Greg [SunPower; Anderson, Mike [SunPower
2017-11-15
The degradation rate plays an important role in predicting and assessing the long-term energy generation of PV systems. Many methods have been proposed for extracting the degradation rate from operational data of PV systems, but most of the published approaches are susceptible to bias due to inverter clipping, module soiling, temporary outages, seasonality, and sensor degradation. In this manuscript, we propose a methodology for determining PV degradation leveraging available modeled clear-sky irradiance data rather than site sensor data, and a robust year-over-year (YOY) rate calculation. We show the method to provide reliable degradation rate estimates even in the case of sensor drift, data shifts, and soiling. Compared with alternate methods, we demonstrate that the proposed method delivers the lowest uncertainty in degradation rate estimates for a fleet of 486 PV systems.
Optimal Design of Modern Transformerless PV Inverter Topologies
Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede
2013-01-01
The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inver...
Solar cell junction temperature measurement of PV module
Huang, B.J.; Yang, P.E.; Lin, Y.P.; Lin, B.Y.; Chen, H.J.; Lai, R.C.; Cheng, J.S.
2011-01-01
The present study develops a simple non-destructive method to measure the solar cell junction temperature of PV module. The PV module was put in the environmental chamber with precise temperature control to keep the solar PV module as well
Photovoltaic (PV) Pricing Trends: Historical, Recent, and Near-Term Projections
Energy Technology Data Exchange (ETDEWEB)
Feldman, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Barbose, Galen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States); Wiser, Ryan [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Darghouth, Naim [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Goodrich, Alan [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2012-11-30
The installed capacity of global and U.S. photovoltaic (PV) systems has soared in recent years, driven by declining PV prices and government incentives. The U.S. Department of Energy’s (DOE) SunShot Initiative aims to make PV cost competitive without incentives by reducing the cost of PV-generated electricity by about 75% between 2010 and 2020. This summary report—based on research at Lawrence Berkeley National Laboratory (LBNL) and the National Renewable Energy Laboratory (NREL)—examines progress in PV price reductions to help DOE and other PV stakeholders manage the transition to a market-driven PV industry, and to provide clarity surrounding the wide variety of potentially conflicting data available about PV system prices.
The Value of Transparency in Distributed Solar PV Markets
Energy Technology Data Exchange (ETDEWEB)
OShaughnessy, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zamzam, Ahmed S [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-12-01
Market transparency refers to the degree of customer awareness of product options and fair market prices for a given good. In The Value of Transparency in Distributed Solar PV Markets, we use residential solar photovoltaic (PV) quote data to study the value of transparency in distributed solar PV markets. We find that improved market transparency results in lower installation offer prices. Further, the results of this study suggest that PV customers benefit from gaining access to more PV quotes.
Optimal design of PV and HP system
DEFF Research Database (Denmark)
Nepper-Rasmussen, Bjarke Christian; Rasmussen, Theis Bo
2015-01-01
Methods of utilizing residential produced photovoltaic (PV) power by converting to thermal energy through heat pumps (HP) are present in literature, where thermal energy is dispersed as either heat or hot water at the instant moment of PV production. In this paper an alternative solution is descr...... that the thermal storage with a BT is a better investment than a PV system without HP or no investment. Furthermore, it showed that the optimization model developed in this project is capable of finding the optimal combination of component sizes based on our data.......Methods of utilizing residential produced photovoltaic (PV) power by converting to thermal energy through heat pumps (HP) are present in literature, where thermal energy is dispersed as either heat or hot water at the instant moment of PV production. In this paper an alternative solution...... is described, where the thermal energy is stored in a buffer tank (BT) capable of dispersing heat to either the heating system of a house or a hot water tank, for later use. The thermal storage solution including a BT can increase the self-consumption of residentially produced PV power and thereby shift...
Learning in PV trends and future prospects
International Nuclear Information System (INIS)
Schaeffer, G.J.; De Moor, H.H.C.
2004-06-01
For large scale application of PV cost reduction is essential. It is shown in this study that the price evolution is on track and even accelerating the last 15 years. Using an experience curve approach a learning rate of little over 20% was found consistent with other studies. As data were collected for small rooftop grid connected systems, it could be shown that this learning rate is not only found for modules, but also for BOS (all costs apart from the modules) in Germany as well as in the Netherlands. Projections of the future price of PV systems show that a learning rate of at least 20% is needed to make introduction of PV affordable. It is very effective to invest in learning, thus increasing the learning rate, as well as developing market segments were the value of PV is higher, such as residential PV systems in southern Europe
PV solar system feasibility study
International Nuclear Information System (INIS)
Ashhab, Moh’d Sami S.; Kaylani, Hazem; Abdallah, Abdallah
2013-01-01
Highlights: ► This research studies the feasibility of PV solar systems. ► The aim is to develop the theory and application of a hybrid system. ► Relevant research topics are reviewed and some of them are discussed in details. ► A prototype of the PV solar system is designed and built. - Abstract: This research studies the feasibility of PV solar systems and aims at developing the theory and application of a hybrid system that utilizes PV solar system and another supporting source of energy to provide affordable heating and air conditioning. Relevant research topics are reviewed and some of them are discussed in details. Solar heating and air conditioning research and technology exist in many developed countries. To date, the used solar energy has been proved to be inefficient. Solar energy is an abundant source of energy in Jordan and the Middle East; with increasing prices of oil this source is becoming more attractive alternative. A good candidate for the other system is absorption. The overall system is designed such that it utilizes solar energy as a main source. When the solar energy becomes insufficient, electricity or diesel source kicks in. A prototype of the PV solar system that operates an air conditioning unit is built and proper measurements are collected through a data logging system. The measured data are plotted and discussed, and conclusions regarding the system performance are extracted.
Data monitoring system for PV solar generators
International Nuclear Information System (INIS)
Stoev, M.; Katerski, A.; Williams, A.
2000-01-01
The two 1.5 kWp photovoltaic (PV) solar generators are installed and the new PC data monitoring system is developed by applying EC standards for European Solar Test Installation (ESTI). The schematic system diagram of PV generator is presented. The recording parameters for analytical and global monitoring are discussed. The meteorological data from ESTI sensors, temperature sensor and electrical data from inverter and calibrated shunt are stored via analog digital converters (ADC) on a hard disk of data storage PC. Data Logger and Monitor software for automatic data acquisition, treatment and visual distance control of all output PV data from PV solar generator has been created
Simulation of Distributed PV Power Output in Oahu Hawaii
Energy Technology Data Exchange (ETDEWEB)
Lave, Matthew Samuel [Sandia National Lab. (SNL-CA), Livermore, CA (United States)
2016-08-01
Distributed solar photovoltaic (PV) power generation in Oahu has grown rapidly since 2008. For applications such as determining the value of energy storage, it is important to have PV power output timeseries. Since these timeseries of not typically measured, here we produce simulated distributed PV power output for Oahu. Simulated power output is based on (a) satellite-derived solar irradiance, (b) PV permit data by neighborhood, and (c) population data by census block. Permit and population data was used to model locations of distributed PV, and irradiance data was then used to simulate power output. PV power output simulations are presented by sub-neighborhood polygons, neighborhoods, and for the whole island of Oahu. Summary plots of annual PV energy and a sample week timeseries of power output are shown, and a the files containing the entire timeseries are described.
Design optimization of transformerless grid-connected PV inverters including reliability
DEFF Research Database (Denmark)
Koutroulis, Eftichios; Blaabjerg, Frede
2012-01-01
Of the Electricity (LCOE) generated during the PV system lifetime period is minimized. The LCOE is calculated also considering the failure rates of the components, which affect the reliability performance and lifetime maintenance cost of the PV inverter. A design example is presented, demonstrating that compared...... to the non-optimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE.......This paper presents a new methodology for optimal design of transformerless Photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal values and types of the PV inverter components are calculated such that the PV inverter Levelized Cost...
Design Optimization of Transformerless Grid-Connected PV Inverters Including Reliability
DEFF Research Database (Denmark)
Koutroulis, Eftichios; Blaabjerg, Frede
2013-01-01
such that the PV inverter LCOE generated during the PV system lifetime period is minimized. The LCOE is also calculated considering the failure rates of the components, which affect the reliability performance and lifetime maintenance cost of the PV inverter. A design example is presented, demonstrating...... that compared to the nonoptimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE.......This paper presents a new methodology for optimal design of transformerless photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal switching frequency as well as the optimal values and types of the PV inverter components is calculated...
Directory of Open Access Journals (Sweden)
Sian Liu
2017-11-01
Full Text Available The passion fruit (Passiflora edulis Sims, also known as the purple granadilla, is widely cultivated as the new darling of the fruit market throughout southern China. This exotic and perennial climber is adapted to warm and humid climates, and thus is generally intolerant of cold. There is limited information about gene regulation and signaling pathways related to the cold stress response in this species. In this study, two transcriptome libraries (KEDU_AP vs. GX_AP were constructed from the aerial parts of cold-tolerant and cold-susceptible varieties of P. edulis, respectively. Overall, 126,284,018 clean reads were obtained, and 86,880 unigenes with a mean size of 1449 bp were assembled. Of these, there were 64,067 (73.74% unigenes with significant similarity to publicly available plant protein sequences. Expression profiles were generated, and 3045 genes were found to be significantly differentially expressed between the KEDU_AP and GX_AP libraries, including 1075 (35.3% up-regulated and 1970 (64.7% down-regulated. These included 36 genes in enriched pathways of plant hormone signal transduction, and 56 genes encoding putative transcription factors. Six genes involved in the ICE1–CBF–COR pathway were induced in the cold-tolerant variety, and their expression levels were further verified using quantitative real-time PCR. This report is the first to identify genes and signaling pathways involved in cold tolerance using high-throughput transcriptome sequencing in P. edulis. These findings may provide useful insights into the molecular mechanisms regulating cold tolerance and genetic breeding in Passiflora spp.
Impedance characterization of PV modules in outdoor conditions
DEFF Research Database (Denmark)
Oprea, Matei-lon; Thorsteinsson, Sune; Spataru, Sergiu
2016-01-01
Impedance spectroscopy (IS) has been used for laboratory characterizations of photovoltaic (PV) technologies under well controlled conditions. This work applies IS for outdoor characterization of PV panels, in order to observe the effect of irradiance (G) and temperature (T) on the PV module’s...
Veldhuis, A.J.; Reinders, Angelina H.M.E.
2014-01-01
We analysed a monitored grid-connected PV system of 34 kWp in Indonesia to investigate the performance of PV systems in tropical climates. The PV system has been installed in Jayapura, the capital of the Province of Papua, Indonesia, by the beginning of 2012. Due to the aged gensets and frequent
Study of bypass diodes configuration on PV modules
Energy Technology Data Exchange (ETDEWEB)
Silvestre, S.; Boronat, A.; Chouder, A. [Electronics Engineering Department - UPC., C/Jordi Girona 1-3, Modul C4 Campus Nord UPC., 08034 Barcelona (Spain)
2009-09-15
A procedure of simulation and modelling solar cells and PV modules, working partially shadowed in Pspice environment, is presented. Simulation results have been contrasted with real measured data from a commercial PV module of 209 Wp from Siliken. Some cases of study are presented as application examples of this simulation methodology, showing its potential on the design of bypass diodes configuration to include in a PV module and also on the study of PV generators working in partial shading conditions. (author)
Latin America as new PV market opportunity
International Nuclear Information System (INIS)
Weiss, Ingrid
2015-01-01
It is important to recognize solar energy as an international and strategic opportunity for the European market to expand. The objective of this paper is to apply the methodology created during the PV Parity project for analyzing PV Competitiveness in the emerging residential PV market in Brazil, using information from the State of Rio de Janeiro. The dynamic competitiveness analysis was performed considering the price with and without taxes in order to assess the year when PV will reach grid parity in Rio de Janeiro and how the taxes impact on the results. Results are divided into 3 scenarios: Optimistic, Conservative, and Conservative Moderate. The LCOE of residential systems will likely become competitive with the residential electricity tariffs between 2020 and 2030, assuming the residential tariffs in Rio de Janeiro. This is an indicator that PV energy business opportunities are increasing in Brazil and, with the adequate policy support, its market competitiveness could be improved. We are also looking in other markets of Latin America. (full text)
Dissipation of heat from building integrated PV
Energy Technology Data Exchange (ETDEWEB)
Taylor, C.M.L.
2001-07-01
The objectives of the project were to investigate methods for improving heat transfer and the reflection of heat from PV modules in building integrated situations and to develop the design of a building integrated PV element with improved heat transfer characteristics, with the aim of reducing the operating temperature of the PV cells. The prototypes developed for improving heat transfer have only shown small reductions in the PV cell operating temperature and these results have not been fully quantified due to problems associated with experimental testing. The improvement in the overall electrical performance of PV modules operating at lower temperatures is consequently even smaller. As a result, none of the prototypes can be considered to be economically viable. Based upon the theoretical and experimental results of this work, it is the recommendation of this project that no further work be conducted in improving BIPV performance through improved heat transfer of BIPV. (Author)
The potential of solar PV in Ontario
International Nuclear Information System (INIS)
McMonagle, R.
2005-01-01
Canada has lagged behind other industrialized nations in the growth of solar energy markets. Currently, over 78 per cent of the global market for solar energy is for grid-connected applications where power is fed into the electrical distribution network. Less than 3.5 per cent of the Canadian solar market is grid-connected. This report investigated the potential size of the photovoltaic (PV) market in Ontario given adequate support from both governments and utilities. The forecast was based on sustainable growth levels that the solar industry as a whole might maintain over an extended period of time. It was suggested that it is technically feasible to install over 3000 MW of PV in single, detached homes in the province, which could generate over 3200 GWh each year. If the right policy conditions were put in place, the technical potential for PV on all buildings in Ontario is over 14,000 MW by 2025, which would generate over 13,000 GWh annually. Support mechanisms such as the Advanced Renewable Tariff (ART) or Standard Offer Contracts (SOC) will enable the PV industry to build capacity. Future markets for PV include new homes, commercial buildings and the existing housing stock. With a properly designed system, it is forecasted that the deployment of PV by 2025 could result in the involvement of 400,000 homes with over 1200 MW of installed capacity and over 290 MW installed annually by 2025. Recommendations to Ontario Power Authority's (OPA) report supply mix report focused on the use of SOCs as the appropriate support mechanism to start building solar capacity in Ontario, as projections using SOCs would see Ontario following the growth patterns of other nations. It was concluded that the OPA report does not acknowledge the current growth rates of PV globally, nor does it fully consider the potential of PV in Ontario. 9 refs., 8 figs
Directory of Open Access Journals (Sweden)
Maria Luiza Zeraik
2012-01-01
Full Text Available The content of isoorientin in passion fruit rinds (Passiflora edulis fo. flavicarpa O. Degener was determined by HPTLC (high performance thin layer chromatography with densitometric analysis. The results revealed a higher amount of isoorientin in healthy rinds of P. edulis (92.275 ± 0.610 mg L-1 than in rinds with typical symptoms of PWV (Passion fruit Woodiness Virus infection (28.931 ± 0.346 mg L-1. The HPTLC data, allied to assays of radical scavenging activity, suggest the potential of P. edulis rinds as a natural source of flavonoids or as a possible functional food.
International Nuclear Information System (INIS)
Slimani, Mohamed El Amine; Amirat, Madjid; Kurucz, Ildikó; Bahria, Sofiane; Hamidat, Abderrahmane; Chaouch, Wafa Braham
2017-01-01
Highlights: • A detailed thermal and electrical model for PV and PV/T systems has been presented. • The developed numerical model was validated successfully with previously published experimental results. • A comparative study between four solar devices (PV and PV/T systems) was carried out. • The experimental weather conditions of Algiers site are used in the numerical model. • The glazed double-pass photovoltaic/thermal air collector shows the best overall energy efficiency. - Abstract: The thermal photovoltaic hybrid collector is a genuine cogeneration technology; it can produce electricity and heat simultaneously. In this paper, a comparative study is presented between four solar device configurations: photovoltaic module (PV-I), conventional hybrid solar air collector (PV/T-II), glazed hybrid solar air collector (PV/T-III) and glazed double-pass hybrid solar air collector (PV/T-IV). A numerical model is developed and validated through experimental results indicated in the previous literature. The numerical model takes the heat balance equations and different thermal and electrical parameters into account for each configuration included in this study, the energy performances are evaluated with a sample weather data of Algiers site. The numerical results show that the daily average of overall energy efficiency reaches: 29.63%, 51.02%, 69.47% and 74% for the first (PV-I), the second (PV/T-II), the third (PV/T-III) and the fourth (PV/T-IV) configurations respectively. These values are obtained with an air flow of 0.023 kg/s and introducing a sample of experimental weather data collected in Algiers site for a sunny day in summer.
Impact of residential PV adoption on Retail Electricity Rates
International Nuclear Information System (INIS)
Cai, Desmond W.H.; Adlakha, Sachin; Low, Steven H.; De Martini, Paul; Mani Chandy, K.
2013-01-01
The price of electricity supplied from home rooftop photo voltaic (PV) solar cells has fallen below the retail price of grid electricity in some areas. A number of residential households have an economic incentive to install rooftop PV systems and reduce their purchases of electricity from the grid. A significant portion of the costs incurred by utility companies are fixed costs which must be recovered even as consumption falls. Electricity rates must increase in order for utility companies to recover fixed costs from shrinking sales bases. Increasing rates will, in turn, result in even more economic incentives for customers to adopt rooftop PV. In this paper, we model this feedback between PV adoption and electricity rates and study its impact on future PV penetration and net-metering costs. We find that the most important parameter that determines whether this feedback has an effect is the fraction of customers who adopt PV in any year based solely on the money saved by doing so in that year, independent of the uncertainties of future years. These uncertainties include possible changes in rate structures such as the introduction of connection charges, the possibility of PV prices dropping significantly in the future, possible changes in tax incentives, and confidence in the reliability and maintainability of PV. -- Highlights: •Households who install PV reduce their electricity consumption from the grid. •Electricity rates must increase for utility companies to recover its fixed costs. •However, higher electricity rates give households more incentives to adopt PV. •We find that this feedback has significant impact on PV uptake only in later years. •Utility companies could lose a significant fraction of high consumption customers
Remote and Centralized Monitoring of PV Power Plants
DEFF Research Database (Denmark)
Kopacz, Csaba; Spataru, Sergiu; Sera, Dezso
2014-01-01
the inverters within each PV plant. The monitoring software stores the PV measurements in a data warehouse optimized for managing and data mining large amounts of data, from where it can be later visualized, analyzed and exported. By combining PV production measurements data with I-V curve measurements...
SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future
Energy Technology Data Exchange (ETDEWEB)
Cole, Wesley J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Woodhouse, Michael A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-12
In this report we summarize the implications, impacts, and deployment potential of reaching the SunShot 2030 targets for the electricity system in the contiguous United States. We model 25 scenarios of the U.S. power sector using the Regional Energy Deployment Systems (ReEDS) and Distributed Generation (dGen) capacity expansion models. The scenarios cover a wide range of sensitivities to capture future uncertainties relating to fuel prices, retirements, renewable energy capital costs, and load growth. We give special attention to the potential for storage costs to also rapidly decline due to its large synergies with low-cost solar. The ReEDS and dGen models project utility- and distributed-scale power sector evolution, respectively, for the United States. Both models have been designed with special emphasis on capturing the unique traits of renewable energy, including variability and grid integration requirements. Across the suite of scenarios modeled, we find that reaching the SunShot 2030 target has the potential to lead to significant capacity additions of PV in the United States. By 2050, PV penetration levels are projected to reach 28-46 percent of total generation. If storage also sees significant reductions in cost, then the 2050 solar penetration levels could reach 41-64 percent. PV deployment is projected to occur in all of the lower 48 states, though the specific deployment level is scenario dependent. The growth in PV is projected to be dominated by utility-scale systems, but the actual mix between utility and distributed systems could ultimately vary depending on how policies, system costs, and rate structures evolve.
The Value of Transparency in Distributed Solar PV Markets
Energy Technology Data Exchange (ETDEWEB)
OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-10-09
Distributed solar photovoltaic (PV) markets are relatively non-transparent: PV price and product information is not readily available, searching for this information is costly (in terms of time and effort), and customers are mostly unfamiliar with the new technology. Quote aggregation, where third-party companies collect PV quotes on behalf of customers, may be one way to increase PV market transparency. In this paper, quote aggregation data are analyzed to study the value of transparency for distributed solar PV markets. The results suggest that easier access to more quotes results in lower prices. We find that installers tend to offer lower prices in more competitive market environments. We supplement the empirical analysis with key findings from interviews of residential PV installers.
Low concentrator PV optics optimization
Sharp, Leonard; Chang, Ben
2008-08-01
Purpose: Cost reduction is a major focus of the solar industry. Thin film technologies and concentration systems are viable ways to reducing cost, with unique strengths and weakness for both. Most of the concentrating PV work focuses on high concentration systems for reducing energy cost. Meanwhile, many believe that low concentrators provide significant cost reduction potential while addressing the mainstream PV market with a product that acts as a flat panel replacement. This paper analyzes the relative benefit of asymmetric vs. symmetric optics for low-concentrators in light of specific PV applications. Approach: Symmetric and asymmetric concentrating PV module performance is evaluated using computer simulation to determine potential value across various geographic locations and applications. The selected optic design is modeled against standard cSi flat panels and thin film to determine application fit, system level energy density and economic value. Results: While symmetric designs may seem ideal, asymmetric designs have an advantage in energy density. Both designs are assessed for aperture, optimum concentration ratio, and ideal system array configuration. Analysis of performance across climate specific effects (diffuse, direct and circumsolar) and location specific effects (sunpath) are also presented. The energy density and energy production of low concentrators provide a compelling value proposition. More significantly, the choice of optics for a low concentrating design can affect real world performance. With the goal of maximizing energy density and return on investment, this paper presents the advantages of asymmetric optic concentration and illustrates the value of this design within specific PV applications.
Directory of Open Access Journals (Sweden)
Joaquim Geraldo Cáprio da Costa
2003-10-01
Full Text Available O crestamento bacteriano comum e a antracnoseincitados por Xanthomonas axonopodis pv. phaseoli (Smith Vauterin, Hoste, Kesters & Swings e Colletotrichum lindemuthianum (Sacc. & Magn. Scrib., respectivamente, podem reduzir consideravelmente a produtividade do feijoeiro comum (Phaseolus vulgaris L.. Conduziu-se este trabalho com o objetivo de obter linhagens com resistência conjunta ao crestamento bacteriano comum e à antracnose, com características agronômicas desejáveis. Foram obtidas 35 populações F2 provenientes de cruzamentos simples entre linhagens com resistência ao crestamento bacteriano comum proveniente de P. acutifolius A. Gray e linhagens resistentes à antracnose e com características agronômicas favoráveis. As populações segregantes de F2 a F5 foram inoculadas com o patótipo 89 de C. lindemuthianum com uma concentração de 1,2 x 10(6 conídios/mL e submetidas à seleção massal modificada. As plantas que apresentaram grau superior a 4 foram eliminadas. Na geração F5, foi realizada seleção individual das plantas remanescentes para obter as famílias F6. As famílias F6 foram avaliadas mediante inoculação com os patótipos 55, 89, 95 e 453 de C. lindemuthianum. As famílias F7 resistentes à antracnose foram inoculadas em casa-de-vegetação por incisão das folhas primárias com tesoura mergulhada em uma suspensão de 5 x 10(7 ufc do isolado XpCNF 15 de X. axonopodis pv. phaseoli. As linhagens resistentes foram avaliadas em quatro experimentos de campo. Foram selecionadas 17 linhagens com alto rendimento de grãos, resistentes ao crestamento bacteriano comum e à antracnose, com boa altura de inserção das vagens inferiores e resistentes ao acamamento.Common bacterial blight and anthracnose diseases, incited by Xanthomonas axonopodis pv. phaseoli (Smith Vauterin, Hoste, Kesters & Swings and Colletotrichum lindemuthianum (Sacc. & Magn. Scrib., respectively, are major constrains for dry bean (Phaseolus vulgaris L
Commercialization and business development of grid-connected PV at SMUD
International Nuclear Information System (INIS)
Osborn, D.E.
1998-01-01
SMUD has completed its first 5 year, 6 MW PV commercialization effort based on the sustained, orderly development of the utility PV market. SMUD has begun a 5 year, 10 MW program designed to complete a process that will result in PV being at a market competitive price by 2002 and as a sustainable business opportunity for SMUD. As part of this effort, by the end of 1997, SMUD had installed over 450 PV systems totaling 6 MW. These included over 420 residential rooftop systems as well as commercial buildings, parking lots and substation systems. Under its new Business Plan, SMUD has signed contracts for an additional 10 MW of PV systems for 1998 through 2002 with cost decreasing to less than $3/W. As part of its new competitive business strategy responding to changes the utility industry is undergoing, SMUD has incorporated PV as a key business opportunity. SMUD has established partnerships with its customers through the PV Pioneer green pricing program, with DOE and UPVG through TEAM-UP and Million Solar Roofs to advance PV commercialization and to develop rooftops as PV power plant sites and with other utilities through its PV Partnership program
Directory of Open Access Journals (Sweden)
Cassia Roberta Malacrida
2012-02-01
Full Text Available The aim of this study was to determine the chemical composition -physico-chemical properties, fatty acid and tocopherol compositions and total phenolic compounds -and evaluate the radical-scavenging activity of crude oil extracted from passion fruit (Passiflora edulis f. flavicarpa seeds, aiming to use the agro-industrial by-products. The oil seed extraction was performed by Soxhlet method and the oil yield from the seeds was 30.39%. The oil showed high levels of unsaturated fatty acids (87.59%, including mainly linoleic (73.14% and oleic (13.83% acids, tocopherol (499.30 mg/kg and phenolic compounds (1,314.13 mg GAE/kg. The physico-chemical characteristics were similar to those of other edible oils and the oil showed significant antioxidant activity. Therefore, the potential utilization of the passion fruit seed oil as a raw material for food, chemical and pharmaceutical industries could be favorable.
TRNSYS HYBRID wind diesel PV simulator
Energy Technology Data Exchange (ETDEWEB)
Quinlan, P.J.A.; Mitchell, J.W.; Klein, S.A.; Beckman, W.A.; Blair, N.J. [Univ. of Wisconsin, Madison, WI (United States)
1996-12-31
The Solar Energy Laboratory (SEL) has developed a wind diesel PV hybrid systems simulator, UW-HYBRID 1.0, an application of the TRNSYS 14.2 time-series simulation environment. An AC/DC bus links up to five diesels and wind turbine models, along with PV modules, a battery bank, and an AC/DC converter. Multiple units can be selected. PV system simulations include solar angle and peak power tracking options. Weather data are Typical Meteorological Year data, parametrically generated synthesized data, or external data files. PV performance simulations rely on long-standing SEL-developed algorithms. Loads data are read as scalable time series. Diesel simulations include estimated fuel-use and waste heat output, and are dispatched using a least-cost of fuel strategy. Wind system simulations include varying air density, wind shear and wake effects. Time step duration is user-selectable. UW-HYBRID 1.0 runs in Windows{reg_sign}, with TRNSED providing a customizable user interface. 12 refs., 6 figs.
Environmental and exergy benefit of nanofluid-based hybrid PV/T systems
International Nuclear Information System (INIS)
Hassani, Samir; Saidur, R.; Mekhilef, Saad; Taylor, Robert A.
2016-01-01
Highlights: • Environmental and ExPBT analysis of different PV/T configurations is presented. • The exergy payback time of nanofluid-based hybrid PV/T system is about 2 years. • Nanofluid-based hybrid PV/T system is a reliable solution for pollution prevention. • Nanofluid-based hybrid PV/T system is highly recommended at high solar concentration. - Abstract: Photovoltaic/thermal (PV/T) solar systems, which produce both electrical and thermal energy simultaneously, represent a method to achieve very high conversion rates of sunlight into useful energy. In recent years, nanofluids have been proposed as efficient coolants and optical filter for PV/T systems. Aim of this paper is to theoretically analyze the life cycle exergy of three different configurations of nanofluids-based PV/T hybrid systems, and compare their performance to a standard PV and PV/T system. Electrical and thermal performance of the analyzed solar collectors was investigated numerically. The life cycle exergy analysis revealed that the nanofluids-based PV/T system showed the best performance compared to a standard PV and PV/T systems. At the optimum value of solar concentration C, nanofluid-based PV/T configuration with optimized optical and thermal properties produces ∼1.3 MW h/m 2 of high-grade exergy annually with the lowest exergy payback time of 2 years, whereas these are ∼0.36, ∼0.79 MW h/m 2 and 3.48, 2.55 years for standard PV and PV/T systems, respectively. In addition, the nanofluids-based PV/T system can prevent the emissions of about 448 kg CO 2 eq m −2 yr −1 . Overall, it was found that the nanofluids-based PV/T with optimized optical and thermal properties has potential for further development in a high-concentration solar system.
Less CO2 by means of photovoltaic energy (PV)
International Nuclear Information System (INIS)
Alsema, E.A.; Van Brummelen, M.
1992-11-01
Regarding the title subject special attention is paid to the technical limitations of a fast introduction of the use of photovoltaic (PV) energy conversion. After a brief introduction on PV systems and the operation of a solar cell in chapter two, a state of the art is given of PV technology and possible price developments for PV modules and Balance-Of-System (BOS) components up to the year 2000 in chapters three and four. In chapter five the potential of installing grid-connected PV systems in the Netherlands is determined, taking into account the options of using existing buildings (PV systems on the roof), unexplored ground, in the verge of highways or railroads, industrial areas and airports. In chapter six non-economical bottlenecks for a large-scale introduction of grid-connected PV systems are discussed: the industrial production capacity for PV modules and other components, the fitting-in into the public electricity supply, and institutional aspects of installing PV systems on roofs. In chapter seven it is determined how much costs can be saved and CO 2 emission can be reduced when PV capacity is fitted-in into the Dutch electric power supply. The calculations are based on the Global Shift scenario. In chapter eight two scenarios (an optimistic scenario and a more realistic scenario) for the introduction of PV systems are outlined. For both scenarios the financial consequences and the contribution to the electric power supply are indicated. In chapter nine the net energy yield, being the result of the previously discussed introduction scenarios, is calculated, followed by a calculation of the avoided CO 2 emission, as well as the costs to avoid such emission. 25 figs., 15 tabs., 116 refs., 1 annex
Accelerating residential PV expansion: supply analysis for competitive electricity markets
International Nuclear Information System (INIS)
Payne, Adam; Williams, Robert H.; Duke, Richard
2001-01-01
Photovoltaic (PV) technology is now sufficiently advanced that market support mechanisms such as net metering plus a renewable portfolio standard (RPS) could induce rapid PV market growth in grid-connected applications. With such support mechanisms, markets would be sufficiently large that manufacturers could profitably build and operate 100 MW p /yr PV module factories, and electricity costs for residential rooftop PV systems would compare favorably with residential electricity prices in certain areas (e.g., California and the greater New York region in the US). This prospect is illustrated by economic and market analyses for one promising technology (amorphous silicon thin-film PV) from the perspectives of both module manufacturers and buyers of new homes with rooftop PV systems. With public policies that reflect the distributed and environmental benefits offered by PV-and that can sustain domestic PV market demand growth at three times the historical growth rate for a period of the order of two decades - PV could provide 3% of total US electricity supply by 2025. (Author)
Directory of Open Access Journals (Sweden)
Rito Hernán Cardozo Gutiérrez
1988-01-01
Full Text Available The trials made on banana passion fruit seeds germination (Passiflora mollisima(HBK Bailey, under laboratory specifications show that the testa delays the water absortion and it is the critic factor on the germination. AG3 increases the germination remarkably and strengthens the effects of the scarification considerably.
PV panel model based on datasheet values
DEFF Research Database (Denmark)
Sera, Dezso; Teodorescu, Remus; Rodriguez, Pedro
2007-01-01
This work presents the construction of a model for a PV panel using the single-diode five-parameters model, based exclusively on data-sheet parameters. The model takes into account the series and parallel (shunt) resistance of the panel. The equivalent circuit and the basic equations of the PV cell....... Based on these equations, a PV panel model, which is able to predict the panel behavior in different temperature and irradiance conditions, is built and tested....
Good and bad practices in pv plants
Martinez Moreno, Francisco; Helleputte, F.; Tyutyundzhiev, N.; Rabal Echeverria, Daniel; Conlon, Michael; Fartaria, Tomás; Oteiza, David
2013-01-01
The PVCROPS project (PhotoVolta ic Cost r€duction, Reliability, Operational performance, Prediction and Simulation), cofinanced by European Commission in the frame of Seventh Framework Programme, has compiled in the “Good and bad practices: Manual to improve the quality and reduce the cost of PV systems” a collection of good and bad practices in actual PV plants . All the situations it collects represent the state-of-the-art of existing PV installations all around Europe. They show how ...
Real Time Photovoltaic Array Simulator for Testing Grid-Connected PV Inverters
DEFF Research Database (Denmark)
Sera, Dezso; Valentini, Massimo; Raducu, Alin
2008-01-01
In this paper a real time flexible PV array simulator is presented. It is a system that can simulate different PV panel arrays in specific environmental conditions. To evaluate performance of the Maximum Power Point Tracking (MPPT) of grid-connected Photovoltaic (PV) inverters only measurements...... undertaken with an appropriate PV array simulator provide accurate and reproducible results. Thus the PV array simulator has been developed and implemented. MPPT efficiency tests on a commercial grid-connected PV inverter have been performed to validate the PV array simulator....
Energy metrics analysis of hybrid - photovoltaic (PV) modules
Energy Technology Data Exchange (ETDEWEB)
Tiwari, Arvind [Department of Electronics and Communication, Krishna Institute of Engineering and Technology, 13 k.m. stone, Ghaziabad - Meerut Road, Ghaziabad 201 206, UP (India); Barnwal, P.; Sandhu, G.S.; Sodha, M.S. [Centre for Energy Studies, Indian Institute of Technology Delhi, Hauz Khas, New Delhi 110 016 (India)
2009-12-15
In this paper, energy metrics (energy pay back time, electricity production factor and life cycle conversion efficiency) of hybrid photovoltaic (PV) modules have been analyzed and presented for the composite climate of New Delhi, India. For this purpose, it is necessary to calculate (1) the energy consumption in making different components of the PV modules and (2) the annual energy (electrical and thermal) available from the hybrid-PV modules. A set of mathematical relations have been reformulated for computation of the energy metrics. The manufacturing energy, material production energy, energy use and distribution energy of the system have been taken into account, to determine the embodied energy for the hybrid-PV modules. The embodied energy and annual energy outputs have been used for evaluation of the energy metrics. For hybrid PV module, it has been observed that the EPBT gets significantly reduced by taking into account the increase in annual energy availability of the thermal energy in addition to the electrical energy. The values of EPF and LCCE of hybrid PV module become higher as expected. (author)
Real time PV manufacturing diagnostic system
Energy Technology Data Exchange (ETDEWEB)
Kochergin, Vladimir [MicroXact Inc., Blacksburg, VA (United States); Crawford, Michael A. [MicroXact Inc., Blacksburg, VA (United States)
2015-09-01
The main obstacle Photovoltaic (PV) industry is facing at present is the higher cost of PV energy compared to that of fossil energy. While solar cell efficiencies continue to make incremental gains these improvements are so far insufficient to drive PV costs down to match that of fossil energy. Improved in-line diagnostics however, has the potential to significantly increase the productivity and reduce cost by improving the yield of the process. On this Phase I/Phase II SBIR project MicroXact developed and demonstrated at CIGS pilot manufacturing line a high-throughput in-line PV manufacturing diagnostic system, which was verified to provide fast and accurate data on the spatial uniformity of thickness, an composition of the thin films comprising the solar cell as the solar cell is processed reel-to-reel. In Phase II project MicroXact developed a stand-alone system prototype and demonstrated the following technical characteristics: 1) ability of real time defect/composition inconsistency detection over 60cm wide web at web speeds up to 3m/minute; 2) Better than 1mm spatial resolution on 60cm wide web; 3) an average better than 20nm spectral resolution resulting in more than sufficient sensitivity to composition imperfections (copper-rich and copper-poor regions were detected). The system was verified to be high vacuum compatible. Phase II results completely validated both technical and economic feasibility of the proposed concept. MicroXact’s solution is an enabling technique for in-line PV manufacturing diagnostics to increase the productivity of PV manufacturing lines and reduce the cost of solar energy, thus reducing the US dependency on foreign oil while simultaneously reducing emission of greenhouse gasses.
Methods for the Optimal Design of Grid-Connected PV Inverters
DEFF Research Database (Denmark)
Koutroulis, Eftichios; Blaabjerg, Frede
2011-01-01
and the efficient processing of this power by the DC/AC inverter. In this paper two new methods are presented for the optimal design of a PV inverter power section, output filter and MPPT control strategy. The influences of the electric grid regulations and standards as well as the PV array operational......The DC/AC inverters are used in grid-connected PV energy production systems as the power processing interface between the PV energy source and the electric grid. The energy injected into the electric grid by the PV installation depends on the amount of power extracted from the PV power source...
Design Optimization of Transformerless Grid-Connected PV Inverters Including Reliability
Koutroulis, Eftichios; Blaabjerg, Frede
2013-01-01
This paper presents a new methodology for optimal design of transformerless photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal switching frequency as well as the optimal values and types of the PV inverter components is calculated such that the PV inverter LCOE generated during the PV system lifetime period is minimized. The LCOE is also calculated considering the failure rates of the components, which affect the reliability performance...
Terawatt Challenge for Thin-Film PV
Energy Technology Data Exchange (ETDEWEB)
Zweibel, K.
2005-08-01
The evolution of PV into one of the world's largest industries is not going to happen without major unforeseen problems. However, this study attempts to address the obvious ones, so that we can put aside the mythology of PV (for example, that it is only ''boutique power'' or that one must pave the world with it to be useful) and get on with changing the world's energy infrastructure. With the years of rapid market growth now under way in PV, the author is sure this will not be the last effort to understand the real potential and pitfalls of meeting the Challenge.
National survey report on PV power applications in Switzerland 2006
International Nuclear Information System (INIS)
Huesser, P.; Hostettler, T.
2007-01-01
This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.
National survey report on PV power applications in Switzerland 2006
Energy Technology Data Exchange (ETDEWEB)
Huesser, P. [Nova Energie GmbH, Aarau (Switzerland); Hostettler, T. [Ingenieurbuero Hostettler, Berne (Switzerland)
2007-07-01
This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.
Accelerating residential PV expansion: demand analysis for competitive electricity markets
International Nuclear Information System (INIS)
Duke, Richard; Williams, Robert; Payne, Adam
2005-01-01
This article quantifies the potential market for grid-connected, residential photovoltaic (PV) electricity integrated into new homes built in the US. It complements an earlier supply-side analysis by the authors that demonstrates the potential to reduce PV module prices below $1.5/W p by scaling up existing thin-film technology in 100 MW p /yr manufacturing facilities. The present article demonstrates that, at that price, PV modules may be cost effective in 125,000 new home installations per year (0.5 GW p /yr). While this market is large enough to support multiple scaled up thin-film PV factories, inefficient energy pricing and demand-side market failures will inhibit prospective PV consumers without strong public policy support. Net metering rules, already implemented in many states to encourage PV market launch, represent a crude but reasonable surrogate for efficient electricity pricing mechanisms that may ultimately emerge to internalize the externality benefits of PV. These public benefits include reduced air pollution damages (estimated costs of damage to human health from fossil fuel power plants are presented in Appendix A), deferral of transmission and distribution capital expenditures, reduced exposure to fossil fuel price risks, and increased electricity system reliability for end users. Thus, net metering for PV ought to be implemented as broadly as possible and sustained until efficient pricing is in place. Complementary PV 'buydowns' (e.g., a renewable portfolio standard with a specific PV requirement) are needed to jumpstart regional PV markets
Do feed-in tariffs drive PV cost or viceversa?
International Nuclear Information System (INIS)
Antonelli, Marco; Desideri, Umberto
2014-01-01
Highlights: • The distribution of PV installations on the territory is not a function of the solar radiation. • Cost of PV plants were adapted to the FIT framework. • The FIT for PV in Italy was considered an incentive to financial investment. • The FIT for PV in Italy did not stimulate the development of national PV industry. - Abstract: A survey of the PV market in Italy was done studying a number of installations of different sizes whose economic data were known and assessed. The Italian market has experienced a boom in the PV market after the first mechanism of feed-in tariffs was promoted in 2005. The variations of the tariff structure in the following years have caused significant changes in the market structure in terms of average size and technical characteristics of installed plants. However, an Italian PV industry was not stimulated by the incentives and only companies involved in installation and maintenance were created. At the same time, the cost of the PV plants components, design and commissioning have followed quite a particular trend, which is more determined by the tariffs than by the market development and structure. It is quite clear that the costs of PV plants component are not driven by the amount of installations but by the tariffs, with a trend that follows the decreases in the incentives and not the global installed power. It is therefore very important to study the right tariff mechanisms and benefits to avoid financial disturbances on the market and to promote a real competitive market instead of a simple financial operation under a fake façade of green economy
Solar Energy: Incentives to Promote PV in EU27
Directory of Open Access Journals (Sweden)
María del P. Pablo-Romero
2013-11-01
Full Text Available The growth in the use of renewable energies in the EU has been remarkable. Among these energies is PV. The average annual growth rate for the EU-27 countries in installed PV capacity in the period 2005-2012 was 41.2%. While the installed capacity of PV has reached almost 82 % of National Renewable Energy Action Plan (NREAP targets for the EU-27 countries for 2020, it is still far from being used at its full potential. Over recent years, several measures have been adopted in the EU to enhance and promote PV. This paper undertakes a complete review of the state of PV power in Europe and the measures taken to date to promote it in EU-27. 25 countries have adopted measures to promote PV. The most widespread measure to promote PV use is Feed- in Tariffs. Tariffs are normally adjusted, in a decreasing manner, annually. Nevertheless, currently, seven countries have decided to accelerate this decrease rate in view of cost reduction of the installations and of higher efficiencies. The second instrument used to promote PV in the EU-27 countries is the concession of subsidies. Nevertheless, subsidies have the disadvantage of being closely linked to budgetary resources and therefore to budgetary constraints. In most EU countries, subsidies for renewable energy for PV are being lowered. Twelve EU-27 countries adopted tax measures. Low-interest loans and green certificate systems were only sparingly used.
Kauai Island Utility Co-op (KIUC) PV integration study.
Energy Technology Data Exchange (ETDEWEB)
Ellis, Abraham; Mousseau, Tom (Knoxville, TN)
2011-08-01
This report investigates the effects that increased distributed photovoltaic (PV) generation would have on the Kauai Island Utility Co-op (KIUC) system operating requirements. The study focused on determining reserve requirements needed to mitigate the impact of PV variability on system frequency, and the impact on operating costs. Scenarios of 5-MW, 10-MW, and 15-MW nameplate capacity of PV generation plants distributed across the Kauai Island were considered in this study. The analysis required synthesis of the PV solar resource data and modeling of the KIUC system inertia. Based on the results, some findings and conclusions could be drawn, including that the selection of units identified as marginal resources that are used for load following will change; PV penetration will displace energy generated by existing conventional units, thus reducing overall fuel consumption; PV penetration at any deployment level is not likely to reduce system peak load; and increasing PV penetration has little effect on load-following reserves. The study was performed by EnerNex under contract from Sandia National Laboratories with cooperation from KIUC.
A global strategy for the European PV industry
International Nuclear Information System (INIS)
Viaud, M.; Despotou, E.; Latour, M.; Hoffmann, W.; Macias, E.; Cameron, M.; Laborde, E.
2004-01-01
The objective was to develop a comprehensive strategy that answers to the need of today European PV industry. Namely: - Develop PV markets in Europe - Develop export markets. - Position the European PV industry within the European political environment and support the effort of national actors in their local objectives. This method lends itself to brainstorming to create actions and synergies, on order to achieve strategy objectives. The whole work is based on working groups clearly defined on the purpose, where all EPIA members are invited to participate. The overall first results are presented during the 19. EU PV Conference in Paris and EPIA will do recommendations on actions to be undertaken in the future. This strategy is co-financed by EPIA members and the 6. Framework Programme for research of the European Commission through the PV Catapult project. (authors)
A Practical Optimization Method for Designing Large PV Plants
DEFF Research Database (Denmark)
Kerekes, Tamas; Koutroulis, E.; Eyigun, S.
2011-01-01
Nowadays Photovoltaic (PV) plants have multi MW sizes, the biggest plants reaching tens of MW of capacity. Such large-scale PV plants are made up of several thousands of PV panels, each panel being in the range of 150-350W. This means that the design of a Large PV power plant is a big challenge...... and configuring such a plant should be implemented taking into consideration not only the cost of the installation, but also the Annual Energy Production, the Performance Ratio and the Levelized Cost Of Energy. In this paper, an algorithm is presented including the most important models of the PV system...
Energy Technology Data Exchange (ETDEWEB)
Hueser, Pius [Nova Energy GmbH, (Switzerland)
2007-06-15
This presentation is mainly about how the PV market in Europe has been growing, and which elements are going to determine if this market succeed or failed not only in Europe but also in the rest of the world. In the first part of this presentation, it is mentioned how in 2005 the development of some PV technologies triggered the PV market growth without any marketing control. Then, there are explained the aspects that changed such situation out of control, therefore, it emerged the beginning of the consolidation of this market. There are briefly explained those factors that are going to determine if this market succeed or failed in the future. Finally, there are given examples of some the PV investments. [Spanish] Esta presentacion habla principalmente de la manera en como ha crecido el Mercado de sistemas fotovoltaicos en Europa, asi tambien se mencionan los elementos fundamentales que determinaran el exito o fracaso de este mercado, no solamente en Europa sino tambien en el resto del mundo, en un futuro. En la primera parte de esta presentacion, se describe como en el 2005, debido al desarrollo de algunas tecnologias fotovoltaicas se desencadeno el crecimiento desenfrenado del mercado fotovoltaico. Despues, se explican los aspectos que hicieron que dicho crecimiento tomara su curso, teniendo como resultado el inicio de un mercado mas consolidado. Se explican brevemente los factores que determinaran si este mercado encuentra el exito o el fracaso en un futuro. Finalmente, se dan ejemplos de algunas adquisiciones fotovoltaicas.
China PV Business and Applications Evaluation; TOPICAL
International Nuclear Information System (INIS)
Sherring, Chris
1999-01-01
This report provides an overview of photovoltaics (PV) business and applications in China. Although more than 70 million people in China are without access to grid electricity, many of the unelectrified regions benefit from considerable renewable resources, including good solar insolation. Current annual PV sales are still modest, however, and are estimated to be between 2.0 and 2.5 megawatts. This and other significant PV data, including information regarding the current status of key aspects of Chinese businesses, markets, and distribution channels, are included in the report. Detailed company profiles of Chinese business organizations and summaries of visits made to these companies (as well as to more remote sites in Inner Mongolia to examine PV usage by the end-use customer) in September-October 1998 are also presented
Rating PV Power and Energy: Cell, Module, and System Measurements
Energy Technology Data Exchange (ETDEWEB)
Emery, Keith
2016-06-02
A summary of key points related to research-level measurements of current vs. voltage measurement theory including basic PV operation, equivalent circuit, and concept of spectral error; PV power performance including PV irradiance sensors, simulators and commercial and generic I-V systems; PV measurement artifacts, intercomparisons, and alternative rating methods.
Directory of Open Access Journals (Sweden)
Nilton Tadeu Vilela Junqueira
2010-09-01
Full Text Available O maracujá-suspiro (Passiflora nitida Kunth é uma espécie silvestre amplamente distribuída no território nacional. Tem alto potencial para o melhoramento visando à resistência a diversas doenças que provocam perdas expressivas em cultivos comerciais de maracujá-azedo (Passiflora edulis Sims. Seus frutos são comestíveis e têm elevado valor comercial como fruta fresca. Dessa forma, esse estudo teve como objetivo analisar as características físicas e químicas dos frutos e determinar, em condições de campo, o rendimento de dez acessos de P. nitida procedentes de estados e/ou de diferentes tipos fitofisionômicos das regiões Centro - Norte do Brasil. O experimento foi conduzido na Embrapa Cerrados, localizada em Planaltina, Distrito Federal. Os acessos avaliados foram coletados em Manaus-AM, de capoeira; no Núcleo Rural São José - DF, de chapada e de vereda; no Vale do Amanhecer - DF, de vereda; Jardim Botânico-DF, de Cerrado Stricto Sensu; em Silvânia-GO, de mata ciliar e de chapada; em Itiquira - MT, de Cerrado Stricto Sensu; em Alto Paraíso-GO, de chapada, e em Natividade-TO, de chapada. O delineamento estatístico foi em blocos casualizados, com quatro repetições e três plantas úteis por repetição. As plantas foram propagadas por estacas enraizadas de cada acesso e conduzidas em espaldeiras verticais de 1,80 metro de altura, com irrigação por gotejamento. As avaliações foram feitas durante as colheitas de 2006 e 2007. O acesso do Vale do Amanhecer apresentou o melhor rendimento de frutos. Este acesso pode ser usado no programa de melhoramento visando à inserção de P. nitida no mercado. Também foi possível observar que as fontes provenientes do Cerrado têm características físicas mais desejáveis, produzindo frutos maiores e com melhor rendimento em polpa. Por outro lado, o acesso do Amazonas teve a menor espessura da casca, característica desejável para o mercado de frutas naturais.The passion fruit
PV System Component Fault and Failure Compilation and Analysis.
Energy Technology Data Exchange (ETDEWEB)
Klise, Geoffrey Taylor; Lavrova, Olga; Gooding, Renee Lynne
2018-02-01
This report describes data collection and analysis of solar photovoltaic (PV) equipment events, which consist of faults and fa ilures that occur during the normal operation of a distributed PV system or PV power plant. We present summary statistics from locations w here maintenance data is being collected at various intervals, as well as reliability statistics gathered from that da ta, consisting of fault/failure distributions and repair distributions for a wide range of PV equipment types.
Examples of successful architectural integration of PV: Germany
International Nuclear Information System (INIS)
Hagemann, I.B.
2004-01-01
In Germany building-integrated photovoltaics (BIPV) are developing rapidly, and much progress has been achieved in the past five years. BIPV can be used today in different ways on both existing and new buildings. Architects and designers are discovering BIPV. With the help of custom-made products available on the German market they are beginning to explore the technical limits of an aesthetic and structural integration of PV in buildings. As a result some exciting high-profile building projects with PV have been built, for example, the small service pavilion Meereslauschen in Steinhude or the new headquarters building of the Wood Trade Association in Munich. These projects show that the use of PV is very varied and offers opportunities for creative architects. However non-technical problems still need to be solved to allow a meaningful and widespread application of PV in the built environment. To decrease costs it is essential to develop further standard BIPV components. The aim of such developments should be to replace standard PV modules by products in which PV and structural building elements are melded into one design and structural unit. (author)
PV experience curves for the Netherlands
International Nuclear Information System (INIS)
Gerwig, R.
2005-01-01
Experience curves are one of several tools used by policy makers to take a look at market development. Numerous curves have been constructed for PV but none specific to the Netherlands. The objective of this report is to take a look at the price development of grid-connected PV systems in the Netherlands using the experience curve theory. After a literature and internet search and attempts to acquire information from PV companies information on 51% of the totally installed capacity was found. Curves for the period 1991-2001 were constructed based on system price, BOS (balance-of-system) price and inverter price. The progress ratio of the locally learning BOS was similar to the globally learning module market. This indicates that the pace of development of the Dutch PV market is similar to the globally followed pace. Improvement of the detail of the data might help to get a better idea of which BOS components have declined most. The similar progress ratio also shows the importance of investing both in module and system research as is the case in the Netherlands
Optimal design of orientation of PV/T collector with reflectors
International Nuclear Information System (INIS)
Kostic, Lj.T.; Pavlovic, T.M.; Pavlovic, Z.T.
2010-01-01
Hybrid conversion of solar radiation implies simultaneous solar radiation conversion into thermal and electrical energy in the PV/Thermal collector. In order to get more thermal and electrical energy, flat solar radiation reflectors have been mounted on PV/T collector. To obtain higher solar radiation intensity on PV/T collector, position of reflectors has been changed and optimal position of reflectors has been determined by both experimental measurements and numerical calculation so as to obtain maximal concentration of solar radiation intensity. The calculated values have been found to be in good agreement with the measured ones, both yielding the optimal position of the flat reflector to be the lowest (5 o ) in December and the highest (38 o ) in June. In this paper, the thermal and electrical efficiency of PV/T collector without reflectors and with reflectors in optimal position have been calculated. Using these results, the total efficiency and energy-saving efficiency of PV/T collector have been determined. Energy-saving efficiency for PV/T collector without reflectors is 60.1%, which is above the conventional solar thermal collector, whereas the energy-saving efficiency for PV/T collector with reflectors in optimal position is 46.7%, which is almost equal to the values for conventional solar thermal collector. Though the energy-saving efficiency of PV/T collector decreases slightly with the solar radiation intensity concentration factor, i.e. the thermal and electrical efficiency of PV/T collector with reflectors are lower than those of PV/T collector without reflectors, the total thermal and electrical energy generated by PV/T collector with reflectors in optimal position are significantly higher than total thermal and electrical energy generated by PV/T collector without reflectors.
Battery storage for PV power systems: an overview
Energy Technology Data Exchange (ETDEWEB)
Chaurey, A; Deambi, S [Tata Energy Research Inst., New Delhi (India)
1992-06-01
Batteries used in photovoltaic applications are required to have particular properties in order to minimize the system cost, in addition to meeting stringent reliability requirements associated with PV system installations. The battery sizing, installations, operation and maintenance, thus, are fundamentally different from those used in several other energy storage applications. The current paper gives an overview of battery systems commonly used in PV installation, as well as several new options which are found suitable or have been modified suitably to meet PV energy storage requirements. The systems are discussed briefly with respect to their construction, performance characteristics and compatibility with PV systems. The battery sizing procedures are also reviewed. (Author).
Assessing the PV business opportunities in Greece
International Nuclear Information System (INIS)
Patlitzianas, Konstantinos D.; Skylogiannis, Georgios K.; Papastefanakis, Dimitrios
2013-01-01
Highlights: • An approach of qualitative judgments for the PV opportunities through the assessing of the licenses’ value in Greece. • It can be supplied in other countries by applying different weights to the criteria. • It can be used by everyone in order to find a suitable PV investment without the need of experts in the field. - Abstract: Greece, as a member of the European Union (EU), has undertaken the obligation to meet the expected goals for the penetration of Renewable Energy Sources (RES) in the national energy balance in compliance with “20–20–20” goals (20% of the Gross Energy Consumption and 40% of the Gross Electricity Consumption should be covered by RES). Although the development of RES, and particularly of Photovoltaic (PV), in Greece during the last years has presented a satisfactory growth, the country is still far away from the above goals. The main reason for this delay is that – except the financial crisis – many licenses are inactive and waiting funding in order to be utilized. Additionally, the latest law (L.4152/2013) has forbidden the interconnection of new PV power Plants to the grid until the end of 2013. The above fact determines the significance of the existing PV Licenses in achieving the national goals. The aim of this paper is to present an integrated approach of qualitative judgments for the PV business opportunities through the assessing of the licenses’ value in Greece. The approach, which is based on a Multi Criteria Decision Making (MCDM) theory of quantifying multiple qualitative judgments, takes into account the real factors which can affect the expected production and cost of the PV installation and therefore the RoI (Return of Investment)
Addressing firefighter safety around solar PV systems
Energy Technology Data Exchange (ETDEWEB)
Harris, B. [Sustainable Energy Technologies, Calgary, AB (Canada)
2010-11-15
The article discussed new considerations for installing photovoltaic (PV) systems that address the needs of fire service personnel. The presence of a PV system presents a multitude of dangers for firefighters, including electrical shock, the inhalation of toxic gases from being unable to cut a hole through the roof, falling debris and flying glass, and dead loading on a compromised structure and tripping on conduits. Mapping systems should be modified so that buildings with PV systems are identified for first responders, including firefighters who should learn that solar modules present an electrical hazard during the day but not at night; covering PV modules with foam or salvage covers may not shut the system down to a safe level; it takes a few moments for the power in PV modules to reduce to zero; and PV modules or conduit should never be cut, broke, chopped, or walked upon. The California Department of Forestry and Fire Protection recommends creating pathways and allowing easier access to the roof by setting the modules back from roof edges, creating a structurally sound pathway for firefighters to walk on and space to cut ventilation holes. However, the setback rule makes the economics of solar installation less viable for residential applications. The technological innovations aimed at addressing system safety all focus on limiting firefighter contact with live electrical components to within the extra-low-voltage (ELV) band. Some of the inverters on the market that support ELV system architecture were described. 1 fig.
Performance Parameters for Grid-Connected PV Systems
Energy Technology Data Exchange (ETDEWEB)
Marion, B.; Adelstein, J.; Boyle, K.; Hayden, H.; Hammond, B.; Fletcher, T.; Canada, B.; Narang, D.; Shugar, D.; Wenger, H.; Kimber, A.; Mitchell, L.; Rich, G.; Townsend, T.
2005-02-01
The use of appropriate performance parameters facilitates the comparison of grid-connected photovoltaic (PV) systems that may differ with respect to design, technology, or geographic location. Four performance parameters that define the overall system performance with respect to the energy production, solar resource, and overall effect of system losses are the following: final PV system yield, reference yield, performance ratio, and PVUSA rating. These performance parameters are discussed for their suitability in providing desired information for PV system design and performance evaluation and are demonstrated for a variety of technologies, designs, and geographic locations. Also discussed are methodologies for determining system a.c. power ratings in the design phase using multipliers developed from measured performance parameters.The use of appropriate performance parameters facilitates the comparison of grid-connected photovoltaic (PV) systems that may differ with respect to design, technology, or geographic location. Four performance parameters that define the overall system performance with respect to the energy production, solar resource, and overall effect of system losses are the following: final PV system yield, reference yield, performance ratio, and PVUSA rating. These performance parameters are discussed for their suitability in providing desired information for PV system design and performance evaluation and are demonstrated for a variety of technologies, designs, and geographic locations. Also discussed are methodologies for determining system a.c. power ratings in the design phase using multipliers developed from measured performance parameters.
A Software Tool for Optimal Sizing of PV Systems in Malaysia
Directory of Open Access Journals (Sweden)
Tamer Khatib
2012-01-01
Full Text Available This paper presents a MATLAB based user friendly software tool called as PV.MY for optimal sizing of photovoltaic (PV systems. The software has the capabilities of predicting the metrological variables such as solar energy, ambient temperature and wind speed using artificial neural network (ANN, optimizes the PV module/ array tilt angle, optimizes the inverter size and calculate optimal capacities of PV array, battery, wind turbine and diesel generator in hybrid PV systems. The ANN based model for metrological prediction uses four meteorological variables, namely, sun shine ratio, day number and location coordinates. As for PV system sizing, iterative methods are used for determining the optimal sizing of three types of PV systems, which are standalone PV system, hybrid PV/wind system and hybrid PV/diesel generator system. The loss of load probability (LLP technique is used for optimization in which the energy sources capacities are the variables to be optimized considering very low LLP. As for determining the optimal PV panels tilt angle and inverter size, the Liu and Jordan model for solar energy incident on a tilt surface is used in optimizing the monthly tilt angle, while a model for inverter efficiency curve is used in the optimization of inverter size.
Delta Power Control Strategy for Multistring Grid-Connected PV Inverters
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Blaabjerg, Frede
2017-01-01
, is required for grid support (e.g., during frequency deviation). In this paper, a cost-effective solution to realize delta power control (DPC) for grid-connected PV systems is presented, where the multistring PV inverter configuration is adopted. This control strategy is a combination of maximum power point...... tracking (MPPT) and constant power generation (CPG) modes. In this control scheme, one PV string operating in the MPPT mode estimates the available power, whereas the other PV strings regulate the total PV power by the CPG control strategy in such a way that the delta power constraint for the entire PV...... system is achieved. Simulations and experiments have been performed on a 3-kW single-phase grid-connected PV system. The results have confirmed the effectiveness of the proposed DPC strategy, where the power reserve according to the delta power constraint is achieved under several operating conditions....
The prospects for cost competitive solar PV power
International Nuclear Information System (INIS)
Reichelstein, Stefan; Yorston, Michael
2013-01-01
New solar Photovoltaic (PV) installations have grown globally at a rapid pace in recent years. We provide a comprehensive assessment of the cost competitiveness of this electric power source. Based on data available for the second half of 2011, we conclude that utility-scale PV installations are not yet cost competitive with fossil fuel power plants. In contrast, commercial-scale installations have already attained cost parity in the sense that the generating cost of power from solar PV is comparable to the retail electricity prices that commercial users pay, at least in certain parts of the U.S. This conclusion is shown to depend crucially on both the current federal tax subsidies for solar power and an ideal geographic location for the solar installation. Projecting recent industry trends into the future, we estimate that utility-scale solar PV facilities are on track to become cost competitive by the end of this decade. Furthermore, commercial-scale installations could reach “grid parity” in about ten years, if the current federal tax incentives for solar power were to expire at that point. - Highlights: ► Assessment of the cost competitiveness of new solar Photovoltaic (PV) installations. ► Utility-scale PV installations are not yet cost competitive with fossil fuel power plants. ► Commercial-scale installations have already attained cost parity in certain parts of the U.S. ► Utility-scale solar PV facilities are on track to become cost competitive by the end of this decade
Silver nano fabrication using leaf disc of Passiflora foetida Linn
Lade, Bipin D.; Patil, Anita S.
2017-06-01
The main purpose of the experiment is to develop a greener low cost SNP fabrication steps using factories of secondary metabolites from Passiflora leaf extract. Here, the leaf extraction process is omitted, and instead a leaf disc was used for stable SNP fabricated by optimizing parameters such as a circular leaf disc of 2 cm (1, 2, 3, 4, 5) instead of leaf extract and grade of pH (7, 8, 9, 11). The SNP synthesis reaction is tried under room temperature, sun, UV and dark condition. The leaf disc preparation steps are also discussed in details. The SNP obtained using (1 mM: 100 ml AgNO3+ singular leaf disc: pH 9, 11) is applied against featured room temperature and sun condition. The UV spectroscopic analysis confirms that sun rays synthesized SNP yields stable nano particles. The FTIR analysis confirms a large number of functional groups such as alkanes, alkyne, amines, aliphatic amine, carboxylic acid; nitro-compound, alcohol, saturated aldehyde and phenols involved in reduction of silver salt to zero valent ions. The leaf disc mediated synthesis of silver nanoparticles, minimizes leaf extract preparation step and eligible for stable SNP synthesis. The methods sun and room temperature based nano particles synthesized within 10 min would be use certainly for antimicrobial activity.
Overview of Recent Grid Codes for PV Power Integration
DEFF Research Database (Denmark)
Craciun, Bogdan-Ionut; Kerekes, Tamas; Sera, Dezso
2012-01-01
The challenge to bring down the cost of produced photovoltaic (PV) power had a major impact on the PV market and in consequence the grid operators experienced higher and higher PV power penetration. The growing share of this decentralized generation plants started to affect the grid stability...
LonWorks as Fieldbus for PV-Installations; LonWorks als Feldbus fuer PV-Anlagen
Energy Technology Data Exchange (ETDEWEB)
Bergen, Ch. von
2003-07-01
The growing market for photovoltaics increasingly requires suitable quality controls covering plant operators, planners and installers, as well as the electric utilities. Additionally, the interest of the general public in the behaviour of photovoltaic (PV) plants is growing. This includes information from everyday practice. Alongside data retrieval, other themes such as the operative management of the unit and energy management become increasingly important for grid-connected PV systems. Todays measuring systems are not compatible with each other. Data communication between different PV plants with computer-aided analysis- and visualisation programmes is very complicated. LonWorks was introduced by Motorola and Toshiba in 1991. Today it leads the world market for field bus systems. With plug and play, components by several manufacturers can easily be incorporated into a LonWorks network. Today more than 3,500 companies use LonWorks technology. The goal of this project is to introduce the very popular LonWorks technology as a new standard for PV applications. The first objective was to develop a LonWorks interface for our Convert inverters and to connect them into a small network. In a second step we installed a LonWorks system at the 260 kW{sub p} PV plant 'Felsenau' in Berne, Switzerland. All 68 inverters are controlled over power line with LonWorks. The on-site PC acts as LonWorks DataServer and making remote information monitoring and data gathering possible. As soon as a functional error occurs, an alarm will be transmitted via modem to the SMSC (Short Message Service Centre). After two years of operation we can say that all expectations were fulfilled by our new system. Knowledge gained from this project has shown that LonWorks has lived up its considerable promise and can be regarded as a high-quality piece of technology. Integration into an overall system is technically very easy. To do this, however, relatively expensive software solutions have
Performance analysis of PV panel under varying surface temperature
Directory of Open Access Journals (Sweden)
Kumar Tripathi Abhishek
2018-01-01
Full Text Available The surface temperature of PV panel has an adverse impact on its performance. The several electrical parameters of PV panel, such as open circuit voltage, short circuit current, power output and fill factor depends on the surface temperature of PV panel. In the present study, an experimental work was carried out to investigate the influence of PV panel surface temperature on its electrical parameters. The results obtained from this experimental study show a significant reduction in the performance of PV panel with an increase in panel surface temperature. A 5W PV panel experienced a 0.4% decrease in open circuit voltage for every 1°C increase in panel surface temperature. Similarly, there was 0.6% and 0.32% decrease in maximum power output and in fill factor, respectively, for every 1°C increase in panel surface temperature. On the other hand, the short circuit current increases with the increase in surface temperature at the rate of 0.09%/°C.
Begin at the beginning: A BAC-end view of the passion fruit (Passiflora) genome.
Santos, Anselmo Azevedo; Penha, Helen Alves; Bellec, Arnaud; Munhoz, Carla de Freitas; Pedrosa-Harand, Andrea; Bergès, Hélène; Vieira, Maria Lucia Carneiro
2014-09-26
The passion fruit (Passiflora edulis) is a tropical crop of economic importance both for juice production and consumption as fresh fruit. The juice is also used in concentrate blends that are consumed worldwide. However, very little is known about the genome of the species. Therefore, improving our understanding of passion fruit genomics is essential and to some degree a pre-requisite if its genetic resources are to be used more efficiently. In this study, we have constructed a large-insert BAC library and provided the first view on the structure and content of the passion fruit genome, using BAC-end sequence (BES) data as a major resource. The library consisted of 82,944 clones and its levels of organellar DNA were very low. The library represents six haploid genome equivalents, and the average insert size was 108 kb. To check its utility for gene isolation, successful macroarray screening experiments were carried out with probes complementary to eight Passiflora gene sequences available in public databases. BACs harbouring those genes were used in fluorescent in situ hybridizations and unique signals were detected for four BACs in three chromosomes (n=9). Then, we explored 10,000 BES and we identified reads likely to contain repetitive mobile elements (19.6% of all BES), simple sequence repeats and putative proteins, and to estimate the GC content (~42%) of the reads. Around 9.6% of all BES were found to have high levels of similarity to plant genes and ontological terms were assigned to more than half of the sequences analysed (940). The vast majority of the top-hits made by our sequences were to Populus trichocarpa (24.8% of the total occurrences), Theobroma cacao (21.6%), Ricinus communis (14.3%), Vitis vinifera (6.5%) and Prunus persica (3.8%). We generated the first large-insert library for a member of Passifloraceae. This BAC library provides a new resource for genetic and genomic studies, as well as it represents a valuable tool for future whole genome
Solar photovoltaic (PV) energy; latest developments in the building integrated and hybrid PV systems
International Nuclear Information System (INIS)
Zahedi, A.
2006-01-01
Environmental concerns are growing and interest in environmental issues is increasing and the idea of generating electricity with less pollution is becoming more and more attractive. Unlike conventional generation systems, fuel of the solar photovoltaic energy is available at no cost. And solar photovoltaic energy systems generate electricity pollution-free and can easily be installed on the roof of residential as well as on the wall of commercial buildings as grid-connected PV application. In addition to grid-connected rooftop PV systems, solar photovoltaic energy offers a solution for supplying electricity to remote located communities and facilities, those not accessible by electricity companies. The interest in solar photovoltaic energy is growing worldwide. Today, more than 3500MW of photovoltaic systems have been installed all over the world. Since 1970, the PV price has continuously dropped [8]. This price drop has encouraged worldwide application of small-scale residential PV systems. These recent developments have led researchers concerned with the environment to undertake extensive research projects for harnessing renewable energy sources including solar energy. The usage of solar photovoltaic as a source of energy is considered more seriously making future of this technology looks promising. The objective of this contribution is to present the latest developments in the area of solar photovoltaic energy systems. A further objective of this contribution is to discuss the long-term prospect of the solar photovoltaic energy as a sustainable energy supply. [Author
A strategic model for PV dissemination in Thailand
Energy Technology Data Exchange (ETDEWEB)
Hiranvarodom, S. [Rajamangala Inst. of Technology, Dept. of Electrical Engineering, Pathumthani (Thailand); Hill, R. [University of Northumbria, Newcastle Photovoltaics Applications Centre, Newcastle upon Tyne (United Kingdom); O' Keefe, P. [University of Northumbria, Dept. of Geography and Environmental Management, Newcastle upon Tyne (United Kingdom)
1999-07-01
The process of information dissemination is necessary for the successful implementation for photovoltaic (PV) programmes in developing countries, and it is essential to consider the strategies for implementation of a PV project to ensure that it will be successful. This paper proposes a strategic model for PV dissemination in Thailand and discusses the roles of key players in the implementation of the strategy and the responsibilities of these organisations. (Author)
The world PV market 2000: shifting from subsidy to 'fully economic'?
International Nuclear Information System (INIS)
Maycock, Paul
2000-01-01
This article presents an overview of the world grid-connected photovoltaic (PV) market concentrating on the US, Japan and Germany. The PV markets in the three countries are examined, and PV module shipments, the economics of residential PVs in the markets, and forecasts of the grid-connected market are discussed. Details are given of the German 100,000 roofs PV roof subsidy programme to stimulate the residential and commercial grid-connected market. A summary of the grid-connected PV markets in the three countries, and economic information on German grid-connected PV roofs are tabulated
Economic perspective of PV electricity in Oman
International Nuclear Information System (INIS)
Al-Badi, A.H.; Albadi, M.H.; Al-Lawati, A.M.; Malik, A.S.
2011-01-01
Solar and wind energies are likely to play an important role in the future energy generation in Oman. This paper utilizes average daily global solar radiation and sunshine duration data of 25 locations in Oman to study the economic prospects of solar energy. The study considers a solar PV power plant of 5-MW at each of the 25 locations. The global solar radiation varies between slightly greater than 4 kWh/m 2 /day at Sur to about 6 kWh/m 2 /day at Marmul while the average value in the 25 locations is more than 5 kWh/m 2 /day. The results show that the renewable energy produced each year from the PV power plant varies between 9000 MWh at Marmul and 6200 MWh at Sur while the mean value is 7700 MWh of all the 25 locations. The capacity factor of PV plant varies between 20% and 14% and the cost of electricity varies between 210 US$/MWh and 304 US$/MWh for the best location to the least attractive location, respectively. The study has also found that the PV energy at the best location is competitive with diesel generation without including the externality costs of diesel. Renewable energy support policies that can be implemented in Oman are also discussed. -- Research highlights: → The global solar radiation values for 25 locations in Oman are obtained using satellite data that are corrected by data from ground stations. → The study considers a solar PV power plant of 5-MW to calculate the capacity factor (CF) and the cost of energy (COE) at each of the 25 locations. → The study has found that the CF of PV plant varies between 20% and 14% and the corresponding COE varies between 210 US$/MWh and 304 US$/MWh for the best location to the least attractive location, respectively. → The study has found that the PV energy at the best location is competitive with diesel generation without including the externality costs of diesel. → Since PV energy is not competitive with fossil fuel-based generation in most locations renewable energy support mechanisms have been
Photovoltaic (PV) contribution to the primary frequency control
International Nuclear Information System (INIS)
Rafa, Adel Hamad
2012-01-01
Photovoltaic (PV) technology is among the most efficient and cost effective renewable energy kinds currently available on the market. The connection of a large number of PVs to the grid may influence the frequency and voltage stability of the power system. This paper proposes load-frequency control technique for system with high penetration of photovoltaic (PV). The proposed controller has been successfully implemented and tested using PSCAD/EMTDC. In this study, the impact of photovoltaic (PV) on frequency stability of the system is studies in detail. This study shows that large penetration of photovoltaic (PV) with load and frequency control has a significant impact on the stability and security level of electrical network.(author)
Photovoltaic-thermal (PV/T) solar collectors: Features and performance modelling
International Nuclear Information System (INIS)
Atienza-Márquez, Antonio; Bruno, Joan Carles; Coronas, Alberto; Korolija, Ivan; Greenough, Richard; Wright, Andy
2017-01-01
Currently, the electrical efficiency of photovoltaic (PV) solar cells ranges between 5–25%. One of the most important parameters that affects the electrical efficiency of a PV collector is the temperature of its cells: the higher temperature, the lower is the efficiency. Photovoltaic/thermal (PV/T) technology is a potential solution to ensure an acceptable solar energy conversion. The PV/T technology produces both electrical and thermal energy simultaneously. It is suitable for low temperature applications (25–40 o C) and overall efficiency increases compared to individual collectors. This paper describes an installation in a single-family house where PV/T collectors are coupled with a ground heat exchanger and a heat pump for domestic hot water and space heating purposes. The aim of this work is twofold. First, the features of the PV/T technology are analyzed. Second, a model of a flat-plate PV/T water collector was developed in TRNSYS in order to analyze collectors performance. (author)
Impact of Rooftop Solar PV on Residential Distribution Network
DEFF Research Database (Denmark)
Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte; Pillai, Jayakrishnan Radhakrishna
Increased environmental awareness in recent years has encouraged rapid growth of renewable energy sources especially solar PV and wind. Among them, small scale solar PV has been gaining more momentum especially at residential level. Even today moderate penetration of grid tied rooftop solar PV has...... become reality in many countries. In spite of various benefits, higher penetration of rooftop PVs might come up with number of detrimental effects, with power quality and overcurrent protection being the major ones. Therefore, it is reasonable to quantify both drawback and benefits of rooftop PV...
Improving the efficiency of photovoltaic (PV) panels by oil coating
International Nuclear Information System (INIS)
Abd-Elhady, M.S.; Fouad, M.M.; Khalil, T.
2016-01-01
Highlights: • It is possible to improve the efficiency of PV panels by increasing the amount of light transmitted to the panel. • Coating PV panels by a fine layer of Labovac oil increases the amount of sun light transmitted to the panel. • Coating PV panels by a fine layer of Labovac oil increases the power output of the panel. • Coating PV panels with a layer of Labovac oil has to be applied in cold countries and not in hot regions. - Abstract: The objective of this research is to develop a new technique for improving the efficiency of Photovoltaic (PV) panels. This technique is done by coating the front surface of the PV panel by a fine layer of oil in order to increase the amount of light transmitted to the panel, and consequently its efficiency. Different types of oils are examined, including both mineral oils and natural oils. In case of mineral oils; vacuum pump oil (Labovac oil), engine oil (Mobil oil) and brake oil (Abro oil) are examined, while in case of natural oils; olive and sunflower oils are examined. An experimental setup has been developed to examine the performance of the PV panels as a function of oil coatings. The experimental setup consists of an artificial sun, the PV panel under investigation, a cooling system and a measuring system to measure the performance of the panel. It has been found that coating the PV panel with a fine layer of Labovac oil, ∼1 mm thick, improves the efficiency of the PV panel by more than 20%, and this is due to the high transmissivity of the Labovac oil compared to other oils. However, the Labovac oil has a drawback which is overheating of the panel due to its high transmissivity. Coating of PV panels with a fine layer of Labovac oil should be done only in cold regions, in order to avoid the heating effect that can decrease the power output of PV panels.
Directory of Open Access Journals (Sweden)
Daniel Antonio Villamil Montero
2013-08-01
Full Text Available Passiflora quadrangularis L. é uma espécie originária do neotrópico, conhecida no Brasil como maracujá-melão devido ao tamanho e formato dos seus frutos. Tem sido amplamente disseminada nas regiões tropicais do mundo onde é produzida em pequena escala para comercialização dos frutos, o que ocorre bem próximo às regiões de cultivo, em função da dificuldade de conservação pós-colheita. As plantas são trepadeiras bastante vigorosas, com flores abundantes, grandes e perfumadas, o que amplia o seu valor e a torna particularmente interessante para caramanchões e cercas-vivas. O uso efetivo de passifloras no mercado de plantas ornamentais depende de estudos da fenologia floral. Neste trabalho foram estudadas algumas características da fenologia floral e o perfume das flores de P. quadrangularis, sob cultivo protegido. São apresentados os dados relativos ao período de floração, picos de florescimento e intensidade relativa das flores, bem como algumas características do perfume floral. Conclui-se que a espécie representa uma nova alternativa de cultivo para fins ornamentais, por apresentar múltiplas flores em antese simultânea, abundantes, grandes, fragrantes e coloridas, com longo período de floração no ano, além de frutos comestíveis, folhas exuberantes e medicinais que oferecem amplo sombreamento para áreas externas de lazer e/ou outras plantas cultivadas.
International Nuclear Information System (INIS)
Beck, T.; Kondziella, H.; Huard, G.; Bruckner, T.
2016-01-01
Highlights: • MILP optimization model for operation and investment of PV-battery systems. • Use of high resolution (10 s) electrical household load and PV generation profiles. • Analysis of influence of temporal resolution on self-consumption and optimal sizing. • Electrical load profile characteristics influence required temporal resolution. - Abstract: The interest in self-consumption of electricity generated by rooftop photovoltaic systems has grown in recent years, fueled by decreasing levelized costs of electricity and feed-in tariffs as well as increasing end customer electricity prices in the residential sector. This also fostered research on grid-connected PV-battery storage systems, which are a promising technology to increase self-consumption. In this paper a mixed-integer linear optimization model of a PV-battery system that minimizes the total discounted operating and investment costs is developed. The model is employed to study the effect of the temporal resolution of electrical load and PV generation profiles on the rate of self-consumption and the optimal sizing of PV and PV-battery systems. In contrast to previous studies high resolution (10 s) measured input data for both PV generation and electrical load profiles is used for the analysis. The data was obtained by smart meter measurements in 25 different households in Germany. It is shown that the temporal resolution of load profiles is more critical for the accuracy of the determination of self-consumption rates than the resolution of the PV generation. For PV-systems without additional storage accurate results can be obtained by using 15 min solar irradiation data. The required accuracy for the electrical load profiles depends strongly on the load profile characteristics. While good results can be obtained with 60 s for all electrical load profiles, 15 min data can still be sufficient for load profiles that do not exhibit most of their electricity consumption at power levels above 2 k
Design procedures of hybrid PV/SMES system
International Nuclear Information System (INIS)
Hamad, Ismail; El-Sayas, M. A.
2006-01-01
This paper presents accurate procedures to determine the design parameters of an autonomous hybrid PV/SMES system. Integrating Superconductive magnetic energy storage as a recent storage technology with photovoltaic power system enhances the PV output utilization during the solar radiation fluctuations period. this is because of SMES fast response to any PV output fluctuation. The load demand is supplied either from PV plant or through SMES or from both. Imposed to the technical and economical constrains, the optimum solar cells area and the proper capacity and rating of SMES system are assessed. Regarding solar radiation profile, clear and cloudy days are accurately considered for investigation. Three indices are suggested to express the cloudy and fluctuations conditions. These indices represent the non-utilized PV energy due to clouds (x), fluctuation period (T f ) and location of fluctuations period(t s t). The incremental changes in the design parameters are computed for any variation in these indices. Differentiation between the role of BS and SMES in affecting the results is determined and quantitatively analyzed. The results of clear day condition with SMES are the bas quantities for these changes. Complete analysis of the most effective parameters is presented. Eventually, mathematical models are deduced for each parameter which assists in predicting its behavior against the independent variable.(Author)
The Value of Transparency in Distributed Solar PV Markets | Solar Research
suggest that PV customers benefit from gaining access to more PV quotes. Context Prospective PV customers are relatively non-transparent; customers are largely unaware of market prices and may not obtain the lowest available price. PV customers that use quote aggregators-third-party companies that collect quotes
On the Impact of Partial Shading on PV Output Power
DEFF Research Database (Denmark)
Sera, Dezso; Baghzouz, Yahia
2008-01-01
clarifies the mechanism of partial PV shading on a number of PV cells connected in series and/or parallel with and without bypass diodes. The analysis is presented in simple terms and can be useful to someone who wishes to determine the impact of some shading geometry on a PV system. The analysis...... is illustrated by measurements on a commercial 70 W panel, and a 14.4 kW PV array....
Review of PV Inverter Technology Cost and Performance Projections
Energy Technology Data Exchange (ETDEWEB)
Navigant Consulting Inc.
2006-01-01
The National Renewable Energy Laboratory (NREL) has a major responsibility in the implementation of the U.S. Department of Energy's (DOE's) Solar Energy Technologies Program. Sandia National Laboratories (SNL) has a major role in supporting inverter development, characterization, standards, certifications, and verifications. The Solar Energy Technologies Program recently published a Multiyear Technical Plan, which establishes a goal of reducing the Levelized Energy Cost (LEC) for photovoltaic (PV) systems to $0.06/kWh by 2020. The Multiyear Technical Plan estimates that, in order to meet the PV system goal, PV inverter prices will need to decline to $0.25-0.30 Wp by 2020. DOE determined the need to conduct a rigorous review of the PV Program's technical and economic targets, including the target set for PV inverters. NREL requested that Navigant Consulting Inc.(NCI) conduct a review of historical and projected cost and performance improvements for PV inverters, including identification of critical barriers identified and the approaches government might use to address them.
Solar Photovoltaic (PV) Distributed Generation Systems - Control and Protection
Yi, Zhehan
This dissertation proposes a comprehensive control, power management, and fault detection strategy for solar photovoltaic (PV) distribution generations. Battery storages are typically employed in PV systems to mitigate the power fluctuation caused by unstable solar irradiance. With AC and DC loads, a PV-battery system can be treated as a hybrid microgrid which contains both DC and AC power resources and buses. In this thesis, a control power and management system (CAPMS) for PV-battery hybrid microgrid is proposed, which provides 1) the DC and AC bus voltage and AC frequency regulating scheme and controllers designed to track set points; 2) a power flow management strategy in the hybrid microgrid to achieve system generation and demand balance in both grid-connected and islanded modes; 3) smooth transition control during grid reconnection by frequency and phase synchronization control between the main grid and microgrid. Due to the increasing demands for PV power, scales of PV systems are getting larger and fault detection in PV arrays becomes challenging. High-impedance faults, low-mismatch faults, and faults occurred in low irradiance conditions tend to be hidden due to low fault currents, particularly, when a PV maximum power point tracking (MPPT) algorithm is in-service. If remain undetected, these faults can considerably lower the output energy of solar systems, damage the panels, and potentially cause fire hazards. In this dissertation, fault detection challenges in PV arrays are analyzed in depth, considering the crossing relations among the characteristics of PV, interactions with MPPT algorithms, and the nature of solar irradiance. Two fault detection schemes are then designed as attempts to address these technical issues, which detect faults inside PV arrays accurately even under challenging circumstances, e.g., faults in low irradiance conditions or high-impedance faults. Taking advantage of multi-resolution signal decomposition (MSD), a powerful signal
Lifetime Evaluation of PV Inverters considering Panel Degradation Rates and Installation Sites
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso
2017-01-01
The PV inverter lifetime is affected by the installed sites related to different solar irradiance and ambient temperature profiles. In fact, the installation site also affects the PV panel degradation rate, and thus the long-term power production. Prior-art lifetime analysis in PV inverters has...... not yet investigated the impact of panel degradation. This paper thus evaluates the lifetime of PV inverters considering panel degradation rates and installation sites. Evaluations have been carried out on PV systems installed in Denmark and Arizona. The results reveal that the PV panel degradation rate...... has a considerable impact on the PV inverter lifetime, especially in the hot climate (e.g., Arizona), where the panel degrades at a faster rate. In that case, the PV inverter lifetime estimation can be deviated by 54%, if the impact of PV panel degradation is not taken into account....
Optimization of a PV/T (photovoltaic/thermal) active solar still
International Nuclear Information System (INIS)
Saeedi, F.; Sarhaddi, F.; Behzadmehr, A.
2015-01-01
In this paper, the optimization of a PV/T (photovoltaic/thermal) active solar still is carried out. Analytical expressions for glass cover temperature, basin temperature, brackish water temperature and fresh water productivity are obtained by writing energy balance for different components of PV/T active solar still. The output electrical power of PV/T active solar still is calculated by four-parameter I–V (current–voltage) model. Objective function in present study is the energy efficiency of PV/T active solar still. A computer simulation program has been developed in order to obtain thermal and electrical parameters, respectively. The simulation results of the present study are in fair agreement with the experimental data of previous literatures. Finally, the optimization of PV/T active solar still has been carried out and the optimized value of mass flow rate, number of PV/T collector and the objective function have been obtained. Furthermore, the effect of various operating parameters on energy efficiency have been investigated. - Highlights: • The comprehensive optimization of a PV/T active solar still is carried out. • Present study is based on numerical simulation. • A modified energy efficiency for PV/T active solar still is obtained. • The effect of design and operating parameters is investigated on energy efficiency
Design of direct solar PV driven air conditioner
Huang, Bin-Juine
2015-12-05
© 2015 Elsevier Ltd. Solar air conditioning system directly driven by stand-alone solar PV is studied. The air conditioning system will suffer from loss of power if the solar PV power generation is not high enough. It requires a proper system design to match the power consumption of air conditioning system with a proper PV size. Six solar air conditioners with different sizes of PV panel and air conditioners were built and tested outdoors to experimentally investigate the running probabilities of air conditioning at various solar irradiations. It is shown that the instantaneous operation probability (OPB) and the runtime fraction (RF) of the air conditioner are mainly affected by the design parameter rpL (ratio of maximum PV power to load power). The measured OPB is found to be greater than 0.98 at instantaneous solar irradiation IT > 600 W m-2 if rpL > 1.71 RF approaches 1.0 (the air conditioner is run in 100% with solar power) at daily-total solar radiation higher than 13 MJ m-2 day-1, if rpL > 3.
Energy Technology Data Exchange (ETDEWEB)
Wilkins, A. [Matrix Energy Inc., Montreal, PQ (Canada)
2010-11-15
This article discussed issues involving the supply chain for photovoltaic (PV) equipment that is emerging in Ontario as a result of the Feed-in-Tariff (FIT) program that was launched in late 2009. The rapidly developing PV supply chain may not be taking a sustainable path. The domestic-content requirement is making manufacturers outlay capital to set up manufacturing in Ontario without reliable market data. Only a small number of dealer/installers have any meaningful experience designing and installing grid-tie PV. Until recently, wholesale distributors designed and supplied most grid-tie PV systems in Canada, and solar dealers/installers or electricians or electrical contractors did the installation. Instead of selling directly to dealer/installers, solar manufacturers should develop strong relationships with wholesalers, who have system design experience and product training. This would allow manufacturers to focus on their core strength, reach more customers, and keep lower inventory levels. Wholesale distributors in turn provide dealer/installers with expertise in product and system design, training from a range of manufacturers, marketing and logistics support, and immediate access to inventory. Manufacturers generally lack appropriate accounting, engineering, marketing, and logistics services to deal with a multitude of active accounts, and they are not structured to work with architects and engineers to do complete system design. Partnering with wholesale distributors allows manufacturers to take on the residential and small-scale commercial sectors by building brand awareness and increasing market share and sales across Canada. 2 figs.
International Nuclear Information System (INIS)
Wilkins, A.
2010-01-01
This article discussed issues involving the supply chain for photovoltaic (PV) equipment that is emerging in Ontario as a result of the Feed-in-Tariff (FIT) program that was launched in late 2009. The rapidly developing PV supply chain may not be taking a sustainable path. The domestic-content requirement is making manufacturers outlay capital to set up manufacturing in Ontario without reliable market data. Only a small number of dealer/installers have any meaningful experience designing and installing grid-tie PV. Until recently, wholesale distributors designed and supplied most grid-tie PV systems in Canada, and solar dealers/installers or electricians or electrical contractors did the installation. Instead of selling directly to dealer/installers, solar manufacturers should develop strong relationships with wholesalers, who have system design experience and product training. This would allow manufacturers to focus on their core strength, reach more customers, and keep lower inventory levels. Wholesale distributors in turn provide dealer/installers with expertise in product and system design, training from a range of manufacturers, marketing and logistics support, and immediate access to inventory. Manufacturers generally lack appropriate accounting, engineering, marketing, and logistics services to deal with a multitude of active accounts, and they are not structured to work with architects and engineers to do complete system design. Partnering with wholesale distributors allows manufacturers to take on the residential and small-scale commercial sectors by building brand awareness and increasing market share and sales across Canada. 2 figs.
Generation of large-scale PV scenarios using aggregated power curves
DEFF Research Database (Denmark)
Nuño Martinez, Edgar; Cutululis, Nicolaos Antonio
2017-01-01
The contribution of solar photovoltaic (PV) power to the generation is becoming more relevant in modern power system. Therefore, there is a need to model the variability large-scale PV generation accurately. This paper presents a novel methodology to generate regional PV scenarios based...... on aggregated power curves rather than traditional physical PV conversion models. Our approach is based on hourly mesoscale reanalysis irradiation data and power measurements and do not require additional variables such as ambient temperature or wind speed. It was used to simulate the PV generation...... on the German system between 2012 and 2015 showing high levels of correlation with actual measurements (93.02–97.60%) and small deviations from the expected capacity factors (0.02–1.80%). Therefore, we are confident about the ability of the proposed model to accurately generate realistic large-scale PV...
Optimal design of NPC and Active-NPC transformerless PV inverters
DEFF Research Database (Denmark)
Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede
2012-01-01
Targeting at a cost-effective deployment of grid-connected PhotoVoltaic (PV) systems, this paper presents a new methodology for the optimal design of transformerless PV inverters, which are based on the Neutral Point Clamped (NPC) and the Active-Neutral Point Clamped (ANPC) topologies. The design...... optimization results demonstrate that a different set of optimal values of the PV inverter switching frequency and output filter components are derived for the NPC and ANPC topologies, respectively, as well as for each of the PV inverter installation sites under study. The NPC and ANPC PV inverter structures......, which are derived using the proposed design optimization methodology exhibit lower Levelized Cost Of generated Electricity (LCOE) and manufacturing cost and they are simultaneously capable to inject more energy into the electric grid than the corresponding non-optimized PV inverters. Thus, the proposed...
A Novel Frequency Restoring Strategy of Hydro-PV Hybrid Microgrid
DEFF Research Database (Denmark)
Wei, Feng; Kai, Sun; Guan, Yajuan
2014-01-01
. The existence of frequency steady-state error and the slow active power/frequency dynamic response are inevitable. Therefore, a novel frequency restoring strategy for the hydro-PV hybrid microgrid based on the improved hierarchical control of PV systems is proposed in this paper. The output active power of PV......The conventional PV systems based on the voltage inverters only inject dispatched power to the utility grid when they work at a grid-connected mode in the hydro-PV hybrid microgrid. Due to the droop method employed for load sharing between generators, as well as the enormous inertia of system...... systems is controlled by an extra frequency restoring controller resided in the tertiary control level. The frequency steady-state error is eliminated through regulating and rebalancing the power flow between the hydropower and the PV system. The proposed strategy has verified through simulations...
Wide-band gap devices in PV systems - opportunities and challenges
DEFF Research Database (Denmark)
Sintamarean, Nicolae Cristian; Eni, Emanuel-Petre; Blaabjerg, Frede
2014-01-01
have an important role in the cost reduction. To increase the efficiency of PV systems, most of solutions for PV inverters have moved to three-level (3L) structures reaching typical efficiencies of 98% due to low switching losses of 600V Si IGBT or MOSFET and reduced core losses in the filter......The recent developments in wide band-gap devices based GaN and SiC is showing a high impact on the PV-inverter technology, which is strongly influenced by efficiency, power density and cost. Besides the high efficiency of PV inverters, also the mechanical size, the compactness and simple structure......) three-phase PV-inverter topologies in terms of efficiency, thermal loading distribution and costs. Moreover the above mentioned PV-inverters are built and tested in laboratory in order to validate the obtained results....
On the Impacts of PV Array Sizing on the Inverter Reliability and Lifetime
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso; Blaabjerg, Frede; Zhou, Dao
2018-01-01
To enable a more wide scale utilization of PV systems, the cost of PV energy should be comparable to or even lower than other energy sources. Due to the relatively low cost of PV modules, oversizing PV arrays becomes a common approach to reduce the cost of PV energy in practice. By doing so, the total energy yield can be increased under weak solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inv...
PV Module Reliability Workshop | Photovoltaic Research | NREL
Gok, Cara Fagerholm, David M. Burns, Timothy J. Peshek, Laura S. Bruckman, Roger H. French Backsheet Chen, C. H. Hsueh, W. J. Hsieh Accurately Measuring PV Power Loss Due to Soiling-Michael Gostein and Walters, Stephen Barkaszi Tracking PV Changes: Bridging Between Thin-Film Cells and Modules-Russell
Assessing the need for better forecasting and observability of pv
DEFF Research Database (Denmark)
Alet, Pierre-Jean; Efthymiou, Venizelos; Graditi, Giorgio
2017-01-01
In its review of the challenges and opportunities associated with massive deployment of solar PV generation, the Grid integration working group of the ETIP PV identified forecasting and observability as critical technologies for the planning and operation of the power system with large PV...... penetration. In this white paper ETIP PV set out to spell out in more details what features are needed from these technologies and what is the state of the art....
Sub-synchronous resonance damping using high penetration PV plant
Khayyatzadeh, M.; Kazemzadeh, R.
2017-02-01
The growing need to the clean and renewable energy has led to the fast development of transmission voltage-level photovoltaic (PV) plants all over the world. These large scale PV plants are going to be connected to power systems and one of the important subjects that should be investigated is the impact of these plants on the power system stability. Can large scale PV plants help to damp sub-synchronous resonance (SSR) and how? In this paper, this capability of a large scale PV plant is investigated. The IEEE Second Benchmark Model aggregated with a PV plant is utilized as the case study. A Wide Area Measurement System (WAMS) based conventional damping controller is designed and added to the main control loop of PV plant in order to damp the SSR and also investigation of the destructive effect of time delay in remote feedback signal. A new optimization algorithm called teaching-learning-based-optimization (TLBO) algorithm has been used for managing the optimization problems. Fast Furrier Transformer (FFT) analysis and also transient simulations of detailed nonlinear system are considered to investigate the performance of the controller. Robustness of the proposed system has been analyzed by facing the system with disturbances leading to significant changes in generator and power system operating point, fault duration time and PV plant generated power. All the simulations are carried out in MATLAB/SIMULINK environment.
Effect of wind speed on performance of a solar-pv array
Thousands of solar photovoltaic (PV) arrays have been installed over the past few years, but the effect of wind speed on the predicted performance of PV arrays is not usually considered by installers. An increase in wind speed will cool the PV array, and the electrical power of the PV modules will ...
Control of Single-Stage Single-Phase PV inverter
DEFF Research Database (Denmark)
Ciobotaru, Mihai; Teodorescu, Remus; Blaabjerg, Frede
2005-01-01
In this paper the issue of control strategies for single-stage photovoltaic (PV) inverter is addressed. Two different current controllers have been implemented and an experimental comparison between them has been made. A complete control structure for the single-phase PV system is also presented......-forward; - and the grid current controller implemented in two different ways, using the classical proportional integral (PI) and the novel proportional resonant (PR) controllers. The control strategy was tested experimentally on 1.5 kW PV inverter....
Impacts of Solar PV Arrays on Physicochemical Properties of Soil
Cagle, A.; Choi, C. S.; Macknick, J.; Ravi, S.; Bickhart, R.
2017-12-01
The deployment of renewable energy technologies, such as solar photovoltaics (PV), is rapidly escalating. While PV can provide clean, renewable energy, there is uncertainty regarding its potential positive and/or negative impacts on the local environment. Specifically, its effects on the physicochemical properties of the underlying soil have not been systematically quantified. This study facilitates the discussion on the effects of PV installations related to the following questions: i. How do soil moisture, infiltration rates, total organic carbon, and nitrogen contents vary spatially under a PV array? ii. How do these physicochemical properties compare to undisturbed and adjacent land covered in native vegetation? iii. Are these variations statistically significant to provide insight on whether PV installations have beneficial or detrimental impacts on soil? We address these questions through field measurements of soil moisture, infiltration, grain particle size distribution, total organic carbon, and nitrogen content at a 1-MW solar PV array located at the National Renewable Energy Laboratory in Golden, Colorado. We collect data via multiple transects underneath the PV array as as well as in an adjacent plot of undisturbed native vegetation. Measurements are taken at four positions under the solar panels; the east-facing edge, center area under the panel, west-facing edge, and interspace between panel rows to capture differences in sun exposure as well as precipitation runoff of panels. Measurements are collected before and after a precipitation event to capture differences in soil moisture and infiltration rates. Results of this work can provide insights for research fields associated with the co-location of agriculture and PV installations as well as the long term ecological impacts of solar energy development. Trends in physicochemical properties under and between solar panels can affect the viability of co-location of commercial crops in PV arrays, the
Energy Technology Data Exchange (ETDEWEB)
Perers, Bengt
2007-02-15
We have found a large number of PV simulation and calculation programmes available on Internet. Many of the programmes are free ware and can still be quite sophisticated like HOMER from NREL and RETSCreen from NRCan. We have made a closer look on the programmes PVSYST, HOMER, RETSCreen and compared to the Swedish PVSUN. All programmes are quite similar in use and in application areas and very easy to use nowadays. The main advantage with PVSUN for Swedish conditions is that it is based on TRNSYS knowledge available on research level. This means that the software can be adapted to new findings from research and development at a relatively low cost. The original question for this project about the availability of easy to use PV/T (photovoltaic/thermal) simulation softwares can be answered no. The PV/T technology is still mainly in the research and development stages.
Prospects for PV: a learning curve analysis
International Nuclear Information System (INIS)
Zwaan, Bob van der; Rabi, A.
2003-01-01
This article gives an overview of the current state-of-the-art of photovoltaic electricity technology, and addresses its potential for cost reductions over the first few decades of the 21st century. Current PV production cost ranges are presented, both in terms of capacity installation and electricity generation, of single crystalline silicon, multi-crystalline silicon, amorphous silicon and other thin film technologies. Possible decreases of these costs are assessed, as expected according to the learning-curve methodology. We also estimate how much PV could gain if external costs (due to environmental and health damage) of energy were internalised, for example by an energy tax. Our conclusions are that, (1) mainly due its high costs, PV electricity is unlikely to play a major role in global energy supply and carbon emissions abatement before 2020, (2) extrapolating learning curves observed in the past, one can expect its costs to decrease significantly over the coming years, so that a considerable PV electricity share world-wide could materialise after 2020, (3) niche-market applications, e.g. using stand-alone systems in remote areas, are crucial for continuing 'the ride along the learning curve', (4) damage costs of conventional (fossil) power sources are considerable, and their internalisation would improve the competitiveness of PV, although probably not enough to close the current cost gap. (author)
Voltage stability issues in a distribution grid with large scale PV plant
Energy Technology Data Exchange (ETDEWEB)
Perez, Alvaro Ruiz; Marinopoulos, Antonios; Reza, Muhamad; Srivastava, Kailash [ABB AB, Vaesteraas (Sweden). Corporate Research Center; Hertem, Dirk van [Katholieke Univ. Leuven, Heverlee (Belgium). ESAT-ELECTA
2011-07-01
Solar photovoltaics (PV) has become a competitive renewable energy source. The production of solar PV cells and panels has increased significantly, while the cost is reduced due to economics of scale and technological achievements in the field. At the same time, the increase in efficiency of PV power systems and high energy prices are expected to lead PV systems to grid parity in the coming decade. This is expected to boost even more the large scale implementation of PV power plants (utility scale PV) and therefore the impact of such large scale PV plants to power system needs to be studies. This paper investigates the voltage stability issues arising from the connection of a large PV power plant to the power grid. For this purpose, a 15 MW PV power plant was implemented into a distribution grid, modeled and simulated using DIgSILENT Power Factory. Two scenarios were developed: in the first scenario, active power injected into the grid by the PV power plants was varied and the resulted U-Q curve was analyzed. In the second scenario, the impact of connecting PV power plants to different points in the grid - resulting in different strength of the connection - was investigated. (orig.)
Modeling Single-Phase PV HB-ZVR Inverter Connected to Grid
DEFF Research Database (Denmark)
Guo, Yougui; Zeng, Ping; Zhu, Jieqiong
2011-01-01
PLECS is used to model the PV H-bridge zero voltage rectifier (HB-ZVR) inverter connected to grid and good results are obtained. First, several common topologies of PV inverters are introduced. Then the unipolar PWM control strategy is described for PV HB-ZVR inverter. Third, PLECS is briefly...... introduced. Fourth, the modeling of PV HB-ZVR inverter is presented with PLECS. Finally, a series of simulations are carried out. The simulation results tell us PLECS is very powerful tool to real power circuits and it is very easy to simulate LCL filter. They have also verified that the unipolar PWM control...... strategy is feasible to control the PV HB-ZVR inverter....
Control Strategies for the DAB Based PV Interface System.
Directory of Open Access Journals (Sweden)
Hadi M El-Helw
Full Text Available This paper presents an interface system based on the Dual Active Bridge (DAB converter for Photovoltaic (PV arrays. Two control strategies are proposed for the DAB converter to harvest the maximum power from the PV array. The first strategy is based on a simple PI controller to regulate the terminal PV voltage through the phase shift angle of the DAB converter. The Perturb and Observe (P&O Maximum Power Point Tracking (MPPT technique is utilized to set the reference of the PV terminal voltage. The second strategy presented in this paper employs the Artificial Neural Network (ANN to directly set the phase shift angle of the DAB converter that results in harvesting maximum power. This feed-forward strategy overcomes the stability issues of the feedback strategy. The proposed PV interface systems are modeled and simulated using MATLAB/SIMULINK and the EMTDC/PSCAD software packages. The simulation results reveal accurate and fast response of the proposed systems. The dynamic performance of the proposed feed-forward strategy outdoes that of the feedback strategy in terms of accuracy and response time. Moreover, an experimental prototype is built to test and validate the proposed PV interface system.
Voltage rise mitigation for solar PV integration at LV grids
DEFF Research Database (Denmark)
Yang, Guangya; Marra, Francesco; Juamperez Goñi, Miguel Angel
2015-01-01
Solar energy from photovoltaic (PV) is among the fastest developing renewable energy systems worldwide. Driven by governmental subsidies and technological development, Europe has seen a fast expansion of solar PV in the last few years. Among the installed PV plants, most of them are situated...
Optimal Capacity Allocation of Large-Scale Wind-PV-Battery Units
Directory of Open Access Journals (Sweden)
Kehe Wu
2014-01-01
Full Text Available An optimal capacity allocation of large-scale wind-photovoltaic- (PV- battery units was proposed. First, an output power model was established according to meteorological conditions. Then, a wind-PV-battery unit was connected to the power grid as a power-generation unit with a rated capacity under a fixed coordinated operation strategy. Second, the utilization rate of renewable energy sources and maximum wind-PV complementation was considered and the objective function of full life cycle-net present cost (NPC was calculated through hybrid iteration/adaptive hybrid genetic algorithm (HIAGA. The optimal capacity ratio among wind generator, PV array, and battery device also was calculated simultaneously. A simulation was conducted based on the wind-PV-battery unit in Zhangbei, China. Results showed that a wind-PV-battery unit could effectively minimize the NPC of power-generation units under a stable grid-connected operation. Finally, the sensitivity analysis of the wind-PV-battery unit demonstrated that the optimization result was closely related to potential wind-solar resources and government support. Regions with rich wind resources and a reasonable government energy policy could improve the economic efficiency of their power-generation units.
NREL PV Working With Industry, v. 27, Third Quarter 2000
Energy Technology Data Exchange (ETDEWEB)
Poole, L.; Nahan, R.
2000-09-12
NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The third quarter, contains articles on several important PV-related conferences held in the prior three months: the REAP/HBCU Conference and the IPS-2000 Photochemistry Conference. The issue also contains a preview article of the PV Specialists conference held in Alaska in September. The editorialist is John Benner, PV Specialist Conference Program Chairman.
Evaluating the limits of solar photovoltaics (PV) in traditional electric power systems
International Nuclear Information System (INIS)
Denholm, Paul; Margolis, Robert M.
2007-01-01
In this work, we examine some of the limits to large-scale deployment of solar photovoltaics (PV) in traditional electric power systems. Specifically, we evaluate the ability of PV to provide a large fraction (up to 50%) of a utility system's energy by comparing hourly output of a simulated large PV system to the amount of electricity actually usable. The simulations use hourly recorded solar insolation and load data for Texas in the year 2000 and consider the constraints of traditional electricity generation plants to reduce output and accommodate intermittent PV generation. We find that under high penetration levels and existing grid-operation procedures and rules, the system will have excess PV generation during certain periods of the year. Several metrics are developed to examine this excess PV generation and resulting costs as a function of PV penetration at different levels of system flexibility. The limited flexibility of base load generators produces increasingly large amounts of unusable PV generation when PV provides perhaps 10-20% of a system's energy. Measures to increase PV penetration beyond this range will be discussed and quantified in a follow-up analysis
Plug and Play PV Systems for American Homes
Energy Technology Data Exchange (ETDEWEB)
Hoepfner, Christian [Fraunhofer USA, Inc., Boston, MA (United States)
2016-12-22
The core objectives of the Plug & Play PV Systems Project were to develop a PV system that can be installed on a residential rooftop for less than $1.50/W in 2020, and in less than 10 hours (from point of purchase to commissioning). The Fraunhofer CSE team’s approach to this challenge involved a holistic approach to system design – hardware and software – that make Plug & Play PV systems: • Quick, easy, and safe to install • Easy to demonstrate as code compliant • Permitted, inspected, and interconnected via an electronic process Throughout the three years of work during this Department of Energy SunShot funded project, the team engaged in a substantive way with inspectional services departments and utilities, manufacturers, installers, and distributors. We received iterative feedback on the system design and on ideas for how such systems can be commercialized. This ultimately led us to conceiving of Plug & Play PV Systems as a framework, with a variety of components compatible with the Plug & Play PV approach, including string or microinverters, conventional modules or emerging lightweight modules. The framework enables a broad group of manufacturers to participate in taking Plug & Play PV Systems to market, and increases the market size for such systems. Key aspects of the development effort centered on the system hardware and associated engineering work, the development of a Plug & Play PV Server to enable the electronic permitting, inspection and interconnection process, understanding the details of code compliance and, on occasion, supporting applications for modifications to the code to allow lightweight modules, for example. We have published a number of papers on our testing and assessment of novel technologies (e.g., adhered lightweight modules) and on the electronic architecture.
Directory of Open Access Journals (Sweden)
Gisela Ferreira
2005-08-01
Full Text Available O objetivo deste trabalho foi avaliar a germinação de sementes de Passiflora alata Curtis sob o efeito da presença de arilo em diferentes substratos de papel e submetidas a pré-tratamentos germinativos. Foram realizados dois experimentos (com e sem remoção de arilo, com delineamento experimental inteiramente casualizado, com 8 tratamentos e 5 repetições de 25 sementes, em esquema fatorial 2x4 (substratos x tratamentos pré-germinativos para cada experimento. Os tratamentos foram constituídos pelos substratos (sobre papel em gerbox e entre papel em rolo e tratamentos pré-germinativos (sementes embebidas em GA3 e água, papel de germinação umedecido com GA3 e água. Pode-se verificar que a germinação das sementes sem arilo foi maior, em substratos sobre papel ou entre papel, umedecidos com GA3.The objective of this work was to evaluate the germination seeds of Passiflora alata submitted to effect of aril presence in different substrates and previous germinated treatments. The work was conduced with two experiments (with and without aril in a completely randomized design with 8 treatments, 5 replicates per treatment and 25 seeds, in a factorial scheme 2X4 (substrates x previous germinated treatments for each experiment. The treatments were composed with the substrates gerbox and roll of paper, and the following previous germinated treatments: seeds soaked in GA3 and in water, paper infusion in GA3 and in water. The analysis of the data showed that the germination has improved when extracting the aril and administrating GA3 infusion in gerbox or roll of paper.
Training and certification of PV installers in Europe
International Nuclear Information System (INIS)
Tsoutsos, Theocharis; Tournaki, Stavroula; Gkouskos, Zacharias; Masson, Gaetan; Holden, John; Huidobro, Ana; Stoykova, Evelina; Rata, Camelia; Bacan, Andro; Maxoulis, Christos; Charalambous, Anthi
2013-01-01
The European strategy for the coming decades sets specific targets for a sustainable growth, including reaching a 20% share of renewables in final energy consumption till 2020. To achieve this target, a number of initiatives and measures have been in force. Europe, is currently the largest market for PV systems with more than 75% of the annual worldwide installations in 2011. The favourable European policies as well as the Member States’ supporting legislations have resulted in high market growth for photovoltaics. Applying PV technologies however, requires high qualified technicians to install, repair and maintain them. Until today, national markets have been growing faster than the skilled PV installers force can satisfy. The PVTRIN, an Intelligent Energy Europe action, addresses these issues by developing a training and certification scheme for technicians active in the installation and maintenance of small scale PV systems. During the implementation of the action, a market research was conducted in the six participating countries in order to record the stakeholders’ attitudes, perceptions and considerations and to adapt the training methods, tools and materials to the national PV industry requirements and markets’ needs. Indicative results of this analysis as well as the current situation regarding relevant training and certification schemes are presented in this paper. - Highlights: ► Market research in six EU countries on PV professional Training and Certification needs. ► PVTRIN scheme integrates the national legislations and the market's needs. ► The different aspects (technical, institutional, financial) are presented
PV Reconfiguration Systems: a Technical and Economic Study
Directory of Open Access Journals (Sweden)
Caruso M.
2017-03-01
Full Text Available Dynamical electrical array reconfiguration strategies for grid-connected PV systems have been proposed as solution to improve energy production due to the mismatch effect of PV plants during partial shading conditions. Strategies are based on the use of dynamic connections between PV panels given by the employment of switches that allow for each panel the series, parallel or exclusion connections, physically changing the electrical connections between the related PV modules, consequentially modifying the layout of the plant. Usually the cost of the dynamic matrix is not taken into account. This novel work evaluates the economic advantages obtained by the use of reconfiguration strategies in PV systems, by taking into consideration the price of energy due to incentives in different European and non-European countries and correlates it with the employment of two types of reconfigurators, with different internal structures. For each of the incentives proposed by the different Countries, the main strength and weakness points of the possible investment are highlighted and critically analyzed. From this analysis, it can be stated that the adoption of reconfiguration systems, in certain cases, can be a very convenient solution.
Polymerase chain reaction (PCR) is particularly useful for plant pathogen detection. In the present study, multiplex PCR and SYBR green real-time PCR were developed to facilitate simultaneous detection of three important rice pathogens, Xanthomonas oryzae pv. oryzae, X. oryzae pv. oryzicola, and Bur...
PV GRID Advisory Paper. Consultation version: key recommendations
Energy Technology Data Exchange (ETDEWEB)
Barth, Bianca; Concas, Giorgia; Cossent, Rafael; Franz, Oliver; Frias, Pablo; Hermes, Roland; Lama, Riccardo; Loew, Holger; Mateo, Carlos; Rekinger, Manoel; Sonvilla, Paolo Michele; Vandenbergh, Michel
2014-01-15
PV GRID is a transnational collaborative effort under the umbrella of the Intelligent Energy Europe programme. The main project goal is to enhance photovoltaic (PV) hosting capacity in distribution grids while overcoming regulatory and normative barriers hampering the application of available technical solutions. The European PV GRID advisory paper aims at providing an overview of the issues and barriers that need to be addressed in order to enhance the distribution grid hosting capacity for PV and other distributed generation (DG).To this purpose, barriers are classified as either cross-cutting challenges or specific barriers, depending on whether they have an overarching, system-wide character or rather focus on one single issue such as curtailment, self-consumption or storage. Finally, a set of preliminary recommendations on how to overcome these issues is presented, allowing for the implementation of the identified technical solutions.
PV Project Finance in the United States, 2016
Energy Technology Data Exchange (ETDEWEB)
Feldman, David; Lowder, Travis; Schwabe, Paul
2016-09-01
This brief is a compilation of data points and market insights that reflect the state of the project finance market for solar photovoltaic (PV) assets in the United States as of the third quarter of 2016. This information can generally be used as a simplified benchmark of the costs associated with securing financing for solar PV as well as the cost of the financing itself (i.e., the cost of capital). Three sources of capital are considered -- tax equity, sponsor equity, and debt -- across three segments of the PV marketplace.
Cost-Reduction Roadmap for Residential Solar Photovoltaics (PV), 2017-2030
Energy Technology Data Exchange (ETDEWEB)
Cook, Jeffrey J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ardani, Kristen B. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Fu, Ran [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2018-01-03
The installed cost of solar photovoltaics (PV) has fallen rapidly in recent years and is expected to continue declining in the future. In this report, we focus on the potential for continued PV cost reductions in the residential market. From 2010 to 2017, the levelized cost of energy (LCOE) for residential PV declined from 52 cents per kilowatt-hour (cents/kWh) to 16 cents/kWh (Fu et al. 2017). The U.S. Department of Energy's (DOE's) Solar Energy Technologies Office (SETO) recently set new LCOE targets for 2030, including a target of 5 cents/kWh for residential PV. We present a roadmap for achieving the SETO 2030 residential PV target. Because the 2030 target likely will not be achieved under business-as-usual trends (NREL 2017), we examine two key market segments that demonstrate significant opportunities for cost savings and market growth: installing PV at the time of roof replacement and installing PV as part of the new home construction process. Within both market segments, we identify four key cost-reduction opportunities: market maturation, business model integration, product innovation, and economies of scale. To assess the potential impact of these cost reductions, we compare modeled residential PV system prices in 2030 to the National Renewable Energy Laboratory's (NREL's) quarter one 2017 (Q1 2017) residential PV system price benchmark (Fu et al. 2017). We use a bottom-up accounting framework to model all component and project-development costs incurred when installing a PV system. The result is a granular accounting for 11 direct and indirect costs associated with installing a residential PV system in 2030. All four modeled pathways demonstrate significant installed-system price savings over the Q1 2017 benchmark, with the visionary pathways yielding the greatest price benefits. The largest modeled cost savings are in the supply chain, sales and marketing, overhead, and installation labor cost categories. When we translate these
Solar Plus: A Holistic Approach to Distributed Solar PV
Energy Technology Data Exchange (ETDEWEB)
O' Shaughnessy, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ardani, Kristen [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cutler, Dylan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-05-25
Solar 'plus' refers to an emerging approach to distributed solar photovoltaic (PV) deployment that uses energy storage and controllable devices to optimize customer economics. The solar plus approach increases customer system value through technologies such as electric batteries, smart domestic water heaters, smart air-conditioner (AC) units, and electric vehicles We use an NREL optimization model to explore the customer-side economics of solar plus under various utility rate structures and net metering rates. We explore optimal solar plus applications in five case studies with different net metering rates and rate structures. The model deploys different configurations of PV, batteries, smart domestic water heaters, and smart AC units in response to different rate structures and customer load profiles. The results indicate that solar plus improves the customer economics of PV and may mitigate some of the negative impacts of evolving rate structures on PV economics. Solar plus may become an increasingly viable model for optimizing PV customer economics in an evolving rate environment.
Solar Plus: A Holistic Approach to Distributed Solar PV
Energy Technology Data Exchange (ETDEWEB)
OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ardani, Kristen B. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Cutler, Dylan S. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-06-08
Solar 'plus' refers to an emerging approach to distributed solar photovoltaic (PV) deployment that uses energy storage and controllable devices to optimize customer economics. The solar plus approach increases customer system value through technologies such as electric batteries, smart domestic water heaters, smart air-conditioner (AC) units, and electric vehicles We use an NREL optimization model to explore the customer-side economics of solar plus under various utility rate structures and net metering rates. We explore optimal solar plus applications in five case studies with different net metering rates and rate structures. The model deploys different configurations of PV, batteries, smart domestic water heaters, and smart AC units in response to different rate structures and customer load profiles. The results indicate that solar plus improves the customer economics of PV and may mitigate some of the negative impacts of evolving rate structures on PV economics. Solar plus may become an increasingly viable model for optimizing PV customer economics in an evolving rate environment.
Self-control system in storage unit of PV plants
Energy Technology Data Exchange (ETDEWEB)
Al-Shaban, Saad; Mohmoud, Ali [Hadhramout Univ. of Science and Technology, Faculty of Engineering, Mukalla (Yemen)
2000-04-01
A new system for self-controlling of storage batteries being charged by PV plants has been developed. This provides enhanced system reliability, lower system cost, and simpler operation for the user. In this system, the only requirement is to design and select PV panels so that their voltage-sensitive region (on the I-V curve) coincides with that required for a simpler remote PV plant and for long periods. (Author)
PV O&M Cost Model and Cost Reduction
Energy Technology Data Exchange (ETDEWEB)
Walker, Andy
2017-03-15
This is a presentation on PV O&M cost model and cost reduction for the annual Photovoltaic Reliability Workshop (2017), covering estimating PV O&M costs, polynomial expansion, and implementation of Net Present Value (NPV) and reserve account in cost models.
Passive cooling of standalone flat PV module with cotton wick structures
International Nuclear Information System (INIS)
Chandrasekar, M.; Suresh, S.; Senthilkumar, T.; Ganesh karthikeyan, M.
2013-01-01
Highlights: • A simple passive cooling system is developed for standalone flat PV modules. • 30% Reduction in module temperature is observed with developed cooling system. • 15.61% Increase in output power of PV module is found with developed cooling system. • Module efficiency is increased by 1.4% with cooling arrangement. • Lower thermal degradation due to narrow range of temperature characteristics. - Abstract: In common, PV module converts only 4–17% of the incoming solar radiation into electricity. Thus more than 50% of the incident solar energy is converted as heat and the temperature of PV module is increased. The increase in module temperature in turn decreases the electrical yield and efficiency of the module with a permanent structural damage of the module due to prolonged period of thermal stress (also known as thermal degradation of the module). An effective way of improving efficiency and reducing the rate of thermal degradation of a PV module is to reduce the operating temperature of PV module. This can be achieved by cooling the PV module during operation. Hence in the present work, a simple passive cooling system with cotton wick structures is developed for standalone flat PV modules. The thermal and electrical performance of flat PV module with cooling system consisting of cotton wick structures in combination with water, Al 2 O 3 /water nanofluid and CuO/water nanofluid are investigated experimentally. The experimental results are also compared with the thermal and electrical performance of flat PV module without cooling system
R and D into stand-alone PV systems for export
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-09-01
The current status of photovoltaic (PV) technology is reviewed for systems to provide electricity where mains supplies are unavailable, known as stand-alone PV systems. Typical applications and experiences with installed stand-alone systems are described. Economic issues and barriers to the wide use of PV systems are also examined. (UK)
Retaining the Value of PV at High Penetration Workshop
Energy Technology Data Exchange (ETDEWEB)
Kurtz, Sarah; Bolen, Michael
2017-01-19
PV prices have dropped and are now attractive without incentives for peaking applications in some locations. Modeling suggests and, empirically, some regions demonstrate that as PV penetration increases its value decreases, predominantly due to a decrease in energy and capacity value. It is not apparent what technologies and price may be needed for PV to supply tens of percent of electricity in the most economically efficient manner. A 1-day workshop was co-sponsored by EPRI and NREL with support from ASU. A dozen presentations and discussions introduced how the interplay of various technologies impact the value of PV, identified technical challenges and gaps impeding implementation, and discussed future R&D needs and opportunities.
PV Systems Reliability Final Technical Report.
Energy Technology Data Exchange (ETDEWEB)
Lavrova, Olga [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flicker, Jack David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Johnson, Jay [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Armijo, Kenneth Miguel [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Gonzalez, Sigifredo [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Schindelholz, Eric John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorensen, Neil R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Yang, Benjamin Bing-Yeh [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-12-01
The continued exponential growth of photovoltaic technologies paves a path to a solar-powered world, but requires continued progress toward low-cost, high-reliability, high-performance photovoltaic (PV) systems. High reliability is an essential element in achieving low-cost solar electricity by reducing operation and maintenance (O&M) costs and extending system lifetime and availability, but these attributes are difficult to verify at the time of installation. Utilities, financiers, homeowners, and planners are demanding this information in order to evaluate their financial risk as a prerequisite to large investments. Reliability research and development (R&D) is needed to build market confidence by improving product reliability and by improving predictions of system availability, O&M cost, and lifetime. This project is focused on understanding, predicting, and improving the reliability of PV systems. The two areas being pursued include PV arc-fault and ground fault issues, and inverter reliability.
Issues and prospects vis a vis Indian PV commercialization programme
International Nuclear Information System (INIS)
Deambi, Suneel
1994-01-01
Following a large scale demonstration of photovoltaic systems attending to the important requirements of lighting, water pumping, television and battery charging etc. in the remote surroundings of India, serious efforts are being made to promote the commercial use of these systems. A recently launched World Bank-supported project on PV market development has provided the much needed boost to the Indian PV programme. This paper tries to analyse the issues and prospects with respect to the National PV Commercialization Programme in view of the changing PV scenario in the country. (author)
Dynamic Characteristics Analysis and Stabilization of PV-Based Multiple Microgrid Clusters
DEFF Research Database (Denmark)
Zhao, Zhuoli; Yang, Ping; Wang, Yuewu
2018-01-01
-based multiple microgrid clusters. A detailed small-signal model for PV-based microgrid clusters considering local adaptive dynamic droop control mechanism of the voltage-source PV system is developed. The complete dynamic model is then used to access and compare the dynamic characteristics of the single...... microgrid and interconnected microgrids. In order to enhance system stability of the PV microgrid clusters, a tie-line flow and stabilization strategy is proposed to suppress the introduced interarea and local oscillations. Robustly selecting of the key control parameters is transformed to a multiobjective......As the penetration of PV generation increases, there is a growing operational demand on PV systems to participate in microgrid frequency regulation. It is expected that future distribution systems will consist of multiple microgrid clusters. However, interconnecting PV microgrids may lead to system...
An Improved Matlab-Simulink Model of PV Module considering Ambient Conditions
Directory of Open Access Journals (Sweden)
R. Ayaz
2014-01-01
Full Text Available A photovoltaic (PV model is proposed on Matlab/Simulink environment considering the real atmospheric conditions and this PV model is tested with different PV panels technologies (monocrystalline silicon, polycrystalline silicon, and thin film. The meteorological data of Istanbul—the location of the study—such as irradiance, cell temperature, and wind speed are taken into account in the proposed model for each technology. Eventually, the power outputs of the PV module under real atmospheric conditions are measured for resistive loading and these powers are compared with the results of proposed PV model. As a result of the comparison, it is shown that the proposed model is more compatible for monocrystal silicon and thin-film modules; however, it does not show a good correlation with polycrystalline silicon PV module.
Fuzzy Logic Based MPPT Controller for a PV System
Directory of Open Access Journals (Sweden)
Carlos Robles Algarín
2017-12-01
Full Text Available The output power of a photovoltaic (PV module depends on the solar irradiance and the operating temperature; therefore, it is necessary to implement maximum power point tracking controllers (MPPT to obtain the maximum power of a PV system regardless of variations in climatic conditions. The traditional solution for MPPT controllers is the perturbation and observation (P&O algorithm, which presents oscillation problems around the operating point; the reason why improving the results obtained with this algorithm has become an important goal to reach for researchers. This paper presents the design and modeling of a fuzzy controller for tracking the maximum power point of a PV System. Matlab/Simulink (MathWorks, Natick, MA, USA was used for the modeling of the components of a 65 W PV system: PV module, buck converter and fuzzy controller; highlighting as main novelty the use of a mathematical model for the PV module, which, unlike diode based models, only needs to calculate the curve fitting parameter. A P&O controller to compare the results obtained with the fuzzy control was designed. The simulation results demonstrated the superiority of the fuzzy controller in terms of settling time, power loss and oscillations at the operating point.
On the Impacts of PV Array Sizing on the Inverter Reliability and Lifetime
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso
2018-01-01
, the total energy yield can be increased under weak solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter reliability and lifetime. In that case, it may result in a negative impact on the overall PV...... energy cost, due to the increased maintenance for the PV inverters. With the above concern, this paper evaluates the reliability and lifetime of PV inverters considering the PV array sizing. The evaluation is based on the mission profile of the installation sites in Denmark and Arizona, where...... the reliability-critical components such as power devices and capacitors are considered. The results reveal that the variation in the PV array sizing can considerably deviate the reliability performance and lifetime expectation of PV inverters, especially for those installed in Denmark, where the average solar...
Cardozo Gutiérrez, Rito Hernán
2011-01-01
Los ensayos de la germinación de semilla de curuba (Passiflora mollisima (HBK) Bailey en condiciones de laboratorio, muestran que la testa retarda la absorción del agua y es el principal factor de control de la germinación. El ácido giberélico aplicado incrementa la germinación y refuerza considerablemente los efectos de la escarificación.
Variations of PV Panel Performance Installed over a Vegetated Roof and a Conventional Black Roof
Directory of Open Access Journals (Sweden)
Mohammed J. Alshayeb
2018-05-01
Full Text Available The total worldwide photovoltaic (PV capacity has been growing from about 1 GW at the beginning of the twenty-first century to over 300 GW in 2016 and is expected to reach 740 GW by 2022. PV panel efficiency is reported by PV manufacturers based on laboratory testing under Standard Testing Condition with a specific temperature of 25 °C and solar irradiation of 1000 W/m2. This research investigated the thermal interactions between the building roof surface and PV panels by examining the differences in PV panel temperature and energy output for those installed over a green roof (PV-Green and those installed over a black roof (PV-Black. A year-long experimental study was conducted over the roof of an educational building with roof mounted PV panels with a system capacity of 4.3 kW to measure PV underside surface temperature (PV-UST, ambient air temperature between PV panel and building roof (PV-AT, and PV energy production (PV-EP. The results show that during the summer the PV-Green consistently recorded lower PV-UST and PV-AT temperatures and more PV-EP than PV-Black. The average hourly PV-EP difference was about 0.045 kWh while the maximum PV-EP difference was about 0.075 kWh, which represents roughly a 3.3% and 5.3% increase in PV-EP. For the entire study period, EP-Green produced 19.4 kWh more energy, which represents 1.4% more than EP-Black.
Development of outdoor luminescence imaging for drone-based PV array inspection
DEFF Research Database (Denmark)
Benatto, Gisele Alves dos Reis; Riedel, Nicholas; Thorsteinsson, Sune
2017-01-01
This work has the goal to examined experimentally PV module imaging methods under natural light conditions, that will be used in a fast, accurate and automatic drone-based inspection system for PV power plants.......This work has the goal to examined experimentally PV module imaging methods under natural light conditions, that will be used in a fast, accurate and automatic drone-based inspection system for PV power plants....
Is rooftop solar PV at socket parity without subsidies?
International Nuclear Information System (INIS)
Hagerman, Shelly; Jaramillo, Paulina; Morgan, M. Granger
2016-01-01
Installations of rooftop solar photovoltaic (PV) technology in the United States have increased dramatically in recent years, in large part because of state and federal subsidies. In the future, such subsidies may be reduced or eliminated. From the homeowner's perspective, solar PV is competitive when it can produce electricity at a cost equivalent to the retail electricity rate, a condition sometimes referred to as “socket parity”. In assessing the economic viability of residential solar PV, most existing literature considers only a few locations and fails to consider the differences in PV system cost and electricity prices that exist across the U.S. We combined insolation data from more than 1000 locations, installation costs by region, and county-level utility rates to provide a more complete economic assessment of rooftop solar PV across the U.S. We calculated the break-even electricity prices and evaluated the reductions in installed costs needed to reach socket parity. Among the scenarios considered, we estimate that only Hawaii has achieved socket parity without the use of subsidies. With subsidies, six states reach socket parity, yet widespread parity is still not achieved. We find that high installation costs and financing rates are two of the largest barriers to socket parity. - Highlights: • We evaluate the economic viability of residential rooftop solar PV across the U.S. • Widespread socket parity has not been achieved in the U.S. without subsidies. • Net metering may be critical for the economic viability of rooftop solar PV.
Cooled solar PV panels for output energy efficiency optimisation
International Nuclear Information System (INIS)
Peng, Zhijun; Herfatmanesh, Mohammad R.; Liu, Yiming
2017-01-01
Highlights: • Effects of cooling on solar PV performance have been experimentally investigated. • As a solar panel is cooled down, the electric output can have significant increase. • A cooled solar PV system has been proposed for resident application. • Life cycle assessment suggests the cost payback time of cooled PV can be reduced. - Abstract: As working temperature plays a critical role in influencing solar PV’s electrical output and efficacy, it is necessary to examine possible way for maintaining the appropriate temperature for solar panels. This research is aiming to investigate practical effects of solar PV surface temperature on output performance, in particular efficiency. Experimental works were carried out under different radiation condition for exploring the variation of the output voltage, current, output power and efficiency. After that, the cooling test was conducted to find how much efficiency improvement can be achieved with the cooling condition. As test results show the efficiency of solar PV can have an increasing rate of 47% with the cooled condition, a cooling system is proposed for possible system setup of residential solar PV application. The system performance and life cycle assessment suggest that the annual PV electric output efficiencies can increase up to 35%, and the annual total system energy efficiency including electric output and hot water energy output can increase up to 107%. The cost payback time can be reduced to 12.1 years, compared to 15 years of the baseline of a similar system without cooling sub-system.
PV solar electricity industry: Market growth and perspective
International Nuclear Information System (INIS)
Hoffmann, Winfried
2006-01-01
The photovoltaic (PV) solar electricity market has shown an impressive 33% growth per year since 1997 until today with market support programs as the main driving force. The rationales for this development and the future projections towards a 100 billion | industry in the 2020s, by then only driven by serving cost-competitively customer needs are described. The PV market, likely to have reached about 600MW in the year 2003, is discussed according to its four major segments: consumer applications, remote industrial electrification, developing countries, and grid-connected systems. While in the past, consumer products and remote industrial applications used to be the main cause for turnover in PV, in recent years the driving forces are more pronounced in the grid-connected systems and by installations in developing countries. Examples illustrating the clear advantage of systems using PV over conventional systems based, e.g., on diesel generators in the rural and remote electrification sector are discussed. For the promotion of rural electrification combined with the creation of local business and employment, suitable measures are proposed in the context of the PV product value chain. The competitiveness of grid-connected systems is addressed, where electricity generating costs for PV are projected to start to compete with conventional utility peak power quite early between 2010 and 2020 if time-dependent electricity tariffs different for bulk and peak power are assumed. The most effective current-pulling force for grid-connected systems is found to be the German Renewable Energy (EEG) Feed-in Law where the customers are focusing on yield, performance, and long-life availability. The future growth in the above-defined four market segments are discussed and the importance of industry political actions in order to stimulate the markets either in grid-connected systems by feed-in tariff programs as well as for off-grid rural developing country applications by long
PV solar electricity industry: Market growth and perspective
Energy Technology Data Exchange (ETDEWEB)
Hoffmann, Winfried [RWE SCHOTT Solar GmbH, Carl-Zeiss-Str. 4, 63755 Alzenau (Germany)
2006-11-23
The photovoltaic (PV) solar electricity market has shown an impressive 33% growth per year since 1997 until today with market support programs as the main driving force. The rationales for this development and the future projections towards a 100 billion | industry in the 2020s, by then only driven by serving cost-competitively customer needs are described. The PV market, likely to have reached about 600MW in the year 2003, is discussed according to its four major segments: consumer applications, remote industrial electrification, developing countries, and grid-connected systems. While in the past, consumer products and remote industrial applications used to be the main cause for turnover in PV, in recent years the driving forces are more pronounced in the grid-connected systems and by installations in developing countries. Examples illustrating the clear advantage of systems using PV over conventional systems based, e.g., on diesel generators in the rural and remote electrification sector are discussed. For the promotion of rural electrification combined with the creation of local business and employment, suitable measures are proposed in the context of the PV product value chain. The competitiveness of grid-connected systems is addressed, where electricity generating costs for PV are projected to start to compete with conventional utility peak power quite early between 2010 and 2020 if time-dependent electricity tariffs different for bulk and peak power are assumed. The most effective current-pulling force for grid-connected systems is found to be the German Renewable Energy (EEG) Feed-in Law where the customers are focusing on yield, performance, and long-life availability. The future growth in the above-defined four market segments are discussed and the importance of industry political actions in order to stimulate the markets either in grid-connected systems by feed-in tariff programs as well as for off-grid rural developing country applications by long
Assessment of MPPT Techniques During the Faulty Conditions of PV System
Directory of Open Access Journals (Sweden)
Bhukya Krishna Naick
2018-01-01
Full Text Available The contribution of Distributed Generation (DG systems like wind energy systems and solar Photovoltaic (PV systems on the generation of electricity has increased. Out of these DG systems, the PV systems have gained wide popularity, because of the availability of solar energy throughout the day. Depending on the size of PV installations, a large number of PV modules can be interconnected in the form of series and parallel connection. Since a large number of modules are interconnected, it is possible for the faults in a PV array to occur due to the failure of protection system, which can cause damage to the PV module and also the decrease in the output power. This paper presents the tracking of a maximum power point under the faulty conditions of 12x5 PV array. The fault conditions that have been considered in the PV array are open circuit fault, line to ground, line to line and failure of bypass diodes. Perturb and observe, incremental conductance and fuzzy logic controller are the maximum power point tracking techniques that have been implemented. For each of the fault conditions, the results have been presented in terms of the maximum power tracked, tracking time and tracking efficiency.
A Non-Modeling Exploration of Residential Solar Photovoltaic (PV) Adoption and Non-Adoption
Energy Technology Data Exchange (ETDEWEB)
Moezzi, Mithra [Portland State Univ., Portland, OR (United States); Ingle, Aaron [Portland State Univ., Portland, OR (United States); Lutzenhiser, Loren [Portland State Univ., Portland, OR (United States); Sigrin, Benjamin O. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-01
Although U.S. deployment of residential rooftop solar photovoltaic (PV) systems has accelerated in recent years, PV is still installed on less than 1 percent of single-family homes. Most research on household PV adoption focuses on scaling initial markets and modeling predicted growth rather than considering more broadly why adoption occurs. Among the studies that have investigated the characteristics of PV adoption, most collected data from adopters, sometimes with additional non-adopter data, and rarely from people who considered but did not adopt PV. Yet the vast majority of Americans are non-adopters, and they are a diverse group - understanding their ways of evaluating PV adoption is important. Similarly, PV is a unique consumer product, which makes it difficult to apply findings from studies of other technologies to PV. In addition, little research addresses the experience of households after they install PV. This report helps fill some of these gaps in the existing literature. The results inform a more detailed understanding of residential PV adoption, while helping ensure that adoption is sufficiently beneficial to adopters and even non-adopters.
Comparison and selection of off-grid PV systems
Izmailov, Andrey Yu.; Lobachevsky, Yakov P.; Shepovalova, Olga V.
2018-05-01
This work deals with comparison, evaluation and selection of PV systems of the same type based on their technical parameters either indicated in their technical specifications or calculated ones. Stand-alone and grid backed up photoelectric systems have been considered. General requirements for photoelectric system selection and evaluation have been presented that ensure system operability and required efficiency in operation conditions. Generic principles and definition of photoelectric systems characteristics have been considered. The described method is mainly targeted at PV engineering personnel and private customers purchasing PV systems. It can be also applied in the course of project contests, tenders, etc.
Robustness analysis of the efficiency in PV inverters
DEFF Research Database (Denmark)
Pigazo, Alberto; Liserre, Marco; Blaabjerg, Frede
2013-01-01
topology and control strategy but also on the characteristics of the employed components. The aim of this paper is evaluate the effect of physical variations associated to the main components on the overall efficiency of PV inverters. It is concluded that a statistical evaluation of the power converter......During last years an increasing attention has been paid to the efficiency of grid-connected PV inverters. They are manufactured from a number of discrete components and by using a certain topology and control strategy. Hence, the performance of a certain PV inverter not only depends on the selected...
Building PV markets: customers and prices
International Nuclear Information System (INIS)
Haas, Reinhard
2002-01-01
What makes market deployment strategies for PV successful? A group of specialists (from IEA Task 7) has been looking at the progress made so far. Here, in the first of two articles based on their report, the author presents some of their findings, including benefits and barriers for defined groups of customers; how customers for PV systems are identified, and what they are willing to pay. It also looks at current prices in different countries, and their possible trends. (Author)
Modelling PV modules' performance in Sahelian climates
Energy Technology Data Exchange (ETDEWEB)
Diarra, D.C.; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering
2003-08-01
This paper describes the development of a thermo-optical model designed to evaluate the temperature of a photovoltaic (PV) module in an effort to design a cost-effective cooling system for PV modules operating under high ambient temperatures. The power output of a PV module is greatly reduced when its temperature rises. This loss in efficiency is particularly significant in Sahelian regions where PV modules are subjected to high solar radiation intensities and high ambient temperatures. The newly developed thermo-optical model confirms that most of the heat in a PV module is generated in the solar cell. The results of the analysis include: the optical absorption, reflection and transmission of the solar radiation incident on the module; the temperature distribution in the module; and, the heat transfer through the top and bottom of the module. At incidence angles of 60 degrees, approximately three-quarters of the heat is generated in the solar cell. The optical efficiency is 88.44 per cent at normal incidence angle and 82.48 per cent when the incidence angle is 60 degrees. It was determined that the cooling system should be located as close as possible to the solar cell in order to increase the thermal heat flow from the cell. 4 refs., 3 tabs., 4 figs.
Solar cell junction temperature measurement of PV module
Huang, B.J.
2011-02-01
The present study develops a simple non-destructive method to measure the solar cell junction temperature of PV module. The PV module was put in the environmental chamber with precise temperature control to keep the solar PV module as well as the cell junction in thermal equilibrium with the chamber. The open-circuit voltage of PV module Voc is then measured using a short pulse of solar irradiation provided by a solar simulator. Repeating the measurements at different environment temperature (40-80°C) and solar irradiation S (200-1000W/m2), the correlation between the open-circuit voltage Voc, the junction temperature Tj, and solar irradiation S is derived.The fundamental correlation of the PV module is utilized for on-site monitoring of solar cell junction temperature using the measured Voc and S at a short time instant with open circuit. The junction temperature Tj is then determined using the measured S and Voc through the fundamental correlation. The outdoor test results show that the junction temperature measured using the present method, Tjo, is more accurate. The maximum error using the average surface temperature Tave as the junction temperature is 4.8 °C underestimation; while the maximum error using the present method is 1.3 °C underestimation. © 2010 Elsevier Ltd.
Industry consultation on grid connection of small PV systems
Energy Technology Data Exchange (ETDEWEB)
Knight, J.; Thorneycroft, J.; Cotterell, M.; Gambro, S.
2000-07-01
This report presents the results of consultation within the PV industry and the electricity supply industry concerning guidelines for the connection of small PV systems to the electricity network. (author)
Delta Power Control Strategy for Multi-String Grid-Connected PV Inverters
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Blaabjerg, Frede
2016-01-01
With a still increasing penetration level of grid-connected PV systems, more advanced active power control functionalities have been introduced in certain grid regulations. A delta power constraint, where a portion of the active power from the PV panels is reserved during operation, is required...... for grid support (e.g., during frequency deviation). In this paper, a cost-effective solution to realize delta power control for grid-connected PV systems is presented, where the residential/commercial multi-string PV inverter configuration is adopted. This control strategy is a combination of Maximum...... for the entire PV system is achieved. Simulations and experiments have been performed on a 3-kW single-phase grid-connected PV system. The results have confirmed the effectiveness of the delta power control strategy, where the power reserve according to the delta power constraint is achieved under several...
Directory of Open Access Journals (Sweden)
Alberto Alberti
2015-01-01
Full Text Available Feline viral plaques are uncommon skin lesions clinically characterized by multiple, often pigmented, and slightly raised lesions. Numerous reports suggest that papillomaviruses (PVs are involved in their development. Immunosuppressed and immunocompetent cats are both affected, the biological behavior is variable, and the regression is possible but rarely documented. Here we report a case of a FIV-positive cat with skin fragility syndrome and regressing multiple viral plaques in which the contemporary presence of two PV types (FcaPV2 and FcaPV3 was demonstrated by combining a quantitative molecular approach to histopathology. The cat, under glucocorticoid therapy for stomatitis and pruritus, developed skin fragility and numerous grouped slightly raised nonulcerated pigmented macules and plaques with histological features of epidermal thickness, mild dysplasia, and presence of koilocytes. Absolute quantification of the viral DNA copies (4555 copies/microliter of FcaPV2 and 8655 copies/microliter of FcaPV3 was obtained. Eighteen months after discontinuation of glucocorticoid therapy skin fragility and viral plaques had resolved. The role of the two viruses cannot be established and it remains undetermined how each of the viruses has contributed to the onset of VP; the spontaneous remission of skin lesions might have been induced by FIV status change over time due to glucocorticoid withdraw and by glucocorticoids withdraw itself.
Karsten Wambach
2017-01-01
This presentation was part of the Workshop: Recycling, reuse and resource efficiency: New solutions for a PV circular economy - Results from the projects CABRISS and ECOSOLAR. The workshop was organized within Freiberg Silicon Days 2017.
Energy rating procedure for PV-modules; Energy rating procedure voor PV-modules
Energy Technology Data Exchange (ETDEWEB)
Van der Borg, N.J.C.M.; Jansen, M.J. [ECN Zon, Petten (Netherlands)
2005-10-15
The performance of PV-modules is usually characterized by the nominal power at standard test conditions. However more relevant for the end-user is the energy production. To arrive at a so-called energy rating procedure the P(G{sub i},T{sub m}) matrix is defined, which makes it possible to calculate the expected annual energy production of a PV-module at any given location with known frequency distribution of horizontal irradiation and ambient temperature. In order to make the de P(G{sub i},T{sub m}) independent of the time and location of the tests the effective irradiation (G{sub i}) is measured with a device with the same characteristics as the module under test. Such a device can be a suitable reference cell or, even better, the module under test itself. The latter, however, is only possible in case the module under test is stable in time. Measurements were performed to test the applicability of the so-called self-reference for a-Si modules. Furthermore the difference between the effective irradiance and the real irradiance (measured with a pyranometer) was quantified for the test location Petten, the Netherlands. The conclusions are: Self-reference is not applicable for a-Si modules because of the time instability, even after 1 full year of degradation; Self-reference signals (the short circuit current of the module under test) can be calibrated outdoor by comparison with a pyranometer at irradiance levels above 800 W/m{sup 2}. The uncertainty of such a calibration is within 3%; The difference between the effective irradiance and the real irradiance on annual basis at Petten is virtually zero for x-Si modules and about 1% for a-Si modules. [Dutch] Het is gebruikelijk om de prestatie van PV-modules te karakteriseren met het nominale vermogen onder standaard testcondities (STC). Echter dit nominaal vermogen geeft geen directe indicatie voor de energieopbrengst. Om tot een karakteristiek voor de energie-opbrengst (energy rating) te komen wordt de prestatie van de
How PV system ownership can impact the market value of residential homes
Energy Technology Data Exchange (ETDEWEB)
Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Johnson, Jamie L. [Energy Sense Finance, LLC, Punta Gorda, FL (United States)
2014-01-01
There are multiple ways for a homeowner to obtain the electricity generating and savings benefits offered by a photovoltaic (PV) system. These include purchasing a PV system through various financing mechanisms, or by leasing the PV system from a third party with multiple options that may include purchase, lease renewal or PV system removal. The different ownership options available to homeowners presents a challenge to appraisal and real estate professionals during a home sale or refinance in terms of how to develop a value that is reflective of the PV systems operational characteristics, local market conditions, and lender and underwriter requirements. This paper presents these many PV system ownership options with a discussion of what considerations an appraiser must make when developing the contributory value of a PV system to a residential property.
Analysis of Long-Term Performance of PV Systems
Nordmann, T.; Clavadetscher, L.; van Sark, Wilfried; Green, M.
This report describes the activities, conclusions and continued efforts undertaken in Subtask 1 by the participating countries in IEA-PVPS Task 13. Subtask 1 examines the PV power plant as a system. It collects and studies the data supplied from installed operating PV plants from different countries
Reliability evaluation of an impedance-source PV microconverter
DEFF Research Database (Denmark)
Shen, Yanfeng; Liivik, Elizaveta; Blaabjerg, Frede
2018-01-01
The reliability of an impedance-source PV microconverter is evaluated based on the real-field mission profile. As part of a PV microinverter, the dc-dc microconverter is firstly described. Then the electro-thermal and lifetime models are built for the most reliability-critical components, i...
Estimation of PV energy production based on satellite data
Mazurek, G.
2015-09-01
Photovoltaic (PV) technology is an attractive source of power for systems without connection to power grid. Because of seasonal variations of solar radiation, design of such a power system requires careful analysis in order to provide required reliability. In this paper we present results of three-year measurements of experimental PV system located in Poland and based on polycrystalline silicon module. Irradiation values calculated from results of ground measurements have been compared with data from solar radiation databases employ calculations from of satellite observations. Good convergence level of both data sources has been shown, especially during summer. When satellite data from the same time period is available, yearly and monthly production of PV energy can be calculated with 2% and 5% accuracy, respectively. However, monthly production during winter seems to be overestimated, especially in January. Results of this work may be helpful in forecasting performance of similar PV systems in Central Europe and allow to make more precise forecasts of PV system performance than based only on tables with long time averaged values.
Highlight of Grid-connected PV systems in administrative buildings in Egypt
Directory of Open Access Journals (Sweden)
Dina Said
2017-03-01
Full Text Available Solar energy applications are becoming increasingly common in Egypt. The abundant sunshine in Egypt, as well as the increasing competitiveness of solar energy systems including- but not limited to photovoltaic (PV, – predicts that these technologies could be weighed to be raised in Egypt.PV systems are installed on roof tiles or other parts of building structures to supplement grid utility, reduce electric bills, and provide emergency back–up energy. Moreover, they simultaneously reduce significant amounts of CO2 emissions. It is foreseen, a number of residential and public buildings in Egypt are using solar power to cut electric utility bills significantly. The approximately payback period to recover the investment costs for PV systems is up to about 5 years. In addition, it is more economical to use PV system than grid utility systems. The two components that determine the total initial price of a grid- connected PV system are the modules and the balance of systems (BOS. The BOS includes different components such as mounting frames, inverters and site- specific installation hardware.The Government of Egypt (GOE has endorsed the deployment of PV systems through three approaches. It started with a prime minister decree to install PV projects on one-thousand of the governmental buildings. This was followed by as an initiative called "Shamsk ya Masr", and finally the Feed-in Tariff (FiT projects.Following the prime minster decree the Egyptian Electricity Holding Company (EEHC and its affiliated companies took the lead to install PV systems at the top roof of their administrative buildings and interconnect these systems to the electricity network where the suitable locations have been selected for mounting them. About 90 PV systems have been already mounted with about a capacity of 9 MW. On the other hand, "Shamsk ya Masr" has considered energy efficiency (EE so as to complement the PV systems, which will be installed on administrative
Performance evaluation of stand alone hybrid PV-wind generator
Energy Technology Data Exchange (ETDEWEB)
Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H. [Faculty of Electrical Engineering, Universiti Teknikal Malaysia Melaka (UTeM), Hang Tuah Jaya, 76100 Melaka (Malaysia); Yahaya, M. S. [Faculty of Engineering Technology, Universiti Teknikal Malaysia Melaka (UTeM), Hang Tuah Jaya, 76100 Melaka (Malaysia)
2015-05-15
This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand.
Performance evaluation of stand alone hybrid PV-wind generator
Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H.; Yahaya, M. S.
2015-05-01
This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand.
Performance evaluation of stand alone hybrid PV-wind generator
International Nuclear Information System (INIS)
Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H.; Yahaya, M. S.
2015-01-01
This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand
Designing PV Incentive Programs to Promote Performance: A Reviewof Current Practice
Energy Technology Data Exchange (ETDEWEB)
Barbose, Galen; Wiser, Ryan; Bolinger, Mark
2007-06-01
Increasing levels of financial support for customer-sited photovoltaic (PV) systems, provided through publicly-funded incentive programs, has heightened concerns about the long-term performance of these systems. Given the barriers that customers face to ensuring that their PV systems perform well, and the responsibility that PV incentive programs bear to ensure that public funds are prudently spent, these programs should, and often do, play a critical role in ensuring that PV systems receiving incentives perform well. To provide a point of reference for assessing the current state of the art, and to inform program design efforts going forward, we examine the approaches to encouraging PV system performance used by 32 prominent PV incentive programs in the U.S. We identify eight general strategies or groups of related strategies that these programs have used to address performance issues, and highlight important differences in the implementation of these strategies among programs.
Analysis on the MPPT control of PV generation system using SPRW
Energy Technology Data Exchange (ETDEWEB)
Park, Min Won [Osaka University (Japan); Kim, Bong Tae; Lee, Jae Deuk; Yu, In Keun [Changwon National University (Korea)
2001-07-01
Photovoltaic (PV) system has been studied and watch with keen interest due to a clean and renewable power source. But, because the output power of PV system is not only unstable but also uncontrollable, the MPPT control of PV power system is still hard to be optimized with the tracking failure under the sudden fluctuation of irradiance. Authors proposed a novel transient phenomenon simulation method for PV power generation system under the real field weather condition(SPRW), and the research and development of PV power generation system is expected to be able to analyze easily and cheaply under various conditions with considering the sort of cell, the capacity of system and the used converter system. In this paper, a PV array was simulated to confirm the availability of SPRW. And, several real weather conditions were used with various MPPT controls. (author). 6 refs., 9 figs., 3 tabs.
Directory of Open Access Journals (Sweden)
Cláudio Villela Vieira
1999-01-01
Full Text Available O objetivo deste trabalho foi avaliar a composição químico-bromatológica e as degradabilidades potenciais e efetivas da matéria seca (MS, proteína bruta (PB e fibra em detergente neutro (FDN do resíduo (casca das variedades de maracujá amarela (Passiflora edulis f. Flavicarpa Degener, roxa (Passiflora edulis Sims e doce (Passiflora alata e da mistura das variedades amarela e roxa. Calcularam-se, também, o consumo de MS e as concentrações de amônia, ácidos graxos voláteis e pH no líquido ruminal e a taxa de passagem das fases líquida e sólida da digesta no rúmen de bovinos. Os resíduos (casca in natura apresentaram grande quantidade de água, enquanto a variedade roxa apresentou o maior teor de matéria seca (17,01% e o amarelo, o menor (10,78%. O teor de proteína bruta variou de 9,82% na MS, para a variedade amarela, a 7,53%, para a doce. O teor de fósforo foi 0,13% na MS para a variedade doce, chegando a 0,09, para a roxo, e 0,08%, para a amarelo. Os teores de cálcio, FDN e FDA não diferiram entre as variedades. Às 48 horas de incubação no rúmen, a degradabilidade atingiu ponto máximo para o teor de MS, PB e FDN. Houve interação de tempo e variedade na degradabilidade de MS, PB e FDN. As degradabilidades de PB e FDN foram influenciadas pelas variedades. A DE da FDN foi maior para a mistura (45,85% e menor para a doce (34,61%. O consumo médio de MS foi de 16,90 kg/animal, equivalente a 3,27% do peso vivo ou 156,11 g/kg0,75, quando se utilizou farelo de casca (resíduo com 90% de MS. As concentrações de ácidos graxos voláteis mantiveram-se na faixa de 7,76 a 10,87 mmoles/100 mL. O pH do líquido ruminal variou de 6,03 a 6,75 e o N-amoniacal, de 4,93 a 9,86 mg/100 mL.Chemical composition and the potential and effective degradabilities of dry matter (DM, crude protein (CP and neutral detergent fiber (NDF of passion fruit residue (shelves were studied in the varieties yellow (Passiflora edulis f. Flavicarpa Degener
Directory of Open Access Journals (Sweden)
Jones S. Silva
2012-01-01
Full Text Available The use of renewable resources for power supply in family homes has passed the stage of utopia to became a reality, with limits set by technical and economic parameters. This paper presents the results of a project originated from the initiative of a middle-class family to achieve energy independence at home. The starting point was the concept of home with “zero energy” in which the total energy available is equal to the energy consumed. The solution devised to meet the energy demand of the residence in question is a PV wind diesel hybrid system connected to the grid, with the possibility of energy storage in batteries and in the form of heating water and the environment of the house. As a restriction, the family requested that the system would represent little impact to the lifestyle and landscape. This paper aims to assess the consequences of reductions in the cost of the PV modules on the optimization space, as conceived by the software Homer. The results show that for this system, a 50% reduction in the cost of PV modules allows all viable solutions including PV modules.
Cost-Reduction Roadmap for Residential Solar Photovoltaics (PV),
Office (SETO) residential 2030 photovoltaics (PV) cost target of $0.05 per kilowatt-hour by identifying could influence system costs in key market segments. This report examines two key market segments that demonstrate significant opportunities for cost savings and market growth: installing PV at the time of roof
Recent developments in ASSERT-PV code for subchannel thermalhydraulics
International Nuclear Information System (INIS)
Rao, Y.F.; Hammouda, N.
2003-01-01
This paper summarises recent development of ASSERT-PV, and provides examples of applications to CANDU fuel bundles in predicting flow, heat transfer and sheath temperatures. The development work is intended to improve computational and phenomenological modelling capabilities of ASSERT-PV in simulating various flow scenarios in CANDU fuel bundles. The latest version of ASSERT-PV can be used for simulations of steady state or transient, subchannel thermalhydraulics in CANDU bundles under conditions up to and including post-dryout heat transfer. (author)
Industrial application of PV/T solar energy systems
International Nuclear Information System (INIS)
Kalogirou, S.A.; Tripanagnostopoulos, Y.
2007-01-01
Hybrid photovoltaic/thermal (PV/T) systems consist of PV modules and heat extraction units mounted together. These systems can simultaneously provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation than plain photovoltaics. Industries show high demand of energy for both heat and electricity and the hybrid PV/T systems could be used in order to meet this requirement. In this paper the application aspects in the industry of PV/T systems with water heat extraction is presented. The systems are analyzed with TRNSYS program for three locations Nicosia, Athens and Madison that are located at different latitudes. The system comprises 300 m 2 of hybrid PV/T collectors producing both electricity and thermal energy and a 10 m 3 water storage tank. The work includes the study of an industrial process heat system operated at two load supply temperatures of 60 deg. C and 80 deg. C. The results show that the electrical production of the system, employing polycrystalline solar cells, is more than the amorphous ones but the solar thermal contribution is slightly lower. A non-hybrid PV system produces about 25% more electrical energy but the present system covers also, depending on the location, a large percentage of the thermal energy requirement of the industry considered. The economic viability of the systems is proven, as positive life cycle savings are obtained in the case of hybrid systems and the savings are increased for higher load temperature applications. Additionally, although amorphous silicon panels are much less efficient than the polycrystalline ones, better economic figures are obtained due to their lower initial cost, i.e., they have better cost/benefit ratio
Grid Integration of PV Power based on PHIL testing using different Interface Algorithms
DEFF Research Database (Denmark)
Craciun, Bogdan-Ionut; Kerekes, Tamas; Sera, Dezso
2013-01-01
to be more active in grid support. Therefore, a better understanding and detailed analysis of the PV systems interaction with the grid is needed; hence power hardware in the loop (PHIL) testing involving PV power became an interesting subject to look into. To test PV systems for grid code (GC) compliance......Photovoltaic (PV) power among all renewable energies had the most accelerated growth rate in terms of installed capacity in recent years. Transmission System Operators (TSOs) changed their perspective about PV power and started to include it into their planning and operation, imposing PV systems...
International Nuclear Information System (INIS)
Medina Gutierrez, Julian; Ospina Torres, Rodulfo; Nates Parra, Guiomar
2012-01-01
The purpose of this paper is to study in two crops of purple passion fruit Passiflora edulis f. edulis harvested at different altitudes (2225 m.a.s.l. and 1657 m.a.s.l.) in the municipality of Buenavista - Boyaca, located in the eastern Mountain range of Colombia, in order to familiarize with visitors and pollinators. This study reveals that in both crops there were differences found in composition, the number of visitors and pollinators. In the crop at 2225 m.a.s.l., 7 species were registered, while 18 species were recorded at the 1657 m.a.s.l. crop. In order to achieve this, collected material by the visitors and the floral structures with which they approach, were observed; at the same time four experiments took place: passive pollination, natural pollination, manual pollination and pollinator's efficiency. These experiments established that pollinator species are: in C1 Apis mellifera, and in C2 and Xylocopa frontalis, Xylocopa lachnea and Epicharis sp.
DEFF Research Database (Denmark)
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso
2018-01-01
Lifetime of PV inverters is affected by the installation sites related to different solar irradiance and ambient temperature profiles (also referred to as mission profiles). In fact, the installation site also affects the degradation rate of the PV panels, and thus long-term energy production...... and reliability. Prior-art lifetime analysis in PV inverters has not yet investigated the impact of PV panel degradations. This paper thus evaluates the lifetime of PV inverters considering panel degradation rates and mission profiles. Evaluations have been carried out on PV systems installed in Denmark...... and Arizona. The results reveal that the PV panel degradation rate has a considerable impact on the PV inverter lifetime, especially in the hot climate (e.g., Arizona), where the panel degrades at a faster rate. In that case, the PV inverter lifetime prediction can be deviated by 54%, if the impact of PV...
Solar Plus: A Holistic Approach to Distributed Solar PV | Solar Research |
customer economics. Illustration titled "The Solar Plus Home," showing depicting the relationship rate structures that affect the customer value of PV generation. At the same time, increasing PV . These issues have prompted the PV industry to consider new ways to optimize the customer value of
Maximum power point tracking controller for PV systems using neural networks
Energy Technology Data Exchange (ETDEWEB)
Bahgat, A.B.G. [Cairo Univ. (Egypt). Faculty of Engineering; Helwa, N.H.; Ahmad, G.E.; El Shenawy, E.T. [National Research Center, Dokki, Cairo (Egypt). Solar Energy Dept.
2005-07-01
This paper presents a development and implementation of a PC-based maximum power point tracker (MPPT) for PV system using neural networks (NN). The system consists of a PV module via a MPPT supplying a dc motor that drives an air fan. The control algorithm is developed to use the artificial NN for detecting the optimal operating point under different operating conditions, then the control action gives the driving signals to the MPPT. A PC is used for data acquisition, running the control algorithm, data storage, as well as data display and analysis. The system has been implemented and tested under various operating conditions. The experimental results showed that the PV system with MPPT always tracks the peak power point of the PV module under various operating conditions. The MPPT transmits about 97% of the actual maximum power generated by the PV module. The MPPT not only increases the power from the PV module to the load, but also maintains longer operating periods for the PV system. The air velocity and the air mass flow rate of the mechanical load are increased considerably, due to the increase of the PV system power. It is also found that the increase in the output energy due to using the MPPT is about 45.2% for a clear sunny day. (Author)
Large scale PV plants - also in Denmark. Project report
Energy Technology Data Exchange (ETDEWEB)
Ahm, P [PA Energy, Malling (Denmark); Vedde, J [SiCon. Silicon and PV consulting, Birkeroed (Denmark)
2011-04-15
Large scale PV (LPV) plants, plants with a capacity of more than 200 kW, has since 2007 constituted an increasing share of the global PV installations. In 2009 large scale PV plants with cumulative power more that 1,3 GWp were connected to the grid. The necessary design data for LPV plants in Denmark are available or can be found, although irradiance data could be improved. There seems to be very few institutional barriers for LPV projects, but as so far no real LPV projects have been processed, these findings have to be regarded as preliminary. The fast growing number of very large scale solar thermal plants for district heating applications supports these findings. It has further been investigated, how to optimize the lay-out of LPV plants. Under the Danish irradiance conditions with several winter months with very low solar height PV installations on flat surfaces will have to balance the requirements of physical space - and cost, and the loss of electricity production due to shadowing effects. The potential for LPV plants in Denmark are found in three main categories: PV installations on flat roof of large commercial buildings, PV installations on other large scale infrastructure such as noise barriers and ground mounted PV installations. The technical potential for all three categories is found to be significant and in the range of 50 - 250 km2. In terms of energy harvest PV plants will under Danish conditions exhibit an overall efficiency of about 10 % in conversion of the energy content of the light compared to about 0,3 % for biomass. The theoretical ground area needed to produce the present annual electricity consumption of Denmark at 33-35 TWh is about 300 km2 The Danish grid codes and the electricity safety regulations mention very little about PV and nothing about LPV plants. It is expected that LPV plants will be treated similarly to big wind turbines. A number of LPV plant scenarios have been investigated in detail based on real commercial offers and
Angle Resolved Performance Measurements on PV Glass and Modules
DEFF Research Database (Denmark)
Juutilainen, Line Tollund; Thorsteinsson, Sune; Poulsen, Peter Behrensdorff
2016-01-01
The angular response of PV-modules has significant impact on the energy production. This is especially pronounced in BIPV where installation angles often are far from optimal. Nevertheless, a gain in energy yield may be obtained by choosing a proper glass as superstrate. In this work we present...... the concept of PV balconies as cost efficient and easy way of integrating PV into buildings. The experimental work consists of the fabrication of single cell mini modules with different glass covering, and characterizing their angular response in a custom made setup, where only the direct sunlight is used...... as a light source. As a special case we estimate the annual yield for each glass in the case of PV balconies for a specific geographical location and orientation of the module....
Economic and policy analysis for solar PV systems in Indiana
International Nuclear Information System (INIS)
Jung, Jinho; Tyner, Wallace E.
2014-01-01
In recent years, the energy market in the US and globally is expanding the production of renewable energy. Solar energy for electricity is also expanding in the US. Indiana is one of the states expanding solar energy with solar photovoltaic (PV) systems. Therefore, we conduct benefit cost analysis with several uncertain input variables to determine the economics of adopting solar PV systems in Indiana based on policy instruments that could increase adoption of solar PV systems. The specific objectives are analyses of the cost distribution of solar PV systems compared with grid electricity in homes and estimating the probability that solar can be cheaper than electricity from grids under different policy combinations. We first do the analysis under current policy and then the analysis under potential policy options for a variety of scenarios. Also, the results inform government policy makers on how effective the alternative policies for encouraging solar PV systems are. The results show that current policies are important in reducing the cost of solar PV systems. However, with current policies, there is only 50–50 chance of solar being cheaper than electricity from grids. If potential policies are implemented, solar PV systems can be more economical than grid electricity. - Highlights: • We investigate the economics of solar PV systems based on policy instruments. • We do scenario analyses under different combinations of policies. • We examine the probability of solar being cheaper than grid electricity for each scenario. • With current policies, there is 50–50 chance of solar being cheaper than the grid. • With depreciation and carbon tax, solar is much more economical than the grid
Continuing Developments in PV Risk Management: Strategies, Solutions, and Implications
Energy Technology Data Exchange (ETDEWEB)
Lowder, T.; Mendelsohn, M.; Speer, B.; Hill, R.
2013-02-01
As the PV industry matures, successful risk management practices will become more imperative to ensure investor confidence, control costs, and facilitate further growth. This report discusses several key aspects of risk management during the commercial- and utility-scale project life cycle, from identification of risks, to the process of mitigating and allocating those risks among project parties, to transferring those risks through insurance. The report also explores novel techniques in PV risk management, options to offload risks onto the capital markets, and innovative insurance policies (namely warranty policies) that address risks unique to the PV sector. One of the major justifications for robust risk management in the PV industry is the cost-reduction opportunities it affords. If the PV industry can demonstrate the capability to successfully manage its risks, thereby inspiring confidence in financiers, it may be able to obtain a lower cost of capital in future transactions. A lower cost of capital translates to a lower cost of energy, which will in turn enhance PV?s competitiveness at a time when it will have to rely less on subsidies to support its market penetration.
Validation of PV-RPM Code in the System Advisor Model.
Energy Technology Data Exchange (ETDEWEB)
Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lavrova, Olga [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Freeman, Janine [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-04-01
This paper describes efforts made by Sandia National Laboratories (SNL) and the National Renewable Energy Laboratory (NREL) to validate the SNL developed PV Reliability Performance Model (PV - RPM) algorithm as implemented in the NREL System Advisor Model (SAM). The PV - RPM model is a library of functions that estimates component failure and repair in a photovoltaic system over a desired simulation period. The failure and repair distributions in this paper are probabilistic representations of component failure and repair based on data collected by SNL for a PV power plant operating in Arizona. The validation effort focuses on whether the failure and repair dist ributions used in the SAM implementation result in estimated failures that match the expected failures developed in the proof - of - concept implementation. Results indicate that the SAM implementation of PV - RPM provides the same results as the proof - of - concep t implementation, indicating the algorithms were reproduced successfully.
Innovation and technology transfer through global value chains: Evidence from China's PV industry
International Nuclear Information System (INIS)
Zhang, Fang; Gallagher, Kelly Sims
2016-01-01
China's success as a rapid innovation follower in the infant Photovoltaic (PV) industry surprised many observers. This paper explores how China inserted itself into global clean energy innovation systems by examining the case of the solar PV industry. The paper decomposes the global PV industrial value chain, and determines the main factors shaping PV technology transfer and diffusion. Chinese firms first entered PV module manufacturing through technology acquisition, and then gradually built their global competitiveness by utilizing a vertical integration strategy within segments of the industry as well as the broader PV value chain. The main drivers for PV technology transfer from the global innovation system to China are global market formation policy, international mobilization of talent, the flexibility of manufacturing in China, and belated policy incentives from China's government. The development trajectory of the PV industry in China indicates that innovation in cleaner energy technologies can occur through both global and national innovation processes, and knowledge exchange along the global PV value chain. - Highlights: •The value chain analytical approach is synergized with the theories of technology transfer and innovation systems. •A detailed review of how China integrated itself into the global solar PV innovation system is provided. •Four main factors shape PV technology transfer to China across various value chain segments. •Innovation in cleaner energy technologies is a combination of global and national innovation processes.
Fault Analysis and Detection in Microgrids with High PV Penetration
Energy Technology Data Exchange (ETDEWEB)
El Khatib, Mohamed [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hernandez Alvidrez, Javier [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Ellis, Abraham [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-05-01
In this report we focus on analyzing current-controlled PV inverters behaviour under faults in order to develop fault detection schemes for microgrids with high PV penetration. Inverter model suitable for steady state fault studies is presented and the impact of PV inverters on two protection elements is analyzed. The studied protection elements are superimposed quantities based directional element and negative sequence directional element. Additionally, several non-overcurrent fault detection schemes are discussed in this report for microgrids with high PV penetration. A detailed time-domain simulation study is presented to assess the performance of the presented fault detection schemes under different microgrid modes of operation.
Photovoltaic (PV) energy in the Netherlands and Switzerland. A comparison
International Nuclear Information System (INIS)
Van der Loo, F.; Spiessens, P.
1995-01-01
The development of photovoltaic (PV) energy in Switzerland and the Netherlands is compared for a number of aspects. The Swiss have realized more PV capacity. Also the economic conditions to develop PV are better in Switzerland than in the Netherlands. In Switzerland the public support is mobilized for solar energy while in the Netherlands a social basis is created for wind energy. 3 ills., 3 tabs
Energy Technology Data Exchange (ETDEWEB)
Tan, Jin; Zhang, Yingchen; Veda, Santosh; Elgindy, Tarek; Liu, Yilu
2017-04-11
Recent large penetrations of solar photovoltaic (PV) generation and the inertial characteristics of inverter-based generation technologies have caught the attention of those in the electric power industry in the United States. This paper presents a systematic approach to developing test cases of high penetrations of PV for the Western Interconnection. First, to examine the accuracy of the base case model, the Western Electricity Coordinating Council (WECC) model is validated by using measurement data from synchronized phasor measurement units. Based on the 2022 Light Spring case, we developed four high PV penetration cases for the WECC system that are of interest to the industry: 5% PV+15 % wind, 25% PV+15% wind, 45% PV+15% wind, 65% PV+15% wind). Additionally, a method to project PV is proposed that is based on collected, realistic PV distribution information, including the current and future PV power plant locations and penetrations in the WECC system. Both the utility-scale PV plant and residential rooftop PV are included in this study.
Methodology for the optimal design of tansformerless grid-connected PV interters
DEFF Research Database (Denmark)
Koutroulis, E.; Blaabjerg, Frede
2012-01-01
inverter, such that the PV inverter levelised cost of the generated electricity is minimised. The proposed method constitutes a systematic design process, which is capable to explore the impact of the PV inverter configuration on the trade-off between the PV inverter manufacturing cost and the power losses...
DOE Request for Information (RFI) DE-FOA-0000153 PV Manufacturing Initiative
Energy Technology Data Exchange (ETDEWEB)
none,
2010-02-01
This draft report summarizes the results of the U.S. Department of Energy PV Manufacturing Request for Information (RFI), DE-FOA-0000153, that was released in September 2009. The PV Manufacturing Initiative is intended to help facilitate the development of a strong PV manufacturing industry in the United States.
Energy Technology Data Exchange (ETDEWEB)
NONE
2003-09-15
This report for the International Energy Agency (IEA) made by Task 9 of the Photovoltaic Power Systems (PVPS) programme takes a look at the institutional framework and financial instruments necessary for PV deployment in developing countries. This guide describes the institutional and financial aspects that need to be addressed to ensure that a long term sustainable (and profitable) PV market is established in developing countries. The guide details main fundamental functions that need to be performed such as the agents needed to perform the functions and their differing roles within the framework, the relationships between these agents and the financial instruments available. It is stated that the majority of the aspects recommended in this guide can be adopted to two main PV deployment models: direct sales and rural electrification and development programmes. It is noted that both approaches will have to be tailored and adapted to local conditions.
Household photovoltaic market in Xining, Qingha province, China: the role of local PV business
International Nuclear Information System (INIS)
Ling, S.; Boardman, B.
2002-01-01
This paper assesses the present and future market for household photovoltaic (PV) systems in rural Northwest China, especially from the PV commerce at Xining, Qinghai Province. This unsubsidised free market is now met by the emerging PV industry in China, which includes cell and module manufacturers, and PV system distributors and assemblers. For widespread deployment of such a renewable energy technology, the development of a local free market seems more successful than donor- or 'government subsidy'-driven programmes. Presently, there is a thriving infant PV industry in Northwest China, mostly centred in Xining. Xining-based PV sales companies have extensive networks for selling, marketing and servicing household PV systems for rural farmers and nomads. Small systems are now ordinary items on sale in local shops. Based on interviews and fieldwork observations with seven major PV sales companies in Xining, the household PV market is assessed from the present business operations of these companies. Detail of primary sources is given with the aim of archiving seminal progress in the history of photovoltaic power. The results suggest that although the household PV market will continue to grow, current government and international sponsored PV programmes can create both opportunities and barriers for the infant PV market an industry in China. (author)
The impact of high PV penetration levels on electrical distribution networks
Energy Technology Data Exchange (ETDEWEB)
Collinson, A; Beddoes, A; Thornycroft, J [Halcrow (United Kingdom); Strbac, G; Jenkins, N [UMIST, Manchester (United Kingdom); Verhoeven, B [KEMA (Netherlands)
2002-07-01
This report describes the results of a collaborative study by EA Technology, UMIST and Halcrow into the effects of large-scale connection of dispersed photovoltaic (PV) power systems on the national electricity supply network. The report is intended to help manufacturers and installers of PV systems and electricity companies to understand the issues associated with grid connection of PV power systems. The increased use of PV systems is expected to have a significant impact on the design, operation and management of electricity supply networks. The study examined three main areas: probability and risk analysis of islanding; PV and network voltage control (including analysis of voltage control in a commercial, domestic retrofit and domestic new build scenarios); and future low voltage network design and operational policies.
Automatic fault diagnosis in PV systems with distributed MPPT
International Nuclear Information System (INIS)
Solórzano, J.; Egido, M.A.
2013-01-01
Highlights: • An automatic failure diagnosis procedure for PV systems with DMPPT is presented. • The different failures diagnosed and their effects on the PV systems are described. • No use of irradiance and temperature sensors decreasing the cost of the system. • Voltage and current analysis to diagnose different failures. • Hot-spots, localized dirt, shading, module degradation and cable losses diagnosis. - Abstract: This work presents a novel procedure for fault diagnosis in PV systems with distributed maximum power point tracking at module level—power optimizers (DC/DC) or micro-inverters (DC/AC). Apart from the power benefits obtained when an irregular irradiance distribution is present, this type of systems permit the monitoring of the PV plant parameters at the module level: voltage and current at the working power point. With these parameters, a prototype diagnosis tool has been developed in Matlab and it has been experimentally verified in a real rooftop PV generator by applying different failures. The tool can diagnose the following failures: fixed object shading (with distance estimation), localized dirt, generalized dirt, possible hot-spots, module degradation and excessive losses in DC cables. In addition, it alerts the user of the power losses produced by each failure and classifies the failures by their severity. This system does not require the use of irradiance or temperature sensors, except for the generalized dirt failure, reducing the cost of installation, especially important in small PV systems
Exploring the Economic Value of EPAct 2005's PV Tax Credits
Energy Technology Data Exchange (ETDEWEB)
Bolinger, Mark; Wiser, Ryan; Ing, Edwin
2006-03-28
The market for grid-connected photovoltaics (PV) in the US has grown dramatically in recent years, driven in large part by PV grant or ''buy-down'' programs in California, New Jersey, and many other states. The recent announcement of a new 11-year, $3.2 billion PV program in California suggests that state policy will continue to drive even faster growth over the next decade. Federal policy has also played a role, primarily by providing commercial PV systems access to tax benefits, including accelerated depreciation (5-year MACRS schedule) and a business energy investment tax credit (ITC). With the signing of the Energy Policy Act of 2005 (EPAct) on August 8, the federal government is poised to play a much more significant future role in supporting both commercial and residential PV systems. Specifically, EPAct increased the federal ITC for commercial PV systems from 10% to 30% of system costs, and also created a new 30% ITC (capped at $2000) for residential solar systems. Both changes went into effect on January 1, 2006, and--absent an extension (for which the solar industry has already begun lobbying)--will last for a period of two years: the new residential ITC will expire, and the 30% commercial ITC will revert back to 10%, on January 1, 2008. How much economic value do these new and expanded federal tax credits really provide to PV system purchasers? And what implications might they hold for state/utility PV grant programs? Using a generic (i.e., non-state-specific) cash flow model, this report explores these questions. We begin with a discussion of the taxability of PV grants and their interaction with federal credits, as this issue significantly affects the analysis that follows. We then calculate the incremental value of EPAct's new and expanded credits for PV systems of different sizes, and owned by different types of entities. We conclude with a discussion of potential implications for purchasers of PV systems, as well as for
Heritage plaza parking lots improvement project- Solar PV installation
Energy Technology Data Exchange (ETDEWEB)
Hooks, Todd [Agua Caliente Indian Reservation, Palm Springs, CA (United States)
2017-03-31
The Agua Caliente Band of Cahuilla Indians (ACBCI or the “Tribe”) installed a 79.95 kW solar photovoltaic (PV) system to offset the energy usage costs of the Tribal Education and Family Services offices located at the Tribe's Heritage Plaza office building, 90I Tahquitz Way, Palm Springs, CA, 92262 (the "Project"). The installation of the Solar PV system was part of the larger Heritage Plaza Parking Lot Improvements Project and mounted on the two southern carport shade structures. The solar PV system will offset 99% of the approximately 115,000 kWh in electricity delivered annually by Southern California Edison (SCE) to the Tribal Education and Family Services offices at Heritage Plaza, reducing their annual energy costs from approximately $22,000 annually to approximately $200. The total cost of the proposed solar PV system is $240,000.
Optimum Design Of On Grid Pv System Using Tracking System
Directory of Open Access Journals (Sweden)
Saeed Mansour
2015-05-01
Full Text Available Abstract The fossil fuel is a main issue in the world due to the increase of fossil fuel cost and the depletion of the fossil fuel with continuous increasing demand on electricity. With continuous decrease of PV panels cost it is interesting to consider generation of electricity from PV system. To provide electric energy to a load in a remote area where electric grid utility is not available or connection with grid utility is available there are two approaches of photovoltaic system PV without tracking system Fixed System and PV with tracking systems. The result shows that the energy production by using PV with tracking system generates more energy in comparison with fixed panels system. However the cost per produced KWH is less in case of using fixed panels. This is the backbone in choice between two approaches of photovoltaic system. In this work a system design and cost analysis for two approaches of photovoltaic system are considered.
Vaca-Vaca, Juan Carlos; Carrasco-Lozano, Emerson Clovis; López-López, Karina
2017-02-01
The complete genome sequence of a bipartite begomovirus (genus Begomovirus, family Geminiviridae) infecting yellow passion fruit (Passiflora edulis) in the state of Valle del Cauca (Colombia) has been determined. The complete DNA-A and DNA-B components were determined to be 2600 and 2572 nt in length, respectively. The DNA-A showed the highest nucleotide sequence identity (87.2 %) to bean dwarf mosaic virus (M88179), a begomovirus found in common bean crops in Colombia, and only 77.4 % identity to passion fruit severe leaf distortion virus (FJ972767), a begomovirus identified infecting passion fruit in Brazil. Based on its sequence identity to all other begomoviruses known to date and in accordance with the ICTV species demarcation criterion for the genus Begomovirus (≥91 % sequence identity for the complete DNA-A), the name passion fruit leaf distortion virus is proposed for this new begomovirus. To our knowledge, this is the first report of a bipartite begomovirus affecting passion fruit in Colombia and the second report of a geminivirus affecting this crop worldwide.
Estimation of Maximum Allowable PV Connection to LV Residential Power Networks
DEFF Research Database (Denmark)
Demirok, Erhan; Sera, Dezso; Teodorescu, Remus
2011-01-01
Maximum photovoltaic (PV) hosting capacity of low voltage (LV) power networks is mainly restricted by either thermal limits of network components or grid voltage quality resulted from high penetration of distributed PV systems. This maximum hosting capacity may be lower than the available solar...... potential of geographic area due to power network limitations even though all rooftops are fully occupied with PV modules. Therefore, it becomes more of an issue to know what exactly limits higher PV penetration level and which solutions should be engaged efficiently such as over sizing distribution...
Size optimization of stand-alone photovoltaic (PV) room air conditioners
International Nuclear Information System (INIS)
Chen, Chien-Wei; Zahedi, A.
2006-01-01
Sizing of a stand-alone PV system determines the main cost of the system. PV electricity cost is determined by the amount of solar energy received, hence the actual climate and weather conditions such as solar irradiance and ambient temperature affect the size required and cost of the system. Air conditioning demand also depends on the weather conditions. Therefore, sizing a PV powered air conditioner must consider the characteristics of local climate and temperature. In this paper, sizing procedures and special considerations for air conditioning under Melbourne's climatic conditions is presented. The reliability of various PV-battery size combinations is simulated by MATLAB. As a result, excellent system performance can be predicated.(Author)
Integrating Solar PV in Utility System Operations
Energy Technology Data Exchange (ETDEWEB)
Mills, A.; Botterud, A.; Wu, J.; Zhou, Z.; Hodge, B-M.; Heany, M.
2013-10-31
This study develops a systematic framework for estimating the increase in operating costs due to uncertainty and variability in renewable resources, uses the framework to quantify the integration costs associated with sub-hourly solar power variability and uncertainty, and shows how changes in system operations may affect these costs. Toward this end, we present a statistical method for estimating the required balancing reserves to maintain system reliability along with a model for commitment and dispatch of the portfolio of thermal and renewable resources at different stages of system operations. We estimate the costs of sub-hourly solar variability, short-term forecast errors, and day-ahead (DA) forecast errors as the difference in production costs between a case with “realistic” PV (i.e., subhourly solar variability and uncertainty are fully included in the modeling) and a case with “well behaved” PV (i.e., PV is assumed to have no sub-hourly variability and can be perfectly forecasted). In addition, we highlight current practices that allow utilities to compensate for the issues encountered at the sub-hourly time frame with increased levels of PV penetration. In this analysis we use the analytical framework to simulate utility operations with increasing deployment of PV in a case study of Arizona Public Service Company (APS), a utility in the southwestern United States. In our analysis, we focus on three processes that are important in understanding the management of PV variability and uncertainty in power system operations. First, we represent the decisions made the day before the operating day through a DA commitment model that relies on imperfect DA forecasts of load and wind as well as PV generation. Second, we represent the decisions made by schedulers in the operating day through hour-ahead (HA) scheduling. Peaking units can be committed or decommitted in the HA schedules and online units can be redispatched using forecasts that are improved
Is solar PV generated electricity cheap in South Africa?
CSIR Research Space (South Africa)
Roro, Kittessa T
2015-07-01
Full Text Available This presentation reflects on photovoltaic (PV) generated electricity in South Africa, and whether it is a cheaper alternative to current generated electricity in the country. It is projected that by 2019 the installed capacity of PV could...
Designing PV powered LED products - Integration of PV technology in innovative products
Reinders, Angelina H.M.E.; de Boer, Andries; de Winter, Arjan; Haverlag, Marco; Ossenbrink Sinke, W.; Helm, P.
2009-01-01
This study covers the design of innovative product concepts based on a combination of PV and LED technology. The products were developed in a project that took place in 2008 and 2009 during a cooperation of the University of Twente with Philips Lighting. It is shown that surprisingly unpredictable -
On-line monitoring system of PV array based on internet of things technology
Li, Y. F.; Lin, P. J.; Zhou, H. F.; Chen, Z. C.; Wu, L. J.; Cheng, S. Y.; Su, F. P.
2017-11-01
The Internet of Things (IoT) Technology is used to inspect photovoltaic (PV) array which can greatly improve the monitoring, performance and maintenance of the PV array. In order to efficiently realize the remote monitoring of PV operating environment, an on-line monitoring system of PV array based on IoT is designed in this paper. The system includes data acquisition, data gateway and PV monitoring centre (PVMC) website. Firstly, the DSP-TMS320F28335 is applied to collect indicators of PV array using sensors, then the data are transmitted to data gateway through ZigBee network. Secondly, the data gateway receives the data from data acquisition part, obtains geographic information via GPS module, and captures the scenes around PV array via USB camera, then uploads them to PVMC website. Finally, the PVMC website based on Laravel framework receives all data from data gateway and displays them with abundant charts. Moreover, a fault diagnosis approach for PV array based on Extreme Learning Machine (ELM) is applied in PVMC. Once fault occurs, a user alert can be sent via E-mail. The designed system enables users to browse the operating conditions of PV array on PVMC website, including electrical, environmental parameters and video. Experimental results show that the presented monitoring system can efficiently real-time monitor the PV array, and the fault diagnosis approach reaches a high accuracy of 97.5%.
Developmental exposure to Passiflora incarnata induces behavioural alterations in the male progeny.
Bacchi, André D; Ponte, Bianca; Vieira, Milene L; de Paula, Jaqueline C C; Mesquita, Suzana F P; Gerardin, Daniela C C; Moreira, Estefânia G
2013-01-01
Passiflora incarnata is marketed in many countries as a phytomedicine and is prescribed mainly as a sedative and anxiolytic. Even though the directions of most marketed phytomedicines recommend them to be used under medical supervision, reproductive and developmental studies are sparse and not mandatory for regulatory purposes. To evaluate the reproductive and developmental toxicity of P. incarnata, Wistar female rats were gavaged with 30 or 300 mg kg(-1) of this herb from gestational Day (GD) 0 to postnatal Day (PND) 21. P. incarnata treatment did not influence dams' bodyweight or food intake or their reproductive performance (post-implantation loss, litter size, litter weight). There was also no influence on the physical development of pups (bodyweight gain, day of vaginal opening or preputial separation) or their behaviour in the open-field at PND 22, 35 and 75. Sexual behaviour was disrupted in adult male pups exposed to 300 mg kg(-1) of P. incarnata; in this group, only 3 out of 11 pups were sexually competent. This behavioural disruption was not accompanied by alterations in plasma testosterone levels, reproductive-related organs and glands weights or sperm count. It is hypothesised that aromatase inhibition may be involved in the observed effect.
Reconciling Consumer and Utility Objectives in the Residential Solar PV Market
Arnold, Michael R.
Today's energy market is facing large-scale changes that will affect all market players. Near the top of that list is the rapid deployment of residential solar photovoltaic (PV) systems. Yet that growing trend will be influenced multiple competing interests between various stakeholders, namely the utility, consumers and technology provides. This study provides a series of analyses---utility-side, consumer-side, and combined analyses---to understand and evaluate the effect of increases in residential solar PV market penetration. Three urban regions have been selected as study locations---Chicago, Phoenix, Seattle---with simulated load data and solar insolation data at each locality. Various time-of-use pricing schedules are investigated, and the effect of net metering is evaluated to determine the optimal capacity of solar PV and battery storage in a typical residential home. The net residential load profile is scaled to assess system-wide technical and economic figures of merit for the utility with an emphasis on intraday load profiles, ramp rates and electricity sales with increasing solar PV penetration. The combined analysis evaluates the least-cost solar PV system for the consumer and models the associated system-wide effects on the electric grid. Utility revenue was found to drop by 1.2% for every percent PV penetration increase, net metering on a monthly or annual basis improved the cost-effectiveness of solar PV but not battery storage, the removal of net metering policy and usage of an improved the cost-effectiveness of battery storage and increases in solar PV penetration reduced the system load factor. As expected, Phoenix had the most favorable economic scenario for residential solar PV, primarily due to high solar insolation. The study location---solar insolation and load profile---was also found to affect the time of year at which the largest net negative system load was realized.
Energy Technology Data Exchange (ETDEWEB)
Schoots, K. [ECN Beleidsstudies, Petten (Netherlands)
2013-12-15
This report describes the results of a qualitative study of the barriers that actors involved in the development and commercialization of polymer solar cells, may encounter. The purpose of this socio-economic research is to identify these barriers for the (market) development of thin film polymeric PV technology and to develop strategies for them in order to overcome the constraints. The necessary data are collected from interviews with actors who are active in the development and deployment of conventional solar cells. Based on the results from this study, it is conclude that it is important for the Organic PV industry to carry out many market experiments beyond the built environment. The report provides recommendations with regard to the markets in which these experiments are most likely to succeed and which drivers should be taken into account [Dutch] Dit rapport beschrijft de resultaten van een kwalitatief onderzoek naar de barrieres die actoren, betrokken bij de ontwikkeling en marktintroductie van polymere zonnecellen, kunnen tegenkomen. Het doel van dit sociaal-economische onderzoek is deze barrieres voor de (markt)ontwikkeling van dunne film polymere PV technologie te identificeren en strategieen te ontwikkelen om ze voor te zijn of ze te overbruggen. De benodigde gegevens worden verzameld uit interviews met actoren die actief zijn in de ontwikkeling en uitrol van conventionele zonnecellen. Op basis van de resultaten uit dit onderzoek komen we tot de conclusie dat het voor de Organische PV sector belangrijk is veel marktexperimenten aan te gaan buiten de gebouwde omgeving. Het rapport geeft aanbevelingen in welke soort markten deze experimenten de meeste kans van slagen hebben en met welke drivers van marktpartijen rekening moet worden gehouden.
PV-wind hybrid system performance. A new approach and a case study
International Nuclear Information System (INIS)
Arribas, Luis; Cano, Luis; Cruz, Ignacio; Mata, Montserrat; Llobet, Ermen
2010-01-01
Until now, there is no internationally accepted guideline for the measurement, data exchange and analysis of PV-Wind Hybrid Systems. As there is a need for such a tool, so as to overcome the barrier that the lack of confidence due to the absence of reliability means for the development of the market of Hybrid Systems, an effort has been made to suggest one tool for PV-Wind Hybrid Systems. The suggested guidelines presented in this work are based on the existing guidelines for PV Systems, as a PV-Wind Hybrid system can be roughly thought of as a PV System to which wind generation has been added. So, the guidelines for PV Systems are valid for the PV-Wind System, and only the part referred to wind generation should be included. This has been the process followed in this work. The proposed method is applied to a case study, the CICLOPS Project, a 5 kW PV, 7.5 kW Wind Hybrid system installed at the Isolated Wind Systems Test Site that CIEMAT owns in CEDER (Soria, Spain). This system has been fully monitored through a year and the results of the monitoring activity, characterizing the long-term performance of the system are shown in this work. (author)
PV-wind hybrid system performance. A new approach and a case study
Energy Technology Data Exchange (ETDEWEB)
Arribas, Luis; Cano, Luis; Cruz, Ignacio [Departamento de Energias Renovables, CIEMAT, Avda. Complutense 22, 28040 Madrid (Spain); Mata, Montserrat; Llobet, Ermen [Ecotecnia, Roc Boronat 78, 08005 Barcelona (Spain)
2010-01-15
Until now, there is no internationally accepted guideline for the measurement, data exchange and analysis of PV-Wind Hybrid Systems. As there is a need for such a tool, so as to overcome the barrier that the lack of confidence due to the absence of reliability means for the development of the market of Hybrid Systems, an effort has been made to suggest one tool for PV-Wind Hybrid Systems. The suggested guidelines presented in this work are based on the existing guidelines for PV Systems, as a PV-Wind Hybrid system can be roughly thought of as a PV System to which wind generation has been added. So, the guidelines for PV Systems are valid for the PV-Wind System, and only the part referred to wind generation should be included. This has been the process followed in this work. The proposed method is applied to a case study, the CICLOPS Project, a 5 kW PV, 7.5 kW Wind Hybrid system installed at the Isolated Wind Systems Test Site that CIEMAT owns in CEDER (Soria, Spain). This system has been fully monitored through a year and the results of the monitoring activity, characterizing the long-term performance of the system are shown in this work. (author)
Energy Technology Data Exchange (ETDEWEB)
None
2017-01-01
The main objectives of this report are to evaluate China's photovoltaic (PV) interconnection standards and the U.S. counterparts and to propose recommendations for future revisions to these standards. This report references the 2013 report Comparative Study of Standards for Grid-Connected PV System in China, the U.S. and European Countries, which compares U.S., European, and China's PV grid interconnection standards; reviews various metrics for the characterization of distribution network with PV; and suggests modifications to China's PV interconnection standards and requirements. The recommendations are accompanied by assessments of four high-penetration PV grid interconnection cases in the United States to illustrate solutions implemented to resolve issues encountered at different sites. PV penetration in China and in the United States has significantly increased during the past several years, presenting comparable challenges depending on the conditions of the grid at the point of interconnection; solutions are generally unique to each interconnected PV installation or PV plant.
Residential Solar PV Planning in Santiago, Chile: Incorporating the PM10 Parameter
Directory of Open Access Journals (Sweden)
Gustavo Cáceres
2014-12-01
Full Text Available This paper addresses an economic study of the installation of photovoltaic (PV solar panels for residential power generation in Santiago, Chile, based on the different parameters of a PV system, such as efficiency. As a performance indicator, the Levelized Cost of Energy (LCOE was used, which indicates the benefit of the facility vs. the current cost of electrical energy. In addition, due to a high level of airborne dusts typically associated with PM10, the effect of the dust deposition on PV panels’ surfaces and the effect on panel performance are examined. Two different scenarios are analyzed: on-grid PV plants and off-grid PV plants.
Modeling of a VMJ PV array under Gaussian high intensity laser power beam condition
Eom, Jeongsook; Kim, Gunzung; Park, Yongwan
2018-02-01
The high intensity laser power beaming (HILPB) system is one of the most promising systems in the long-rang wireless power transfer field. The vertical multi-junction photovoltaic (VMJ PV) array converts the HILPB into electricity to power the load or charges a battery. The output power of a VMJ PV array depends mainly on irradiance values of each VMJ PV cells. For simulating an entire VMJ PV array, the irradiance profile of the Gaussian HILPB and the irradiance level of the VMJ PV cell are mathematically modeled first. The VMJ PV array is modeled as a network with dimension m*n, where m represents the number of VMJ PV cells in a column, and n represents the number of VMJ PV cells in a row. In order to validate the results obtained in modeling and simulation, a laboratory setup was developed using 55 VMJ PV array. By using the output power model of VMJ PV array, we can establish an optimal power transmission path by the receiver based on the received signal strength. When the laser beam from multiple transmitters aimed at a VMJ PV array at the same time, the received power is the sum of all energy at a VMJ PV array. The transmitter sends its power characteristics as optically coded laser pulses and powers as HILPB. Using the attenuated power model and output power model of VMJ PV array, the receiver can estimate the maximum receivable powers from the transmitters and select optimal transmitters.
Studies on floral biology of passion fruit (passiflora spp.)
International Nuclear Information System (INIS)
Kishore, K.; Pathak, K.A.; Shukla, R.; Bharali, R.
2010-01-01
Floral biology of purple, yellow, giant and Passiflora foetida was studied at the ICAR Research Complex, Mizoram Centre, Kolasib, Mizoram, India during 2005-07. Purple, giant and P. foetida had major bloom during March-April, July-August and September-October. While major bloom in yellow was mainly during May-June and September-October. Purple, giant and P. foetida had the maximum duration of bloom of 42.4, 22.5 and 32.6 days, respectively during March-April with the maximum duration of effective bloom of 12.5 8.6 and 10.4 days in purple, giant and P. foetida, respectively. Yellow had the maximum duration of bloom for 28.4 days and effective bloom of 10.5 days during May-June. Most of the flowers of purple (54.5%) and giant (58.5%) opened between 6-7 hrs, while the maximum per cent of anthesis in yellow (70%) took place between 12-13 hrs. Pollen dehiscence and pollination in purple and giant mainly occurred between 7-8 hrs, while 13-14 hrs was the major period of pollen dehiscence and pollination in yellow. The earliest anthesis (5-6 hrs), anther dehiscence (6-7 hrs) and pollination (6-7 hrs) were recorded in P. foetida. The maximum stigma receptivity was recorded on the day of anthesis in all the passion fruits. Completely curved style was more common in all passion fruits that gave the maximum fruit set. The maximum number of bees observed between 7-8 hrs in purple and giant and between 13-14 hrs in yellow. The most common pollinating bee in purple, giant and yellow was Apis mellifera, while A. cerena was in P. foetida. (author)
Seasonal energy storage - PV-hydrogen systems
Energy Technology Data Exchange (ETDEWEB)
Leppaenen, J. [Neste Oy/NAPS (Finland)
1998-10-01
PV systems are widely used in remote areas e.g. in telecommunication systems. Typically lead acid batteries are used as energy storage. In northern locations seasonal storage is needed, which however is too expensive and difficult to realise with batteries. Therefore, a PV- battery system with a diesel backup is sometimes used. The disadvantages of this kind of system for very remote applications are the need of maintenance and the need to supply the fuel. To overcome these problems, it has been suggested to use hydrogen technologies to make a closed loop autonomous energy storage system
Directory of Open Access Journals (Sweden)
Scheila da Conceição Maciel
2009-06-01
Full Text Available Cowpea aphid-borne mosaic virus (CABMV is a potyvirus that causes the most serious virus disease of passion fruit crops in Brazil. It is transmitted by several species of aphids in a non-persistent, non-circulative manner. The reaction of 16 species of Passiflora to infection by mechanical inoculation with four Brazilian isolates of CABMV was evaluated under greenhouse conditions. Only P. suberosa, a wild species, was resistant to infection by all virus isolates, in two independent assays. P. suberosa grafted onto infected P. edulis f. flavicarpa did not develop symptoms; neither was the virus detected by RT-PCR in the upper leaves, suggesting that this species is immune to CABMV.O vírus do mosaico do caupi (Cowpea aphid-borne mosaic virus - CABMV é um potyvirus que causa uma das mais importantes doenças do maracujazeiro no Brasil. O vírus é transmitido por diversas espécies de afídeos de maneira não persistente, não circulativa. A reação de 16 espécies de Passiflora à infecção com quatro isolados brasileiros do CABMV, por meio de inoculação mecânica foi avaliada em condições de casa-de-vegetação. Somente a espécie selvagem P. suberosa foi resistente à infecção com todos os isolados do CABMV, em dois ensaios independentes. Plantas de P. suberosa enxertadas em plantas de P. edulis f. flavicarpa infectadas com o CABMV também não desenvolveram sintomas da doença. O vírus também não foi detectado por RT-PCR nas folhas superiores das plantas, sugerindo que essa espécie é imune ao CABMV.
POWERED LED LIGHTING SUPPLIED FROM PV CELLS
Directory of Open Access Journals (Sweden)
Tirshu M.
2011-12-01
Full Text Available The paper deals with practical realization of efficient lighting system based on LED’s of 80W total power mounted on corridor ceiling total length of which is 120m and substitutes existing traditional lighting system consisting of 29 lighting blocks with 4 fluorescent lamps each of them and summary power 2088W. Realized lighting system is supplied from two photovoltaic panels of power 170W. Generated energy by PV cells is accumulated in two accumulators of 75Ah capacity and from battery by means of specialized convertor is applied to lighting system. Additionally, paper present data measured by digital weather station (solar radiation and UV index, which is mounted near of PV cells and comparative analyze of solar energy with real energy generated by PV cells is done. Measured parameters by digital weather station are stored by computer in on-line mode.
Solar PV O&M Standards and Best Practices - Existing Gaps and Improvement Efforts
Energy Technology Data Exchange (ETDEWEB)
Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Balfour, John R. [High Performance PV, Phoenix, AZ (United States); Keating, T. J. [SunSpec Alliance, San Jose, CA (United States)
2014-11-01
As greater numbers of photovoltaic (PV) systems are being installed, operations & maintenance (O&M) activities will need to be performed to ensure the PV system is operating as designed over its useful lifetime. To mitigate risks to PV system availability and performance, standardized procedures for O&M activities are needed to ensure high reliability and long-term system bankability. Efforts are just getting underway to address the need for standard O&M procedures as PV gains a larger share of U.S. generation capacity. Due to the existing landscape of how and where PV is installed, including distributed generation from small and medium PV systems, as well as large, centralized utility-scale PV, O&M activities will require different levels of expertise and reporting, making standards even more important. This report summarizes recent efforts made by solar industry stakeholders to identify the existing standards and best practices applied to solar PV O&M activities, and determine the gaps that have yet to be, or are currently being addressed by industry.
Performance of a PV module augmented by a plane reflector
Energy Technology Data Exchange (ETDEWEB)
Ahmad, G. E; Hussein, H. M. S; Mohamad, M. A [Dokki, Giza (Egypt)
2000-07-01
This paper presents a comparative experimental study on the performance of a PV module augmented by a south facing titled plane reflector and another identical one without reflector. The tilt angles of the two PV modules and reflector overhang are selected to be according to a previous theoretical study by the authors. The reflector tilt angle has been changed once a month so that the reflected beams from the plane reflector cover the total surface area of the PV module all days of every month during the high solar radiation period (i.e. three hours before and after solar noon). The study has been carried out on the two PV modules for a complete year under the actual atmospheric conditions of Cairo, Egypt. The measuring system used in the study comprises a data acquisition system, a computer, an electronic load and weather station. The experimental results indicate that the plane reflector enhances the yearly output energy of the PV module y about 22%. [Spanish] Este articulo presenta un estudio comparativo experimental sobre el rendimiento de un modulo de PV aumentado por un reflector plano inclinado mirando hacia el sur y otro identico sin reflector. Los angulos de inclinacion de los dos modulos y el reflector sobresaliente se seleccionan para que esten de acuerdo con un estudio teorico previo hecho por los autores. El angulo de inclinacion del reflector se cambio una vez al mes de manera que los rayos reflejados por el reflector plano cubrieran el area total de la superficie del modulo de PV todos los dias de cada mes durante el periodo de radiacion alto (o sea tres horas antes y despues del medio dia solar). El estudio ha sido llevado a cabo en dos modulos de PV durante un ano completo bajo condiciones atmosfericas reales de El Cairo, Egipto. El sistema de medicion usado en el estudio comprende un sistema de adquisicion de datos, una computadora, una memoria electronica y una estacion climatologica. Los resultados experimentales indican que el reflector plano
Xanthomonas citri pv. citri pathotypes
DEFF Research Database (Denmark)
Di Lorenzo, Flaviana; Silipo, Alba; Gersby, Lotte Bettina Andersen
2017-01-01
Xanthomonas citri pv. citri is the pathogen responsible for Asiatic citrus canker, one of the most serious citrus diseases worldwide. The lipopolysaccharide (LPS) molecule has been demonstrated to be involved in X. citri pv. citri virulence. Despite enormous progress in investigations of the mole...
The Historical Evolution of South Korea's Solar PV Policies since the 1970's
International Nuclear Information System (INIS)
Hyun Jin Yu, Julie; Popiolek, Nathalie
2013-01-01
The study aims at analyzing the historical evolution of South Korea's solar PV policies from the 1970's until today. An in-depth analysis of different policy instruments has been conducted to understand the PV policy context and the consequences of public policies in the PV sector in terms of patents, manufacturing capacity, PV installations, and impacts on the national economy and energy transition. Also, the key success factors and barriers in South Korea's past PV policies have been identified to make recommendations for future development
PV inverter test setup for European efficiency, static and dynamic MPPT efficiency evaluation
DEFF Research Database (Denmark)
Sera, Dezso; Teodorescu, Remus; Valentini, Massimo
2008-01-01
This paper concerns the evaluation of performance of grid-connected PV inverters in terms of conversion efficiency, European efficiency, static and dynamic MPP efficiency. Semi-automated tests were performed in the PV laboratory of the Institute of Energy Technology at the Aalborg University...... (Denmark) on a commercial transformerless PV inverter. Thanks to the available experimental test setups, that provide the required high measuring accuracy, and the developed PV simulator, which is required for MPPT performance evaluation, PV Inverters can be pretested before being tested by accredited...
DEFF Research Database (Denmark)
Knudsen, Trine A; Skov, Robert; Petersen, Andreas
2016-01-01
BACKGROUND: Panton-Valentine leucocidin is a Staphylococcus aureus virulence factor encoded by lukF-PV and lukS-PV that is infrequent in S aureus bacteremia (SAB), and, therefore, little is known about risk factors and outcome of lukF-PV/lukS-PV-positive SAB. METHODS: This report is a register......-based nationwide observational cohort study. lukF-PV was detected by polymerase chain reaction. Factors associated with the presence of lukF-PV were assessed by logistic regression analysis. Adjusted 30-day hazard ratios of mortality associated with lukF-PV status were computed by Cox proportional hazards...... regression analysis. RESULTS: Of 9490 SAB cases, 129 were lukF-PV-positive (1.4%), representing 14 different clonal complexes. lukF-PV was associated with younger age, absence of comorbidity, and methicillin-resistant S aureus. In unadjusted analysis, mortality associated with lukF-PV-positive SAB...
What's stopping a huge expansion of the PV market?
International Nuclear Information System (INIS)
Varadi, P.F.
1998-01-01
Over the past 25 years the terrestrial PV industry has turned into a billion-dollar global business. The necessary technology is available and substantial market growth is continuing. It has often been said that the cost of PV must come down further before the technology really takes off. However the author argues here that the dominant segments of the market are not price-sensitive and that the future explosive expansion of PV markets will need financing on a global basis, assured quality in the products, and the institution of an extensive public-awareness programme of advertising, promotion and education. (author)
Assessment of subchannel code ASSERT-PV for flow-distribution predictions
International Nuclear Information System (INIS)
Nava-Dominguez, A.; Rao, Y.F.; Waddington, G.M.
2014-01-01
Highlights: • Assessment of the subchannel code ASSERT-PV 3.2 for the prediction of flow distribution. • Open literature and in-house experimental data to quantify ASSERT-PV predictions. • Model changes assessed against vertical and horizontal flow experiments. • Improvement of flow-distribution predictions under CANDU-relevant conditions. - Abstract: This paper reports an assessment of the recently released subchannel code ASSERT-PV 3.2 for the prediction of flow-distribution in fuel bundles, including subchannel void fraction, quality and mass fluxes. Experimental data from open literature and from in-house tests are used to assess the flow-distribution models in ASSERT-PV 3.2. The prediction statistics using the recommended model set of ASSERT-PV 3.2 are compared to those from previous code versions. Separate-effects sensitivity studies are performed to quantify the contribution of each flow-distribution model change or enhancement to the improvement in flow-distribution prediction. The assessment demonstrates significant improvement in the prediction of flow-distribution in horizontal fuel channels containing CANDU bundles
Assessment of subchannel code ASSERT-PV for flow-distribution predictions
Energy Technology Data Exchange (ETDEWEB)
Nava-Dominguez, A., E-mail: navadoma@aecl.ca; Rao, Y.F., E-mail: raoy@aecl.ca; Waddington, G.M., E-mail: waddingg@aecl.ca
2014-08-15
Highlights: • Assessment of the subchannel code ASSERT-PV 3.2 for the prediction of flow distribution. • Open literature and in-house experimental data to quantify ASSERT-PV predictions. • Model changes assessed against vertical and horizontal flow experiments. • Improvement of flow-distribution predictions under CANDU-relevant conditions. - Abstract: This paper reports an assessment of the recently released subchannel code ASSERT-PV 3.2 for the prediction of flow-distribution in fuel bundles, including subchannel void fraction, quality and mass fluxes. Experimental data from open literature and from in-house tests are used to assess the flow-distribution models in ASSERT-PV 3.2. The prediction statistics using the recommended model set of ASSERT-PV 3.2 are compared to those from previous code versions. Separate-effects sensitivity studies are performed to quantify the contribution of each flow-distribution model change or enhancement to the improvement in flow-distribution prediction. The assessment demonstrates significant improvement in the prediction of flow-distribution in horizontal fuel channels containing CANDU bundles.
International Nuclear Information System (INIS)
Makki, Adham; Omer, Siddig; Su, Yuehong; Sabir, Hisham
2016-01-01
Highlights: • Integration of TE generators with a heat pipe-based PV module as a hybrid system is proposed. • Numerical transient modeling based on the energy balance equations of the system was performed. • Integration of TE generators with PV module aid operating the solar cells at a steady level in harsh conditions. - Abstract: Photovoltaic (PV) cells are able to absorb about 80% of the solar spectral irradiance, however, certain percentage accounts for electricity conversion depending on the cell technology employed. The remainder energy however, can elevate the silicon junction temperature in the PV encapsulation perilously, resulting in deteriorated performance. Temperature rise at the PV cell level is addressed as one of the most critical issues that can seriously degrade and shortens the life-time of the PV cells, hence thermal management of the PV module during operation is considered essential. Hybrid PV designs which are able to simultaneously generate electrical energy and utilize the waste heat have been proven to be the most promising solution. In this study, theoretical investigation of a hybrid system comprising of thermoelectric generator integration with a heat pipe-based Photovoltaic/Thermal (PV/T) absorber is proposed and evaluated. The system presented incorporates a PV panel for direct electricity generation, a heat pipe for excessive heat absorption from the PV cells and a thermoelectric generator (TEG) performing direct heat-to-electricity conversion. A mathematical model based on the energy balance within the system is developed to evaluate the performance of the hybrid integration and the improvements associated with the thermal management of PV cells. Results are presented in terms of the overall system efficiency compared to a conventional PV panel under identical operating conditions. The integration of TEG modules with PV cells in such way aid improving the performance of the PV cells in addition to utilizing the waste
Final Technical Report: Advanced Measurement and Analysis of PV Derate Factors.
Energy Technology Data Exchange (ETDEWEB)
King, Bruce Hardison [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Burton, Patrick D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hansen, Clifford [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Christian Birk [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-12-01
The Advanced Measurement and Analysis of PV Derate Factors project focuses on improving the accuracy and reducing the uncertainty of PV performance model predictions by addressing a common element of all PV performance models referred to as “derates”. Widespread use of “rules of thumb”, combined with significant uncertainty regarding appropriate values for these factors contribute to uncertainty in projected energy production.
Review of Artificial Abrasion Test Methods for PV Module Technology
Energy Technology Data Exchange (ETDEWEB)
Miller, David C. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Muller, Matt T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Simpson, Lin J. [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2016-08-01
This review is intended to identify the method or methods--and the basic details of those methods--that might be used to develop an artificial abrasion test. Methods used in the PV literature were compared with their closest implementation in existing standards. Also, meetings of the International PV Quality Assurance Task Force Task Group 12-3 (TG12-3, which is concerned with coated glass) were used to identify established test methods. Feedback from the group, which included many of the authors from the PV literature, included insights not explored within the literature itself. The combined experience and examples from the literature are intended to provide an assessment of the present industry practices and an informed path forward. Recommendations toward artificial abrasion test methods are then identified based on the experiences in the literature and feedback from the PV community. The review here is strictly focused on abrasion. Assessment methods, including optical performance (e.g., transmittance or reflectance), surface energy, and verification of chemical composition were not examined. Methods of artificially soiling PV modules or other specimens were not examined. The weathering of artificial or naturally soiled specimens (which may ultimately include combined temperature and humidity, thermal cycling and ultraviolet light) were also not examined. A sense of the purpose or application of an abrasion test method within the PV industry should, however, be evident from the literature.
Dynamic response evaluation of sensorless MPPT method for hybrid PV-DFIG wind turbine system
Directory of Open Access Journals (Sweden)
Danvu Nguyen
2016-01-01
Full Text Available This research proposes a sensorless Maximum Power Point Tracking (MPPT method for a hybrid Photovoltaic-Wind system, which consists of Photovoltaic (PV system and Doubly-Fed Induction Generator (DFIG Wind Turbine. In the hybrid system, the DC/DC converter output of the PV system is directly connected to the DC-link of DFIG’s back-to-back converter. Therefore, the PV inverter and its associated circuit can be removed in this structure. Typically, the PV power is monitored by using PV current sensor and PV voltage sensor for MPPT. In this paper, the powers of converters on grid side and rotor side of DFIG are used to estimate the PV power without the PV current sensor. That can efficiently reduce the cost of the hybrid system. The detailed analysis of the sensorless MPPT method, which includes derived equations and operation response, is also presented in this paper. In addition, an overview of PV-DFIG research in literature is stated to supply comprehensive knowledge of related research.
Annual Prediction Output of an RADTIRC-PV Module
Directory of Open Access Journals (Sweden)
Daria Freier
2018-03-01
Full Text Available The number of solar photovoltaic (PV installations has been increasing worldwide but the high capital cost of installation continues to be the main challenge, particularly in many developing countries. The solar concentrator, a device that focuses the sunlight onto a small area, has the potential to minimize the use of expensive PV material while maintaining the system’s performance, ultimately bringing down its overall cost. This study aims to predict the annual electrical output of a specific concentrator design called the rotationally asymmetrical dielectric totally internally reflecting concentrator (RADTIRC. The aforementioned design is assumed to be installed in Berlin/Brandenburg, Germany. First, a short review of concentrators is provided. Next, a description of the RADTIRC and the previous research that revolved around it are provided. Afterwards, the key parameters that are needed to determine the annual electrical output of the RADTIRC are explained before presenting the results of the simulations. It was found that the yearly energy yield was increased by a factor of 2.29 when the RADTIRC-PV module was used when compared with the non-concentrating PV module.
The German experience with grid-connected PV-systems
International Nuclear Information System (INIS)
Erge, T.; Hoffmann, V.U.; Kiefer, K.
2001-01-01
Grid-connected photovoltaics experienced increasing attention in Germany in recent years and are expected to face a major boost at the beginning of the new millennium. Highlights like the German 100,000-Roofs-Solar-Programme, PV programmes at schools financed by utilities and governments (e.g. 'SONNEonline' by PreussenElektra, 'Sonne in der Schule' by BMWi and 'Sonne in der Schule' by Bayernwerk) and large centralised installations of MW size ('Neue Messe Munchen' by Bayernwerk and 'Energiepark Mont-Cenis' by state Nordrhein-Westfalen, Stadtwerke Herne and European Union) count for the potential of grid-connected PV. Today in Germany a typical grid-connected PV installation of 1 kW nominal power produces average annual energy yields of 700 kWh (dependent on location and system components) and shows a high operating availability. The price per kWh from PV installations is still significantly higher than the price for conventional energy, but new funding schemes and cost models (like the large increase of feed-in tariff in Germany due to the Act on Granting Priority to Renewable Energy Sources in 2000) give optimism about the future. (Author)
Directory of Open Access Journals (Sweden)
Gláucia Amorim Faria
2006-08-01
Full Text Available Este trabalho teve como objetivo estudar o efeito da sacarose e do sorbitol na conservação in vitro de um acesso de Passiflora giberti N. E. Brown. Para isso, foi instalado um experimento no delineamento inteiramente casualizado, em que foi comparado o tratamento-testemunha (MS padrão com o meio MS suplementado com três concentrações de sacarose (0; 15 e 30 g L-1 em combinação com três concentrações de sorbitol (10; 20 e 40 g L-1. As avaliações foram realizadas aos 30; 60; 90 e 120 dias de incubação, observando-se o comprimento das brotações (cm, número de raízes, número e coloração das folhas. Os resultados mostram ser possível conservar sob crescimento lento, por quatro meses, microplantas de maracujazeiro em meio de cultura MS suplementado com 10 ou 20 g L-1 de sorbitol, na ausência de sacarose, e mantidas sob condições de fotoperíodo de 16 h (22 µE m-2s-1 e temperatura de 27 ± 1 ºC. A sacarose promoveu maior desenvolvimento de microplantas. A rizogênese é afetada pelo sorbitol na concentração de 40 g L-1 e pela ausência de sacarose no meio de cultura.This work objectified the study of sucrose and sorbitol effect in the in vitro conservation for Passiflora giberti N. E. Brown, access. Therefore, an experiment was conducted in a completely randomized design to compare control treatment (standard MS to MS medium supplemented with three sucrose concentrations (0, 15 and 30 g L-1 combined with three sorbitol concentrations (10, 20 and 40 g L-1, in a total of 10 treatments with 20 replicas. The experiment evaluation was carried out at 30, 60, 90 and 120 days of incubation, whereas the height of shoots (cm, number of roots, number and color of leaves were observed. The results showed the possibility to maintain passion-fruit microplants for a four months period under slow growth in MS medium supplemented with 10 or 20 g L-1 of sorbitol, without sucrose, and kept under 16 hours photoperiod (22 µ E m-2 s-1 and
In the balance. The social costs and benefits of PV
Energy Technology Data Exchange (ETDEWEB)
Olsen, C. [ECN Solar Energy, Petten (Netherlands)
2013-10-16
For more than a decade, the growth in PV markets surpassed expectations. Then, in 2012, the European market declined for the first time compared with the previous year. As policymakers' support for PV hesitates over the costs to society of this technology, it is timely to take an overview of the social costs and benefits, also referred to as the 'external costs', of PV electricity. In this article, these costs are put into perspective vis-a-vis those associated with conventional electricity-generating technologies. The external costs of electricity can be broken down into: (1) the environmental and health costs; (2) the costs of subsidies and energy security; and (3) the costs for grid expansion and reliability. Included in these costs are the increased insurance, health, social and environmental costs associated with damages to health, infrastructure and environment, as well as tax payments that subsidize producers of electricity or fuels, their markets and the electricity infrastructure. A life cycle assessment (LCA) of the environmental impact is used in the quantification of the associated environmental and health costs. Because the environmental footprint of PV electricity is highly dependent on the electricity mix used in PV module fabrication, the environmental indicators are calculated for PV electricity manufactured using different electricity mixes, and compared with those for the European electricity mix (UCTE), and electricity generated by burning 100% coal or 100% natural gas. In 2012 USD, coal electricity requires 19-29 eurocent/kWh above the market price, compared with 1-1.6 eurocent/kWh for PV manufactured with 100% coal electricity. The sum of the subsidies, avoided fossil-fuel imports and energy security, and the economic stimulation associated with PV electricity deployment, amounts to net external benefits. Integrating high penetrations of renewables, with the same reliability as we have today, appears to be fully feasible and
International Nuclear Information System (INIS)
Chowdhury, Sanjeeda; Sumita, Ushio; Islam, Ashraful; Bedja, Idriss
2014-01-01
Photovoltaic (PV) has the highest cost reduction potential among all renewable energy sources (RES). To overcome institutional barriers, developing the technology, and creating an initial market, policies are needed. Comparative case studies of Japan and German PV sector from 1990 to 2011 were developed. Japan dominated the PV industry during 1994–2004, PV market increased to 290 MW in 2005. After 2005 Japan's PV market decreased. German PV market increased from 44 MW in 2000 to 7.5 GW in 2011. The reason behind Japanese PV market decline was the unaligned energy policy and termination of incentives. This paper discusses about successful policy implementation and the impact of policy for the diffusion of PV technology. The analysis section of this paper shows how much the PV technology has been diffused during the period of 1990–2011 and finally what will make the transformation process successful. - Highlights: • We studied PV diffusion of Japan and German considering public energy policy, environmental policy and cost reduction. • This study determined that policy and incentives are responsible for cost reduction. • Japans concentration on nuclear energy more than renewables, made the PV diffusion slow. • Successful implementation of FIT helped Germany reduce PV electricity price more than grid electricity
PV solar electricity: status and future
Hoffmann, Winfried
2006-04-01
Within the four main market segments of PV solar electricity there are already three areas competitive today. These are off-grid industrial and rural as well as consumer applications. The overall growth within the past 8 years was almost 40 % p.a. with a "normal" growth of about 18 % p.a. for the first three market segments whereas the grid connected market increased with an astonishing 63 % p.a. The different growth rates catapulted the contribution of grid connected systems in relation to the total market from about one quarter 6 years ago towards more than three quarters today. The reason for this development is basically due to industry-politically induced market support programs in the aforementioned countries. It is quite important to outline under which boundary conditions grid connected systems will be competitive without support programs like the feed in tariff system in Germany, Spain and some more to come in Europe as well as investment subsidies in Japan, US and some other countries. It will be shown that in a more and more liberalized utility market worldwide electricity produced by PV solar electricity systems will be able to compete with their generating cost against peak power prices from utilities. The point of time for this competitiveness is mainly determined by the following facts: 1. Price decrease for PV solar electricity systems leading to an equivalent decrease in the generated cost for PV produced kWh. 2. Development of a truly liberalized electricity market. 3. Degree of irradiation between times of peak power demand and delivery of PV electricity. The first topic is discussed using price experience curves. Some explanations will be given to correlate the qualitative number of 20 % price decrease for doubling cumulative worldwide sales derived from the historic price experience curve with a more quantitative analysis based on our EPIA-Roadmap (productivity increase and ongoing improvements for existing technologies as well as development
User acceptance of diesel/PV hybrid system in an island community
International Nuclear Information System (INIS)
Phuangpornpitak, N.; Kumar, S.
2011-01-01
This paper presents the results of a study conducted at a rural (island) community to understand the role of PV hybrid system installed on an island. Until 2004, most islanders had installed diesel generators in their homes to generate electricity, which was directly supplied to appliances or stored in the batteries for later use. A field survey was carried out to study the user satisfaction of the PV hybrid system in the island community. The attitude of islanders to the PV hybrid system was mostly positive. The islanders can use more electricity, the supply of which can meet the demand. A comparison of pollutions before and after installation of the PV hybrid system was made along with the interviews with the users. The data show that the users are highly satisfied with the PV hybrid system which can reduce environmental impact, especially air and noise pollutions. New opportunities as a result of access to electric service include studying and reading at night that were not possible earlier. All the islanders use the PV hybrid system and more importantly, no one found that the system made their life worse as compared to the earlier state of affairs. (author)
Energy Technology Data Exchange (ETDEWEB)
Blumenscheit, R.; Hettwer, C. [Stadt Barsinghausen (Germany); Diestelmeier, C.; Wiegmann, A. [Raumplan, Hannover (Germany); Decker, B.; Hennig, C.; Mack, M. [Solar Engineering Decker and Mack GmbH, Hannover (Germany)
2004-07-01
The completely building-integrated PV plant with a nominal power of 60.54 kW{sub p} uses synergies with constructional and energetical retrofit of a school building. The PV plant is operated by the town of Barsinghausen (30 km southwest of Hannover). The federal state of Lower Saxony gave a grant of 36,61%, the Hannover region of 12,39% to the total investment of 824.190 Euro (incl. building construction). The PV plant is divided into five units. PV modules serve as the curtain wall of heat-insulated building core (blue PV cold facade: 12.67 kW{sub p}, grey PV breastwork: 8,38 kW{sub p}). Semitransparent PV modules substitute the insulating glass shed lights of a music room (4,28 kW{sub p}) and the glass roofing of an inner court (12,17 kW{sub p} - all modules: Solarnova) giving an optimum of sun-shading and daylighting. Thin-film PV modules on plastic foils (23,04 kW{sub p} - Alwitra EVALON Solar, Unisolar amorphous Si cells) are tested as flat roof standard retrofit. The PV system has 29 string inverters mostly of SMA Sunny Boy family mounted near to the PV modules in operational rooms or in crawling cellars. The PV operator gets a reimbursement of 0,481 Euro per kWh PV energy according to EEG. The PV system is monitored in detail within 'Solaroffensive' of Lower Saxony. Visualization tableaus inform the public about actual irradiance, actual power and annual energy. (orig.) [German] Schulgebaeude und insbesondere grosse Schulzentren aus den 70er Jahren haben geeignete Dachflaechen zur Errichtung von grossen PV-Anlagen (typisch >1.000 m{sup 2}). Zugleich sind Schulen ein idealer Ort, um vor breitem Publikum (Schueler, Lehrer, Eltern) Planung, Installation und Betrieb einer PV-Anlage zu demonstrieren. In Barsinghausen, am Fusse des Deisters etwa 30 km suedwestlich von Hannover, entstand zwischen August 2001 und Maerz 2003 eine innovative PV-Modellanlage am Schulzentrum 'Am Spalterhals', die verschiedene Arten der PV-Gebaeudeintegration erprobt
NREL Suite of Tools for PV and Storage Analysis
Energy Technology Data Exchange (ETDEWEB)
Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Salasovich, James A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2018-04-03
Many different factors such as the solar resource, technology costs and incentives, utility cost and consumption, space available, and financial parameters impact the technical and economic potential of a PV project. NREL has developed techno-economic modeling tools that can be used to evaluate PV projects at a site.
Models for a stand-alone PV system[Photovoltaic
Energy Technology Data Exchange (ETDEWEB)
Hansen, A.D.; Soerensen, P.; Hansen, L.H.; Bindner, H.
2000-12-01
This report presents a number of models for modelling and simulation of a stand-alone photovoltaic (PV) system with a battery bank verified against a system installed at Risoe National Laboratory. The work has been supported by the Danish Ministry of Energy, as a part of the activities in the Solar Energy Centre Denmark. The study is carried out at Risoe National Laboratory with the main purpose to establish a library of simple mathematical models for each individual element of a stand-alone PV system, namely solar cells, battery, controller, inverter and load. The models for PV module and battery are based on the model descriptions found in the literature. The battery model is developed at UMASS and is known as the Kinetic Battery Model (KiBaM). The other component models in the PV system are based on simple electrical knowledge. The implementation is done using Matlab/Simulink, a simulation program that provides a graphical interface for building models as modular block diagrams. The non-linear behaviour of the battery, observed in the measurements, is investigated and compared to the KiBaM model's performance. A set of linear Black box models are estimated based on the battery measurements. The performance of the best linear Black box model is compared to the KiBaM model. A validation of each of the implemented mathematical model is performed by an interactive analysis and comparison between simulation results and measurements, acquired from the stand-alone PV system at Risoe. (au)
Models for a stand-alone PV system
DEFF Research Database (Denmark)
Hansen, A.D.; Sørensen, Poul Ejnar; Hansen, L.H.
2001-01-01
are based on the model descriptions found in the literature. The battery model is developed at UMASS and is known as the Kinetic Battery Model(KiBaM). The other component models in the PV system are based on simple electrical knowledge. The implementation is done using Matlab/Simulink, a simulation program......This report presents a number of models for modelling and simulation of a stand-alone photovoltaic (PV) system with a battery bank verified against a system installed at Risø National Laboratory. The work has been supported by the Danish Ministry ofEnergy, as a part of the activities in the Solar...... Energy Centre Denmark. The study is carried out at Risø National Laboratory with the main purpose to establish a library of simple mathematical models for each individual element of a stand-alone PVsystem, namely solar cells, battery, controller, inverter and load. The models for PV module and battery...
Directory of Open Access Journals (Sweden)
Hatice Karauzum
Full Text Available Previous efforts towards S. aureus vaccine development have largely focused on cell surface antigens to induce opsonophagocytic killing aimed at providing sterile immunity, a concept successfully applied to other Gram-positive pathogens such as Streptococcus pneumoniae. However, these approaches have largely failed, possibly in part due to the remarkable diversity of the staphylococcal virulence factors such as secreted immunosuppressive and tissue destructive toxins. S. aureus produces several pore-forming toxins including the single subunit alpha hemolysin as well as bicomponent leukotoxins such as Panton-Valentine leukocidin (PVL, gamma hemolysins (Hlg, and LukED. Here we report the generation of highly attenuated mutants of PVL subunits LukS-PV and LukF-PV that were rationally designed, based on an octameric structural model of the toxin, to be deficient in oligomerization. The attenuated subunit vaccines were highly immunogenic and showed significant protection in a mouse model of S. aureus USA300 sepsis. Protection against sepsis was also demonstrated by passive transfer of rabbit immunoglobulin raised against LukS-PV. Antibodies to LukS-PV inhibited the homologous oligomerization of LukS-PV with LukF-PV as well heterologous oligomerization with HlgB. Importantly, immune sera from mice vaccinated with the LukS mutant not only inhibited the PMN lytic activity produced by the PVL-positive USA300 but also blocked PMN lysis induced by supernatants of PVL-negative strains suggesting a broad protective activity towards other bicomponent toxins. These findings strongly support the novel concept of an anti-virulence, toxin-based vaccine intended for prevention of clinical S. aureus invasive disease, rather than achieving sterile immunity. Such a multivalent vaccine may include attenuated leukotoxins, alpha hemolysin, and superantigens.
Determining the Impact of Steady-State PV Fault Current Injections on Distribution Protection
Energy Technology Data Exchange (ETDEWEB)
Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Grijalva, Santiago [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-05-01
This report investigates the fault current contribution from a single large PV system and the impact it has on existing distribution overcurrent protection devices. Assumptions are made about the modeling of the PV system under fault to perform exhaustive steady - state fault analyses throughout distribution feeder models. Each PV interconnection location is tested to determine how the size of the PV system affects the fault current measured by each protection device. This data is then searched for logical conditions that indicate whether a protection device has operated in a manner that will cause more customer outages due to the addition of the PV system. This is referred to as a protection issue , and there are four unique types of issues that have been identified in the study. The PV system size at which any issues occur are recorded to determine the feeder's PV hosting capacity limitations due to interference with protection settings. The analysis is carried out on six feeder models. The report concludes with a discussion of the prevalence and cause of each protection issue caused by PV system fault current.
NREL PV working with industry, Third quarter 1998
Energy Technology Data Exchange (ETDEWEB)
Moon, S.; Cook, G.
1998-12-04
This quarterly report encourages cooperative R and D by providing the US PV industry with information on activities and capabilities of the laboratories. This issue contains information on the CIS and CdTe R and D teams, an editorial by Richard King on the stand-out accomplishments of the PV Program, and an overview of the NCPV Program Review Meeting highlighting the strength of US photovoltaics.
How to Estimate Demand Charge Savings from PV on Commercial Buildings
Energy Technology Data Exchange (ETDEWEB)
Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Bird, Lori A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-09-28
Rooftop photovoltaic (PV) systems are compensated through retail electricity tariffs - and for commercial and industrial customers, these are typically comprised of three components: a fixed monthly charge, energy charges, and demand charges. Of these, PV's ability to reduce demand charges has traditionally been the most difficult to estimate. In this fact sheet we explain the basics of demand charges, and provide a new method that a potential customer or PV developer can use to estimate a range of potential demand charge savings for a proposed PV system. These savings can then be added to other project cash flows, in assessing the project's financial performance.
Sustainable recycling technologies for Solar PV off-grid system
Uppal, Bhavesh; Tamboli, Adish; Wubhayavedantapuram, Nandan
2017-11-01
Policy makers throughout the world have accepted climate change as a repercussion of fossil fuel exploitation. This has led the governments to integrate renewable energy streams in their national energy mix. PV off-grid Systems have been at the forefront of this transition because of their permanently increasing efficiency and cost effectiveness. These systems are expected to produce large amount of different waste streams at the end of their lifetime. It is important that these waste streams should be recycled because of the lack of available resources. Our study found that separate researches have been carried out to increase the efficiencies of recycling of individual PV system components but there is a lack of a comprehensive methodical research which details efficient and sustainable recycling processes for the entire PV off-grid system. This paper reviews the current and future recycling technologies for PV off-grid systems and presents a scheme of the most sustainable recycling technologies which have the potential for adoption. Full Recovery End-of-Life Photovoltaic (FRELP) recycling technology can offer opportunities to sustainably recycle crystalline silicon PV modules. Electro-hydrometallurgical process & Vacuum technologies can be used for recovering lead from lead acid batteries with a high recovery rate. The metals in the WEEE can be recycled by using a combination of biometallurgical technology, vacuum metallurgical technology and other advanced metallurgical technologies (utrasonical, mechano-chemical technology) while the plastic components can be effectively recycled without separation by using compatibilizers. All these advanced technologies when used in combination with each other provide sustainable recycling options for growing PV off-grid systems waste. These promising technologies still need further improvement and require proper integration techniques before implementation.
EcPV2 DNA in equine genital squamous cell carcinomas and normal genital mucosa.
Bogaert, Lies; Willemsen, Anouk; Vanderstraeten, Eva; Bracho, Maria A; De Baere, Cindy; Bravo, Ignacio G; Martens, Ann
2012-07-06
Squamous cell carcinoma (SCC) represents the most common genital malignant tumor in horses. Similar to humans, papillomaviruses (PVs) have been proposed as etiological agents and recently Equine papillomavirus type 2 (EcPV2) has been identified in a subset of genital SCCs. The goals of this study were (1) to determine the prevalence of EcPV2 DNA in tissue samples from equine genital SCCs, penile intraepithelial neoplasia (PIN) and penile papillomas, using EcPV2-specific PCR, (2) to examine the prevalence of latent EcPV2 infection in healthy genital mucosa and (3) to determine genetic variability within EcPV2 and to disentangle phylogenetic relationships of EcPV2 among PVs. EcPV2 DNA was detected in all but one penile SCC (15/16), in all PIN lesions (8/8) and penile papillomas (4/4). Additionally, EcPV2 DNA was demonstrated in one of two metastasized lymph nodes, one contact metastasis in the mouth, two vaginal and one anal lesion. In healthy horses, EcPV2 DNA was detected in 10% (4/39) of penile swabs but in none of vulvovaginal swabs (0/20). This study confirms the presence of EcPV2 DNA in equine genital SCCs and shows its involvement in anal lesions, a lymph node and contact metastases. Latent EcPV2 presence was also shown in normal male genital mucosa. We found that different EcPV2 variants cocirculate among horses and that EcPV2 is related to the Delta+Zeta PVs and is only a very distant relative of high-risk human PVs causing genital cancer. Thus, similar viral tropism and similar malignant outcome of the infection do not imply close evolutionary relationship. Copyright © 2012 Elsevier B.V. All rights reserved.
Simulation of Power Produced by a Building Added PV System in Indonesia using virtual reality
Veldhuis, A.J.; Reinders, Angelina H.M.E.
2014-01-01
In this study a PV system will be simulated using virtual reality software for PV system simulations -called VR4PV - to show the effectiveness of the modelling of PV systems on buildings which are placed in the tropics. The PV system used for this study has been installed in Papua, Indonesia and
STAT FAQs Part 2: Lifetime of PV Panels | State, Local, and Tribal
Governments | NREL STAT FAQs Part 2: Lifetime of PV Panels STAT FAQs Part 2: Lifetime of PV Panels April 23, 2018 by Benjamin Mow The Solar Technical Assistance Team (STAT) receives many is the productive lifetime and degradation rate of solar PV panels. Question: What is the productive
Energy Technology Data Exchange (ETDEWEB)
Bolinger, Mark [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Holt, Edward [Ed Holt & Associates, Inc., Harpswell, ME (United States)
2015-06-01
High up-front costs and a lack of financing options have historically been the primary barriers to the adoption of photovoltaics (PV) in the residential sector. State clean energy funds, which emerged in a number of states from the restructuring of the electricity industry in the mid-to-late 1990s, have for many years attempted to overcome these barriers through PV rebate and, in some cases, loan programs. While these programs (rebate programs in particular) have been popular, the residential PV market in the United States only started to achieve significant scale in the last five years – driven in large part by an initial wave of financial innovation that led to the rise of third-party ownership.
Spatio-temporal analysis of regional PV generation
DEFF Research Database (Denmark)
Nuño Martinez, Edgar; Cutululis, Nicolaos Antonio
2016-01-01
Photovoltaic (PV) power is growing in importance worldwide and hence needs to be represented in operation and planning of power system. As opposed to traditional generation technologies, it is characterized by exhibiting both a high variability and a significant spatial dependence. This paper...... presents a fundamental analysis of regional solar generation time series, aiming to potentially facilitate large-scale solar integration. It will focus on characterizing the underlying dependence structure at the system level as well as describing both statistical and temporal properties of regional PV...
An Emulated PV Source Based on an Unilluminated Solar Panel and DC Power Supply
Directory of Open Access Journals (Sweden)
Zhongfu Zhou
2017-12-01
Full Text Available This paper provides a review on various PV simulator technologies as well as presents a novel equivalent photovoltaic (PV source that was constructed by using un-illuminated solar panels and a DC power supply that operates in current source mode. The constructed PV source was used for testing photovoltaic converters and various maximum power point tracking (MPPT algorithms required for capturing the maximum possible output power. The mathematical model and electrical characteristics of the constructed PV source were defined and analyzed in detail in the paper. The constructed PV source has the advantages of high bandwidth over the switching circuit based PV simulators. The constructed PV source has been used for testing various power electronics converters and various control techniques effectively in laboratory environments for researchers and university students.
Smoothing out the volatility of South Africa's wind and PV energy resources
CSIR Research Space (South Africa)
Bofinger, S
2015-10-01
Full Text Available Solar PV & wind are the cheapest new-build options per kWh in South Africa. By 2020, a mix of PV, wind and flexible gas (LNG-based) costs the same as new coal, even without any value given to excess wind/PV energy. South Africa has abundant solar...
Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso; Blaabjerg, Frede
2018-01-01
Lifetime of PV inverters is affected by the installation sites related to different solar irradiance and ambient temperature profiles (also referred to as mission profiles). In fact, the installation site also affects the degradation rate of the PV panels, and thus long-term energy production and reliability. Prior-art lifetime analysis in PV inverters has not yet investigated the impact of PV panel degradations. This paper thus evaluates the lifetime of PV inverters considering panel degrada...
Interconnecting PV on New York City's Secondary Network Distribution System
Energy Technology Data Exchange (ETDEWEB)
Anderson, K; Coddington, M; Burman, K; Hayter, S; Kroposki, B; Watson, and A
2009-11-01
The U.S. Department of Energy (DOE) has teamed with cities across the country through the Solar America Cities (SAC) partnership program to help reduce barriers and accelerate implementation of solar energy. The New York City SAC team is a partnership between the City University of New York (CUNY), the New York City Mayor s Office of Long-term Planning and Sustainability, and the New York City Economic Development Corporation (NYCEDC).The New York City SAC team is working with DOE s National Renewable Energy Laboratory (NREL) and Con Edison, the local utility, to develop a roadmap for photovoltaic (PV) installations in the five boroughs. The city set a goal to increase its installed PV capacity from1.1 MW in 2005 to 8.1 MW by 2015 (the maximum allowed in 2005). A key barrier to reaching this goal, however, is the complexity of the interconnection process with the local utility. Unique challenges are associated with connecting distributed PV systems to secondary network distribution systems (simplified to networks in this report). Although most areas of the country use simpler radial distribution systems to distribute electricity, larger metropolitan areas like New York City typically use networks to increase reliability in large load centers. Unlike the radial distribution system, where each customer receives power through a single line, a network uses a grid of interconnected lines to deliver power to each customer through several parallel circuits and sources. This redundancy improves reliability, but it also requires more complicated coordination and protection schemes that can be disrupted by energy exported from distributed PV systems. Currently, Con Edison studies each potential PV system in New York City to evaluate the system s impact on the network, but this is time consuming for utility engineers and may delay the customer s project or add cost for larger installations. City leaders would like to streamline this process to facilitate faster, simpler, and
Ravikumar, Dwarakanath; Sinha, Parikhit
2017-10-01
With utility-scale photovoltaic (PV) projects increasingly developed in dry and dust-prone geographies with high solar insolation, there is a critical need to analyze the impacts of PV installations on the resulting particulate matter (PM) concentrations, which have environmental and health impacts. This study is the first to quantify the impact of a utility-scale PV plant on PM concentrations downwind of the project site. Background, construction, and post-construction PM 2.5 and PM 10 (PM with aerodynamic diameters construction through a wind-shielding effect. The results show that the (1) confidence intervals of the mean PM concentrations during construction overlap with or are lower than background concentrations for three of the four BAM stations; and (2) post-construction PM 2.5 and PM 10 concentrations downwind of the PV installation are significantly lower than the background concentrations at three of the four BAM stations. At the fourth BAM station, downwind post-construction PM 2.5 and PM 10 concentrations increased marginally by 5.7% and 2.6% of the 24-hr ambient air quality standards defined by the U.S. Environmental Protection Agency, respectively, when compared with background concentrations, with the PM 2.5 increase being statistically insignificant. This increase may be due to vehicular emissions from an access road near the southwest corner of the site or a drainage berm near the south station. The findings demonstrate the overall environmental benefit of downwind PM emission abatement from a utility-scale PV installation in desert conditions due to wind shielding. With PM emission reductions observed within 10 months of completion of construction, post-construction monitoring of downwind PM levels may be reduced to a 1-yr period for other projects with similar soil and weather conditions. This study is the first to analyze impact of a utility photovoltaic (PV) project on downwind particulate matter (PM) concentration in desert conditions. The PM
Numerical modelling of phase-change material used for PV panels cooling
Sellami, Assia; Elotmani, Rabie; Kandoussi, Khalid; Eljouad, Mohamed; Hajjaji, Abdelowahed; Boutaous, M'Hamed
2017-12-01
Passive cooling of a PV solar panel using phase-change material (PCM) may play an important role in increasing efficiency of PV cells. Because it does not need a maintenance and does not release greenhouses gases, PCM seems to be a good way to decrease the among of overheating of PV cell. The aims of this paper describes a detailed multiphysical issue in order to understand the effect of PCM (RT25) in keeping PV cell temperature close to ambient. The study is focused on modeling the heat and mass transfer in a PCM domain by modifying the buoyancy term in momentum equation. Due to a phase-change and free convection, transient incompressible flow is taken into account to explain the dynamic variations of the velocity profile and viscosity distribution. With standard condition of irradiation and heat flux on both sides of the PV panel, a melt front has been tracked by the energy equation, which gives a good argument for the temperature evolution during phase-change.
Lee, Boyoung; Lee, Soohyun; Ryu, Choong-Min
2012-07-01
Plants modulate defence signalling networks in response to different biotic stresses. The present study evaluated the effect of a phloem-sucking aphid on plant defence mechanisms in pepper (Capsicum annuum) during subsequent pathogen attacks on leaves and rhizosphere bacteria on roots. Plants were pretreated with aphids and/or the chemical trigger benzothiadiazol (BTH) 7 d before being challenged with two pathogenic bacteria, Xanthomonas axonopodis pv. vesicatoria (Xav) as a compatible pathogen and X. axonopodis pv. glycines (Xag) as an incompatible (non-host) pathogen. Disease severity was noticeably lower in aphid- and BTH + aphid-treated plants than in controls. Although treatment with BTH or aphids alone did not affect the hypersensitive response (HR) against Xag strain 8ra, the combination treatment had a synergistic effect on the HR. The aphid population was reduced by BTH pretreatment and by combination treatment with BTH and bacterial pathogens in a synergistic manner. Analysis of the expression of the defence-related genes Capsicum annum pathogenesis-related gene 9 (CaPR9), chitinase 2 (CaCHI2), SAR8·2 and Lipoxygenase1 (CaLOX1) revealed that aphid infestation resulted in the priming of the systemic defence responses against compatible and incompatible pathogens. Conversely, pre-challenge with the compatible pathogen Xav on pepper leaves significantly reduced aphid numbers. Aphid infestation increased the population of the beneficial Bacillus subtilis GB03 but reduced that of the pathogenic Ralstonia solanacearum SL1931. The expression of defence-related genes in the root and leaf after aphid feeding indicated that the above-ground aphid infestation elicited salicylic acid and jasmonic acid signalling throughout the whole plant. The findings of this study show that aphid feeding elicits plant resistance responses and attracts beneficial bacterial populations to help the plant cope with subsequent pathogen attacks.
Directory of Open Access Journals (Sweden)
Tzu-Pi Huang
Full Text Available Citrus bacterial canker caused by Xanthomonas axonopodis pv. citri is a devastating disease resulting in significant crop losses in various citrus cultivars worldwide. A biocontrol agent has not been recommended for this disease. To explore the potential of bacilli native to Taiwan to control this disease, Bacillus species with a broad spectrum of antagonistic activity against various phytopathogens were isolated from plant potting mixes, organic compost and the rhizosphere soil. Seven strains TKS1-1, OF3-16, SP4-17, HSP1, WG6-14, TLB7-7, and WP8-12 showing superior antagonistic activity were chosen for biopesticide development. The genetic identity based on 16S rDNA sequences indicated that all seven native strains were close relatives of the B. subtilis group and appeared to be discrete from the B. cereus group. DNA polymorphisms in strains WG6-14, SP4-17, TKS1-1, and WP8-12, as revealed by repetitive sequence-based PCR with the BOXA1R primers were similar to each other, but different from those of the respective Bacillus type strains. However, molecular typing of the strains using either tDNA-intergenic spacer regions or 16S-23S intergenic transcribed spacer regions was unable to differentiate the strains at the species level. Strains TKS1-1 and WG6-14 attenuated symptom development of citrus bacterial canker, which was found to be correlated with a reduction in colonization and biofilm formation by X. axonopodis pv. citri on leaf surfaces. The application of a Bacillus strain TKS1-1 endospore formulation to the leaf surfaces of citrus reduced the incidence of citrus bacterial canker and could prevent development of the disease.
Current limitations of trend curve analysis for the prediction of reactor PV embrittlement
International Nuclear Information System (INIS)
Gold, R.; McElroy, W.N.
1986-02-01
In operating light water reactor (LWR) commercial power plants, neutron radiation induces embrittlement of the pressure vessel (PV) and its support structures. As a consequence, LWR-PV integrity is a primary safety consideration. LWR-PV integrity is a significant economic consideration since the PV and its support structures are nonreplaceable power plant components and embrittlement of these components can therefore limit the effective operating lifetime of the plant
MISTURAS VITAMÍNICAS NA REGENERAÇÃO DO MARACUJAZEIRO AMARELO (Passiflora edulis f. flavicarpa Deg.
Directory of Open Access Journals (Sweden)
Ribas Alessandra Ferreira
2002-01-01
Full Text Available Cotilédones obtidos a partir de sementes germinadas in vitro foram usados como explantes com o objetivo de avaliar o efeito de dois complexos vitamínicos e de duas concentrações de 6-benzilaminopurina (BAP na organogênese direta do maracujá amarelo (Passiflora edulis f. flavicarpa Deg.. Empregou-se o meio Murashige & Skoog (1962 suplementado com as vitaminas MS ou B5 (vitaminas de GAMBORG et al., 1968 e 1 ou 2 mg. -1 de BAP. Foram testados quatro tratamentos, sendo cada um constituído de 60 explantes. O experimento foi inteiramente casualizado, com dez repetições. Os dados, analisados pelo teste de Tukey, demonstraram que os meios de cultura suplementados com o complexo vitamínico B5 induziram gemas em mais de 70% dos explantes, obtendo-se até 8 brotos por explante, com um enraizamento superior a 90%. A análise de ploidia das plantas regeneradas indicou um número aparentemente normal de cromossomos típicos dessa espécie (2n=18
PVSOFT99 - Photovoltaic (PV) System Sizing And Simulation Software
African Journals Online (AJOL)
A computer program (PVSOFT99) has been developed for sizing and simulation of stand-alone photovoltaic (PV) systems. Two distinct PV sizing algorithms, one based on the worst case and the other on the reliability concept, have been incorporated in the program. The reliability concept is generalized in that variation of ...
Developing solar: PV solar system markets in Africa
International Nuclear Information System (INIS)
Asali, Karim
2002-01-01
Governments, NGO's and UN organisations are increasingly convinced that renewable energies not only help to solve energy problems in Africa but are indispensable in alleviating regional disparities, social problems and bridging the digital gap. Still, many years after introducing high efficiency solar PV systems the necessary breakthrough of implementing them on a mass scale is still not a reality. The author provides perspectives on developing solar PV in Africa. (Author)
Multilevel governance and deployment of solar PV panels in U.S. cities
International Nuclear Information System (INIS)
Li, Hui; Yi, Hongtao
2014-01-01
Solar photovoltaic (PV) installations have been growing rapidly in the United States over the last few years, incentivized by policies from federal, state and local governments. The complex relationships between solar policies at multiple levels of government and solar deployment are questions of importance to policy makers and scholars. Extant literature on solar policies pays less attention to the role of local governments and policies than to their federal and state counterparts. Local governments and policies play indispensable roles in the deployment of solar PVs. This paper studies the multilevel governance of solar development in the U.S. by evaluating the relative effectiveness of state and local policy tools in stimulating solar PV installations, with an emphasis on local solar policies. With a regression analysis on a national sample of 186 U.S. cities, we find that cities with local financial incentives deploy 69% more solar PV capacities than cities without such policies. We also find that cities subject to RPS requirements have 295% more solar PV capacity, compared with cities not regulated by state RPS. - Highlights: • This study evaluates state and local solar PV policies. • State RPS has positive impacts on local solar PV capacity. • Local financial incentives matter for solar PV deployment
Measures for diffusion of solar PV in selected African countries
DEFF Research Database (Denmark)
Nygaard, Ivan; Hansen, Ulrich Elmer; Mackenzie, Gordon A.
2017-01-01
that governments’ strategies to promoting solar PV are moving from isolated projects towards frameworks for market development and that there are high expectations to upgrading in the PV value chain through local assembly of panels and local production of other system elements. Commonly identified measures include......This paper investigates how African governments are considering supporting and promoting the diffusion of solar PV. This issue is explored by examining so-called ‘technology action plans (TAPs)’, which were main outputs of the Technology Needs Assessment project implemented in 10 African countries...... from 2010 to 2013. The paper provides a review of three distinct but characteristic trajectories for PV market development in Kenya (private-led market for solar home systems), Morocco (utility-led fee-for service model) and Rwanda (donorled market for institutional systems). The paper finds...
Meio semi-seletivo para isolamento de Xanthomonas campestris pv. viticola
Directory of Open Access Journals (Sweden)
Peixoto Ana Rosa
2006-01-01
Full Text Available O cancro bacteriano causado por Xanthomonas campestris pv. viticola é a fitobacteriose mais importante da videira no Submédio São Francisco. O isolamento de X. campestris pv. viticola de tecidos vegetais infectados é dificultado pela presença de contaminantes bacterianos, entre os quais Microbacterium barkeri. Objetivando-se a formulação de meio de cultura semi-seletivo, 22 isolados de X. campestris pv. viticola foram testados com relação a 30 antibióticos. O meio semi-seletivo NYDAM (extrato de carne 3, peptona 5, glicose 10, extrato de levedura 5, ágar 18 e ampicilina 0,1 em g L-1 inibiu M. barkeri e bactérias fitopatogênicas podendo ser utilizado para isolar X. campestris pv. viticola de hospedeiros com infecção natural em campo.
Evaluating the Technical and Economic Performance of PV Plus Storage Power Plants
Energy Technology Data Exchange (ETDEWEB)
Denholm, Paul L. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Eichman, Joshua D. [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2017-08-17
The decreasing costs of both PV and energy storage technologies have raised interest in the creation of combined PV plus storage systems to provide dispatchable energy and reliable capacity. In this study, we examine the tradeoffs among various PV plus storage configurations and quantify the impact of configuration on system net value.
Multilayer PV-storage Microgrids Algorithm for the Dispatch of Distributed Network
Directory of Open Access Journals (Sweden)
Yang Ping
2016-01-01
Full Text Available In recent years, due to the support of our country, PV-storage microgrid develops rapidly. However, the flexible network operation modes of PV-storage microgrid change flexibly and the operating characteristics with a large amout of sources is highly complicated. Based on the existing microgrid coordinate control methods, this paper proposes multilayer PV-storage microgrid algorithm for fitting dispatch of distributed network, which achieves maximum output of renewable energy when meeting the scheduling requirements of network, by building PV-storage microgrid type dynamic simulation system in a variety of conditions in PSCAD. Simulation results show that the heuristic algorithm proposed can achieve microgrid stable operation and satisfy the demands of the dispatch in distributed network.
Sensitivity of Rooftop PV Projections in the SunShot Vision Study to Market Assumptions
Energy Technology Data Exchange (ETDEWEB)
Drury, E.; Denholm, P.; Margolis, R.
2013-01-01
The SunShot Vision Study explored the potential growth of solar markets if solar prices decreased by about 75% from 2010 to 2020. The SolarDS model was used to simulate rooftop PV demand for this study, based on several PV market assumptions--future electricity rates, customer access to financing, and others--in addition to the SunShot PV price projections. This paper finds that modeled PV demand is highly sensitive to several non-price market assumptions, particularly PV financing parameters.
Energy Technology Data Exchange (ETDEWEB)
2011-08-01
The U.S. photovoltaic (PV) industry is forecast to grow, and it represents an opportunity for economic development and job creation in communities throughout the United States. This report helps U.S. cities evaluate economic opportunities in the PV industry. It serves as a guide for local economic development offices in evaluating their community?s competitiveness in the solar PV industry, assessing the viability of solar PV development goals, and developing strategies for recruiting and retaining PV companies to their areas.
Energy Technology Data Exchange (ETDEWEB)
Staudacher, Dietmar [Fronius International GmbH, Wels (Austria)
2012-05-15
In the past, the disposition to install east/west oriented PV systems was rather subdued. Meanwhile, a growing interest in the installation of PV arrays on east/west roof is observed. Although PV systems with south orientations are better east/west-oriented PV arrays also with considerable yields can be achieved.
Leakage current measurement in transformerless PV inverters
DEFF Research Database (Denmark)
Kerekes, Tamas; Sera, Dezso; Mathe, Laszlo
2012-01-01
Photovoltaic (PV) installations have seen a huge increase during the last couple of years. Transformerless PV inverters are gaining more share of the total inverter market, due to their high conversion efficiency, small weight and size. Nevertheless safety should have an important role in case...... of these tranformerless systems, due to the missing galvanic isolation. Leakage and fault current measurement is a key issue for these inverter topologies to be able to comply with the required safety standards. This article presents the test results of two different current measurement sensors that were suggested...
Sustainable recycling technologies for Solar PV off-grid system
Directory of Open Access Journals (Sweden)
Uppal Bhavesh
2017-01-01
Full Text Available Policy makers throughout the world have accepted climate change as a repercussion of fossil fuel exploitation. This has led the governments to integrate renewable energy streams in their national energy mix. PV off-grid Systems have been at the forefront of this transition because of their permanently increasing efficiency and cost effectiveness. These systems are expected to produce large amount of different waste streams at the end of their lifetime. It is important that these waste streams should be recycled because of the lack of available resources. Our study found that separate researches have been carried out to increase the efficiencies of recycling of individual PV system components but there is a lack of a comprehensive methodical research which details efficient and sustainable recycling processes for the entire PV off-grid system. This paper reviews the current and future recycling technologies for PV off-grid systems and presents a scheme of the most sustainable recycling technologies which have the potential for adoption. Full Recovery End-of-Life Photovoltaic (FRELP recycling technology can offer opportunities to sustainably recycle crystalline silicon PV modules. Electro-hydrometallurgical process & Vacuum technologies can be used for recovering lead from lead acid batteries with a high recovery rate. The metals in the WEEE can be recycled by using a combination of biometallurgical technology, vacuum metallurgical technology and other advanced metallurgical technologies (utrasonical, mechano-chemical technology while the plastic components can be effectively recycled without separation by using compatibilizers. All these advanced technologies when used in combination with each other provide sustainable recycling options for growing PV off-grid systems waste. These promising technologies still need further improvement and require proper integration techniques before implementation.
Product integrated PV: the future is design and styling
Eggink, Wouter; Reinders, Angelina H.M.E.
2016-01-01
In this paper we explore how PV powered products have been designed in the past. For this purpose we have drawn a historical time line of the design features of PV powered products in the context of main stream design and styling. Our time frame is 1970 till 2016, focusing in first instance on
Impact of PID on industrial rooftop PV-installations
Buerhop, Claudia; Fecher, Frank W.; Pickel, Tobias; Patel, Tirth; Zetzmann, Cornelia; Camus, Christian; Hauch, Jens; Brabec, Christoph J.
2017-08-01
Potential induced degradation (PID) causes severe damage and financial losses even in modern PV-installations. In Germany, approximately 19% of PV-installations suffer from PID and resulting power loss. This paper focuses on the impact of PID in real installations and how different evaluated time intervals influence the performance ratio (PR) and the determined degradation rate. The analysis focuses exemplarily on a 314 kWp PV-system in the Atlantic coastal climate. IR-imaging is used for identifying PID without operation interruption. Historic electric performance data are available from a monitoring system for several years on system level, string level as well as punctually measured module string IV- curves. The data sets are combined for understanding the PID behavior of this PV plant. The number of PID affected cells within a string varies strongly between 1 to 22% with the string position on the building complex. With increasing number of PID-affected cells the performance ratio decreases down to 60% for daily and monthly periods. Local differences in PID evolution rates are identified. An average PR-reduction of -3.65% per year is found for the PV-plant. On the string level the degradation rate varied up to 8.8% per year depending on the string position and the time period. The analysis reveals that PID generation and evolution in roof-top installations on industrial buildings with locally varying operation conditions can be fairly complex. The results yield that local operating conditions, e.g. ambient weather conditions as well as surrounding conditions on an industrial building, seem to have a dominating impact on the PID evolution rate.
Solar PV O&M Standards and Best Practices – Existing Gaps and Improvement Efforts
Energy Technology Data Exchange (ETDEWEB)
Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Balfour, John R. [High Performance PV, Phoenix, AZ (United States); Keating, T. J. [SunSpec Alliance, San Jose, CA (United States)
2014-11-01
As greater numbers of photovoltaic (PV) systems are being installed, operations & maintenance (O&M) activities will need to be performed to ensure the PV system is operating as designed over its useful lifetime. To mitigate risks to PV system availability and performance, standardized procedures for O&M activities are needed to ensure high reliability and long-term system bankability. Efforts are just getting underway to address the need for standard O&M procedures as PV gains a larger share of U.S. generation capacity. Due to the existing landscape of how and where PV is installed, including distributed generation from small and medium PV systems, as well as large, centralized utility-scale PV, O&M activities will require different levels of expertise and reporting, making standards even more important. This report summarizes recent efforts made by solar industry stakeholders to identify the existing standards and best practices applied to solar PV O&M activities, and determine the gaps that have yet to be, or are currently being addressed by industry.
Directory of Open Access Journals (Sweden)
Maria José de Carvalho
2010-03-01
Full Text Available O gênero Passiflora (Passifloraceae é utilizado principalmente para tratar doenças do SNC e cardiovasculares. A espécie Passiflora nitida Kunth é comumente conhecida como “maracujá-do-mato". A literatura relata o consumo in natura dos frutos desta espécie pela população local para distúrbios gastrointestinais. Considerando o potencial farmacológico do gênero, este trabalho teve por objetivo realizar estudo de caracterização fitoquímica desta espécie e estudar os efeitos dos extratos aquoso (EA, etanólico (EE e hexânico (EH de suas folhas sobre a coagulação sanguínea e agregação plaquetária. Para a caracterização fitoquímica foram realizados testes de cromatografia em camada delgada e ressonância magnética nuclear. O efeito dos extratos sobre a coagulação foi avaliado pelos testes de tempo de protrombina (TP e tempo de tromboplastina parcial ativada (TTPa. O efeito sobre a agregação plaquetária foi avaliado em plasma rico em plaquetas por método espectrofotométrico, usando adenosina difosfato (ADP e adrenalina (ADR como indutores da agregação. Os extratos EA, EE e EH apresentaram atividade coagulante pelo teste do TP e o EE apresentou atividade anticoagulante para o TTPa. Quando induzidos por ADP, os extratos EA, EE e EH apresentaram valores de concentração inibitória 50% (CI50, µg/mL de 450,5 ± 50,7; 511,2 ± 35,5 e 394,4 ± 8,9, respectivamente, e quando induzidos por ADR apresentaram valores de 438,7 ± 5,2; 21,0 ± 1,9 e 546,9 ± 49,9, respectivamente. O EE apresentou atividade inibitória sobre a agregação. A caracterização fitoquímica foi sugestiva da presença de flavonóides e cumarinas, aos quais podem ser atribuídos, em parte, os efeitos biológicos estudados.The Passiflora genus (Passifloraceae is mainly used to treat CNS and cardiovascular diseases. The Passiflora nitida Kunth species is commonly known as “maracujá-do-mato". The literature reports the in natura consumption of
Comparative analysis of old, recycled and new PV modules
Directory of Open Access Journals (Sweden)
Haroon Ashfaq
2017-01-01
Full Text Available This paper presents comparative analysis of old, recycled and new PV modules. It is possible to recycle even very old products by modern standard processes in a value-conserving manner. About 90% of the materials recovered from solar panels can be recycled into useful products. Carbon emission and energy cost are low in manufacturing recycled SPV. Modules can be manufactured with recycled materials and reinstalled in systems as a full quality product with today’s technology good for another 25–30 years. Analysis of all the models of PV module is done with the help of MATLAB. This helps in comparison and proves the effectiveness of the recycled PV module based systems.
Energy Technology Data Exchange (ETDEWEB)
Stein, Joshua [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-03-01
In 2014, the IEA PVPS Task 13 added the PVPMC as a formal activity to its technical work plan for 2014-2017. The goal of this activity is to expand the reach of the PVPMC to a broader international audience and help to reduce PV performance modeling uncertainties worldwide. One of the main deliverables of this activity is to host one or more PVPMC workshops outside the US to foster more international participation within this collaborative group. This report reviews the results of the first in a series of these joint IEA PVPS Task 13/PVPMC workshops. The 4th PV Performance Modeling Collaborative Workshop was held in Cologne, Germany at the headquarters of TÜV Rheinland on October 22-23, 2015.
Directory of Open Access Journals (Sweden)
Faa-Jeng Lin
2017-01-01
Full Text Available An intelligent PV power smoothing control using probabilistic fuzzy neural network with asymmetric membership function (PFNN-AMF is proposed in this study. First, a photovoltaic (PV power plant with a battery energy storage system (BESS is introduced. The BESS consisted of a bidirectional DC/AC 3-phase inverter and LiFePO4 batteries. Then, the difference of the actual PV power and smoothed power is supplied by the BESS. Moreover, the network structure of the PFNN-AMF and its online learning algorithms are described in detail. Furthermore, the three-phase output currents of the PV power plant are converted to the dq-axis current components. The resulted q-axis current is the input of the PFNN-AMF power smoothing control, and the output is a smoothing PV power curve to achieve the effect of PV power smoothing. Comparing to the other smoothing methods, a minimum energy capacity of the BESS with a small fluctuation of the grid power can be achieved by the PV power smoothing control using PFNN-AMF. In addition, a personal computer- (PC- based PV power plant emulator and BESS are built for the experimentation. From the experimental results of various irradiance variation conditions, the effectiveness of the proposed intelligent PV power smoothing control can be verified.
A Standalone PV System with a Hybrid P&O MPPT Optimization Technique
Directory of Open Access Journals (Sweden)
S. Hota
2017-12-01
Full Text Available In this paper a maximum power point tracking (MPPT design for a photovoltaic (PV system using a hybrid optimization technique is proposed. For maximum power transfer, maximum harvestable power from a PV cell in a dynamically changing surrounding should be known. The proposed technique is compared with the conventional Perturb and Observe (P&O technique. A comparative analysis of power-voltage and current-voltage characteristics of a PV cell with and without the MPPT module when connected to the grid was performed in SIMULINK, to demonstrate the increment in the efficiency of the PV module after using the MPPT module.
PV market in Germany and activities of the metropolitan utility of Karlsruhe
International Nuclear Information System (INIS)
Weissmueller, G.; Lewald, N.
2001-01-01
The introduction of the Renewable Energy Law in Germany in combination with the 100,000 roof program lead to an explosion of the market for grid-connected PV systems, with all possible effects such as the formation of new PV companies, job creation and the installation of a huge number of PV systems. But there is also one negative aspect: higher prices for the modules due to production bottle-necks. The Municipal Utility of Karlsruhe (SWK) commits itself to the sector of renewable energy especially PV. Some of these activities are also described in the paper
Efficient outdoor performance of esthetic bifacial a-Si:H semi-transparent PV modules
International Nuclear Information System (INIS)
Myong, Seung Yeop; Jeon, Sang Won
2016-01-01
Highlights: • 1.43 m"2 a-Si:H semi-transparent PV modules with emotionally inoffensive and esthetically pleasing colors are developed. • Seasonal outdoor performance of the developed colorful PV modules is measured and simulated. • The bifacial TBC a-Si:H semi-transparent PV module performs at a superior annual electrical energy output. • An impressive performance ratio of 124.5% is achieved by surpassing a simulated prediction considerably. - Abstract: We developed bifacial transparent back contact (TBC) hydrogenated amorphous silicon (a-Si:H) semi-transparent glass-to-glass photovoltaic (PV) modules with emotionally inoffensive and esthetically pleasing colors have been developed by combining the transparent back contact and color of the back glass. Due to the high series resistance of the transparent back contact, the bifacial TBC a-Si:H semi-transparent PV modules had a lower rated power after light soaking than the monofacial opaque (metal) back contact (OBC) a-Si:H semi-transparent PV modules fabricated using the additional laser scribing patterns. However, the TBC a-Si:H semi-transparent PV module produced a higher annual electrical energy output than the OBC a-Si:H semi-transparent PV module thanks to bifacial power generation during the outdoor field test. In particular, the performance ratio of the TBC a-Si:H semi-transparent PV module measured at the optimal tilt angle of 30° surpassed its simulated prediction by a drastically high value of 124.5%. At a higher tilt angle of 85°, bifacial power generation produced a higher deviation between the measured and simulated annual performance of the TBC a-Si:H semi-transparent PV module. Since the reflected albedo has a tendency to increase toward higher tilt angles, bifacial power generation can compensate for the loss of lower direct plane-of-array irradiation at a higher tilt angle. Therefore, the TBC a-Si:H semi-transparent PV module is suitable for the vertically mounted building integrated
New test and characterization methods for PV modules and cells
Energy Technology Data Exchange (ETDEWEB)
Van Aken, B.; Sommeling, P. [ECN Solar Energy, Petten (Netherlands); Scholten, H. [Solland, Heerlen (Netherlands); Muller, J. [Moser-Baer, Eindhoven (Netherlands); Grossiord, N. [Holst Centre, Eindhoven (Netherlands); Smits, C.; Blanco Mantecon, M. [Holland Innovative, Eindhoven (Netherlands); Verheijen, M.; Van Berkum, J. [Philips Innovation Services, Eindhoven (Netherlands)
2012-08-15
The results of the project geZONd (shared facility for solar module analysis and reliability testing) are described. The project was set up by Philips, ECN, Holst, Solland, OM and T and Holland Innovative. The partners have shared most of their testing and analysis equipment for PV modules and cells, and together developed new or improved methods (including the necessary application know-how). This enables faster and more efficient innovation projects for each partner, and via commercial exploitation for other interested parties. The project has concentrated on five failure modes: corrosion, delamination, moisture ingress, UV irradiation, and mechanical bending. Test samples represented all main PV technologies: wafer based PV and rigid and flexible thin-film PV. Breakthroughs are in very early detection of corrosion, in quantitative characterization of adhesion, in-situ detection of humidity and oxygen inside modules, and ultra-fast screening of materials on UV stability.
Jawna-Zboińska, Katarzyna; Blecharz-Klin, Kamilla; Joniec-Maciejak, Ilona; Wawer, Adriana; Pyrzanowska, Justyna; Piechal, Agnieszka; Mirowska-Guzel, Dagmara; Widy-Tyszkiewicz, Ewa
2016-05-01
Passiflora incarnata L. has been used as a medicinal plant in South America and Europe since the 16th century. Previous pharmacological studies focused mainly on the plant's sedative, anxiolytic, and anticonvulsant effects on the central nervous system and its supporting role in the treatment of addiction. The aim of the present study was to evaluate the behavioral and neurochemical effects of long-term oral administration of P. incarnata. The passionflower extract (30, 100, or 300 mg/kg body weight/day) was given to 4-week-old male Wistar rats via their drinking water. Tests were conducted after 7 weeks of treatment. Spatial memory was assessed in a water maze, and the levels of amino acids, monoamines, and their metabolites were evaluated in select brain regions by high performance liquid chromatography (HPLC). We observed reduced anxiety and dose-dependent improvement of memory in rats given passionflower compared to the control group. In addition, hippocampal glutamic acid and cortical serotonin content were depleted, with increased levels of metabolites and increased turnover. Thus, our results partially confirmed the proposed mechanism of action of P. incarnata involving GABAA receptors. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Researchers at NREL Find Fewer Failures of PV Panels and Different
certifications that quickly give confidence in the warranty are in demand by consumers, investors, and long-term lifespan predictions for new PV products. Reliability test standards for PV modules were
International Nuclear Information System (INIS)
Saber, Esmail M.; Lee, Siew Eang; Manthapuri, Sumanth; Yi, Wang; Deb, Chirag
2014-01-01
Air pollution and climate change increased the importance of renewable energy resources like solar energy in the last decades. Rack-mounted PhotoVoltaics (PV) and Building Integrated PhotoVoltaics (BIPV) are the most common photovoltaic systems which convert incident solar radiation on façade or surrounding area to electricity. In this paper the performance of different solar cell types is evaluated for the tropical weather of Singapore. As a case study, on-site measured data of PV systems implemented in a zero energy building in Singapore, is analyzed. Different types of PV systems (silicon wafer and thin film) have been installed on rooftop, façade, car park shelter, railing and etc. The impact of different solar cell generations, arrays environmental conditions (no shading, dappled shading, full shading), orientation (South, North, East or West facing) and inclination (between PV module and horizontal direction) is investigated on performance of modules. In the second stage of research, the whole PV systems in the case study are simulated in EnergyPlus energy simulation software with several PV performance models including Simple, Equivalent one-diode and Sandia. The predicted results by different models are compared with measured data and the validated model is used to provide simulation-based energy yield predictions for wide ranges of scenarios. It has been concluded that orientation of low-slope rooftop PV has negligible impact on annual energy yield but in case of PV external sunshade, east façade and panel slope of 30–40° are the most suitable location and inclination. - Highlights: • Characteristics of PV systems in tropics are analyzed in depth. • The ambiguity toward amorphous panel energy yield in tropics is discussed. • Equivalent-one diode and Sandia models can fairly predict the energy yield. • A general guideline is provided to estimate the energy yield of PV systems in tropics
A Hybrid Power Control Concept for PV Inverters with Reduced Thermal Loading
DEFF Research Database (Denmark)
Yang, Yongheng; Wang, Huai; Blaabjerg, Frede
2014-01-01
on a single-phase PV inverter under yearly operation is presented with analyses of the thermal loading, lifetime, and annual energy yield. It has revealed the trade-off factors to select the power limit and also verified the feasibility and the effectiveness of the proposed control concept.......This letter proposes a hybrid power control concept for grid-connected Photovoltaic (PV) inverters. The control strategy is based on either a Maximum Power Point Tracking (MPPT) control or a Constant Power Generation (CPG) control depending on the instantaneous available power from the PV panels....... The essence of the proposed concept lies in the selection of an appropriate power limit for the CPG control to achieve an improved thermal performance and an increased utilization factor of PV inverters,and thus to cater for a higher penetration level of PV systems with intermittent nature. A case study...
Thermal performances of vertical hybrid PV/T air collector
Tabet, I.; Touafek, K.; Bellel, N.; Khelifa, A.
2016-11-01
In this work, numerical analyses and the experimental validation of the thermal behavior of a vertical photovoltaic thermal air collector are investigated. The thermal model is developed using the energy balance equations of the PV/T air collector. Experimental tests are conducted to validate our mathematical model. The tests are performed in the southern Algerian region (Ghardaïa) under clear sky conditions. The prototype of the PV/T air collector is vertically erected and south oriented. The absorber upper plate temperature, glass cover temperature, air temperature in the inlet and outlet of the collector, ambient temperature, wind speed, and solar radiation are measured. The efficiency of the collector increases with increase in mass flow of air, but the increase in mass flow of air reduces the temperature of the system. The increase in efficiency of the PV/T air collector is due to the increase in the number of fins added. In the experiments, the air temperature difference between the inlet and the outlet of the PV/T air collector reaches 10 ° C on November 21, 2014, the interval time is between 10:00 and 14:00, and the temperature of the upper plate reaches 45 ° C at noon. The mathematical model describing the dynamic behavior of the typical PV/T air collector is evaluated by calculating the root mean square error and mean absolute percentage error. A good agreement between the experiment and the simulation results is obtained.
Directory of Open Access Journals (Sweden)
Amelia A.R.
2017-01-01
Full Text Available Photovoltaic (PV panel suffers in low conversion efficiency of the output performance affected by the elevated operating temperature of the PV panel. It is important to keep the PV panel to operate at low temperature. To address this issue, this paper proposes the cooling system using thermoelectric cooling (TEC and water block heatsink for enhancing the PV panel output performance. These both types cooling system were designed located on the back side of the PV panel to cool down the operating temperature of the PV panel. To evaluate the function for the existing cooling systems, the experiment was subsequently performed for PV panel without and with different design of the cooling system in outdoor weather conditions. By comparing the experimental results, it is concluded that by the hybrid cooling system which combining TEC module and the water block heatsink could improve the output performance of the PV panel. By the reduction temperature of the PV panel by 16.04 %, the average output power of the PV panel has been boosted up from 8.59 W to 9.03 W. In short, the output power of the PV panel was enhanced by the reduction of the operating temperature of the PV panel.
Amelia, A. R.; Jusoh, MA; Shamira Idris, Ida
2017-11-01
Photovoltaic (PV) panel suffers in low conversion efficiency of the output performance affected by the elevated operating temperature of the PV panel. It is important to keep the PV panel to operate at low temperature. To address this issue, this paper proposes the cooling system using thermoelectric cooling (TEC) and water block heatsink for enhancing the PV panel output performance. These both types cooling system were designed located on the back side of the PV panel to cool down the operating temperature of the PV panel. To evaluate the function for the existing cooling systems, the experiment was subsequently performed for PV panel without and with different design of the cooling system in outdoor weather conditions. By comparing the experimental results, it is concluded that by the hybrid cooling system which combining TEC module and the water block heatsink could improve the output performance of the PV panel. By the reduction temperature of the PV panel by 16.04 %, the average output power of the PV panel has been boosted up from 8.59 W to 9.03 W. In short, the output power of the PV panel was enhanced by the reduction of the operating temperature of the PV panel.
A novel solar multifunctional PV/T/D system for green building roofs
International Nuclear Information System (INIS)
Feng, Chaoqing; Zheng, Hongfei; Wang, Rui; Yu, Xu; Su, Yuehong
2015-01-01
Highlights: • A novel transparent roof combines the solar PV/T/D system with green building design. • Novel photovoltaic-thermal roofing design can achieve excellent light control at noon. • The roof has no obvious influence on indoor light intensity in morning and afternoon. • Higher efficiency of solar energy utilization could be achieved with new roofing. - Abstract: A novel transparent roof which is made of solid CPC (Compound Parabolic Concentrator) PV/T/D (Photovoltaic/Thermal/Day lighting) system is presented. It combines the solar PV/T/D system with green building design. The PV/T/D system can achieve excellent light control at noon and adjust the thermal environment in the building, such that high efficiency utilization of solar energy could be achieved in modern architecture. This kind of roof can increase the visual comfort for building occupants; it can also avoid the building interior from overheating and dazzling at noon which is caused by direct sunlight through transparent roof. Optical simulation software is used to track the light path in different incidence angles. CFD (Computational Fluid Dynamics) simulation and steady state experiment have been taken to investigate the thermal characteristic of PV/T/D device. Finally, the PV/T/D experimental system was built; and the PV efficiency, light transmittance and air heating power of the system are tested under real sky conditions
Integration, Validation, and Application of a PV Snow Coverage Model in SAM
Energy Technology Data Exchange (ETDEWEB)
Freeman, Janine M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ryberg, David Severin [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-08-01
Due to the increasing deployment of PV systems in snowy climates, there is significant interest in a method capable of estimating PV losses resulting from snow coverage that has been verified for a variety of system designs and locations. Many independent snow coverage models have been developed over the last 15 years; however, there has been very little effort verifying these models beyond the system designs and locations on which they were based. Moreover, major PV modeling software products have not yet incorporated any of these models into their workflows. In response to this deficiency, we have integrated the methodology of the snow model developed in the paper by Marion et al. (2013) into the National Renewable Energy Laboratory's (NREL) System Advisor Model (SAM). In this work, we describe how the snow model is implemented in SAM and we discuss our demonstration of the model's effectiveness at reducing error in annual estimations for three PV arrays. Next, we use this new functionality in conjunction with a long term historical data set to estimate average snow losses across the United States for two typical PV system designs. The open availability of the snow loss estimation capability in SAM to the PV modeling community, coupled with our results of the nationwide study, will better equip the industry to accurately estimate PV energy production in areas affected by snowfall.