WorldWideScience

Sample records for axonopodis pv passiflorae

  1. Reação de híbridos interespecíficos de Passiflora spp. à Xanthomonas axonopodis pv. passiflorae

    Directory of Open Access Journals (Sweden)

    Elisiane Fuhrmann

    2014-01-01

    Full Text Available Avaliou-se o grau de resistência de 36 clones de maracujazeiro obtidos por seleção massal de sete progênies de híbridos interespecíficos a três isolados de Xanthomonas axonopodis pv. passiflorae. As progênies foram obtidas por meio de cruzamentos entre a cultivar comercial Passiflora edulis "flavicarpa" com as espécies silvestres P. caerulea, P. edulis "roxo" e P. setacea. Os isolados da bactéria foram obtidos em Rio Claro-SP, Planaltina-DF e Limeira-SP. Clones individuais foram inoculados com solução bacteriana na concentração de 108ufc ml-1 aos 120 dias da semeadura. As avaliações ocorreram aos 5, 10 e 15 dias após a inoculação, medindo-se o diâmetro longitudinal e transversal das lesões. Em seguida, calculou-se a área abaixo da curva de progresso da lesão (AACPL. O delineamento experimental foi em blocos ao acaso com parcelas subdivididas, sendo os genótipos os tratamentos distribuídos em quatro blocos com parcelas de três plantas para cada genótipo. Em cada parcela, plantas individuais foram inoculadas com um dos isolados da bactéria, totalizando três plantas com isolados diferentes. Plantas das espécies genitoras P. caerulea (AACPL=0,17 e P. setacea (AACPL=14,50 apresentaram alto grau de resistência, quando comparadas às plantas da testemunha BRS Gigante Amarelo (AACPL=4089,25, enquanto genótipos híbridos apresentaram valores intermediários (AACPL de 15,67 a 768,42, indicando a importância desses materiais como fontes de resistência à bacteriose.

  2. Characterization of Xanthomonas axonopodis pv. phaseoli isolates

    NARCIS (Netherlands)

    Nunes, W.M.C.; Corazza, M.J.; De Souza, S.A.C.D.; Tsai, S.M.; Kuramae, E.E.

    2008-01-01

    A simple, quick and easy protocol was standardized for extraction of total DNA of the bacteria Xanthomonas axonopodis pv. phaseoli. The DNA obtained by this method had high quality and the quantity was enough for the Random Amplified Polymorphic DNA (RAPD) reactions with random primers, and

  3. Expression Profiling of Virulence and Pathogenicity Genes of Xanthomonas axonopodis pv. citri

    Science.gov (United States)

    Astua-Monge, Gustavo; Freitas-Astua, Juliana; Bacocina, Gisele; Roncoletta, Juliana; Carvalho, Sérgio A.; Machado, Marcos A.

    2005-01-01

    DNA macroarrays of 279 genes of Xanthomonas axonopodis pv. citri potentially associated with pathogenicity and virulence were used to compare the transcriptional alterations of this bacterium in response to two synthetic media. Data analysis indicated that 31 genes were up-regulated by synthetic medium XVM2, while only 7 genes were repressed. The results suggest that XVM2 could be used as an in vitro system to identify candidate genes involved in pathogenesis of X. axonopodis pv. citri. PMID:15659697

  4. Insights into xanthomonas axonopodis pv. Citri biofilm through proteomics

    KAUST Repository

    Zimaro, Tamara

    2013-08-07

    Background: Xanthomonas axonopodis pv. Citri (X. a. pv. Citri) causes citrus canker that can result in defoliation and premature fruit drop with significant production losses worldwide. Biofilm formation is an important process in bacterial pathogens and several lines of evidence suggest that in X. a. pv. Citri this process is a requirement to achieve maximal virulence since it has a major role in host interactions. In this study, proteomics was used to gain further insights into the functions of biofilms. Results: In order to identify differentially expressed proteins, a comparative proteomic study using 2D difference gel electrophoresis was carried out on X. a. pv. Citri mature biofilm and planktonic cells. The biofilm proteome showed major variations in the composition of outer membrane proteins and receptor or transport proteins. Among them, several porins and TonB-dependent receptor were differentially regulated in the biofilm compared to the planktonic cells, indicating that these proteins may serve in maintaining specific membrane-associated functions including signaling and cellular homeostasis. In biofilms, UDP-glucose dehydrogenase with a major role in exopolysaccharide production and the non-fimbrial adhesin YapH involved in adherence were over-expressed, while a polynucleotide phosphorylase that was demonstrated to negatively control biofilm formation in E. coli was down-regulated. In addition, several proteins involved in protein synthesis, folding and stabilization were up-regulated in biofilms. Interestingly, some proteins related to energy production, such as ATP-synthase were down-regulated in biofilms. Moreover, a number of enzymes of the tricarboxylic acid cycle were differentially expressed. In addition, X. a. pv. Citri biofilms also showed down-regulation of several antioxidant enzymes. The respective gene expression patterns of several identified proteins in both X. a. pv. Citri mature biofilm and planktonic cells were evaluated by

  5. Reaction of common bean lines to Xanthomonas axonopodis pv. phaseoli and Curtobacterium flaccumfaciens pv. flaccumfaciens

    Directory of Open Access Journals (Sweden)

    Tamires Ribeiro

    2016-12-01

    Full Text Available The aim of this study was to evaluate the resistance of 58 common bean lines against common bacterial blight (Xanthomonas axonopodis pv. phaseoli and bacterial wilt (Curtobacterium flaccumfaciens pv. flaccumfaciens. The experimental design consisted of completely randomized blocks, with four replications per pathogen. The results were subjected to variance analysis by the F test at 1% probability. Significant differences between the treatments indicated different resistance levels among the lines against both pathogens. According to the Scott-Knott test, six lines were resistant to Xanthomonas axonopodis pv. phaseoli, 14 moderately resistant, and 38 susceptible. To Curtobacterium flaccumfaciens pv. flaccumfaciens, 11 lines were resistant, 26 moderately resistant and 21 susceptible. Among these, the lines Pr10-3-4/1, Pr10-5-2/1 and Pr10-5- 2/2 of the black bean group and C10-2-4/2 of the Carioca group were resistant to both major bacterial diseases affecting common bean in Brazil.

  6. Caracterização de isolados de Xanthomonas axonopodis pv. manihotis = Characterization of isolates of Xanthomonas axonopodis pv. manihotis

    Directory of Open Access Journals (Sweden)

    Roberto Luis Portz

    2006-07-01

    Full Text Available A bacteriose (Xanthomonas axonopodis pv. manihotis e a doenca de maior importancia economica na cultura da mandioca. Para estudar a variabilidade genetica desta bacteria no Oeste do Parana, foram realizados levantamentos em Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa e Pato Bragado. Os isolados foram caracterizados em relacao a atividade de amilase, ƒ¿ e ƒÀ-esterase e agressividade. Dos 61 materiais vegetais coletados, obtiveram-se 19 isolados da bacteria, com maior incidencia para variedades de mesa em relacao aqueles para industria. Manivas provenientes de Pato Bragado, Entre Rios do Oeste e Mercedes apresentaram incidencias de 10, 27 e 10%, respectivamente, valores inferiores aos de Marechal Candido Rondon (50% e Nova Santa Rosa (58%. Os isolados foram agrupados em cinco, seis e 12 grupos em relacao a capacidade amilolitica, agressividade e isoenzimas de esterase, respectivamente. Nao houve relacao entre atividade de amilase e agressividade. Isolados de Marechal Candido Rondon foram mais agressivos que os provenientes das outras regioes. O agrupamento com base em esterase permitiu verificar que isolados provenientes de Entre Rios do Oeste, Nova Santa Rosa e Mercedes apresentaram alto grau de similaridade. Estes resultados indicam haver diferenciacaoentre os isolados da bacteria presentes nos municipios amostrados.The bacterial blight (Xanthomonas axonopodis pv. manihotis is the most important disease of cassava. To study the genetic variability of pathogen in the West of Parana, a research was carried out at Entre Rios do Oeste, Marechal Candido Rondon, Mercedes, Missal, Nova Santa Rosa and Pato Bragado. The isolates were characterized to amylase activity, ƒ¿ and ƒÀ-esterase and aggressiveness. From 61 collected materials, were obtained 19 bacterial isolates, with larger incidence for varieties of human consume than those for industry. Stems from Pato Bragado, Entre Rios do Oeste and Mercedes

  7. A simple method for in vivo expression studies of Xanthomonas axonopodis pv. citri.

    Science.gov (United States)

    Mehta, Angela; Rosato, Yoko B

    2003-11-01

    A major problem in studying bacterial plant pathogens is obtaining the microorganism directly from the plant tissue to perform in vivo expression (protein or mRNA) analyses. Here we report an easy and fast protocol to isolate Xanthomonas axonopodis pv. citri directly from the host plant, in sufficient amounts to perform protein fingerprinting by 2-D gel electrophoresis as well as RNA expression assays. The protein profile obtained was very similar to that of X. axonopodis pv. citri grown in the presence of a leaf extract of Citrus sinensis; however, some differential proteins expressed in vivo were observed. Total RNA extraction revealed typical 16S and 23S bands in the agarose gel, and RT-PCR reactions using primers specific for genes of the bacterium confirmed the quality of the RNA preparation. Also, RT-PCR reactions using plant ribosomal primers were employed, and no amplification product was obtained, indicating that plant RNA is not present in the bacterium RNA sample.

  8. Efect of aqueous extract from turmeric (Curcuma longa L.) in Xanthomonas axonopodis pv. manihotis.

    OpenAIRE

    Odair Josà Kuhn

    2003-01-01

    The cassava bacterial blight caused by Xanthomonas axonopodis pv. manihotis is the most importance disease of the culture and it is distributed in all the places where it is cultivated. Infected stems constitute themselves in the principal way of the bacterium dissemination to new cultivation areas. The chemical control of phytobacteria is difficult due to the products shortage, as well as, the existing ones are used exclusively in plantations of high economic value. By the other hand, the al...

  9. Genetic diversity of Xanthomonas axonopodis pv. citri based on plasmid profile and pulsed field gel electrophoresis

    Directory of Open Access Journals (Sweden)

    Carvalho Flávia Maria de Souza

    2005-01-01

    Full Text Available Xanthomonas axonopodis pv. citri strains that cause disease in citrus were investigated by pulsed field and plasmid profile analysis. For the first method, genomic DNA was digested by the rare-cutting enzymes Xba I and Vsp I. The strains evaluated were collected in seven different States of Brazil and in Argentina, Bolivia, Paraguay and Uruguay. Genetic variability was found among strains of X. axonopodis pv. citri from different geographical areas Argentina, Bolivia and Uruguay, with similarities varying from 0.62 to 0.83. However, the strains collected in Brazil, despite being from different States, have shown a genetic similarity ranging from 0.83 to 1.00. Cluster analysis showed a relationship between genomic similarity and geographical origin of the strains. Plasmids were observed in all strains, with a total of five different plasmids, with sizes between 57.7 and 83.0 kilobases. The 72.6 kb plasmid was the most frequent, present in 15 out of 22 strains, while the 68.1 kb plasmid was observed in two strains only. Although the plasmid diversity detected in the present study was not very great, the X. axonopodis pv. citri strains evaluated showed a considerable degree of diversity with regard to this extrachromosomal genetic element.

  10. Produção e sensibilidade de isolados brasileiros de Xanthomonas axonopodis pv. citri à bacteriocinas

    Directory of Open Access Journals (Sweden)

    Marcel Bonini

    2012-09-01

    Full Text Available Este trabalho teve por objetivo avaliar a produção e a sensibilidade de 48 isolados brasileiros de X. axonopodis pv. citri (Xac à bacteriocinas. Pelos resultados obtidos, nenhum isolado de Xac foi sensível às bacteriocinas produzidas pelos isolados bacterianos avaliados.

  11. Detection of Xanthomonas axonopodis pv. phaseoli in bean seeds by flow cytometry, immunostaining and direct viable counting

    NARCIS (Netherlands)

    Tebaldi, N.D.; Peters, J.; Chitarra, L.G.; Souza, R.M.; Zouwen, van der P.S.; Bergervoet, J.H.W.; Wolf, van der J.M.

    2010-01-01

    Flow cytometric analysis of immuno-stained cells (immuno-FCM) was compared to immunofluorescence microscopy (IF) and dilution plating on a semi-selective medium, for quantitative detection of Xanthomonas axonopodis pv. phaseoli (Xap) in bean seed extracts. Cell concentrations of Xap between 103-107

  12. Multiplexed lateral flow microarray assay for detection of citrus pathogens Xylella fastidiosa and Xanthomonas axonopodis pv citri

    Energy Technology Data Exchange (ETDEWEB)

    Cary,; Bruce, R [Santa Fe, NM; Stubben, Christopher J [Los Alamos, NM

    2011-03-22

    The invention provides highly sensitive and specific assays for the major citrus pathogens Xylella fastidiosa and Xanthomonas axonopodis, including a field deployable multiplexed assay capable of rapidly assaying for both pathogens simultaneously. The assays are directed at particular gene targets derived from pathogenic strains that specifically cause the major citrus diseases of citrus variegated chlorosis (Xylella fastidiosa 9a5c) and citrus canker (Xanthomonas axonopodis pv citri). The citrus pathogen assays of the invention offer femtomole sensitivity, excellent linear dynamic range, and rapid and specific detection.

  13. Crystal Structure of the FAD-Containing Ferredoxin-NADP+ Reductase from the Plant Pathogen Xanthomonas axonopodis pv. citri

    Directory of Open Access Journals (Sweden)

    María Laura Tondo

    2013-01-01

    Full Text Available We have solved the structure of ferredoxin-NADP(H reductase, FPR, from the plant pathogen Xanthomonas axonopodis pv. citri, responsible for citrus canker, at a resolution of 1.5 Å. This structure reveals differences in the mobility of specific loops when compared to other FPRs, probably unrelated to the hydride transfer process, which contributes to explaining the structural and functional divergence between the subclass I FPRs. Interactions of the C-terminus of the enzyme with the phosphoadenosine of the cofactor FAD limit its mobility, thus affecting the entrance of nicotinamide into the active site. This structure opens the possibility of rationally designing drugs against the X. axonopodis pv. citri phytopathogen.

  14. The molybdate-binding protein (ModA) of the plant pathogen Xanthomonas axonopodis pv. citri.

    Science.gov (United States)

    Balan, Andrea; Santacruz, Carolina P; Moutran, Alexandre; Ferreira, Rita C C; Medrano, Francisco J; Pérez, Carlos A; Ramos, Carlos H I; Ferreira, Luís C S

    2006-12-01

    The modABC operon of phytopathogen Xanthomonas axonopodis pv. citri (X. citri) encodes a putative ABC transporter involved in the uptake of the molybdate and tungstate anions. Sequence analyses showed high similarity values of ModA orthologs found in X. campestris pv. campestris (X. campestris) and Escherichia coli. The X. citri modA gene was cloned in pET28a and the recombinant protein, expressed in the E. coli BL21 (DE3) strain, purified by immobilized metal affinity chromatography. The purified protein remained soluble and specifically bound molybdate and tungstate with K(d) 0.29+/-0.12 microM and 0.58+/-0.14 microM, respectively. Additionally binding of molybdate drastically enhanced the thermal stability of the recombinant ModA as compared to the apoprotein. This is the first characterization of a ModA ortholog expressed by a phytopathogen and represents an important tool for functional, biochemical and structural analyses of molybdate transport in Xanthomonas species.

  15. Biological, serological and molecular techniques to xanthomonas axonopodis pv. Ci tri Asymptomatic detection

    International Nuclear Information System (INIS)

    Peyrou, M.; Del Campo, R.; Russi, P.; Mara, H.; Rigamonti, N.; Larrechart, L.; Perez, E.

    2012-01-01

    Xanthomonas axonopodis pv. ci tri (X ac) produces citrus canker disease in all citrus commercial species. The bacteria can be disseminated through vegetative propagation material in asymptomatic form. To optimize bacteria detection techniques applicable to asymptomatic citrus plant tissue routine analysis, ELISA, Immunofluorescence, Pcr, qRT P CR and host plant inoculation (bioassay) diagnostic techniques were compared. Tests were made from decimal dilutions between 108 uf6.ml-1 and 102 ufc.mL-1 using a pure culture of 49b strain.The detection level obtained was 1.8 x 102 ufc.mL-1 using Inmunofluorescence; 1.8x104 ufc.mL-1 with indirect ELISA, 1.8 x 103 ufc.mL-1 by means of PCR; 10 ufc.mL-1 through of qRT P CR and 230 ufc.mL-1 in sour orange inoculated plants. The experiment was repeated at least three times for each technique. Considering this result, and taking into account that sensitivity, practicity and cost, are important when a great number of plants need to be tested, the PCR and inoculation in host plants were those that met the best characteristics to be evaluated in asymptomatic plant material

  16. Disease Development and Symptom Expression of Xanthomonas axonopodis pv. citri in Various Citrus Plant Tissues.

    Science.gov (United States)

    Vernière, C J; Gottwald, T R; Pruvost, O

    2003-07-01

    ABSTRACT Experimental inoculations of Xanthomonas axonopodis pv. citri in different tissues of Tahiti lime and Pineapple sweet orange were conducted monthly under natural conditions on Réunion Island. The interactions between a set of environmental and epidemic variables associated with disease expression and 184 different factor combinations were investigated to determine the parameters needed to explain Asiatic citrus canker (ACC) disease expression. Area under the disease progress curve (AUDPC), inoculation date (Id), fruit and leaf age ratings (FAR and LAR), and number of days during the first 2 weeks postinoculation for which the temperature was less than 14 degrees C (T(min)) or more than 28 degrees C (T(max)) were retained by principal component analysis and canonical correlation analysis as the most meaningful epidemic and environmental variables, respectively. AUDPC as the strongest dependent variable and combinations of the environmental variables as independent variables were used in multiple regression analyses. Tissue age rating at the time of infection was a good predictor for disease resulting from spray inoculation on fruits and leaves and also on fruits following a wound inoculation. Temperature, as expressed by T(min) or T(max), was also a significant factor in determining disease development described by AUDPC. Mature green stems were highly susceptible after wounding, similarly to leaves, but buds and leaf scars expressed the lowest susceptibility. These variations in disease expression according to the tissues will have different impacts on ACC epidemiology.

  17. COMPARING INOCULATION METHODS TO EVALUATE THE GROWTH OF Xanthomonas axonopodis pv. manihotis ON CASSAVA PLANTS

    Directory of Open Access Journals (Sweden)

    Alejandra Muñoz Bodnar

    2015-05-01

    RESUMEN Xanthomonas axonopodis pv. manihotis (Xam es el agente causal del tizón bacteriano de la yuca, una de las principales enfermedades de los cultivos de yuca en América del Sur y África. Hasta ahora, el desarrollo de la enfermedad se mide a través de AUDPC (Area  Under Disease Progress curve, pero no hay disponibles métodos cuantitativos fiables,  esto debido posiblemente a la alta variabilidad del crecimiento bacteriano en la planta. Para establecer un método exacto para la cuantificación bacteriana durante el curso de la infección Xam dentro de los tejidos del huésped, se analizaron las poblaciones de bacterias sobre tallo y hojas, así como corte de hojas de las variedades de yucaMCOL1522 y SG107-35 con la cepa virulenta CIO151 Xam. En esta investigación se muestra que el movimiento de las bacterias a lo largo de los tejidos y especialmente en las hojas es estocástico. Por otra parte, hemos podido demostrar el crecimiento diferencial de la cepa virulenta  Xam CIO151 tras la punción al tallo y la cuantificación de la bacteria a 6 cm de distancia del punto de inoculación de dos variedades que presentan niveles contrastantes de susceptibilidad.

  18. Genome sequencing reveals a new lineage associated with lablab bean and genetic exchange between Xanthomonas axonopodis pv. phaseoli and Xanthomonas fuscans subsp. fuscans

    Directory of Open Access Journals (Sweden)

    Valente eAritua

    2015-10-01

    Full Text Available Common bacterial blight is a devastating seed-borne disease of common beans that also occurs on other legume species including lablab and Lima beans. We sequenced and analysed the genomes of 26 isolates of Xanthomonas axonopodis pv. phaseoli and X. fuscans subsp. fuscans, the causative agents of this disease, collected over four decades and six continents. This revealed considerable genetic variation within both taxa, encompassing both single-nucleotide variants and differences in gene content, that could be exploited for tracking pathogen spread. The bacterial isolate from Lima bean fell within the previously described Genetic Lineage 1, along with the pathovar type isolate (NCPPB 3035. The isolates from lablab represent a new, previously unknown genetic lineage closely related to strains of X. axonopodis pv. glycines. Finally, we identified more than 100 genes that appear to have been recently acquired by Xanthomonas axonopodis pv. phaseoli from X. fuscans subsp. fuscans.

  19. Amplification of DNA of Xanthomonas axonopodis pv. citri from historic citrus canker herbarium specimens.

    Science.gov (United States)

    Li, Wenbin; Brlansky, Ronald H; Hartung, John S

    2006-05-01

    Herbaria are important resources for the study of the origins and dispersal of plant pathogens, particularly bacterial plant pathogens that incite local lesions in which large numbers of pathogen genomes are concentrated. Xanthomonas axonopodis pv. citri (Xac), the causal agent of citrus bacterial canker disease, is a notable example of such a pathogen. The appearance of novel strains of the pathogen in Florida and elsewhere make it increasingly important to understand the relationships among strains of this pathogen. USDA-ARS at Beltsville, Maryland maintains approximately 700 herbarium specimens with citrus canker disease lesions up to 90 years old, originally collected from all over the world, and so is an important resource for phytogeographic studies of this bacterium. Unfortunately, DNA in herbarium specimens is degraded and may contain high levels of inhibitors of PCR. In this study, we compared a total of 23 DNA isolation techniques in combination with 31 novel primer pairs in order to develop an efficient protocol for the analysis of Xac DNA in herbarium specimens. We identified the most reliable extraction method, identified in terms of successful amplification by our panel of 31 primer pairs. We also identified the most robust primer pairs, identified as successful in the largest number of extracts prepared by different methods. We amplified Xac genomic sequences up to 542 bp long from herbarium samples up to 89 years old. Primers varied in effectiveness, with some primer pairs amplifying Xac DNA from a 1/10,000 dilution of extract from a single lesion from a citrus canker herbarium specimen. Our methodology will be useful to identify pathogens and perform molecular analyses of bacterial and possibly fungal genomes from herbarium specimens.

  20. Infección de callo embriogénico friable de yuca con Xanthomonas axonopodis pv. manihotis (Xam)

    OpenAIRE

    Paula Díaz Tatis; Carlos Andrés Zárate; Adriana Bernal Giraldo; Camilo López Carrascal

    2016-01-01

    Las nuevas tecnologías para la edición de genomas, como los TALEN y el sistema CRISPR/Cas9, representan una gran oportunidad para mejorar características deseables en diferentes organismos. Los TALEN son el resultado del acoplamiento de nucleasas a los TALE (Transcription Activator-Like Effectors), los cuales son efectores naturales de gran importancia en la patogénesis de las especies de Xanthomonas. Xanthomonas axonopodis pv. manihotis (Xam) es el agente causal del añublo bacteriano de la y...

  1. Structural-functional characterization and physiological significance of ferredoxin-NADP reductase from Xanthomonas axonopodis pv. citri.

    Directory of Open Access Journals (Sweden)

    María Laura Tondo

    Full Text Available Xanthomonas axonopodis pv. citri is a phytopathogen bacterium that causes severe citrus canker disease. Similar to other phytopathogens, after infection by this bacterium, plants trigger a defense mechanism that produces reactive oxygen species. Ferredoxin-NADP(+ reductases (FNRs are redox flavoenzymes that participate in several metabolic functions, including the response to reactive oxygen species. Xanthomonas axonopodis pv. citri has a gene (fpr that encodes for a FNR (Xac-FNR that belongs to the subclass I bacterial FNRs. The aim of this work was to search for the physiological role of this enzyme and to characterize its structural and functional properties. The functionality of Xac-FNR was tested by cross-complementation of a FNR knockout Escherichia coli strain, which exhibit high susceptibility to agents that produce an abnormal accumulation of (•O(2(-. Xac-FNR was able to substitute for the FNR in E. coli in its antioxidant role. The expression of fpr in X. axonopodis pv. citri was assessed using semiquantitative RT-PCR and Western blot analysis. A 2.2-fold induction was observed in the presence of the superoxide-generating agents methyl viologen and 2,3-dimethoxy-1,4-naphthoquinone. Structural and functional studies showed that Xac-FNR displayed different functional features from other subclass I bacterial FNRs. Our analyses suggest that these differences may be due to the unusual carboxy-terminal region. We propose a further classification of subclass I bacterial FNRs, which is useful to determine the nature of their ferredoxin redox partners. Using sequence analysis, we identified a ferredoxin (XAC1762 as a potential substrate of Xac-FNR. The purified ferredoxin protein displayed the typical broad UV-visible spectrum of [4Fe-4S] clusters and was able to function as substrate of Xac-FNR in the cytochrome c reductase activity. Our results suggest that Xac-FNR is involved in the oxidative stress response of Xanthomonas axonopodis pv

  2. FORMULASI PADAT RHIZOBAKTERIA INDIGENUS BACILLUS THURINGIENSIS TS2 DAN WAKTU PENYIMPANAN UNTUK MENGENDALIKAN PENYAKIT PUSTUL BAKTERI XANTHOMONAS AXONOPODIS PV. GLYCINES

    Directory of Open Access Journals (Sweden)

    Yulmira Yanti

    2017-05-01

    Full Text Available Solid formulations of indigenous rhizobacteria Bacillus thuringiensis TS2 and storage time to control bacterial pustule disease Xanthomonas axonopodis pv. glycines. Bacterial pustule disease caused by Xanthomonas axonopodis pv. Glycines is a major constraint in soybean cultivation. Indigenous rhizobacteria Bacillus thuringiensis TS2 from soybean rhizosphere acquired from previous research is the best isolate which can control soybean bacterial pustule disease and increase growth rate of soybean. To increased its stability and interaction with soybean plants, Bacillus thuringiensis TS2 was urged to test furthermore especially its formulation with based formula tapioca powder, peat and bulk. The most effective storage time also need to test. Result showed that all rhizobacterial formula had ability to decrease incidence of bacterial pustule disease compared to control. Moreover, all the three formula could increase plant growth, total of leaves, total of branch and yields. Flowering time was also advanced by 1-8 days compared to control. Decreasing of disease rate and increasing of plant growth rate variated between different formulations.

  3. Differential expression of pathogenicity- and virulence-related genes of Xanthomonas axonopodis pv. citri under copper stress

    Directory of Open Access Journals (Sweden)

    Ana Carolina Basílio Palmieri

    2010-01-01

    Full Text Available In this study, we used real-time quantitative PCR (RT-qPCR to evaluate the expression of 32 genes of Xanthomonas axonopodis pv. citri related to pathogenicity and virulence that are also involved in copper detoxification. Nearly all of the genes were up-regulated, including copA and copB. Two genes homologous to members of the type II secretion system (xcsH and xcsC and two involved in the degradation of plant cell wall components (pglA and pel were the most expressed in response to an elevated copper concentration. The type II secretion system (xcs operon and a few homologues of proteins putatively secreted by this system showed enhanced expression when the bacteria were exposed to a high concentration of copper sulfate. The enhanced expression of the genes of secretion II system during copper stress suggests that this pathway may have an important role in the adaptative response of X. axonopodis pv. citri to toxic compounds. These findings highlight the potential role of these genes in attenuating the toxicity of certain metals and could represent an important means of bacterial resistance against chemicals used to control diseases.

  4. Crystallization, data collection and phasing of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri

    International Nuclear Information System (INIS)

    Santacruz, C. P.; Balan, A.; Ferreira, L. C. S.; Barbosa, J. A. R. G.

    2006-01-01

    The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222 1, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222 1 , with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress

  5. Crystallization, data collection and phasing of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri

    Energy Technology Data Exchange (ETDEWEB)

    Santacruz, C. P.; Balan, A.; Ferreira, L. C. S. [Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil); Barbosa, J. A. R. G., E-mail: joao@lnls.br [Centro de Biologia Molecular e Estrutural (CeBiMe), Laboratório Nacional de Luz Síncrotron (LNLS), CP 6192, Campinas, SP 13084-971 (Brazil); Departamento de Microbiologia, Instituto de Ciências Biomédicas II, Universidade de São Paulo, São Paulo, SP (Brazil)

    2006-03-01

    The molybdate-binding protein (ModA) from X. axonopodis pv. citri was crystallized with sodium molybdate in the presence of PEG or sulfate. The crystal diffracted to a maximum resolution of 1.7 Å and belongs to the orthorhombic space group C222{sub 1,} with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. Xanthomonas axonopodis pv. citri ModA protein is the ABC periplasmic binding component responsible for the capture of molybdate. The protein was crystallized with sodium molybdate using the hanging-drop vapour-diffusion method in the presence of PEG or sulfate. X-ray diffraction data were collected to a maximum resolution of 1.7 Å using synchrotron radiation. The crystal belongs to the orthorhombic space group C222{sub 1}, with unit-cell parameters a = 68.15, b = 172.14, c = 112.04 Å. The crystal structure was solved by molecular-replacement methods and structure refinement is in progress.

  6. Detecção de Xanthomonas axonopodis pv. phaseoli em sementes de feijoeiro provenientes do estado do Paraná, Brasil Detection of Xanthomonas axonopodis pv. phaseoli in common bean seeds from the state of Paraná (Brazil

    Directory of Open Access Journals (Sweden)

    João Pereira Torres

    2009-06-01

    Full Text Available O crestamento bacteriano comum do feijoeiro causado por sobrevivência e disseminação da Xap, a semente representa o mais Xanthomonas axonopodis pv. phaseoli (Xap é a principal doença eficiente. A qualidade sanitária de 34 amostras de sementes de feijoeiro do feijoeiro comum no Brasil. O patógeno encontra-se disseminado produzidas no estado do Paraná, nas safras 1998/99 e 1999, foram em todas as regiões produtoras do país, porém com maior importância avaliadas quanto à presença de Xap em macerados de sementes nos estados do Paraná, Rio de Janeiro, São Paulo e na região do Brasil plaqueados em meio semi-seletivo. Cinqüenta por cento dos lotes de Central, sobretudo na safra das águas. Dentre os vários meios de sementes foram portadores de Xap com incidência de 0,1% a 1,7%.The common bacterial blight of bean, caused by Xanthomonas effective means of survival and dissemination of the Xap. The health axonopodis pv. phaseoli (Xap, is a major disease of common beans quality of 34 samples of seeds lots of common beans produced in the in Brazil. Even though this pathogen is disseminated in all production state of Paraná during 1998/99 and 1999 were evaluated to the presence regions of the country, it has caused major damages in the states of of Xap in seed macerates plated on a semi-selective culture medium. Paraná, Rio de Janeiro and São Paulo and in Central Region of Brazil, Fifty percent of the seed lots were carrying out by Xap with an particularly during the rainy season. Infected bean seeds are most incidence range of 0.1% to 1.7%.

  7. Crystallization, data collection and data processing of maltose-binding protein (MalE) from the phytopathogen Xanthomonas axonopodis pv. citri

    International Nuclear Information System (INIS)

    Souza, C. S.; Ferreira, L. C. S.; Thomas, L.; Barbosa, J. A. R. G.; Balan, A.

    2009-01-01

    The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. Maltose-binding protein is the periplasmic component of the ABC transporter responsible for the uptake of maltose/maltodextrins. The Xanthomonas axonopodis pv. citri maltose-binding protein MalE has been crystallized at 293 K using the hanging-drop vapour-diffusion method. The crystal belonged to the primitive hexagonal space group P6 1 22, with unit-cell parameters a = 123.59, b = 123.59, c = 304.20 Å, and contained two molecules in the asymetric unit. It diffracted to 2.24 Å resolution

  8. Bioassay for selection of biocontroller bacteria against bean common blight (Xanthomonas axonopodis pv. phaseoli Bioensaio para seleção de bactérias biocontroladoras do crestamento bacteriano comum do feijão (Xanthomonas axonopodis pv. phaseoli

    Directory of Open Access Journals (Sweden)

    Zarela G.C.N. Zanatta

    2007-09-01

    Full Text Available Emphasis has been given on selection of micro-organism for biological control. However, in order to evaluate the biological control potential of a great number of micro-organisms in a small period of time it is necessary to develop an efficient bioassay. Seven hundred and sixty bacterial isolates from different habitats, were selected for compatibility with Rhizobium leguminosarum bv. phaseoli (SEMIA 4077 e SEMIA 4080. Among them 596 isolates were ineffective against both rhizobia. Bean seeds immersed in suspension of each one of these isolates were agitated for 5 hours at 10ºC and sowed in non-sterilized soil. The plants were kept in greenhouse. After the development of cotyledonary and primary leaves, these were removed and bioassayed for Xanthomonas axonopodis pv. phaseoli (XAP control. In the cotyledonary leaves, it was observed that the isolate DFs093 offered 100% control, DFs041 and DFs1297 offered 90% and DFs490, DFs769, DFs831, DFs842 and DFs843 offered 80% control. In the primary leaves, the DFs482 isolated offered 100% and the DFs080, DFs348, DFs513, DFs622, DFs769, DFs842 and DFs912 offered 80% of XAP control.Tem-se dado muita ênfase ao controle biológico mediante seleção de microorganismos. Porém, para se avaliar o potencial de biocontroladores de forma massal e em pequeno intervalo de tempo é necessário desenvolver um bioensaio eficiente. Bactérias de diferentes sítios, num total de 760 isolados, foram selecionadas para compatibilidade com Rhizobium leguminosarum bv. phaseoli estirpes SEMIA 4077 e SEMIA 4080, onde 596 isolados foram inefetivos contra ambos rizóbios. Sementes de feijão foram imersas em suspensão de cada um destes isolados sendo agitadas por 5 horas a 10ºC, plantadas em solo não esterelizado, sendo as plantas mantidas em casa de vegetação. Após o desenvolvimento das folhas cotiledonares e folhas primárias, estas foram retiradas e avaliadas por bioensaio para o controle de Xanthomonas axonopodis pv

  9. The role of type III effectors from Xanthomonas axonopodis pv. manihotis in virulence and suppression of plant immunity.

    Science.gov (United States)

    Medina, Cesar Augusto; Reyes, Paola Andrea; Trujillo, Cesar Augusto; Gonzalez, Juan Luis; Bejarano, David Alejandro; Montenegro, Nathaly Andrea; Jacobs, Jonathan M; Joe, Anna; Restrepo, Silvia; Alfano, James R; Bernal, Adriana

    2018-03-01

    Xanthomonas axonopodis pv. manihotis (Xam) causes cassava bacterial blight, the most important bacterial disease of cassava. Xam, like other Xanthomonas species, requires type III effectors (T3Es) for maximal virulence. Xam strain CIO151 possesses 17 predicted T3Es belonging to the Xanthomonas outer protein (Xop) class. This work aimed to characterize nine Xop effectors present in Xam CIO151 for their role in virulence and modulation of plant immunity. Our findings demonstrate the importance of XopZ, XopX, XopAO1 and AvrBs2 for full virulence, as well as a redundant function in virulence between XopN and XopQ in susceptible cassava plants. We tested their role in pathogen-associated molecular pattern (PAMP)-triggered immunity (PTI) and effector-triggered immunity (ETI) using heterologous systems. AvrBs2, XopR and XopAO1 are capable of suppressing PTI. ETI suppression activity was only detected for XopE4 and XopAO1. These results demonstrate the overall importance and diversity in functions of major virulence effectors AvrBs2 and XopAO1 in Xam during cassava infection. © 2017 BSPP AND JOHN WILEY & SONS LTD.

  10. The PthB protein from Xanthomonas axonopodis pv. Manihotis is an autoactive in yeast two-hybrid assays

    International Nuclear Information System (INIS)

    Gil, Juliana; Bohorquez, Laura; Castiblanco, Luisa B; Bernal, Adriana; Lopez, Camilo

    2011-01-01

    Cassava bacterial blight disease is caused by the gram-negative bacteria Xanthomonas axonopodis pv. manihotis (Xam), and constitutes one of the most important constraints for cassava production. One of the first determinants of pathogenicity identified in this bacterium is the PthB gene. The PthB protein belongs to the PthB/AvrBs3 family, characterized by the presence of nuclear localization signal (NLS) and acidic activation (AAD) domains, suggesting that these proteins are transcription factors. The identification of cassava proteins interacting with PthB could give insights about the function of this protein in the pathogenicity of this bacterium. In this work we cloned PthB in the yeast two hybrid expression vector plaw10, generating a fusion protein with the binding domain (BD) of the transcription factor Gal4. In this work, PthB was cloned in a translational fusion with Gal4-BD (DNA Binding Domain). After transforming this construct into a yeast strain, autoactivation of the reporter genes was observed, even at the highest concentrations of 3-AT. The deletion of the first, second or both NLS and the AAD did not eliminate the ability of autoactivation of PthB. These results show the impossibility of using PthB to screen a cassava cDNA library to identify the proteins interacting with PthB.

  11. Crystallographic structure and substrate-binding interactions of the molybdate-binding protein of the phytopathogen Xanthomonas axonopodis pv. citri.

    Science.gov (United States)

    Balan, Andrea; Santacruz-Pérez, Carolina; Moutran, Alexandre; Ferreira, Luís Carlos Souza; Neshich, Goran; Gonçalves Barbosa, João Alexandre Ribeiro

    2008-02-01

    In Xanthomonas axonopodis pv. citri (Xac or X. citri), the modA gene codes for a periplasmic protein (ModA) that is capable of binding molybdate and tungstate as part of the ABC-type transporter required for the uptake of micronutrients. In this study, we report the crystallographic structure of the Xac ModA protein with bound molybdate. The Xac ModA structure is similar to orthologs with known three-dimensional structures and consists of two nearly symmetrical domains separated by a hinge region where the oxyanion-binding site lies. Phylogenetic analysis of different ModA orthologs based on sequence alignments revealed three groups of molybdate-binding proteins: bacterial phytopathogens, enterobacteria and soil bacteria. Even though the ModA orthologs are segregated into different groups, the ligand-binding hydrogen bonds are mostly conserved, except for Archaeglobus fulgidus ModA. A detailed discussion of hydrophobic interactions in the active site is presented and two new residues, Ala38 and Ser151, are shown to be part of the ligand-binding pocket.

  12. Bioinformatic identification of cassava miRNAs differentially expressed in response to infection by Xanthomonas axonopodis pv. manihotis

    Science.gov (United States)

    2012-01-01

    Background microRNAs (miRNAs) are short RNA molecules that control gene expression by silencing complementary mRNA. They play a crucial role in stress response in plants, including biotic stress. Some miRNAs are known to respond to bacterial infection in Arabidopsis thaliana but it is currently unknown whether these responses are conserved in other plants and whether novel species-specific miRNAs could have a role in defense. Results This work addresses the role of miRNAs in the Manihot esculenta (cassava)-Xanthomonas axonopodis pv. manihotis (Xam) interaction. Next-generation sequencing was used for analyzing small RNA libraries from cassava tissue infected and non-infected with Xam. A full repertoire of cassava miRNAs was characterized, which included 56 conserved families and 12 novel cassava-specific families. Endogenous targets were predicted in the cassava genome for many miRNA families. Some miRNA families' expression was increased in response to bacterial infection, including miRNAs known to mediate defense by targeting auxin-responding factors as well as some cassava-specific miRNAs. Some bacteria-repressed miRNAs included families involved in copper regulation as well as families targeting disease resistance genes. Putative transcription factor binding sites (TFBS) were identified in the MIRNA genes promoter region and compared to promoter regions in miRNA target genes and protein coding genes, revealing differences between MIRNA gene transcriptional regulation and other genes. Conclusions Taken together these results suggest that miRNAs in cassava play a role in defense against Xam, and that the mechanism is similar to what's known in Arabidopsis and involves some of the same families. PMID:22361011

  13. La proteína PthB de Xanthomonas axonopodis pv. manihotis es autoactiva en ensayos de doble hibrido

    Directory of Open Access Journals (Sweden)

    Juliana Gil

    2011-01-01

    Full Text Available La bacteriosis vascular de yuca producida por la bacteria Xanthomonas axonopodis pv. manihotis (Xam es uno de los factores limitantes para la producción de yuca. Dentro de los primeros factores de patogenicidad identificados en esta bacteria se encuentra el gen pthB. La proteína PthB pertenece a la familia de efectores PthA/AvrBs3, que se caracterizan por presentar dominios NLS (Nuclear Localization Signal y un dominio AAD (Acidic Activation Domain, lo cual sugiere que estas proteínas actúan como factores de transcripción. La identificación de las proteínas de yuca que interactúan con PthB permitiría dar luces sobre la función de esta proteína en la patogenicidad de esta bacteria. En este trabajo se clonó pthB en una fusión traduccional con el BD (Binding Domain del factor de transcripción GAL4. Después de transformar este constructo en una cepa de levadura, se observó autoactivación de los genes reporteros, incluso a concentraciones altas de 3-AT. La eliminación del primer, segundo o de los dos NLS y del AAD no eliminaron la capacidad de autoactivación de los genes reporteros mediada por PthB. Estos resultados indican la imposibilidad de su utilización en un tamizaje de una librería de ADNc de yuca para identificar las proteínas que interactúan con PthB.

  14. Otimização da técnica de PCR para detecção de Xanthomonas axonopodis pv. phaseoli em sementes de feijão

    OpenAIRE

    Silva, Franklin Cordeiro

    2014-01-01

    O crestamento bacteriano comum, causado por Xanthomonas axonopodis pv. phaseoli (Xap), é a principal bacteriose do feijoeiro no Brasil, sendo transmitida principalmente por sementes. O presente trabalho foi realizado com o objetivo de aperfeiçoar uma técnica para detecção de Xap em sementes de feijão, por meio da utilização de diferentes métodos de preparação do extrato para a detecão via PCR, além da detecção simultânea de Xap e Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff) nos extr...

  15. Otimização da técnica de PCR para a detecção de Xanthomonas axonopodis pv. phaseoli em sementes de feijão

    OpenAIRE

    Silva,Franklin Cordeiro; Souza,Ricardo Magela de; Zacaroni,Ana Beatriz; Lelis,Flávia Mara Vieira; Figueira,Antonia dos Reis

    2013-01-01

    O crestamento bacteriano comum, causado por Xanthomonas axonopodis pv. phaseoli (Xap), é a principal bacteriose do feijoeiro no Brasil, sendo transmitida principalmente por sementes. O presente trabalho teve como objetivo aperfeiçoar uma técnica, por meio de diferentes métodos de preparação do extrato, para a detecção de Xap, bem como sua detecção simultânea com Curtobacterium flaccumfaciens pv. flaccumfaciens (Cff) nos extratos de sementes de feijão,via PCR. A partir de amostras de sementes ...

  16. Meio semi-seletivo para detectar Xanthomonas axonopodis pv. phaseoli em sementes de feijoeiro e sua erradicação através do tratamento de sementes com o fungicida tolylfluanid A semi-selective medium to detect Xanthomonas axonopodis pv. phaseoli in bean seeds and its eradication through seed treatment with tolylfluanid

    Directory of Open Access Journals (Sweden)

    Lucilene Paula Lopes

    2008-09-01

    Full Text Available Estudou-se a eficiência do meio semi-seletivo desenvolvido para Xanthomonas axonopodis pv. malvacearum (Xam do algodoeiro, com algumas modificações, na detecção de Xanthomonas axonopodis pv. phaseoli (Xap em sementes de feijoeiro, bem como a eficiência do fungicida tolylfluanid na erradicação de Xap através do tratamento de sementes. Foram utilizadas sementes naturalmente infectadas por Xap, procedentes de diferentes municípios do Estado do Paraná. Houve o desenvolvimento de colônias bacterianas ao redor das sementes infectadas sob meio semi-seletivo entre seis e 12 dias de incubação. A freqüência de recuperação de colônias da bactéria em relação ao meio Agar nutriente (AN variou entre 30 a 112%. O crescimento de Xap foi inibido a concentrações entre 54 a 1500 ppm do fungicida tolylfluanid. A bactéria foi recuperada das sementes não tratadas em meio semi-seletivo, mas não das sementes tratadas em solução do fungicida tolylfluanid (1,20g/L água. Em casa de vegetação, das 400 sementes tratadas com tolylfluanid não foi produzida nenhuma planta com sintomas da doença até 30 dias após a semeadura, enquanto que 9,75% das sementes não tratadas apresentaram sintomas de Xap. Em um outro experimento, das 1200 sementes não tratadas um total de 7,08% e 11,67% das plantas mostraram-se com sintomas da doença, enquanto que das sementes tratadas 0,5% e 2,4% apresentaram sintomas, 26 e 46 dias após a semeadura, respectivamente.The efficiency of a semi-selective medium developed for Xanthomonas axonopidis pv. malvacearum (Xam, was verified with some modifications, in detecting the presence of X. axonopodis pv. phaseoli (Xap in bean seed. Seed samples naturally infected with Xap were collected from the State of Paraná. The bacterial growth developed around the infected seed in the semi-selective medium after 12 days after incubation. The recovery frequency of bacterial colonies in relation to nutrient agar varied between 30

  17. XopN-T3SS effector of Xanthomonas axonopodis pv. punicae localizes to the plasma membrane and modulates ROS accumulation events during blight pathogenesis in pomegranate.

    Science.gov (United States)

    Kumar, Rishikesh; Soni, Madhvi; Mondal, Kalyan K

    2016-12-01

    Bacterial blight caused by Xanthomonas axonopodis pv. punicae (Xap) is a major disease of pomegranate. Xap secretes effector proteins via type III secretion system (T3SS) to suppress pathogen-associated molecular pattern (PAMP)-triggered plant immunity (PTI). Previously we reported that XopN, a conserved effector of Xap, modulate in planta bacterial growth, and blight disease. In continuation to that here we report the deletion of XopN from Xap caused higher accumulation of reactive oxygen species (ROS) including H 2 O 2 and O 2 - . We quantitatively assessed the higher accumulation of H 2 O 2 in pomegranate leaves infiltrated with Xap ΔxopN compared to Xap wild-type. We analysed that 1.5 to 3.3 fold increase in transcript expression of ROS and flg22-inducible genes, namely FRK1, GST1, WRKY29, PR1, PR2 and PR5 in Arabidopsis when challenged with Xap ΔxopN; contrary, the up-regulation of all the genes were compromised when challenged with either Xap wild-type or Xap ΔxopN+xopN. Further, we demonstrated the plasma-membrane based localization of XopN protein both in its natural and experimental hosts. All together, the present study suggested that XopN-T3SS effector of Xap gets localized in the plasma membrane and suppresses ROS-mediated early defense responses during blight pathogenesis in pomegranate. Copyright © 2016 Elsevier GmbH. All rights reserved.

  18. A plant natriuretic peptide-like molecule of the pathogen Xanthomonas axonopodis pv. citri causes rapid changes in the proteome of its citrus host

    Directory of Open Access Journals (Sweden)

    Ottado Jorgelina

    2010-03-01

    Full Text Available Abstract Background Plant natriuretic peptides (PNPs belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival. Results Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 α subunit, maturase K, and α- and β-tubulin. Conclusions We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence.

  19. A plant natriuretic peptide-like molecule of the pathogen Xanthomonas axonopodis pv. citri causes rapid changes in the proteome of its citrus host

    KAUST Repository

    Garavaglia, Betiana S

    2010-03-21

    Background: Plant natriuretic peptides (PNPs) belong to a novel class of peptidic signaling molecules that share some structural similarity to the N-terminal domain of expansins and affect physiological processes such as water and ion homeostasis at nano-molar concentrations. The citrus pathogen Xanthomonas axonopodis pv. citri possesses a PNP-like peptide (XacPNP) uniquely present in this bacteria. Previously we observed that the expression of XacPNP is induced upon infection and that lesions produced in leaves infected with a XacPNP deletion mutant were more necrotic and lead to earlier bacterial cell death, suggesting that the plant-like bacterial PNP enables the plant pathogen to modify host responses in order to create conditions favorable to its own survival.Results: Here we measured chlorophyll fluorescence parameters and water potential of citrus leaves infiltrated with recombinant purified XacPNP and demonstrate that the peptide improves the physiological conditions of the tissue. Importantly, the proteomic analysis revealed that these responses are mirrored by rapid changes in the host proteome that include the up-regulation of Rubisco activase, ATP synthase CF1 ? subunit, maturase K, and ?- and ?-tubulin.Conclusions: We demonstrate that XacPNP induces changes in host photosynthesis at the level of protein expression and in photosynthetic efficiency in particular. Our findings suggest that the biotrophic pathogen can use the plant-like hormone to modulate the host cellular environment and in particular host metabolism and that such modulations weaken host defence. 2010 Garavaglia et al; licensee BioMed Central Ltd.

  20. Crystallization and preliminary X-ray diffraction analysis of XAC1151, a small heat-shock protein from Xanthomonas axonopodis pv. citri belonging to the α-crystallin family

    Energy Technology Data Exchange (ETDEWEB)

    Hilario, Eduardo; Teixeira, Elaine Cristina; Pedroso, Gisele Audrei; Bertolini, Maria Célia [Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil); Medrano, Francisco Javier, E-mail: fjmedrano@yahoo.com [Departamento de Cristalografia de Proteínas, Centro de Biologia Molecular Estrutural, Laboratório Nacional de Luz Síncrotron, Caixa Postal 6192, CEP 13084-971, Campinas-SP (Brazil); Departamento de Bioquímica e Tecnologia Química, Instituto de Química, Universidade Estadual Paulista, Araraquara-SP (Brazil)

    2006-05-01

    XAC1151, a small heat-shock protein from X. axonopodis pv. citri belonging to the α-crystallin family, was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The hspA gene (XAC1151) from Xanthomonas axonopodis pv. citri encodes a protein of 158 amino acids that belongs to the small heat-shock protein (sHSP) family of proteins. These proteins function as molecular chaperones by preventing protein aggregation. The protein was crystallized using the sitting-drop vapour-diffusion method in the presence of ammonium phosphate. X-ray diffraction data were collected to 1.65 Å resolution using a synchrotron-radiation source. The crystal belongs to the rhombohedral space group R3, with unit-cell parameters a = b = 128.7, c = 55.3 Å. The crystal structure was solved by molecular-replacement methods. Structure refinement is in progress.

  1. Análise da diversidade genética de isolados de Xanthomonas axonopodis pv. malvacearum do algodoeiro Analysis of genetic diversity among the isolates of Xanthomonas axonopolis pv. malvacearum of cotton

    Directory of Open Access Journals (Sweden)

    Maria Paula Nunes

    2009-06-01

    Full Text Available A mancha angular do algodoeiro, causada por Xanthomonas axonopodis pv. malvacearum (Xam, é uma doença de importância econômica e pode causar perdas apreciáveis no rendimento. A doença pode ser controlada por resistência varietal desde que haja conhecimento sobre a variabilidade das populações do patógeno. A variabilidade genética e a estabilidade patogênica entre os isolados deste patógeno não foram suficientemente estudadas, principalmente considerando a introdução de novas cultivares e a expansão da cultura. O objetivo do presente estudo foi avaliar a variabilidade genética entre os 61 isolados de Xam, provenientes de diversas cultivares e regiões do Brasil, através de ensaios moleculares. Análises de ERIC e REP-PCR demonstraram dois grupos distintos de Xam associados a região geográfica de origem. Não foram observadas diferenças nos perfis dos isolados através de PCR-RFLP da região 16S-23S rDNA. A região espaçadora 16S-23S rDNA de três linhagens de Xam foi analisada através de clonagem e sequenciamento e seis diferenças nas seqüências foram encontradas. A técnica de RAPD revelou um maior nível de polimorfismo, distinguindo 6 grupos de Xam a 85% de similaridade. Os resultados indicam a existência de variabilidade muito restrita entre os isolados analisados.Angular leaf spot or black arm of cotton, caused by Xanthomonas axonopodis pv. malvacearum (Xam, is a disease of economic importance. The disease can be controlled by using resistant cultivars if the knowledge regarding the genetic variability of the pathogen population is available. The genetic variability and the pathogen stability among the isolates of this pathogen have not been sufficiently studied, especially considering the introduction of new cultivars and the expansion of areas under cotton cultivation. The objective of the present study was to identify genetic variability among 61 isolates of Xam collected from different cultivars and geographic

  2. 1H HRMAS NMR spectroscopy and chemometrics for evaluation of metabolic changes in citrus sinensis Caused by Xanthomonas axonopodis pv. citri

    International Nuclear Information System (INIS)

    Silva, Lorena M.A.; Alves Filho, Elenilson G.; Choze, Rafael; Liao, Luciano M.; Alcantara, Glaucia B.

    2012-01-01

    Xanthomonas axonopodis (Xac) bacterium causes one of the most feared and untreatable diseases in citriculture: citrus canker. To understand the response mechanisms of orange trees when attacked by Xac, leaves and fruits of Citrus sinensis were directly evaluated by HRMAS NMR (high resolution magic angle spinning nuclear magnetic resonance) spectroscopy. This technique allows the analysis of samples without laborious pre-treatments and also allows access to important information about chemical composition of samples. The orange tree leaves and fruit peels investigated in this study demonstrated the biochemical changes caused by Xac. Aided by chemometric analysis, the HRMAS NMR results show relevant changes in amino acids, carbohydrates, organic acids and terpenoids content. (author)

  3. Caracterización de la respuesta morfológica de variedades susceptibles y resistentes de yuca (Manihot esculenta Crantz a la bacteriosis vascular causada por Xanthomonas axonopodis pv. manihotis

    Directory of Open Access Journals (Sweden)

    Tamara Sandino

    2015-06-01

    Full Text Available Xanthomonas axonopodis pv. manihotis es una de las principales limitaciones del cultivo de yuca. En esta investigación, mediante microscopía óptica, se realizó un análisis comparativo de los cambios morfológicos e histoquímicos en tallos de una variedad de yuca susceptible (TMS60444 y una resistente (CM6438-14, 7 y 14 días después de ser inoculadas con la cepa patogénica CIO151. Se pudo detectar que la variedad resistente genera barreras de calosa en las paredes celulares del parénquima cortical y del floema, manteniendo funcional este tejido. En tanto que los tejidos vasculares de la variedad susceptible colapsan, el floema por obstrucción total con tapones de calosa y por formación de compuestos fenólicos, y el xilema por formación de tílides y/o acumulación de compuestos fenólicos, sin poder frenar el avance sistémico de la enfermedad.

  4. Pathogenic and genetic variation in Xanthomonas axonopodis pv ...

    African Journals Online (AJOL)

    Thus, results based on reaction of the majority isolates, suggest the absence of different races. However, the distinct differential reaction recorded for a single isolate, may prove to represent another, as yet unrecorded, race of this pathogen. Both RAPD and AFLP analyses revealed high frequency of DNA polymorphism ...

  5. Cyanohydrin glycosides of Passiflora

    DEFF Research Database (Denmark)

    Jaroszewski, Jerzy W; Olafsdottir, Elin S; Wellendorph, Petrine

    2002-01-01

    Nineteen species of Passiflora (Passifloraceae) were examined for the presence of cyanogenic glycosides. Passibiflorin, a bisglycoside containing the 6-deoxy-beta-D-gulopyranosyl residue, was isolated from P. apetala, P. biflora, P. cuneata, P. indecora, P. murucuja and P. perfoliata. In some cas...

  6. Cyanohydrin glycosides of Passiflora

    DEFF Research Database (Denmark)

    Jaroszewski, Jerzy W; Olafsdottir, Elin S; Wellendorph, Petrine

    2002-01-01

    Nineteen species of Passiflora (Passifloraceae) were examined for the presence of cyanogenic glycosides. Passibiflorin, a bisglycoside containing the 6-deoxy-beta-D-gulopyranosyl residue, was isolated from P. apetala, P. biflora, P. cuneata, P. indecora, P. murucuja and P. perfoliata. In some cases...

  7. A plant natriuretic peptide-like gene in the bacterial pathogen Xanthomonas axonopodis may induce hyper-hydration in the plant host: a hypothesis of molecular mimicry

    Directory of Open Access Journals (Sweden)

    Sayed Muhammed

    2004-03-01

    Full Text Available Abstract Background Plant natriuretic peptides (PNPs are systemically mobile molecules that regulate homeostasis at nanomolar concentrations. PNPs are up-regulated under conditions of osmotic stress and PNP-dependent processes include changes in ion transport and increases of H2O uptake into protoplasts and whole tissue. Presentation of the hypothesis The bacterial citrus pathogen Xanthomonas axonopodis pv. Citri str. 306 contains a gene encoding a PNP-like protein. We hypothesise that this bacterial protein can alter plant cell homeostasis and thus is likely to represent an example of molecular mimicry that enables the pathogen to manipulate plant responses in order to bring about conditions favourable to the pathogen such as the induced plant tissue hyper-hydration seen in the wet edged lesions associated with Xanthomonas axonopodis infection. Testing the hypothesis We found a Xanthomonas axonopodis PNP-like protein that shares significant sequence similarity and identical domain organisation with PNPs. We also observed a significant excess of conserved residues between the two proteins within the domain previously identified as being sufficient to induce biological activity. Structural modelling predicts identical six stranded double-psi β barrel folds for both proteins thus supporting the hypothesis of similar modes of action. No significant similarity between the Xanthomonas axonopodis protein and other bacterial proteins from GenBank was found. Sequence similarity of the Xanthomonas axonopodis PNP-like protein with the Arabidopsis thaliana PNP (AtPNP-A, shared domain organisation and incongruent phylogeny suggest that the PNP-gene may have been acquired by the bacteria in an ancient lateral gene transfer event. Finally, activity of a recombinant Xanthomonas axonopodis protein in plant tissue and changes in symptoms induced by a Xanthomonas axonopodis mutant with a knocked-out PNP-like gene will be experimental proof of molecular mimicry

  8. Evolutionary history of the plant pathogenic bacterium Xanthomonas axonopodis.

    Directory of Open Access Journals (Sweden)

    Nadia Mhedbi-Hajri

    Full Text Available Deciphering mechanisms shaping bacterial diversity should help to build tools to predict the emergence of infectious diseases. Xanthomonads are plant pathogenic bacteria found worldwide. Xanthomonas axonopodis is a genetically heterogeneous species clustering, into six groups, strains that are collectively pathogenic on a large number of plants. However, each strain displays a narrow host range. We address the question of the nature of the evolutionary processes--geographical and ecological speciation--that shaped this diversity. We assembled a large collection of X. axonopodis strains that were isolated over a long period, over continents, and from various hosts. Based on the sequence analysis of seven housekeeping genes, we found that recombination occurred as frequently as point mutation in the evolutionary history of X. axonopodis. However, the impact of recombination was about three times greater than the impact of mutation on the diversity observed in the whole dataset. We then reconstructed the clonal genealogy of the strains using coalescent and genealogy approaches and we studied the diversification of the pathogen using a model of divergence with migration. The suggested scenario involves a first step of generalist diversification that spanned over the last 25,000 years. A second step of ecology-driven specialization occurred during the past two centuries. Eventually, secondary contacts between host-specialized strains probably occurred as a result of agricultural development and intensification, allowing genetic exchanges of virulence-associated genes. These transfers may have favored the emergence of novel pathotypes. Finally, we argue that the largest ecological entity within X. axonopodis is the pathovar.

  9. Passiflora kikiana, a new species of Passifloraceae from the Brazilian Amazon Passiflora kikiana, uma nova espécie de Passifloraceae da Amazônia brasileira

    OpenAIRE

    Armando Carlos Cervi; Leonardo von Linsingen

    2010-01-01

    A new species of Passifloraceae from the Brazilian Amazon is described and illustrated. Passiflora kikianabelongs to the subg. Passiflora,supersect.Passiflora, sect. Laurifolia, ser. Laurifoliae. It is closely related to P. odontophylla and P. nitida; a key to these species is provided.Uma nova espécie de Passifloraceae da Amazônia brasileira é descrita e ilustrada. Passiflora kikiana pertence ao subg. Passiflora, supersect. Passiflora, sect. Laurifolia, ser. Laurifoliae. Está proximamente re...

  10. MICROSPOROGÉNESIS DE TRES ESPECIES DEL SUBGÉNERO PASSIFLORA (PASSIFLORA, PASSIFLORACEAE DE PARAGUAY

    Directory of Open Access Journals (Sweden)

    Claudia Pereira Sühsner

    2016-01-01

    Full Text Available El presente trabajo tuvo por objeto caracterizar cariológicamente las especies del género Passiflora L., subgénero Passiflora, del Distrito Félix Pérez Cardozo, Guairá, Paraguay. Por primera vez, se da a conocer el número cromosómico en meiosis 2n = 9II para P. alata Curtis y P. caerulea L. También, se confirma el número cromosómico de 2n = 9II para P. edulis Sims. El comportamiento meiótico en todas las especies estudiadas fue normal, con segregación regular de los cromosomas. La asociación cromosómica frecuentemente encontrada en diacinesis y metafase I fue de bivalentes. Las pocas irregularidades meióticas observadas consistieron en cromosomas rezagados en anafase I y fases asincrónicas en meiosis II, sin embargo, la viabilidad de polen es alta, entre 78,83% y 98,6%. Los resultados confirman x = 9 como número básico para el subgénero Passiflora. Este estudio es una importante contribución al conocimiento sobre la citogenética de las especies de Passiflora subg Passiflora de Paraguay.

  11. Una nueva especie de Passiflora, subgénero Passiflora (Passifloraceae del oeste de Colombia

    Directory of Open Access Journals (Sweden)

    Gerlach Gϋnter

    2000-12-01

    Full Text Available A new species of Passiflora from Colombia is here described: Passiflora chocoensis. It is closely related to P. menispermifolia, but differs by its sparsely spreading hairs, the finer texture of the leaves, its larger and cordate bracts, the number of petiolar glands and the lack of glands on the stipules and bracts.Se describe una nueva especie de Passiflora de Colombia: P. chocoensis, la cual tiene un parentesco cercano con P. menispermifolia, diferenciándose de ésta por su indumento ligero de pocos pelos dispersos, la textura de las hojas más fina, el mayor tamaño de sus brácteas en forma de corazón, la cantidad de glándulas en los pecíolos, al igual que por la ausencia de las glándulas en las brácteas y estípulas.

  12. Passiflora kikiana, a new species of Passifloraceae from the Brazilian Amazon Passiflora kikiana, uma nova espécie de Passifloraceae da Amazônia brasileira

    Directory of Open Access Journals (Sweden)

    Armando Carlos Cervi

    2010-12-01

    Full Text Available A new species of Passifloraceae from the Brazilian Amazon is described and illustrated. Passiflora kikianabelongs to the subg. Passiflora,supersect.Passiflora, sect. Laurifolia, ser. Laurifoliae. It is closely related to P. odontophylla and P. nitida; a key to these species is provided.Uma nova espécie de Passifloraceae da Amazônia brasileira é descrita e ilustrada. Passiflora kikiana pertence ao subg. Passiflora, supersect. Passiflora, sect. Laurifolia, ser. Laurifoliae. Está proximamente relacionada a P. odontophylla e P. nitida; uma chave de identificação é apresentada para diferenciá-las.

  13. Differential organellar inheritance in Passiflora's (Passifloraceae) subgenera.

    Science.gov (United States)

    Muschner, Valéria C; Lorenz-Lemke, Aline P; Vecchia, Maurizio; Bonatto, Sandro L; Salzano, Francisco M; Freitas, Loreta B

    2006-01-01

    Four chloroplast (cp), one mitochondrial (mt), and one ribosomal nuclear (ITS) DNA regions were studied in four artificial and one natural interspecific Passiflora hybrids. The ITS results confirmed their hybrid origin and all mtDNAs were maternally inherited. The same, however, was not true for cpDNA. The four hybrids (three artificial and one natural) derived from species of the Passiflora subgenus showed a cpDNA paternal inheritance, while the one involving taxa of the Decaloba subgenus gave evidence of maternal transmission. These results are of significance for the ongoing studies which are being performed on the molecular evolution of this genus and furnish important background for investigations aimed at clarifying the factors which determine cpDNA inheritance.

  14. Passiflora kapiriensis (Passifloraceae), a new species from French Guiana

    NARCIS (Netherlands)

    Rome, M.; Coppens d'Eeckenbrugge, G.

    2016-01-01

    Passiflora kapiriensis is a new Guianese species in the series Laurifoliae of subgenus Passiflora, found near Saint-Georges-de-l’Oyapock. The filaments of the fourth corona row are 1 cm long and oriented to the androgynophore, which is reminiscent of P. acuminata, P. cerasina, P. fissurosa, P.

  15. Evaluation of gastroprotective activity of Passiflora alata

    OpenAIRE

    Wasicky, André; Hernandes, Leandro S.; Vetore-Neto, Alberto; Moreno, Paulo R.H.; Bacchi, Elfriede Marianne; Kato, Edna Tomiko Myiake; Yoshida, Massayoshi

    2015-01-01

    AbstractPassiflora alata Curtis, Passifloraceae, is a liana popularly known in Brazil as ‘maracujá-doce’ that has been used for treating different illnesses. Its leaves are described in the Brazilian Pharmacopoeia, but the gastroprotective activity has never been investigated. In the present study a freeze-dried crude 60% ethanol–water extract of P. alata aerial parts was prepared. Total flavonoid content, expressed as vitexin, was 0.67% ± 0.01. The hemolytic activity was 32...

  16. The apo structure of sucrose hydrolase from Xanthomonas campestris pv. campestris shows an open active-site groove

    DEFF Research Database (Denmark)

    Champion, Elise; Remaud-Simeon, Magali; Skov, Lars Kobberøe

    2009-01-01

    , are not engaged in salt-bridge formation in the resting X. campestris enzyme. In the absence of the salt bridge an opening is created which gives access to subsite -1 from the ;nonreducing' end. Binding of the glucosyl moiety in subsite -1 is therefore likely to induce changes in the conformation of the active......-site cleft of the X. campestris enzyme. These changes lead to salt-bridge formation that shortens the groove. Additionally, this finding has implications for understanding the molecular mechanism of the closely related subfamily 4 glucosyl transferase amylosucrase, as it indicates that sucrose could enter...... of GH-13. Comparisons with structures of the highly similar sucrose hydrolase from X. axonopodis pv. glycines most notably showed that residues Arg516 and Asp138, which form a salt bridge in the X. axonopodis sucrose complex and define part of the subsite -1 glucosyl-binding determinants...

  17. A new species of Passiflora L. (Passifloraceae) from Brazil

    OpenAIRE

    Nunes, Teonildes Sacramento; Queiroz, Luciano Paganucci de

    2007-01-01

    Uma nova espécie de Passifloraceae é descrita e ilustrada, Passiflora mucugeana T.S. Nunes & L.P. Queiroz. Esta espécie é conhecida até o momento, na região da Chapada Diamantina, Bahia, em áreas próximas aos municípios de Mucugê, Ibicoara e Barra da Estiva, em áreas de florestas estacionais e campo rupestre (Complexo Espinhaço), chegando a uma altitude de 1.200 metros. Passiflora mucugeana é inserida no subg. Passiflora supersect. Stipulata Feuillet & MacDougal sect. Granadillastrum Triana &...

  18. Poscosecha de la gulupa: (passiflora edulis sims)

    OpenAIRE

    Orjuela-Baquero, Nubia Marcela; Campos Alba, Sandra; Sánchez Nieves, Jimena; Melgarejo, Luz Marina; Hernández, María Soledad; Sierra A., César A.; Gutiérrez Carranza, Luis Alejandro; Martínez, Sugey M.; Moreno-Chacón, Leonardo; Pérez-Martínez, Laura Victoria; Flórez, Laura Marcela

    2011-01-01

    Este libro presenta resultados de investigación, generados a través del proyecto “Efecto de las condiciones poscosecha sobre la fisiología, bioquímica, conservación y análisis proteómico en frutos de gulupa “Passiflora edulis Sims” ejecutado por la Universidad Nacional de Colombia, con la colaboración de la empresa OCATI S.A, y financiación por Colciencias; con el apoyo del proyecto “Materiales poliméricos para la fabricación de un empaque apropiado para el manejo poscosecha de la Gulupa” fi...

  19. Critical evaluation of proteomic protocols for passion fruit ( Passiflora ...

    African Journals Online (AJOL)

    Critical evaluation of proteomic protocols for passion fruit (Passiflora edulis Sims) leaves, a crop with juice market benefits. VA Perdizio, OLT Machado, JS Araujo, AEA Oliveira, LR Monteiro, MN Costa, AT Ferreira, J Perales, T Jacinto ...

  20. Passiflora dorisiae, una nueva especie en el Subgénero Passiflora (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Boris Esquerre-Ibañez

    2015-12-01

    Full Text Available Passiflora dorisiae es descrita e ilustrada como una nueva especie del género Passiflora (Passifloraceae para los bosques de neblina occidentales del noroeste del Perú. P. dorisiae es muy similar a P. lawessonii del Ecuador pero se diferencia en la estructura interna de la flor al poseer un opérculo erecto con la mitad superior filiforme y filamentos pequeños insertos; brácteas glandular-aserradas; lámina 3-lobada en un 1/3-1/4 de su tamaño, glandular-aserrada en la cara interna de la base; peciolo biglandular ocasionalmente con una glándula adicional distal y en su rango geográfico.

  1. Influência da natureza do rejeito agroindustrial fermentado por Xanthomonas axonopodis pv. manihotis nas propriedades das gomas xantana resultantes

    Directory of Open Access Journals (Sweden)

    Denilson de Jesus Assis

    2014-01-01

    Full Text Available Um destino para resíduos agro-industriais é usá-los como substratos fermentescíveis, diminuindo o custo na produção de produtos com alto valor agregado. Este trabalho avaliou a influência da natureza dos resíduos fermentescíveis e das cepas de Xanthomonas sobre a produção e propriedades do biopolímero resultante. A produção foi realizada em agitador orbital (250 rpm / 28 °C / 120 h por fermentação de sacarose (controle, glicerina residual do biodiesel e resíduo líquido de sisal. Tanto a composição do substrato como as cepas mostraram um forte efeito sobre a produção (0,36-2,40 gL- 1, viscosidade aparente (13,73 para 36,31 mPa.s e massa molecular (2,1-5,9 × 10(6 Da da goma de xantana resultante, não influenciando o comportamento pseudoplástico de soluções aquosas dos biopolímeros.

  2. Induction of soybean resistance to bacterial pustule disease (Xanthomonas axonopodis pv. glycines) by rhizobacteria and organic material treatment

    Science.gov (United States)

    Khaeruni, A.; Johan, E. A.; Wijayanto, T.; Taufik, M.; Syafar, A. A. R.; Kade Sutariati, G. A.

    2018-02-01

    This study aimed to evaluate the role of different formulations and types of organic matter in improving yield and resistance of soybean plants to bacterial pustule disease. The study was prepared based on a randomized block design with a factorial pattern. The first factor was the application of rhizobacterial formulation (biofresh), ie F0 = without the application of rhizobacteria, F1 = application of biofresh in solid formulation, and F2 = application of biofresh in liquid formulation. The second factor was the application of organic materials, namely B1 = compost of soybean litter + cow dung, B2 = compost of rice straw + cow dung, B3 = compost of soybean litter + rice straw + cow dung. Observation of disease severity and soybean yield was conducted on five sample plants in each treatment. The results showed that the treatment of biological agent biofresh in solid formulation combined with compos of soybean litter, was the best treatment in increasing plant resistance to bacterial pustule disease and seed weight. Plant resistance induction occurred systemically characterized by salicylic acid increase of 0.3 mg and peroxidase increase of 0.07 unit / mL in the sample plants.

  3. Comparative pharmacological study of hydroethanol extracts of Passiflora alata and Passiflora edulis leaves.

    Science.gov (United States)

    Petry, R D; Reginatto, F; de-Paris, F; Gosmann, G; Salgueiro, J B; Quevedo, J; Kapczinski, F; Ortega, G G; Schenkel, E P

    2001-03-01

    Several species of the genus Passiflora, known in Brazil as "maracujá", have widespread use in folk medicine as sedatives and tranquillizers. The anxiolytic activity of hydroethanol extracts of P. alata and P. edulis leaves was evaluated using the elevated plus-maze test. The extracts presented anxiolytic activity in dosages around 50, 100 and 150 mg/kg. Copyright 2001 John Wiley & Sons, Ltd.

  4. A first molecular phylogenetic analysis of Passiflora (Passifloraceae).

    Science.gov (United States)

    Muschner, Valéria C; Lorenz, Aline P; Cervi, Armando C; Bonatto, Sandro L; Souza-Chies, Tatiana T; Salzano, Francisco M; Freitas, Loreta B

    2003-08-01

    Passiflora, a genus with more than 400 species, exhibits a high diversity of floral and vegetative structures and a complex taxonomy, which includes 23 subgenera and many sections and series. To better understand Passiflora's variability and interspecific relationships, the phylogeny of 61 species, classified in 11 of 23 suggested subgenera, was investigated. Three molecular markers were used, the nuclear ribosomal internal transcribed spacers (nrITS), the plastid trnL-trnF spacer regions (∼1000 bp), and the rps4 plastid gene (∼570 bp). Three major clades were highly supported, independent of the marker and phylogenetic method used; one included the subgenera Distephana, Dysosmia, Dysosmioides, Passiflora, and Tacsonioides, a second, the subgenera Adopogyne, Decaloba, Murucuja, and Pseudomurucuja, and a third, the subgenus Astrophea. We call these the Passiflora, Decaloba, and Astrophea clades, respectively. The position of subgenus Deidamioides is undefined. The monophyly of Passiflora could not be statistically corroborated, and the relationships among the major clades and of these clades with the related genera remain unresolved. Our results indicate that a reevaluation of the monophyly of Passiflora and its infrageneric classification is necessary.

  5. Building Integrated PV and PV/Hybrid Products - The PV:BONUS Experience: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, H.; Pierce, L. K.

    2001-10-01

    Presented at the 2001 NCPV Program Review Meeting: Successes and lessons learned from PV:BONUS (Building Opportunities in the United States in PV). This program has funded the development of PV or PV/hybrid products for building applications.

  6. The aqueous extracts of Passiflora alata and Passiflora edulis reduce anxiety-related behaviors without affecting memory process in rats.

    Science.gov (United States)

    Barbosa, Paulo R; Valvassori, Samira S; Bordignon, Celso L; Kappel, Virginia D; Martins, Márcio R; Gavioli, Elaine C; Quevedo, João; Reginatto, Flávio H

    2008-06-01

    Several species of Passiflora have been employed widely as a folk medicine because of sedative and tranquillizer activities. In this study, we evaluate the effects on anxiety and memory process of two popularly used Passiflora species. To this aim, male Wistar rats (weighing 250-300 g) were intraperitoneally injected with the aqueous extract of Passiflora alata or Passiflora edulis (25, 50, 100, or 150 mg/kg; single injection) 30 minutes prior to the elevated plus-maze test, inhibitory avoidance test, or habituation to an open-field apparatus. The effects of both species of Passiflora were compared with that of diazepam (1 mg/kg), a standard anxiolytic drug. Our findings revealed that, similar to diazepam, the treatment with P. alata (100 and 150 mg/kg) and P. edulis (50, 100, and 150 mg/kg) induced anxiolytic-like effects in rats. Memory was not affected by the treatment with any dose of P. alata or P. edulis, but diazepam disrupted memory process in rats. Phytochemical analysis showed that the content of flavonoids of the aqueous extract of P. edulis is almost twice that of P. alata. These differences in contents of flavonoids could explain the lower active doses of the aqueous extract of P. edulis in inducing anxiolytic-like effects compared to P. alata. In conclusion, our findings suggest that, distinct from diazepam, the aqueous extract of both species of Passiflora induced anxiolytic-like effects in rats without disrupting memory process.

  7. Steroidal and triterpenoidal glucosides from Passiflora alata

    Directory of Open Access Journals (Sweden)

    Reginatto Flávio H.

    2001-01-01

    Full Text Available Five glycosides were isolated from leaves of P. alata. The structures 1-5 were obtained through extensive spectral analyses as 3-O-beta-D-glucopyranosyl-stigmasterol (1, 3-O-beta-D-glucopyranosyl-oleanolic acid (2, 3-O-beta-D-glucopyranosyl-(1->3-beta-D-glucopyranosyl-oleanolic acid (3, 3-O-beta-D-glucopyranosyl-(1->2-beta-D-glucopyranosyl-oleanolic acid (4 and 9,19-cyclolanost-24Z-en-3beta,21,26-trihydroxy-3,26-di-O-gentiobiose (5. Comparison of the TLC profiles of the hydroethanolic extracts from leaves of other Passiflora species found in the south of Brazil (P. actinia, P. caerulea, P. edulis var. flavicarpa, P. elegans, P. foetida, P. misera and P. tenuifila showed that only P. alata presented saponin accumulation.

  8. Fire resistant PV shingle assembly

    Science.gov (United States)

    Lenox, Carl J.

    2012-10-02

    A fire resistant PV shingle assembly includes a PV assembly, including PV body, a fire shield and a connection member connecting the fire shield below the PV body, and a support and inter-engagement assembly. The support and inter-engagement assembly is mounted to the PV assembly and comprises a vertical support element, supporting the PV assembly above a support surface, an upper interlock element, positioned towards the upper PV edge, and a lower interlock element, positioned towards the lower PV edge. The upper interlock element of one PV shingle assembly is inter-engageable with the lower interlock element of an adjacent PV shingle assembly. In some embodiments the PV shingle assembly may comprise a ventilation path below the PV body. The PV body may be slidably mounted to the connection member to facilitate removal of the PV body.

  9. Comparative pollen morphological analysis in the subgenera Passiflora and Decaloba

    Directory of Open Access Journals (Sweden)

    TALIANE L. SOARES

    2017-10-01

    Full Text Available ABSTRACT The genus Passiflora is the most diversified of the Passifloraceae, and its palynology presents wide morphological variability. The objective of the study was to evaluate the pollen morphology of 18 Passiflora species in order to identify informative pollinic characteristics to contribute to the taxonomic classification of the genus. The morphology of the pollen grains and the exine structure were investigated using light microscopy and scanning electron microscopy. Differences in the pollen morphology were found in the studied species, mainly in terms of shape, pollen aperture and ornamentation pattern of the exine. Most of the species belonging to the subgenus Passiflora presented ornamented 6-syncolpate pollen grains with an oblate-spheroidal shape and an exine with large lumens. In the subgenus Decaloba the pollen grains were 6-colporate, 12-colpate and 12-colporate, with subprolate to prolate-spheroidal shape, as well as an exine with smaller lumen size and few ornamented. The pollen morphology of the species of the subgenera Passiflora and Decaloba has shown palynological characteristics that have specific diagnostic value, thus allowing a better understanding of the taxonomy of the genus Passiflora.

  10. Comparative pollen morphological analysis in the subgenera Passiflora and Decaloba.

    Science.gov (United States)

    Soares, Taliane L; Jesus, Onildo N; Souza, Everton H; Rossi, Mônica L; Oliveira, Eder J

    2017-10-16

    The genus Passiflora is the most diversified of the Passifloraceae, and its palynology presents wide morphological variability. The objective of the study was to evaluate the pollen morphology of 18 Passiflora species in order to identify informative pollinic characteristics to contribute to the taxonomic classification of the genus. The morphology of the pollen grains and the exine structure were investigated using light microscopy and scanning electron microscopy. Differences in the pollen morphology were found in the studied species, mainly in terms of shape, pollen aperture and ornamentation pattern of the exine. Most of the species belonging to the subgenus Passiflora presented ornamented 6-syncolpate pollen grains with an oblate-spheroidal shape and an exine with large lumens. In the subgenus Decaloba the pollen grains were 6-colporate, 12-colpate and 12-colporate, with subprolate to prolate-spheroidal shape, as well as an exine with smaller lumen size and few ornamented. The pollen morphology of the species of the subgenera Passiflora and Decaloba has shown palynological characteristics that have specific diagnostic value, thus allowing a better understanding of the taxonomy of the genus Passiflora.

  11. Floral scent of brazilian Passiflora: five species analised by dynamic headspace

    Directory of Open Access Journals (Sweden)

    DANIEL A.V. MONTERO

    2016-01-01

    Full Text Available ABSTRACT This study describes for the first time the chemical composition and olfactive description of floral scent from Brazilian Passiflora (Passiflora edulis Sim, Passiflora alata Curtis, Passiflora cincinnata Mast., Passiflora coccinea Aubl. and Passiflora quadrangularis L.. Five species were grown in greenhouse at the Agronomic Institute (IAC, São Paulo, Brazil. Volatile compounds were collected using dynamic headspace. Analyses of scent composition were performed by gas chromatograph coupled to mass spectrometer. Identification of chemical constituents was conducted through of retention index followed by comparative analysis of mass spectra with specialized databases. The olfactive descriptions of floral scent from each species was evaluated for a professional perfumer. High interspecific diversity was found between chemical compositions of floral scent within Passiflora and different bouquets were observed amount the studied species. Mayor constituents were linalool (P. alata, geraniol (P. quadrangularis, 1,4-dimethoxybenzene (P. edulis, benzaldehyde (P. cincinnata and 2-methyl-3-pentanone (P. coccinea.

  12. Floral scent of brazilian Passiflora: five species analised by dynamic headspace.

    Science.gov (United States)

    Montero, Daniel A V; Marques, Marcia Ortiz M; Meletti, Laura M M; Kampen, Maria H VAN; Polozzi, Sandra C

    2016-09-01

    This study describes for the first time the chemical composition and olfactive description of floral scent from Brazilian Passiflora (Passiflora edulis Sim, Passiflora alata Curtis, Passiflora cincinnata Mast., Passiflora coccinea Aubl. and Passiflora quadrangularis L.). Five species were grown in greenhouse at the Agronomic Institute (IAC), São Paulo, Brazil. Volatile compounds were collected using dynamic headspace. Analyses of scent composition were performed by gas chromatograph coupled to mass spectrometer. Identification of chemical constituents was conducted through of retention index followed by comparative analysis of mass spectra with specialized databases. The olfactive descriptions of floral scent from each species was evaluated for a professional perfumer. High interspecific diversity was found between chemical compositions of floral scent within Passiflora and different bouquets were observed amount the studied species. Mayor constituents were linalool (P. alata), geraniol (P. quadrangularis), 1,4-dimethoxybenzene (P. edulis), benzaldehyde (P. cincinnata) and 2-methyl-3-pentanone (P. coccinea).

  13. Effect of a medicinal plant (Passiflora incarnata L on sleep

    Directory of Open Access Journals (Sweden)

    Fructuoso Ayala Guerrero

    Full Text Available INTRODUCTION: Extracts of the plant Passiflora incarnata L. (Passifloraceae were administered intraperitoneally in order to test its effects on sleep. METHOD: Experiments were carried out on chronically implanted male adult wistar rats to obtain cerebral (EEG, ocular (EOG and muscular (EMG activities throughout their states of vigilance. Polygraphic recordings were taken during 9 continuous hours before and after the extract administration (500 mg/kg. RESULTS: Passiflora incarnata induced a significant increment in the total sleep time (p<0.05. This increment was due to an increase in the time spent by animals in slow wave sleep (SWS. Concomitantly, a significant decrement in wakefulness (W was observed (p<0.05. In contrast, time spent in rapid eye movement (REM sleep showed a decreasing tendency, since both its frequency and mean duration were reduced. CONCLUSIONS: The extracts obtained from Passiflora incarnata can be considered as appropriated sleep inducers.

  14. Genetic variability assessment in the genus Passiflora by SSR markers

    Directory of Open Access Journals (Sweden)

    Claudia Lougon Paiva

    2014-09-01

    Full Text Available The genus Passiflora encompasses many species that are endemic to the Brazilian territory, including some with economic value. Studies on genetic diversity in this genus are fundamental because they allow understanding genetic variability and distance. The present study aimed to determine the genetic variability and distances among 10 species of the genus Passiflora by using microsatellite markers (Simple Sequence Repeat, SSR. Twenty-eight heterologous microsatellite markers were tested, but only 12 were used in the diversity analysis because they amplified in at least 80% of the species. A clear separation was observed among the subgenuses studied, as well as wide variation among the accessions of Passiflora. This knowledge enables breeders to explore diversity and transfer favorable alleles found in wild species.

  15. Notas sobre Passiflora ischnoclada Harms (Passifloraceae Notes on Passiflora ischnoclada Harms (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Luís Carlos Bernacci

    2001-08-01

    Full Text Available Passiflora ischnoclada foi descrita com base em apenas uma coleta. O único exemplar conhecido estava depositado no herbário de Berlin-Dahlem (B, mas foi destruído. A sinonimização da espécie em P. jilekii Wawra havia sido proposta, com base apenas em sua descrição original, mas, outro exemplar da coleção-tipo foi localizado no herbário do Instituto de Botânica (SP e P. ischnoclada foi recoletada na mesma área, quase um século depois. Foi possível comprovar a validade da espécie e seu posicionamento na série Laurifoliae e complementar sua descrição, acrescentando caracteres das flores e do fruto imaturo.The description of Passiflora ischnoclada was based on the type collection. The only mentioned material was deposited in the Berlin-Dahlem herbarium (B and was destroyed. The synonimization of P. ischnoclada under P. jilekii was proposed according to that description. Recently another material from the type collection was found in the SP herbarium and the species was collected again in the type locality. In this work the reestablishment of P. ischnoclada is proposed as well as the position of the species in the series Laurifoliae is discussed, and the description of the species is complemented, with adding characters of the flowers and the immature fruit.

  16. Passiflora alata and Passiflora edulis spray-dried aqueous extracts inhibit inflammation in mouse model of pleurisy.

    Science.gov (United States)

    Vargas, A J; Geremias, D S; Provensi, G; Fornari, P E; Reginatto, F H; Gosmann, G; Schenkel, E P; Fröde, T S

    2007-02-01

    The aqueous leaves extracts of Passiflora alata (100-300 mg/kg, i.p.) and Passiflora edulis (100-1000 mg/kg, i.p.) possess a significant antiinflammatory activity on carrageenan-induced pleurisy in mice. Treatment with the extracts inhibited leukocyte migration and reduced the formation of exudate. Moreover, a significant inhibition of myeloperoxidase and adenosine-deaminase activities was observed at the doses tested (100 or 250 mg/kg, i.p.). At the same doses, a significant decrease of serum C-reactive protein was observed.

  17. The PV market

    International Nuclear Information System (INIS)

    Hammond, B.

    1992-01-01

    This paper forecasts the photovoltaic (PV) market growth for the 1990s. Ten years of PV history are reviewed and used to establish market trends in terms of average selling price (ASP) and kilowatts shipped by market segment. The market is segmented into indoor consumer, stand-alone, and grid-connected applications. Indoor consumer presently represents a saturated market and is fairly predictable. The stand-alone market (i.e. not connected to the utility grid) is fairly stable and predictable. The utility PV market however is highly dependent on a number of market factors such as the cost of conventional energy the cost of PV systems utility acceptance of PV and regulatory controls. Government and institutional regulations, environmental issues, and OPEC and Middle East politics will have the greatest impact on the cost of conventional fuels. Private and federal investment in PV technology development could have a significant impact on the cost of PV systems. Forecasts are provided through the year 2000 for indoor consumer stand-alone and utility markets

  18. Phylogeny, biogeography and divergence times in Passiflora (Passifloraceae).

    Science.gov (United States)

    Muschner, Valéria C; Zamberlan, Priscilla M; Bonatto, Sandro L; Freitas, Loreta B

    2012-12-01

    As part of a long-term investigation on the evolution of Passiflora L., we investigated the divergence ages of the genus and diversification of its subgenera, relating them with biogeographical and/or historical events, and other characteristics of this taxon. The main aim of the present work was to evaluate the biogeographic distribution of this genus to better understand its evolutionary history. This is the first time that representatives from South American and Old World Passifloraceae genera have been studied as a group comprising a total of 106 widely distributed species, with representative samples of the four suggested subgenera. Seven DNA regions were studied, comprising 7,431 nucleotides from plastidial, mitochondrial and nuclear genomes. Divergence time estimates were obtained by using a Bayesian Markov Chain Monte Carlo method and a random local clock model for each partition. Three major subgenera have been shown to be monophyletic and here we are proposing to include another subgenus in the Passiflora infrageneric classification. In general, divergence among the four subgenera in Passiflora is very ancient, ranging from ∼32 to ∼38 Mya, and Passifloraceae seems to follow a biogeographic scenario proposed for several plant groups, originating in Africa, crossing to Europe/Asia and arriving in the New World by way of land bridges. Our results indicated that Passiflora ancestors arrived in Central America and diversified quickly from there, with many long distance dispersion events.

  19. Phylogeny, biogeography and divergence times in Passiflora (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Valéria C. Muschner

    2012-01-01

    Full Text Available As part of a long-term investigation on the evolution of Passiflora L., we investigated the divergence ages of the genus and diversification of its subgenera, relating them with biogeographical and/or historical events, and other characteristics of this taxon. The main aim of the present work was to evaluate the biogeographic distribution of this genus to better understand its evolutionary history. This is the first time that representatives from South American and Old World Passifloraceae genera have been studied as a group comprising a total of 106 widely distributed species, with representative samples of the four suggested subgenera. Seven DNA regions were studied, comprising 7,431 nucleotides from plastidial, mitochondrial and nuclear genomes. Divergence time estimates were obtained by using a Bayesian Markov Chain Monte Carlo method and a random local clock model for each partition. Three major subgenera have been shown to be monophyletic and here we are proposing to include another subgenus in the Passiflora infrageneric classification. In general, divergence among the four subgenera in Passiflora is very ancient, ranging from ~32 to ~38 Mya, and Passifloraceae seems to follow a biogeographic scenario proposed for several plant groups, originating in Africa, crossing to Europe/Asia and arriving in the New World by way of land bridges. Our results indicated that Passiflora ancestors arrived in Central America and diversified quickly from there, with many long distance dispersion events.

  20. Golden wine produced from mixed juices of passion fruit ( Passiflora ...

    African Journals Online (AJOL)

    African Journal of Food, Agriculture, Nutrition and Development ... The mixture of the three juices from Passiflora edulis, Mangifera indica and Ananas comosus produced an alcoholic beverage with a wonderful flavor that was generally delicious and acceptable to 40 trained and blind panelists during sensory evaluation ...

  1. The rediscovery of Passiflora kwangtungensis Merr. (subgenus Decaloba supersection Disemma): a critically endangered Chinese endemic.

    Science.gov (United States)

    Krosnick, Shawn E; Xun-Lin Yu; Deng, Yunfei

    2013-01-01

    Passiflora kwangtungensis is a critically endangered Chinese species known from Guangxi, Guangdong, and Jiangxi Provinces. The species belongs to Passiflora subgenus Decaloba, supersection Disemma, section Octandranthus. Field observations decreased rapidly during the 1970s to 1980s, and it was suspected that this species might have been extirpated due to repeated deforestation events throughout southern China. In recent years, however, small isolated populations of this species have been rediscovered in Hunan Province, representing new locality records for Passiflora kwangtungensis. New herbarium collections, color photographs, and silica gel collections have provided an unexpected opportunity to examine the evolutionary significance of this species. The current study presents a revised morphological description of Passiflora kwangtungensis based on fresh material, along with an updated distribution map. Using nrITS sequence data, preliminary insights into the phylogenetic position of Passiflora kwangtungensis are presented. Molecular data support the placement of Passiflora kwangtungensis within supersection Disemma section Octandranthus. However, the exact placement of Passiflora kwangtungensis within this lineage is unclear. The nrITS data suggest that Passiflora kwangtungensis may be sister to a clade containing Passiflora from China, Nepal, India, and Southeast Asia. Morphologically, Passiflora kwangtungensis displays the most similarity Passiflora geminiflora (Nepal, India) and Passiflora henryi (China). Lastly, conservation status and recommendations are made for Passiflora kwangtungensis following the IUCN Red List Criteria, where this species is classified as CR C1+C2a(i); D.

  2. PASSIOMA: Exploring Expressed Sequence Tags during Flower Development in Passiflora spp.

    Directory of Open Access Journals (Sweden)

    Lucas Cutri

    2012-01-01

    Full Text Available The genus Passiflora provides a remarkable example of floral complexity and diversity. The extreme variation of Passiflora flower morphologies allowed a wide range of interactions with pollinators to evolve. We used the analysis of expressed sequence tags (ESTs as an approach for the characterization of genes expressed during Passiflora reproductive development. Analyzing the Passiflora floral EST database (named PASSIOMA, we found sequences showing significant sequence similarity to genes known to be involved in reproductive development such as MADS-box genes. Some of these sequences were studied using RT-PCR and in situ hybridization confirming their expression during Passiflora flower development. The detection of these novel sequences can contribute to the development of EST-based markers for important agronomic traits as well as to the establishment of genomic tools to study the naturally occurring floral diversity among Passiflora species.

  3. Grid integrated distributed PV (GridPV).

    Energy Technology Data Exchange (ETDEWEB)

    Reno, Matthew J.; Coogan, Kyle

    2013-08-01

    This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functions are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in the OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function in the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

  4. Evaluation of gastroprotective activity of Passiflora alata

    Directory of Open Access Journals (Sweden)

    André Wasicky

    Full Text Available AbstractPassiflora alata Curtis, Passifloraceae, is a liana popularly known in Brazil as ‘maracujá-doce’ that has been used for treating different illnesses. Its leaves are described in the Brazilian Pharmacopoeia, but the gastroprotective activity has never been investigated. In the present study a freeze-dried crude 60% ethanol–water extract of P. alata aerial parts was prepared. Total flavonoid content, expressed as vitexin, was 0.67% ± 0.01. The hemolytic activity was 32 units for P. alata, using Saponin (Merck® as reference. P. alata presented EC50 of 1061.2 ± 8.5 µg/ml in the 2,2-diphenyl-1-picryhydrazyl assay and 1076 ± 85 µmol Trolox/g in the Oxygen Radical Absorbance Capacity assay. P. alata, its solvent fractions and a P. alatananopreparation were investigated for gastroprotective activity. The test samples exhibited gastroprotective activity on HCl/ethanol induced gastric mucosal lesions in rats. P. alata at doses of 100, 200 and 400 mg/kg, using the necrotizing agent at 150 mmol/l, inhibited 100% of ulcer formation (compared to the negative control, while lansoprazole (30 mg/kg 77%. When tested against a more concentrated necrotizing agent (300 mmol/l, fractions of P. alata at 100 mg/kg reduced 57% (n-hexane, 34% (ethyl acetate and 72% (aqueous fraction the ulcer formation. In this assay, lansoprazole (30 mg/kg inhibited 47%. When encapsulated, P. alata inhibited ulcer formation at 55%, 94% and 90% for dosages of 25, 50 and 100 mg/kg. These results suggest the potential use of P. alata as a gastroprotective herbal medicine.

  5. Assessment of sedative effects of Passiflora edulis f. flavicarpa and Passiflora alata extracts in mice, measured by telemetry.

    Science.gov (United States)

    Klein, Nadine; Gazola, Andressa Córneo; de Lima, Thereza Christina Monteiro; Schenkel, Eloir; Nieber, Karen; Butterweck, Veronika

    2014-05-01

    Several Passiflora species have been used widely as a folk medicine due to their sedative and anxiolytic activities. In Brazil, a number of native plants of the genus Passiflora exist, but only Passiflora edulis f. flavicarpa (PE) and Passiflora alata (PA) are of commercial value. Thus, the aim of the present study was to investigate the sedative effects of aqueous extracts obtained from the pericarp as well as from the leaves of PE and PA in mice using radiotelemetry. Aqueous extracts from PE and PA were tested for effects on locomotion over 180 min in 300 mg/kg, 600 mg/kg and 1200 mg/kg, in male C57BL/6J mice after oral administration. For validation of the telemetry system, caffeine (negative control) and midazolam (positive control) were used. All tested extracts decreased locomotor activity in a dose-dependent manner in comparison to the control group. The two lower concentrations of each extract showed the highest decrease in locomotion after 24 min, while 1200 mg/kg had a significant sedative effect already after 18 min. Interestingly, aqueous extracts of PA were more active in comparison to aqueous extracts of PE and the pericarp extracts of both plants showed more pronounced effects on locomotor activity if compared to leaf extracts. In conclusion, the present study represents an innovative, objective approach to measure sedative effects of plant extracts with minimized handling-related stress and remote data collection. Copyright © 2013 John Wiley & Sons, Ltd.

  6. Insights into Genome Plasticity and Pathogenicity of the Plant Pathogenic Bacterium Xanthomonas campestris pv. vesicatoria Revealed by the Complete Genome Sequence

    Science.gov (United States)

    Thieme, Frank; Koebnik, Ralf; Bekel, Thomas; Berger, Carolin; Boch, Jens; Büttner, Daniela; Caldana, Camila; Gaigalat, Lars; Goesmann, Alexander; Kay, Sabine; Kirchner, Oliver; Lanz, Christa; Linke, Burkhard; McHardy, Alice C.; Meyer, Folker; Mittenhuber, Gerhard; Nies, Dietrich H.; Niesbach-Klösgen, Ulla; Patschkowski, Thomas; Rückert, Christian; Rupp, Oliver; Schneiker, Susanne; Schuster, Stephan C.; Vorhölter, Frank-Jörg; Weber, Ernst; Pühler, Alfred; Bonas, Ulla; Bartels, Daniela; Kaiser, Olaf

    2005-01-01

    The gram-negative plant-pathogenic bacterium Xanthomonas campestris pv. vesicatoria is the causative agent of bacterial spot disease in pepper and tomato plants, which leads to economically important yield losses. This pathosystem has become a well-established model for studying bacterial infection strategies. Here, we present the whole-genome sequence of the pepper-pathogenic Xanthomonas campestris pv. vesicatoria strain 85-10, which comprises a 5.17-Mb circular chromosome and four plasmids. The genome has a high G+C content (64.75%) and signatures of extensive genome plasticity. Whole-genome comparisons revealed a gene order similar to both Xanthomonas axonopodis pv. citri and Xanthomonas campestris pv. campestris and a structure completely different from Xanthomonas oryzae pv. oryzae. A total of 548 coding sequences (12.2%) are unique to X. campestris pv. vesicatoria. In addition to a type III secretion system, which is essential for pathogenicity, the genome of strain 85-10 encodes all other types of protein secretion systems described so far in gram-negative bacteria. Remarkably, one of the putative type IV secretion systems encoded on the largest plasmid is similar to the Icm/Dot systems of the human pathogens Legionella pneumophila and Coxiella burnetii. Comparisons with other completely sequenced plant pathogens predicted six novel type III effector proteins and several other virulence factors, including adhesins, cell wall-degrading enzymes, and extracellular polysaccharides. PMID:16237009

  7. PV-WEB: internet-based PV information tool

    International Nuclear Information System (INIS)

    Cowley, P.

    2003-01-01

    This report gives details of a project to create a web-based information system on photovoltaic (PV) systems for the British PV Association (PV-UK) for use by decision makers in government, the utilities, and the housing and construction sectors. The project, which aims to provide an easily accessible tool for UK companies, promote PV technology, increase competitiveness, and identify market opportunities, is described. The design of the web site and its implementation and the evolution are discussed, along with the maintenance of the site by PV-UK and the opportunities offered to PV-UK Members

  8. Global PV Market Development

    International Nuclear Information System (INIS)

    Schmidt, F.

    2009-01-01

    The dawn of 2009 saw several events which caused major turbulence in the global photovoltaic industry. In 2008 the Spanish PV market grew beyond all expectations and even outranked Germany as the world's number one market. However, the promotion scheme was modified and a market cap was introduced in 2009, cutting back the maximum capacity to be installed to about the level of 2007. In addition, the industry is facing an oversupply of PV modules and a harsh recession which is significantly affecting the traditionally strong PV markets. International photovoltaic companies are challenged by a changing market situation: all of a sudden, competition has increased significantly, pushing the customer to the fore. As a result, a consolidation process is expected within the PV industry worldwide. However, the story is not all negative. In the U.S., the election of Barack Obama may be seen as the starting signal for a massive expansion in PV, likely to bring the country to first place globally within the next five years. Furthermore, different markets and market segments are being opened up - especially in Europe - thanks to the gradual arrival of generation parity and new PV support mechanisms. EuPD Research has observed and studied international PV markets since its foundation. The information included in the presentation is based on a wide range of quantitative and qualitative studies that EuPD Research has conducted in the key markets since 2002. Florian Schmidt, EuPD Research's Head of Product Management, will give an overview of the global PV market and how it is developing in this crucial year 2009. Aspects such as technology development, production capacities and the demand side will be included, with a special emphasis on the European PV markets. So far Chinese PV companies have often benefited from the booming PV markets in Europe, above all Germany and Spain. Due to the lack of domestic market, the Chinese industry strongly depends on the export and is

  9. Isolation and characterization of microsatellite markers for Passiflora contracta.

    Science.gov (United States)

    Cazé, Ana Luíza R; Kriedt, Raquel A; Beheregaray, Luciano B; Bonatto, Sandro L; Freitas, Loreta B

    2012-01-01

    Passiflora contracta Vitta (Passifloraceae) is an endemic species of the Atlantic Rainforest, one of the most species-rich ecoregions in the world, although extremely endangered. We have developed an enriched microsatellite library in order to fine-scale studies of the genetic structure of P. contracta. Twelve pairs of microsatellite primers were designed, and seven loci were successfully amplified and characterized by genotyping two wild populations of P. contracta. All seven loci were polymorphic, with an average number of alleles found being 4.8 and 5 per population. The cross-species transferability was tested using sister species Passiflora ovalis Vell. Ex Roemer. The development of these markers will contribute to the studies of population genetics in P. contracta as well as future studies concerning diversity patterns in the Atlantic Rainforest, and may also help to establish strategies for the conservation of this species.

  10. In vitro regeneration and multiplication of Passiflora hybrid "Guglielmo Betto".

    Science.gov (United States)

    Pipino, Luca; Braglia, Luca; Giovannini, Annalisa; Fascella, Giancarlo; Mercuri, Antonio

    2010-01-01

    With more than 450 species, Passiflora is the most important genus of the family Passifloraceae. It comprises many species grown for their edible fruits, for their high ornamental value, and further for the therapeutic properties. With their striking exotic flowers, they are of particular interest for the floriculture market. With the aim of evaluating the in vitro propagation of an Italian ornamental hybrid, axillary tendrils of Passiflora "Guglielmo Betto" M. Vecchia (P. incarnata L. x P. tucumanensis L.) were sterilized and placed in vitro. Direct shoot regeneration was achieved from young tendrils cultivated on MS medium containing, either 4.43 microM 6-benzylaminopurine (BAP) and 11.41 microM indoleacetic acid (IAA), or 49.20 microM 6-gamma-gamma-dimethylallylaminopurine (2iP) and 2.68 microM alpha-naphthalene acetic acid (NAA), respectively. In vitro shoot multiplication, rooting, and regenerated plant acclimatization protocols were established.

  11. Isolation and Characterization of Microsatellite Markers for Passiflora contracta

    Directory of Open Access Journals (Sweden)

    Ana Luíza R. Cazé

    2012-09-01

    Full Text Available Passiflora contracta Vitta (Passifloraceae is an endemic species of the Atlantic Rainforest, one of the most species-rich ecoregions in the world, although extremely endangered. We have developed an enriched microsatellite library in order to fine-scale studies of the genetic structure of P. contracta. Twelve pairs of microsatellite primers were designed, and seven loci were successfully amplified and characterized by genotyping two wild populations of P. contracta. All seven loci were polymorphic, with an average number of alleles found being 4.8 and 5 per population. The cross-species transferability was tested using sister species Passiflora ovalis Vell. Ex Roemer. The development of these markers will contribute to the studies of population genetics in P. contracta as well as future studies concerning diversity patterns in the Atlantic Rainforest, and may also help to establish strategies for the conservation of this species.

  12. Morfoanatomia de folhas e caules de Passiflora edulis Sims, Passifloraceae

    Directory of Open Access Journals (Sweden)

    Josseara Beraldo

    Full Text Available Passiflora edulis Sims, espécie vegetal empregada na medicina popular e amplamente cultivada no território nacional, tem suas folhas e seus caules, muitas vezes utilizados como adulterante de amostras comerciais da droga vegetal oficializada no país também conhecida como maracujá, Passiflora alata Curtis. Caracteres morfoanatômicos de folhas e de caules de P. edulis, foram descritos e documentados. Dentre os caracteres auxiliares na distinção entre a droga oficial e os órgãos aéreos de P. edulis podem-se destacar o contorno da lâmina foliar, a forma da nervura mediana em secção transversal, o número e a localização de nectários extraflorais e, o indumento

  13. ORF Sequence: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Xanthomonas axonopodis pv. citri str. 306] MTQRLMKTALIGVLALVSQGALAQAADKPAKALTSGEVTSMLTAKGYTKVHDLKFEHGVWTADAR...SGDGKDVDVHIDPVTGRVYGDQTTSKLSEADVRASLSTGGYADVHDLKFNDGLWKADAKRNGQKVELHVDPEDGHVVSVEND

  14. Efficiency of ITS sequences for DNA barcoding in Passiflora (Passifloraceae).

    Science.gov (United States)

    Giudicelli, Giovanna Câmara; Mäder, Geraldo; de Freitas, Loreta Brandão

    2015-04-01

    DNA barcoding is a technique for discriminating and identifying species using short, variable, and standardized DNA regions. Here, we tested for the first time the performance of plastid and nuclear regions as DNA barcodes in Passiflora. This genus is a largely variable, with more than 900 species of high ecological, commercial, and ornamental importance. We analyzed 1034 accessions of 222 species representing the four subgenera of Passiflora and evaluated the effectiveness of five plastid regions and three nuclear datasets currently employed as DNA barcodes in plants using barcoding gap, applied similarity-, and tree-based methods. The plastid regions were able to identify less than 45% of species, whereas the nuclear datasets were efficient for more than 50% using "best match" and "best close match" methods of TaxonDNA software. All subgenera presented higher interspecific pairwise distances and did not fully overlap with the intraspecific distance, and similarity-based methods showed better results than tree-based methods. The nuclear ribosomal internal transcribed spacer 1 (ITS1) region presented a higher discrimination power than the other datasets and also showed other desirable characteristics as a DNA barcode for this genus. Therefore, we suggest that this region should be used as a starting point to identify Passiflora species.

  15. Efficiency of ITS Sequences for DNA Barcoding in Passiflora (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Giovanna Câmara Giudicelli

    2015-04-01

    Full Text Available DNA barcoding is a technique for discriminating and identifying species using short, variable, and standardized DNA regions. Here, we tested for the first time the performance of plastid and nuclear regions as DNA barcodes in Passiflora. This genus is a largely variable, with more than 900 species of high ecological, commercial, and ornamental importance. We analyzed 1034 accessions of 222 species representing the four subgenera of Passiflora and evaluated the effectiveness of five plastid regions and three nuclear datasets currently employed as DNA barcodes in plants using barcoding gap, applied similarity-, and tree-based methods. The plastid regions were able to identify less than 45% of species, whereas the nuclear datasets were efficient for more than 50% using “best match” and “best close match” methods of TaxonDNA software. All subgenera presented higher interspecific pairwise distances and did not fully overlap with the intraspecific distance, and similarity-based methods showed better results than tree-based methods. The nuclear ribosomal internal transcribed spacer 1 (ITS1 region presented a higher discrimination power than the other datasets and also showed other desirable characteristics as a DNA barcode for this genus. Therefore, we suggest that this region should be used as a starting point to identify Passiflora species.

  16. Isolation, culture, and plant regeneration from leaf protoplasts of Passiflora.

    Science.gov (United States)

    Davey, Michael R; Anthony, Paul; Power, J Brian; Lowe, Kenneth C

    2006-01-01

    The family Passifloraceae contains many species exploited in the food, pharmaceutical, and ornamental plant industries. The routine culture of isolated protoplasts (naked cells) followed by reproducible plant regeneration, is crucial to the genetic improvement of Passiflora spp. by somatic cell technologies. Such procedures include somatic hybridization by protoplast fusion to generate novel hybrid plants, and gene introduction by transformation. Seedling leaves are a convenient source of totipotent protoplasts. The protoplast-to-plant system developed for Passiflora edulis fv. flavicarpa is summarized in this chapter. The procedure involves enzymatic degradation of leaf tissue using commercially-available Macerozyme R10, Cellulase R10, and Driselase. Isolated protoplasts are cultured in Kao and Michayluk medium, semi-solidified with agarose. The medium containing the suspended protoplasts is dispensed as droplets or thin layers and bathed in liquid medium of the same composition. Shoot regeneration involves transfer of protoplast-derived tissues to Murashige and Skoog-based medium. The protocols developed for P. edulis are applicable to other Passiflora spp. and will underpin the future biotechnological exploitation of a range of species in this important plant family.

  17. Apparently no sedative benzoflavone moiety in passiflorae herba.

    Science.gov (United States)

    Holbik, Martin; Krasteva, Stanimira; Mayer, Nina; Kählig, Hanspeter; Krenn, Liselotte

    2010-05-01

    Due to the fact that an Indian group had reported a benzoflavone moiety (BZF) as an active principle in the herb of Passiflora incarnata L. (Passifloraceae), this study was performed to isolate the compound for analytical purposes. In Passiflorae herba from three different origins (cultivations in India, Italy and France) a compound with the published TLC characteristics was detected in trace amounts only in the Italian material. No traces of the substance were found in the drugs from India and France. In a commercial extract two compounds with the respective TLC characteristics were detected. One was identified as a phytol isomer. Due to the very small amounts of the second compound its structure elucidation was not successful. The amount of extract for the isolation corresponded to approximately the 10-fold amount of the drug, from which the isolation of 332 mg "BZF" had been reported. The detection of only trace amounts of a BZF-like compound in one of three commercial samples of Passiflorae herba and in an extract suggests for the first time that BZF is not the active principle in this drug and should not serve as an active marker. Georg Thieme Verlag KG Stuttgart. New York.

  18. PV investment in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Hueser, Pius [Nova Energy GmbH, (Switzerland)

    2007-06-15

    This presentation is mainly about how the PV market in Europe has been growing, and which elements are going to determine if this market succeed or failed not only in Europe but also in the rest of the world. In the first part of this presentation, it is mentioned how in 2005 the development of some PV technologies triggered the PV market growth without any marketing control. Then, there are explained the aspects that changed such situation out of control, therefore, it emerged the beginning of the consolidation of this market. There are briefly explained those factors that are going to determine if this market succeed or failed in the future. Finally, there are given examples of some the PV investments. [Spanish] Esta presentacion habla principalmente de la manera en como ha crecido el Mercado de sistemas fotovoltaicos en Europa, asi tambien se mencionan los elementos fundamentales que determinaran el exito o fracaso de este mercado, no solamente en Europa sino tambien en el resto del mundo, en un futuro. En la primera parte de esta presentacion, se describe como en el 2005, debido al desarrollo de algunas tecnologias fotovoltaicas se desencadeno el crecimiento desenfrenado del mercado fotovoltaico. Despues, se explican los aspectos que hicieron que dicho crecimiento tomara su curso, teniendo como resultado el inicio de un mercado mas consolidado. Se explican brevemente los factores que determinaran si este mercado encuentra el exito o el fracaso en un futuro. Finalmente, se dan ejemplos de algunas adquisiciones fotovoltaicas.

  19. In Vitro Culture and Phytochemical Analysis of Passiflora tenuifila Killip and Passiflora setacea DC (Passifloraceae).

    Science.gov (United States)

    Sozo, Jenny Sumara; Cruz, Daniel Cuzziol; Pavei, Ana Flavia; Pereira, Isadora Medeiros da Costa; Wolfart, Marcia; Ramlov, Fernanda; Fiuza Montagner, Daiane; Maraschin, Marcelo; Viana, Ana Maria

    2016-01-01

    We have developed reproducible micropropagation, callus culture, phytochemical, and antioxidant analysis protocols for the wild passion fruit species P. tenuifila, and P. setacea, native to the Brazilian endangered biomes Atlantic Forest, Cerrado, and Caatinga, by using seeds and explants from seedlings and adult plants. Genotype and explant origin-linked differences are visible amongst the Passiflora species concerning callus production, total phenolics, and antioxidant activity. The protocols developed for screening phytochemicals and antioxidants in P. tenuifila and P. setacea callus extracts have shown their potential for phenolic production and antioxidant activity. The high level of phenolic compounds seems to account for the antioxidant activity of methanolic extracts of P. tenuifila derived from 45-day-old immature seed callus. The methanolic extracts of callus derived from P. setacea seedling leaf node and cotyledonary node explants have shown the highest antioxidant activity despite their lower content of phenolics, as compared to cotyledon callus extracts. The optimized micropropagation and callus culture protocols have great potential to use cell culture techniques for further vegetative propagation, in vitro germplasm conservation, and secondary metabolite production using biotic and abiotic elicitors.

  20. Tipos de aberturas dos grãos de pólen de espécies de Passiflora L. (Passifloraceae Aperture types of pollen grains of Passiflora L. species (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Greta Aline Dettke

    2009-12-01

    Full Text Available Estudos palinológicos revelam uma ampla variação de formas, número e tipos de aberturas nos grãos de pólen em Passiflora. Este estudo tem como objetivo caracterizar as aberturas polínicas de onze espécies do gênero ocorrentes no Rio Grande do Sul e duas em Santa Catarina (Brasil, pertencentes a três dos quatro subgêneros atualmente reconhecidos: Astrophea, Decaloba e Passiflora. Foram utilizadas várias técnicas de microscopia óptica de campo claro e microscopia eletrônica de varredura. Passiflora haematostigma (Astrophea possui grãos de pólen 6-colporados, com três endoaberturas lalongadas. Passiflora alata, P. amethystina, P. caerulea e P. edulis (Passiflora apresentam pólen 6-colpados, com fusões das ectoaberturas, aos pares, na região do apocolpo. Passiflora actinia, P. elegans e P. tenuifila (Passiflora apresentam grãos de pólen com 6 a 12 colpos, também fusionados aos pares. Passiflora misera, P. morifolia, P. suberosa e P. truncata (Decaloba apresentam grãos de pólen 6-colporados operculados, com diferenças no tamanho das endoaberturas e largura do opérculo. Passiflora capsularis (Decaloba apresenta pólen 12-colporado. São discutidos os principais termos relacionados às descrições polínicas do grupo e indicados os termos mais apropriados e sinônimos.Palynological studies reveal a wide variation in shape, number and types of apertures in Passiflora pollen grains. This study aimed to characterize pollen grain apertures of eleven species of Passiflora from Rio Grande do Sul state and two species from Santa Catarina state (Brazil, belonging to three of the four subgenera now recognized: Astrophea, Decaloba and Passiflora. Several techniques of light and scanning electron microscopy were employed. Passiflora haematostigma (Astrophea has 6-colporate pollen grains with three lalongate endoapertures. Passiflora alata, P. amethystina, P. caerulea and P. edulis (Passiflora have 6-colpate pollen grains, with fusion

  1. Firefighter Safety for PV Systems

    DEFF Research Database (Denmark)

    Mathe, Laszlo; Sera, Dezso; Spataru, Sergiu

    2015-01-01

    An important and highly discussed safety issue for photovoltaic (PV) systems is that as long as the PV panels are illuminated, a high voltage is present at the PV string terminals and cables between the string and inverters that is independent of the state of the inverter's dc disconnection switch...

  2. Testing for PV Reliability (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, S.; Bansal, S.

    2014-09-01

    The DOE SUNSHOT workshop is seeking input from the community about PV reliability and how the DOE might address gaps in understanding. This presentation describes the types of testing that are needed for PV reliability and introduces a discussion to identify gaps in our understanding of PV reliability testing.

  3. PV potential and potential PV rent in European regions

    DEFF Research Database (Denmark)

    Hansen, Anders Chr.; Thorn, Paul

    2013-01-01

    The paper provides a GIS based model for assessing the potentials of photovoltaic electricity in Europe by NUTS 2 regions. The location specific energy potential per PV-­‐panel area is estimated based on observations of solar irradiation, conversion efficiency, levelised costs and the social value...... of PV-­‐electricity. Combined with the potential density of PV-­‐panel area based on land cover and environental restrictions, the PV energy potential and the potential PV ressource rent is calculated. These calculations enbable the model to estimate the regional patterns at NUTS 2 level...

  4. MALDI-TOF-MS with PLS Modeling Enables Strain Typing of the Bacterial Plant Pathogen Xanthomonas axonopodis

    Science.gov (United States)

    Sindt, Nathan M.; Robison, Faith; Brick, Mark A.; Schwartz, Howard F.; Heuberger, Adam L.; Prenni, Jessica E.

    2017-11-01

    Matrix-assisted desorption/ionization time of flight mass spectrometry (MALDI-TOF-MS) is a fast and effective tool for microbial species identification. However, current approaches are limited to species-level identification even when genetic differences are known. Here, we present a novel workflow that applies the statistical method of partial least squares discriminant analysis (PLS-DA) to MALDI-TOF-MS protein fingerprint data of Xanthomonas axonopodis, an important bacterial plant pathogen of fruit and vegetable crops. Mass spectra of 32 X. axonopodis strains were used to create a mass spectral library and PLS-DA was employed to model the closely related strains. A robust workflow was designed to optimize the PLS-DA model by assessing the model performance over a range of signal-to-noise ratios (s/n) and mass filter (MF) thresholds. The optimized parameters were observed to be s/n = 3 and MF = 0.7. The model correctly classified 83% of spectra withheld from the model as a test set. A new decision rule was developed, termed the rolled-up Maximum Decision Rule (ruMDR), and this method improved identification rates to 92%. These results demonstrate that MALDI-TOF-MS protein fingerprints of bacterial isolates can be utilized to enable identification at the strain level. Furthermore, the open-source framework of this workflow allows for broad implementation across various instrument platforms as well as integration with alternative modeling and classification algorithms. [Figure not available: see fulltext.

  5. Evidence of anti-inflammatory effects of Passiflora edulis in an inflammation model.

    Science.gov (United States)

    Montanher, Ana Beatriz; Zucolotto, Silvana Maria; Schenkel, Eloir Paulo; Fröde, Tânia Silvia

    2007-01-19

    The popular medicine Passiflora edulis has been used as a sedative, tranquilizer, against cutaneous inflammatory diseases and intermittent fever. Most of the pharmacological investigations of Passiflora edulis have been addressed to its Central Nervous System activities, such as anxiolytic, anticonvulsant and sedative actions. Otherwise, there are few reports about the anti-inflammatory activity of the Passiflora species. The aim of this study was to investigate the mechanism of the anti-inflammatory effect of aqueous lyophilized extract obtained from leaves of Passiflora edulis var. flavicarpa Degener (Passifloraceae) in the mouse model of pleurisy induced by carrageenan (Cg), bradykinin, histamine or substance P, observing the effects upon leucocytes migration, myeloperoxidase (MPO), nitric oxide (NO) concentrations and tumor necrosis factor-alpha (TNFalpha) and interleukin-1 beta (IL-1beta) levels. Passiflora edulis (250mg/kg) administered by intraperitoneal route (i.p.) inhibited the leukocyte, neutrophils, myeloperoxidase, nitric oxide, TNFalpha and IL-1beta levels (P<0.01) in the pleurisy induced by carrageenan. Passiflora edulis (250-500mg/kg, i.p.) also inhibited total and differential leukocytes in the pleurisy induced by bradykinin, histamine or substance P (P<0.05). Several mechanisms, including the inhibition of pro-inflammatory cytokines (TNFalpha, IL-1beta), enzyme (myeloperoxidase) and mediators (bradykinin, histamine, substance P, nitric oxide) release and/or action, appear to account for Passiflora edulis's actions.

  6. PV and PV/hybrid products for buildings

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, H. P.; Hayter, S. J.; Martin, R. L., Pierce, L. K.

    2000-05-15

    Residential, commercial, and industrial buildings combined are the largest consumers of electricity in the United States and represent a significant opportunity for photovoltaic (PV) and PV/hybrid systems. The U.S. Department of Energy (DOE) is conducting a phased research and product development program, Building Opportunities in the United States for Photovoltaics (PV:BONUS), focused on this market sector. The purpose of the program is to develop technologies and foster business arrangements integrating cost-effective PV or hybrid products into buildings. The first phase was completed in 1996 and a second solicitation, PV:BONUS2, was initiated during 1997. These projects are resulting in a variety of building-integrated products. This paper summarizes the recent progress of the seven firms and collaborative teams currently participating in PV:BONUS2 and outlines planned work for the final phase of their work.

  7. A structural review of foliar glands in Passiflora L. (Passifloraceae).

    Science.gov (United States)

    Lemos, Renata Cristina Cassimiro de; da Costa Silva, Delmira; Flavia de Albuquerque Melo-de-Pinna, Gladys

    2017-01-01

    Extrafloral glands in Passifloraceae species have aroused the interest of many researchers because of their wide morphological diversity. The present work analyzed the foliar glands on 34 species of Passiflora from samples containing glands in the petiole and foliar blade fixed in 50% solution of formaldehyde-ethanol-acetic acid and stored in a 70% ethanol solution. For anatomical analyses, part of the material was embedded in Paraplast, longitudinally sectioned and double stained with safranin and astra blue. Scanning electron microscopy analysis was also carried out. To analyze the presence of sugars in the secretion of foliar glands, a glucose strip test was used. Based on the results of morphological, anatomical and glucose strip tests, the foliar secretory glands in Passiflora can be grouped into two categories: Type I glands, defined as nectaries, can be elevated or flattened, and can have a sugar content high enough to be detected by the glucose strip test analysis. Type II glands are elevated and did not show a positive reaction to the glucose strip test. From an anatomical viewpoint, glands characterized as extrafloral nectaries show a multistratified secretory epidermis, typically followed by two flat layers of nectariferous parenchyma with dense content. Internal to these layers, vascular bundles are immersed in the subsecretory parenchyma and terminate in phloem cells. On the other hand, type II glands show a single layer of elongated secretory epidermal cells. Internal to this single layer, parenchyma and vascular tissue with both phloem and xylem elements can be observed. The analyzed species show a wide diversity of gland shape and distribution, and the combined analysis of morphology, anatomy and preliminary tests for the presence of glucose in the exudate in different Passiflora subgenera suggests the occurrence of two categories of glands: nectaries and resin glands.

  8. Toxicity and genotoxicity evaluation of Passiflora alata Curtis (Passifloraceae).

    Science.gov (United States)

    Boeira, Jane M; Fenner, Raquel; Betti, Andresa H; Provensi, Gustavo; Lacerda, Luciana de A; Barbosa, Patrícia R; González, Félix H D; Corrêa, André M R; Driemeier, David; Dall'Alba, Marília P; Pedroso, Annelise P; Gosmann, Grace; da Silva, Juliana; Rates, Stela M K

    2010-03-24

    Passiflora alata is an official species of Brazilian Pharmacopoeia and its aerial parts are used as medicinal plant by local population as well as constitutes many phytomedicines commercialized in Brazil as sedative. To evaluate the acute and sub-acute toxicity and genotoxicity of an aqueous spray-dried extract (PA) of Passiflora alata (2.6% flavonoids). The acute and the sub-acute toxicity was evaluated in mice and rats, respectively. Behavioural, biochemical, hematological, histological and urine parameters were considered. Genotoxicity was assessed by using micronucleus test performed in peripheral blood and bone marrow cells and comet assay in peripheral blood leukocytes. Mice deaths were not observed up to 4800 mg/kg, p.o., single dose. Rats treated with aqueous extract at dose of 300 mg/kg, p.o., for 14 days did not present biochemical, hematological or histopathological significant alterations when compared to control group. However, these rats showed signs of irritability and did not show weight gain. In addition, mice acutely treated with extract 150, 300 and 600 mg/kg, p.o., presented DNA damage determined by comet assay in peripheral blood cells 3h after treatment. The effect of lower doses (12.5, 25 and 50mg/kg, p.o.) was evaluated at 3, 6 and 24h after treating. Only PA 50mg/kg (p.o.) induced significant damage at 3 and 6h. The maximum damage induction was observed at 6h. When the animals received PA 12.5, 25 or 50mg/kg/day during 3 days (i.e., 72h treatment) DNA damage (comet and micronucleus tests) increased significantly in a dose-dependent manner. In conclusion Passiflora alata presented genotoxic effect and deserves further toxicity evaluation in order to guarantee its safety for human use. Copyright (c) 2010. Published by Elsevier Ireland Ltd.

  9. Advances in PV Inverters

    DEFF Research Database (Denmark)

    Anthon, Alexander

    and preferably low complexity leads to new research demands. This is especially true in the field of low cost residential PV inverters where efficiencies are used as major selling arguments. Traditional converter topologies equipped with conventional Silicon based semiconductors to date reach their limitations......, a replacement of only two switching devices per phase leg can greatly reduce the semiconductor losses. The Hybrid-NPC converter can be seen as an attractive and cost competitive alternative to the Silicon Carbide based converter, also allowing to overcome the major drawbacks with the conventional Silicon IGBT...

  10. Outdoor PV Degradation Comparison

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, D. C.; Smith, R. M.; Osterwald, C. R.; Gelak, E.; Kurtz, S. R.

    2011-02-01

    As photovoltaic (PV) penetration of the power grid increases, it becomes vital to know how decreased power output; may affect cost over time. In order to predict power delivery, the decline or degradation rates must be determined; accurately. At the Performance and Energy Rating Testbed (PERT) at the Outdoor Test Facility (OTF) at the; National Renewable Energy Laboratory (NREL) more than 40 modules from more than 10 different manufacturers; were compared for their long-term outdoor stability. Because it can accommodate a large variety of modules in a; limited footprint the PERT system is ideally suited to compare modules side-by-side under the same conditions.

  11. GENETIC AND MORPHOAGRONOMIC DIVERSITY OF Passiflora spp. BASED ON QUANTITATIVE MEASUREMENTS OF FLOWERS AND FRUITS

    Directory of Open Access Journals (Sweden)

    JAMILE DA SILVA OLIVEIRA

    Full Text Available ABSTRACT The aim of this study was to characterize Passiflora spp. accessions and its genetic diversity based on quantitative morphological descriptors of flowers and fruits. The study was conducted at Embrapa Cerrados, Planaltina-DF. Fifteen Passiflora spp. accessions were characterized using 14 quantitative morphological descriptors. Genetic distances among accessions were estimated based on Mahalanobis’ generalized distance. Cluster analysis via dendrogram and graphic dispersion was analyzed. The relative contribution of characters for accession divergence was also calculated. The morphoagronomic characterization based on quantitative descriptors of flowers and fruits contributed to the differentiation of Passiflora spp. accessions, serving as an important tool for variability quantification. This information is useful to perform Passiflora spp. characterization and genetic diversity studies.

  12. Genetic Breeding and Diversity of the Genus Passiflora: Progress and Perspectives in Molecular and Genetic Studies

    Directory of Open Access Journals (Sweden)

    Carlos Bernard M. Cerqueira-Silva

    2014-08-01

    Full Text Available Despite the ecological and economic importance of passion fruit (Passiflora spp., molecular markers have only recently been utilized in genetic studies of this genus. In addition, both basic genetic researches related to population studies and pre-breeding programs of passion fruit remain scarce for most Passiflora species. Considering the number of Passiflora species and the increasing use of these species as a resource for ornamental, medicinal, and food purposes, the aims of this review are the following: (i to present the current condition of the passion fruit crop; (ii to quantify the applications and effects of using molecular markers in studies of Passiflora; (iii to present the contributions of genetic engineering for passion fruit culture; and (iv to discuss the progress and perspectives of this research. Thus, the present review aims to summarize and discuss the relationship between historical and current progress on the culture, breeding, and molecular genetics of passion fruit.

  13. Chemical investigation and effects of the tea of Passiflora alata on biochemical parameters in rats.

    Science.gov (United States)

    Doyama, J T; Rodrigues, H G; Novelli, E L B; Cereda, E; Vilegas, W

    2005-01-15

    Passiflora alata (Passifloraceae) is a native plant from the South-America tropical forest that provides a much appreciated fruit known as "maracujá-doce". Although tea of the leaves of Passiflora alata is used in folk medicine as a sedative and tranquilizer, there are no investigations about its effects on biochemical parameters in blood or from its major chemical composition. The purpose of this study was to evaluate the effects of the tea of the leaves of Passiflora alata on biochemical parameters (antioxidant system, glucose and cholesterol levels) and to perform a phytochemical investigation of the tea. We isolated and identified two saponins and five C-glycosylflavones derived from apigenin, luteolin and chrysoeriol. Three of them are new in this species. Passiflora alata extract was administrated orally in rats at dose of 1000 mg/kg and it was observed an increase in high-density lipoprotein level (HDL-cholesterol).

  14. Sensorless PV Array Diagnostic Method for Residential PV Systems

    DEFF Research Database (Denmark)

    Sera, Dezso; Spataru, Sergiu; Mathe, Laszlo

    2011-01-01

    This work proposes a temperature and irradiance sensorless diagnostic method suitable for small residential PV installations, focusing on detection of partial shadows. The method works by detection of failures in crystalline silicone PV arrays by concomitant monitoring of some of their key...

  15. Interband cascade (IC) photovoltaic (PV) architecture for PV devices

    Science.gov (United States)

    Yang, Rui Q.; Tian, Zhaobing; Mishima, Tetsuya D.; Santos, Michael B.; Johnson, Matthew B.; Klem, John F.

    2015-10-20

    A photovoltaic (PV) device, comprising a PV interband cascade (IC) stage, wherein the IC PV stage comprises an absorption region with a band gap, the absorption region configured to absorb photons, an intraband transport region configured to act as a hole barrier, and an interband tunneling region configured to act as an electron barrier. An IC PV architecture for a photovoltaic device, the IC PV architecture comprising an absorption region, an intraband transport region coupled to the absorption region, and an interband tunneling region coupled to the intraband transport region and to the adjacent absorption region, wherein the absorption region, the intraband transport region, and the interband tunneling region are positioned such that electrons will flow from the absorption region to the intraband transport region to the interband tunneling region.

  16. Analysis of transferability of microsatellite primers (SSR) in wild Passiflora species and intraspecific genetic diversity in Passiflora alata.

    Science.gov (United States)

    Silva, M A A; Souza, M M; Silva, G S; Melo, C A F; Corrêa, R X; Araújo, I S; Conceição, L D H C S

    2014-08-07

    The genus Passiflora L. is the most representative of Passifloraceae, with over 500 known species, among which 150-200 originated from Brazil. In addition to the great commercial importance of this genus for the fruit market, many of the species have exotic flowers with a huge diversity of colors and can thereby be exploited as ornamental plants. This study was aimed at investigating the transferability of microsatellite primers in wild Passiflora species (P. cacao, P. cincinnata, P. glandulosa, P. gibertii, and P. mucronata) and characterizing 29 P. alata accessions using microsatellite primers that were previously developed in a library enriched with microsatellites from P. edulis f. flavicarpa for P. alata. The interspecies cross-amplification rate varied, and P. cacao exhibited the highest rate of amplification, suggesting a greater degree of proximity to P. edulis. The study of intraspecific accessions in P. alata found genetic similarity, with values ranging from 0.47 to 1.00 and an average similarity of 0.74. Hence, this study revealed the intraspecific genetic variability of P. alata in the Universidade Estadual de Santa Cruz's Active Germplasm Bank and will lead to the adoption of mating strategies between accessions; thus making their use more suitable for breeding purposes.

  17. Perfis de metabólitos secundários e atividade antioxidante de frutos, sementes e calos cultivados in vitro de Passiflora setacea e Passiflora tenuifila (Passifloraceae)

    OpenAIRE

    Sozo, Jenny Sumara

    2014-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências Biológicas, Programa de Pós-Graduação em Biotecnologia e Biociências, Florianópolis, 2014. Passiflora tenuifila Killip e Passiflora setacea DC. são espécies endêmicas do Brasil que ocorrem no Cerrado, Mata Atlântica e Caatinga (P. setacea DC.) e que foram selecionadas pelo programa de melhoramento genético realizado pela Embrapa Cerrados, visando o desenvolvimento tecnológico para uso funcional das Passiflo...

  18. Impacts of PV Array Sizing on PV Inverter Lifetime and Reliability

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2017-01-01

    In order to enable a more wide-scale utilization of PV systems, the cost of PV energy has to be comparable with other energy sources. Oversizing the PV array is one common approach to reduce the cost of PV energy, since it increases the PV energy yield during low solar irradiance conditions....... However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter lifetime and reliability. In that case, it may result in a negative impact on the overall PV energy cost, due to the increased maintenance for the PV inverters. This paper...... evaluates the lifetime of PV inverters considering the PV array sizing and installation sites, e.g., Denmark and Arizona. The results reveal that the PV array sizing has a considerable impact on the PV inverter lifetime and reliability, especially in Denmark, where the average solar irradiance level...

  19. Anti-inflammatory Flavonoids Isolated from Passiflora foetida.

    Science.gov (United States)

    Nguyen, Thi Yen; To, Dao Cuong; Tran, Manh Hung; Lee, Joo Sang; Lee, Jeong Hyung; Kim, Jeong Ah; Woo, Mi Hee; Min, Byung Sun

    2015-06-01

    In this study, we evaluated the anti-inflammatory activity of the soluble ethyl acetate fraction and chemical components of the stem bark of Passiflora foetida (Passifloraceae). Ten flavonoids (1-10) were isolated by various chromatographic techniques, and their structures were determined based on spectroscopic analyses by using nuclear magnetic resonance (NMR). Luteolin (2) and chrysoeriol (3) showed the most potent inhibition of nitric oxide (NO) production in macrophage cell line, RAW264.7, with half maximal inhibitor concentration (IC50) values of 1.2 and 3.1 μM, respectively. These compounds suppressed lipopolysaccharide (LPS)-induced inducible NO synthase (iNOS) expression at the transcription level. Our research indicates that the stem bark of P. foetida has significant anti-inflammatory properties, suggesting that its flavonoids may have anti-inflammatory benefits.

  20. Enxertia de mesa de Passiflora edulis Sims f. flavicarpa Deg. sobre Passiflora alata Curtis, em ambiente de nebulização intermitente Bench graft of Passiflora edulis Sims f. flavicarpa Deg. on Passiflora alata Curtis, in intermittent misty atmosphere

    Directory of Open Access Journals (Sweden)

    Flávia Matos Silva

    2005-04-01

    Full Text Available O maracujazeiro é uma cultura típica de países tropicais, sendo estes responsáveis por cerca de 90% da produção mundial. A propagação vegetativa do maracujazeiro permite a obtenção de pomares uniformes, bem como de porta-enxertos altamente produtivos ou resistentes a doenças. O experimento teve como objetivo verificar a viabilidade da enxertia de mesa do maracujazeiro-amarelo (Passiflora edulis Sims f. flavicarpa Deg. sobre o maracujazeiro-doce (Passiflora alata Curtis, conduzido em telado com 50% de sombreamento, dotado de sistema de nebulização intermitente. Foi conduzido de agosto de 2001 a maio de 2002, na Fazenda de Ensino e Pesquisa da UNESP - Câmpus de Ilha Solteira, localizada no município de Selvíria - MS. O delineamento experimental utilizado foi blocos ao acaso, esquema de parcelas subdivididas no tempo, totalizando quatro tratamentos (T1 - enxertia tipo fenda cheia, com o garfo do ponteiro dos ramos; T2 - enxertia tipo inglês simples, com o garfo do ponteiro dos ramos; T3 - enxertia tipo fenda cheia, com o garfo da parte mediana dos ramos; T4 - enxertia tipo inglês simples, com o garfo da parte mediana dos ramos, cinco repetições e 25 estacas enxertadas por parcela. Foram avaliados: a porcentagem de sobrevivência das estacas enxertadas; b porcentagem de estacas enxertadas enraizadas; c número de brotos emitidos por estaca enxertada; d número de folhas emitidas por estaca enxertada; e massa da matéria seca da raiz, caule, folha e planta. Com base nos resultados, pode-se concluir que: a técnica de enxertia de mesa, quando aplicada ao maracujazeiro, mostrou-se viável, com excelente porcentagem de sobrevivência e enraizamento.The passion fruit plant is a typical culture of tropical countries, which are responsible for about 90% of the world production. The vegetative propagation of the passion fruit plant allows the obtainment of uniform orchards, as well as of rootstocks highly productive or resistant to

  1. Typifications in Passiflora L. (Passifloraceae described by Frei José Mariano da Conceição Vellozo

    Directory of Open Access Journals (Sweden)

    Michaele Alvim Milward-de-Azevedo

    2017-09-01

    Full Text Available ABSTRACT This work presents 19 lectotypifications and one epitype for the genus Passiflora (Passifloraceae sensu stricto described by Frei José Mariano da Conceição Vellozo in Flora Fluminensis. The original illustrations are designated as lectotypes. Passiflora obtusa is here proposed to be a synonym of P. porophylla.

  2. Typifications in Passiflora L. (Passifloraceae) described by Frei José Mariano da Conceição Vellozo

    OpenAIRE

    Milward-de-Azevedo, Michaele Alvim

    2017-01-01

    ABSTRACT This work presents 19 lectotypifications and one epitype for the genus Passiflora (Passifloraceae sensu stricto) described by Frei José Mariano da Conceição Vellozo in Flora Fluminensis. The original illustrations are designated as lectotypes. Passiflora obtusa is here proposed to be a synonym of P. porophylla.

  3. Uma nova espécie de Passiflora L. (Passifloraceae para o Brasil A new species of Passiflora L. (Passifloraceae from Brazil

    Directory of Open Access Journals (Sweden)

    Teonildes Sacramento Nunes

    2007-06-01

    Full Text Available Uma nova espécie de Passifloraceae é descrita e ilustrada, Passiflora mucugeana T.S. Nunes & L.P. Queiroz. Esta espécie é conhecida até o momento, na região da Chapada Diamantina, Bahia, em áreas próximas aos municípios de Mucugê, Ibicoara e Barra da Estiva, em áreas de florestas estacionais e campo rupestre (Complexo Espinhaço, chegando a uma altitude de 1.200 metros. Passiflora mucugeana é inserida no subg. Passiflora supersect. Stipulata Feuillet & MacDougal sect. Granadillastrum Triana & Planch., por apresentar caracteres morfológicos que a assemelham a P. imbeana Sacco.A new Brazilian species of Passifloraceae is described and illustrated: P. mucugeana T.S. Nunes & L.P. Queiroz. This species is from the Chapada Diamantina region, state of Bahia, near the towns of Mucugê, Ibicoara and Barra da Estiva, growing in semideciduous forests and "campo rupestre", at 1200 m altitude. The new species is classified in subg. Passiflora supersect. Stipulata Feuillet & MacDougal sect. Granadillastrum Triana & Planch., because it appears to be a close relative of P. imbeana Sacco.

  4. PSCAD Modules Representing PV Generator

    Energy Technology Data Exchange (ETDEWEB)

    Muljadi, E.; Singh, M.; Gevorgian, V.

    2013-08-01

    Photovoltaic power plants (PVPs) have been growing in size, and the installation time is very short. With the cost of photovoltaic (PV) panels dropping in recent years, it can be predicted that in the next 10 years the contribution of PVPs to the total number of renewable energy power plants will grow significantly. In this project, the National Renewable Energy Laboratory (NREL) developed a dynamic modeling of the modules to be used as building blocks to develop simulation models of single PV arrays, expanded to include Maximum Power Point Tracker (MPPT), expanded to include PV inverter, or expanded to cover an entire PVP. The focus of the investigation and complexity of the simulation determines the components that must be included in the simulation. The development of the PV inverter was covered in detail, including the control diagrams. Both the current-regulated voltage source inverter and the current-regulated current source inverter were developed in PSCAD. Various operations of the PV inverters were simulated under normal and abnormal conditions. Symmetrical and unsymmetrical faults were simulated, presented, and discussed. Both the three-phase analysis and the symmetrical component analysis were included to clarify the understanding of unsymmetrical faults. The dynamic model validation was based on the testing data provided by SCE. Testing was conducted at SCE with the focus on the grid interface behavior of the PV inverter under different faults and disturbances. The dynamic model validation covers both the symmetrical and unsymmetrical faults.

  5. PV module mounting method and mounting assembly

    Science.gov (United States)

    Lenox, Carl J.S.; Johnson, Kurt M.

    2013-04-23

    A method for mounting PV modules to a deck includes selecting PV module layout pattern so that adjacent PV module edges are spaced apart. PV mounting and support assemblies are secured to the deck according to the layout pattern using fasteners extending into the deck. The PV modules are placed on the PV mounting and support assemblies. Retaining elements are located over and secured against the upper peripheral edge surfaces of the PV modules so to secure them to the deck with the peripheral edges of the PV modules spaced apart from the deck. In some examples a PV module mounting assembly, for use on a shingled deck, comprises flashing, a base mountable on the flashing, a deck-penetrating fastener engageable with the base and securable to the deck so to secure the flashing and the base to the shingled deck, and PV module mounting hardware securable to the base.

  6. The arms race between heliconiine butterflies and Passiflora plants - new insights on an ancient subject.

    Science.gov (United States)

    de Castro, Érika C P; Zagrobelny, Mika; Cardoso, Márcio Z; Bak, Søren

    2018-02-01

    Heliconiines are called passion vine butterflies because they feed exclusively on Passiflora plants during the larval stage. Many features of Passiflora and heliconiines indicate that they have radiated and speciated in association with each other, and therefore this model system was one of the first examples used to exemplify coevolution theory. Three major adaptations of Passiflora plants supported arguments in favour of their coevolution with heliconiines: unusual variation of leaf shape within the genus; the occurrence of yellow structures mimicking heliconiine eggs; and their extensive diversity of defence compounds called cyanogenic glucosides. However, the protection systems of Passiflora plants go beyond these three features. Trichomes, mimicry of pathogen infection through variegation, and production of extrafloral nectar to attract ants and other predators of their herbivores, are morphological defences reported in this plant genus. Moreover, Passiflora plants are well protected chemically, not only by cyanogenic glucosides, but also by other compounds such as alkaloids, flavonoids, saponins, tannins and phenolics. Heliconiines can synthesize cyanogenic glucosides themselves, and their ability to handle these compounds was probably one of the most crucial adaptations that allowed the ancestor of these butterflies to feed on Passiflora plants. Indeed, it has been shown that Heliconius larvae can sequester cyanogenic glucosides and alkaloids from their host plants and utilize them for their own benefit. Recently, it was discovered that Heliconius adults have highly accurate visual and chemosensory systems, and the expansion of brain structures that can process such information allows them to memorize shapes and display elaborate pre-oviposition behaviour in order to defeat visual barriers evolved by Passiflora species. Even though the heliconiine-Passiflora model system has been intensively studied, the forces driving host-plant preference in these

  7. Modulation of the γ-aminobutyric acid (GABA) system by Passiflora incarnata L.

    Science.gov (United States)

    Appel, Kurt; Rose, Thorsten; Fiebich, Bernd; Kammler, Thomas; Hoffmann, Christine; Weiss, Gabriele

    2011-06-01

    Passiflora incarnata L. (Passifloraceae) is important in herbal medicine for treating anxiety or nervousness, Generalized Anxiety Disorder (GAD), symptoms of opiate withdrawal, insomnia, neuralgia, convulsion, spasmodic asthma, ADHD, palpitations, cardiac rhythm abnormalities, hypertension, sexual dysfunction and menopause. However, the mechanism of action is still under discussion. Despite gaps in our understanding of neurophysiological processes, it is increasingly being recognized that dysfunction of the GABA system is implicated in many neuropsychiatric conditions, including anxiety and depressive disorders. Therefore, the in vitro effects of a dry extract of Passiflora incarnata (sole active ingredient in Pascoflair® 425 mg) on the GABA system were investigated. The extract inhibited [(3) H]-GABA uptake into rat cortical synaptosomes but had no effect on GABA release and GABA transaminase activity. Passiflora incarnata inhibited concentration dependently the binding of [(3) H]- SR95531 to GABA(A) -receptors and of [(3) H]-CGP 54626 to GABA(B) -receptors. Using the [(35) S]-GTPγS binding assay Passiflora could be classified as an antagonist of the GABA(B) receptor. In contrast, the ethanol- and the benzodiazepine-site of the GABA(A) -receptor were not affected by this extract. In conclusion, the first evidence was shown that numerous pharmacological effects of Passiflora incarnata are mediated via modulation of the GABA system including affinity to GABA(A) and GABA(B) receptors, and effects on GABA uptake. Copyright © 2010 John Wiley & Sons, Ltd.

  8. Comparative study of Passiflora taxa leaves: I. A morpho-anatomic profile

    Directory of Open Access Journals (Sweden)

    Luma Wosch

    Full Text Available AbstractDetermining the authenticity and quality of plant raw materials used in the formulation of herbal medicines, teas and cosmetics is essential to ensure their safety and efficacy for clinical use. Some Passiflora species are officially recognized in the pharmaceutical compendia of various countries and have therapeutic uses, particularly as sedatives and anxiolytics. However, the large number of Passiflora species, coupled with the fact that most species are popularly known as passion fruit, increases the misidentification problem. The purpose of this study is to make a pharmacognostic comparison between various Passiflora species to establish a morpho-anatomical profile that could contribute to the quality control of herbal drug products that contain passion fruit. This was conducted by collecting samples of leaves from twelve Passiflora taxa (ten species and two forms of P. edulis: P. actinia, P. alata, P. amethystina, P. capsularis, P. cincinnata, P. edulisf. flavicarpa, P. edulis f. edulis, P. incarnata, P. morifolia, P. urnifolia, P. coccinea and P. setacea, from different locations and their morpho-anatomical features were analyzed using optical microscopy and scanning electron microscopy. Microscopic analysis allowed to indicate a set of characters that can help to differentiate species. These include midrib and petiole shape, midrib and petiole vascular pattern, medium vein shape, presence of trichomes, presence of blade epidermal papillae and sclerenchymatic cells adjoining the vascular bundles. These characters could be used to assist in the determination of herbal drug quality and authenticity derived from a species of Passiflora.

  9. Effect of a medicinal plant (Passiflora incarnataL) on sleep.

    Science.gov (United States)

    Guerrero, Fructuoso Ayala; Medina, Graciela Mexicano

    2017-01-01

    Extracts of the plant Passiflora incarnata L. (Passifloraceae) were administered intraperitoneally in order to test its effects on sleep. Experiments were carried out on chronically implanted male adult wistar rats to obtain cerebral (EEG), ocular (EOG) and muscular (EMG) activities throughout their states of vigilance. Polygraphic recordings were taken during 9 continuous hours before and after the extract administration (500 mg/kg). Passiflora incarnata induced a significant increment in the total sleep time ( p <0.05). This increment was due to an increase in the time spent by animals in slow wave sleep (SWS). Concomitantly, a significant decrement in wakefulness (W) was observed ( p <0.05). In contrast, time spent in rapid eye movement (REM) sleep showed a decreasing tendency, since both its frequency and mean duration were reduced. The extracts obtained from Passiflora incarnata can be considered as appropriated sleep inducers.

  10. New microsatellite markers for wild and commercial species of Passiflora (Passifloraceae) and cross-amplification1

    Science.gov (United States)

    Cerqueira-Silva, Carlos B. M.; Santos, Elisa S. L.; Vieira, João G. P.; Mori, Gustavo M.; Jesus, Onildo N.; Corrêa, Ronan X.; Souza, Anete P.

    2014-01-01

    • Premise of the study: We developed the first microsatellites for Passiflora setacea and characterized new sets of markers for P. edulis and P. cincinnata, enabling further genetic diversity studies to support the conservation and breeding of passion fruit species. • Methods and Results: We developed 69 microsatellite markers and, in conjunction with assessments of cross-amplification using primers available from the literature, present 43 new polymorphic microsatellite loci for three species of Passiflora. The mean number of alleles per locus was 3.1, and the mean values of the expected and observed levels of heterozygosity were 0.406 and 0.322, respectively. • Conclusions: These microsatellite markers will be valuable tools for investigating the genetic diversity and population structure of wild and commercial species of passion fruit (Passiflora spp.) and may be useful for developing conservation and improvement strategies by contributing to the understanding of the mating system and hybridization within the genus. PMID:25202599

  11. New microsatellite markers for wild and commercial species of Passiflora (Passifloraceae) and cross-amplification.

    Science.gov (United States)

    Cerqueira-Silva, Carlos B M; Santos, Elisa S L; Vieira, João G P; Mori, Gustavo M; Jesus, Onildo N; Corrêa, Ronan X; Souza, Anete P

    2014-02-01

    We developed the first microsatellites for Passiflora setacea and characterized new sets of markers for P. edulis and P. cincinnata, enabling further genetic diversity studies to support the conservation and breeding of passion fruit species. • We developed 69 microsatellite markers and, in conjunction with assessments of cross-amplification using primers available from the literature, present 43 new polymorphic microsatellite loci for three species of Passiflora. The mean number of alleles per locus was 3.1, and the mean values of the expected and observed levels of heterozygosity were 0.406 and 0.322, respectively. • These microsatellite markers will be valuable tools for investigating the genetic diversity and population structure of wild and commercial species of passion fruit (Passiflora spp.) and may be useful for developing conservation and improvement strategies by contributing to the understanding of the mating system and hybridization within the genus.

  12. New Microsatellite Markers for Wild and Commercial Species of Passiflora (Passifloraceae and Cross-Amplification

    Directory of Open Access Journals (Sweden)

    Carlos B. M. Cerqueira-Silva

    2014-02-01

    Full Text Available Premise of the study: We developed the first microsatellites for Passiflora setacea and characterized new sets of markers for P. edulis and P. cincinnata, enabling further genetic diversity studies to support the conservation and breeding of passion fruit species. Methods and Results: We developed 69 microsatellite markers and, in conjunction with assessments of cross-amplification using primers available from the literature, present 43 new polymorphic microsatellite loci for three species of Passiflora. The mean number of alleles per locus was 3.1, and the mean values of the expected and observed levels of heterozygosity were 0.406 and 0.322, respectively. Conclusions: These microsatellite markers will be valuable tools for investigating the genetic diversity and population structure of wild and commercial species of passion fruit (Passiflora spp. and may be useful for developing conservation and improvement strategies by contributing to the understanding of the mating system and hybridization within the genus.

  13. Hypnotic activities of chamomile and passiflora extracts in sleep-disturbed rats.

    Science.gov (United States)

    Shinomiya, Kazuaki; Inoue, Toshio; Utsu, Yoshiaki; Tokunaga, Shin; Masuoka, Takayoshi; Ohmori, Asae; Kamei, Chiaki

    2005-05-01

    In the present study, we investigated hypnotic activities of chamomile and passiflora extracts using sleep-disturbed model rats. A significant decrease in sleep latency was observed with chamomile extract at a dose of 300 mg/kg, while passiflora extract showed no effects on sleep latency even at a dose of 3000 mg/kg. No significant effects were observed with both herbal extracts on total times of wakefulness, non-rapid eye movement (non-REM) sleep and REM sleep. Flumazenil, a benzodiazepine receptor antagonist, at a dose of 3 mg/kg showed a significant antagonistic effect on the shortening in sleep latency induced by chamomile extract. No significant effects were observed with chamomile and passiflora extracts on delta activity during non-REM sleep. In conclusion, chamomile extract is a herb having benzodiazepine-like hypnotic activity.

  14. Evaluation of anxiolytic activity of spray dried powders of two South Brazilian Passiflora species.

    Science.gov (United States)

    Reginatto, Flávio H; De-Paris, Fernanda; Petry, Raquel D; Quevedo, João; Ortega, George González; Gosmann, Grace; Schenkel, Eloir P

    2006-05-01

    The Passiflora extracts have been used in folk medicine because of its reputed sedative and anxiolytic properties. The present study aimed to compare the potential anxiolytic activity of two Passiflora spray-dried powders obtained from P. alata and P. edulis, known in Brazil as 'maracujá'. Male adult Swiss rats were treated with 200, 400 and 800 mg/kg of spray-dried powders p.o. and anxiolytic activity was evaluated using the elevated plus-maze test. The spray-dried powders showed anxiolytic activity in doses of 400 and 800 mg/kg. Our results support the potential anxiolytic effect of Passiflora spray-dried powders (P. alata and P. edulis). Copyright 2006 John Wiley & Sons, Ltd.

  15. The arms race between heliconiine butterflies and Passiflora plants - new insights on an ancient subject

    DEFF Research Database (Denmark)

    Pinheiro de Castro, Érika Cristina; Zagrobelny, Mika; Cardoso, Márcio Z.

    2018-01-01

    of the first examples used to exemplify coevolution theory. Three major adaptations of Passiflora plants supported arguments in favour of their coevolution with heliconiines: unusual variation of leaf shape within the genus; the occurrence of yellow structures mimicking heliconiine eggs; and their extensive...... diversity of defence compounds called cyanogenic glucosides. However, the protection systems of Passiflora plants go beyond these three features. Trichomes, mimicry of pathogen infection through variegation, and production of extrafloral nectar to attract ants and other predators of their herbivores......, are morphological defences reported in this plant genus. Moreover, Passiflora plants are well protected chemically, not only by cyanogenic glucosides, but also by other compounds such as alkaloids, flavonoids, saponins, tannins and phenolics. Heliconiines can synthesize cyanogenic glucosides themselves...

  16. Search for alkaloids on callus culture of Passiflora alata

    Directory of Open Access Journals (Sweden)

    Michelli Wesz Machado

    2010-08-01

    Full Text Available Preliminary work on Passiflora alata leaves failed to detect harmane alkaloids using LC. The aim of this work was to investigate the production of harmane alkaloids through the cell culture of P. alata, inducing its precursor (L-tryptophan. The leaf explants presented satisfactory results after disinfection, and the callus formation was initiated in MS media with adequate quantities of phytohormones. Sixty days after inoculation, calli were inoculated in the optimized semi-solid MS media, with and without the addition of L-tryptophan (50, 100, 200 mg/L and kept in standard conditions for 90 days. Calli were collected on days 6, 16, 26, 36, and 90, followed by acid-base extraction, and analysed by LC. The results showed an absence of harmane, harmin, harmol, harmalol, and harmaline. With L-tryptophan feeding, two peaks were detected, collected and analysed through positive mode electrospray [ESI(+-MS] and sequential analysis in tandem ESI(+-MS/MS. The spectra obtained were very similar, with a repetition of the more intense ions, and consecutive loss of 68 Da units, attributed to the heterocycle pyrazole. It appeared that this transformation was not related to any enzymatic pathway previously described for the plant from L-tryptophan, and the biosynthesis of β-carboline alkaloids in callus culture of P. alata were not observed in this work.As folhas de varias espécies de Passiflora são utilizadas como ansioliticas e sedativas. Passiflora alata Curtis, Passifloraceae consta em três edições da farmacopéia brasileira, porem não há muitos estudos sobre sua composição química. No passado, enfatizava-se a ação conjunta de alcalóides e flavonóides. Em trabalho anterior, não foi detectada a presença de alcalóides harmanicos através de CLAE. Assim, decidiu-se investigar a produção dos mesmos através de cultivo celular, introduzindo seu precursor metabólico L-triptofano. Os explantes foliares apresentaram resultados satisfatorios

  17. PV solar system feasibility study

    International Nuclear Information System (INIS)

    Ashhab, Moh’d Sami S.; Kaylani, Hazem; Abdallah, Abdallah

    2013-01-01

    Highlights: ► This research studies the feasibility of PV solar systems. ► The aim is to develop the theory and application of a hybrid system. ► Relevant research topics are reviewed and some of them are discussed in details. ► A prototype of the PV solar system is designed and built. - Abstract: This research studies the feasibility of PV solar systems and aims at developing the theory and application of a hybrid system that utilizes PV solar system and another supporting source of energy to provide affordable heating and air conditioning. Relevant research topics are reviewed and some of them are discussed in details. Solar heating and air conditioning research and technology exist in many developed countries. To date, the used solar energy has been proved to be inefficient. Solar energy is an abundant source of energy in Jordan and the Middle East; with increasing prices of oil this source is becoming more attractive alternative. A good candidate for the other system is absorption. The overall system is designed such that it utilizes solar energy as a main source. When the solar energy becomes insufficient, electricity or diesel source kicks in. A prototype of the PV solar system that operates an air conditioning unit is built and proper measurements are collected through a data logging system. The measured data are plotted and discussed, and conclusions regarding the system performance are extracted.

  18. Low concentrator PV optics optimization

    Science.gov (United States)

    Sharp, Leonard; Chang, Ben

    2008-08-01

    Purpose: Cost reduction is a major focus of the solar industry. Thin film technologies and concentration systems are viable ways to reducing cost, with unique strengths and weakness for both. Most of the concentrating PV work focuses on high concentration systems for reducing energy cost. Meanwhile, many believe that low concentrators provide significant cost reduction potential while addressing the mainstream PV market with a product that acts as a flat panel replacement. This paper analyzes the relative benefit of asymmetric vs. symmetric optics for low-concentrators in light of specific PV applications. Approach: Symmetric and asymmetric concentrating PV module performance is evaluated using computer simulation to determine potential value across various geographic locations and applications. The selected optic design is modeled against standard cSi flat panels and thin film to determine application fit, system level energy density and economic value. Results: While symmetric designs may seem ideal, asymmetric designs have an advantage in energy density. Both designs are assessed for aperture, optimum concentration ratio, and ideal system array configuration. Analysis of performance across climate specific effects (diffuse, direct and circumsolar) and location specific effects (sunpath) are also presented. The energy density and energy production of low concentrators provide a compelling value proposition. More significantly, the choice of optics for a low concentrating design can affect real world performance. With the goal of maximizing energy density and return on investment, this paper presents the advantages of asymmetric optic concentration and illustrates the value of this design within specific PV applications.

  19. Lectotypes for species of Passiflora L. (Passifloraceae described by João Barbosa Rodrigues

    Directory of Open Access Journals (Sweden)

    Ana Carolina Mezzonato-Pires

    Full Text Available ABSTRACT During taxonomic review of the Brazilian species of the Passiflora subgenus Astrophea and P. subg Decaloba, six names published by the Brazilian botanist João Barbosa Rodrigues were found in need of discussion: Passiflora alliacea, P. amalocarpa, P. cabedelensis, P. hexagonocarpa, P. hydrophila and Tacsonia coccinea. The original illustrations are here designated as lectotypes for P. alliacea, P. amalocarpa, P. cabedelensis (a synonym of P. amalocarpa, P. hexagonocarpa, P. hydrophila (a synonym of P. costata and Tacsonia coccinea (a synonym of P. spinosa.

  20. Genetic diversity in wild species of passion fruit (Passiflora trintae) based on molecular markers.

    Science.gov (United States)

    Cerqueira-Silva, C B M; Cardoso-Silva, C B; Santos, E S L; Conceição, L D H C S; Pereira, A S; Oliveira, A C; Corrêa, R X

    2010-10-26

    In spite of the importance of and the considerable variability observed in Passiflora (Passifloraceae), little is known about the genetic diversity of most of the species of this genus. We evaluated the genetic diversity by RAPD markers in 18 genotypes of Passiflora trintae. The 15 primers generated 112 markers, 84% of which were polymorphic. The genetic distance estimated by the complement of the Dice index (average dissimilarity = 0.30) and genotype grouping based on the UPGMA algorithm showed low variability among genotypes. More attention should be given to the study and conservation of the biodiversity of this economically important genus.

  1. Microsatellite marker development by partial sequencing of the sour passion fruit genome (Passiflora edulis Sims).

    Science.gov (United States)

    Araya, Susan; Martins, Alexandre M; Junqueira, Nilton T V; Costa, Ana Maria; Faleiro, Fábio G; Ferreira, Márcio E

    2017-07-21

    The Passiflora genus comprises hundreds of wild and cultivated species of passion fruit used for food, industrial, ornamental and medicinal purposes. Efforts to develop genomic tools for genetic analysis of P. edulis, the most important commercial Passiflora species, are still incipient. In spite of many recognized applications of microsatellite markers in genetics and breeding, their availability for passion fruit research remains restricted. Microsatellite markers in P. edulis are usually limited in number, show reduced polymorphism, and are mostly based on compound or imperfect repeats. Furthermore, they are confined to only a few Passiflora species. We describe the use of NGS technology to partially assemble the P. edulis genome in order to develop hundreds of new microsatellite markers. A total of 14.11 Gbp of Illumina paired-end sequence reads were analyzed to detect simple sequence repeat sites in the sour passion fruit genome. A sample of 1300 contigs containing perfect repeat microsatellite sequences was selected for PCR primer development. Panels of di- and tri-nucleotide repeat markers were then tested in P. edulis germplasm accessions for validation. DNA polymorphism was detected in 74% of the markers (PIC = 0.16 to 0.77; number of alleles/locus = 2 to 7). A core panel of highly polymorphic markers (PIC = 0.46 to 0.77) was used to cross-amplify PCR products in 79 species of Passiflora (including P. edulis), belonging to four subgenera (Astrophea, Decaloba, Distephana and Passiflora). Approximately 71% of the marker/species combinations resulted in positive amplicons in all species tested. DNA polymorphism was detected in germplasm accessions of six closely related Passiflora species (P. edulis, P. alata, P. maliformis, P. nitida, P. quadrangularis and P. setacea) and the data used for accession discrimination and species assignment. A database of P. edulis DNA sequences obtained by NGS technology was examined to identify microsatellite repeats in

  2. Flexible packaging for PV modules

    Science.gov (United States)

    Dhere, Neelkanth G.

    2008-08-01

    Economic, flexible packages that provide needed level of protection to organic and some other PV cells over >25-years have not yet been developed. However, flexible packaging is essential in niche large-scale applications. Typical configuration used in flexible photovoltaic (PV) module packaging is transparent frontsheet/encapsulant/PV cells/flexible substrate. Besides flexibility of various components, the solder bonds should also be flexible and resistant to fatigue due to cyclic loading. Flexible front sheets should provide optical transparency, mechanical protection, scratch resistance, dielectric isolation, water resistance, UV stability and adhesion to encapsulant. Examples are Tefzel, Tedlar and Silicone. Dirt can get embedded in soft layers such as silicone and obscure light. Water vapor transmittance rate (WVTR) of polymer films used in the food packaging industry as moisture barriers are ~0.05 g/(m2.day) under ambient conditions. In comparison, light emitting diodes employ packaging components that have WVTR of ~10-6 g/(m2.day). WVTR of polymer sheets can be improved by coating them with dense inorganic/organic multilayers. Ethylene vinyl acetate, an amorphous copolymer used predominantly by the PV industry has very high O2 and H2O diffusivity. Quaternary carbon chains (such as acetate) in a polymer lead to cleavage and loss of adhesional strength at relatively low exposures. Reactivity of PV module components increases in presence of O2 and H2O. Adhesional strength degrades due to the breakdown of structure of polymer by reactive, free radicals formed by high-energy radiation. Free radical formation in polymers is reduced when the aromatic rings are attached at regular intervals. This paper will review flexible packaging for PV modules.

  3. Analysis of C-glycosyl flavonoids from South American Passiflora species by HPLC-DAD and HPLC-MS.

    Science.gov (United States)

    Zucolotto, Silvana Maria; Fagundes, Carize; Reginatto, Flávio Henrique; Ramos, Freddy A; Castellanos, Leonardo; Duque, Carmenza; Schenkel, Eloir Paulo

    2012-01-01

    Leaves and fruits of Passiflora species are widely used around the world in popular medicine, mainly as sedatives and tranquilisers. C-glycosyl flavonoids are the main components of these species. To investigate the constituent patterns and to develop a chromatographic method for the characterisation of the C-glycosyl flavonoids profile of the extracts of the leaves and the pericarp of South American Passiflora species. The chemical composition of extracts from the leaves and the fruits' pericarp of Passiflora edulis var. flavicarpa, P. edulis var. edulis, Passiflora alata, Passiflora tripartita var. mollissima, Passiflora quadrangularis, Passiflora manicata and Passiflora ligularis was evaluated for the presence of C-glycosyl flavonoids. Two separate HPLC methods were developed suitable for a diode array detector (DAD) and a MS detector. Separation by HPLC-DAD was achieved on a Luna C-18 column, using solvent A (tetrahydrofuran-isopropanol-acetonitrile) and solvent B (H₃PO₄ 0.5%) in an isocratic elution mode. In the HPLC-MS, the components were separated on a Luna RP-18A column by a gradient elution (water-acetonitrile-formic acid). The presence of C-glycosyl flavonoids was identified in leaves and pericarp of P. edulis var. flavicarpa, P. alata, P. edulis var. edulis and P. tripartita var. molissima, but only in leaf extracts of P. quadrangularis and P. manicata and not at all in P. ligularis. The different species and varieties showed different major constituents. The C-glycosyl flavonoids identified more frequently were orientin, isoorientin, vitexin and isovitexin. The methods established are simple and can be used as a tool for the characterisation and quality control of pharmaceutical preparations containing these Passiflora extracts. Copyright © 2011 John Wiley & Sons, Ltd.

  4. Solar PV. Innovators talking; Zon PV. Innovators aan het woord

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-02-15

    Qualitative studies have been conducted of the results of completed projects focused on energy innovation, spread over the seven themes of the top sector Energy: Energy saving in industry, Energy conservation in the built environment, Gas, Bio-energy, Smart grids, Offshore Wind, Solar PV. This provides insight into the follow-up activities and lessons of some EOS (Energy Research Subsidy) completed projects with the aim to inspire, connect and strengthen the TKIs (Topconsortia for Knowledge and Innovation) and individual companies and researchers working on energy innovation. This report concerns the research on solar PV [Dutch] Er is een kwalitatief onderzoek uitgevoerd naar de resultaten van afgeronde projecten gericht op energie-innovatie, verdeeld over de zeven thema's van de topsector Energie: Energiebesparing in de industrie; Energiebesparing in de gebouwde omgeving; Gas; Bio-energie; Smart grids; Wind op zee; Zon-pv. Daarmee wordt inzicht gegeven in de vervolgactiviteiten en lessen van een aantal afgesloten EOS-projecten (Energie Onderzoek Subsidie) met het oog op het inspireren, verbinden en versterken van de TKI's (Topconsortia voor Kennis en Innovatie) en individuele bedrijven en onderzoekers die werken aan energie-innovatie. Dit rapport betreft het onderzoek naar zon PV.

  5. Cyanogenic allosides and glucosides from Passiflora edulis and Carica papaya.

    Science.gov (United States)

    Seigler, David S; Pauli, Guido F; Nahrstedt, Adolf; Leen, Rosemary

    2002-08-01

    Leaf and stem material of Passiflora edulis (Passifloraceae) contains the new cyanogenic glycosides (2R)-beta-D-allopyranosyloxy-2-phenylacetonitrile (1a) and (2S)-beta-D-allopyranosyloxy-2-phenylacetonitrile (1b), along with smaller amounts of (2R)-prunasin (2a), sambunigrin (2b), and the alloside of benzyl alcohol (4); the major cyanogens of the fruits are (2R)-prunasin (2a) and (2S)-sambunigrin (2b). The major cyanogenic glycoside of Carica papaya (Caricaceae) is 2a; only small amounts of 2b also are present. We were not able to confirm the presence of a cyclopentenoid cyanogenic glycoside, tetraphyllin B, in Carica papaya leaf and stem materials. In detailed 1H NMR studies of 1a/b and 2a/b, differences in higher order effects in glucosides and allosides proved to be valuable for assignment of structures in this series. The diagnostic chemical shifts of cyanogenic methine and anomeric protons in 1a/b are sensitive to anisotropic environmental effects. The assignment of C-2 stereochemistry of 1a/b was made in analogy to previous assignments in the glucoside series and was supported by GLC analysis of the TMS ethers.

  6. Pharmacognosy and chemotypes of passionflower (Passiflora incarnata L.).

    Science.gov (United States)

    Wohlmuth, Hans; Penman, Kerry George; Pearson, Tanya; Lehmann, Reginald Paul

    2010-01-01

    Passionflower (Passiflora incarnata L.) is used in phytotherapy as a mild sedative and anxiolytic agent. In the literature it is clear this plant shows considerable qualitative and quantitative variability with respect to its content of C-glycosyl flavones, some of which are used as marker compounds for extracts. Analysis of plant material cultivated in Australia revealed two chemically distinct groups; hence an investigation was carried out to determine whether distinct intraspecific chemotypes exist in this species. Eleven P. incarnata samples were analysed by HPLC, LC-MS and two different TLC methods. The samples fell into two distinct groups with respect to their C-glycosyl flavone profile, with little within-group variation. One chemotype was dominated by isovitexin and schaftoside/isoschaftoside, as is most widely reported in the literature for this species. The other chemotype was characterized by a high level of swertisin, with low levels of schaftoside/isoschaftoside. The two chemotypes are readily identified by both HPLC and TLC. Although the compounds responsible for the therapeutic activity of P. incarnata are yet to be identified, phytomedicines should be made with the accepted isovitexin chemotype until the pharmacological implications of chemotypical differences are understood.

  7. Biological activities of extracts from cultivated Granadilla Passiflora alata.

    Science.gov (United States)

    Vasic, Sava M; Stefanovic, Olgica D; Licina, Braho Z; Radojevic, Ivana D; Comic, Ljiljana R

    2012-01-01

    Research conducted in this study showed the influence of ethanol, acetone and ethyl acetate extracts of the outgrowth of cultivated Passiflora alata on microorganisms, as well as the antioxidant activity and the concentrations of total phenols, flavonoids and tannins. In vitro antimicrobial activities of extracts were studied on 27 species of microorganisms, of which 17 species of bacteria and 10 species of fungi. The strongest antimicrobial activity was detected on G+ bacteria while the activities on other species were moderate. Ethyl acetate extract showed the strongest effect. The concentrations of total phenols were examined by using Folin-Ciocalteu reagent and the obtained values ranged from 14.04 to 34.22 mg GA/g. By using aluminium chloride method, the concentrations of flavonoids were obtained and the values ranged from 33.19 to 62.30 mg RU/g. In determining the amount of tannins we used the method with buthanol-HCl reagent and the obtained value was 5.1 % of dry matter. The efficiency of antioxidation, which we identified through the reduction of DPPH, was in the range from 808.69 to 1107.79 µg/ml for a particular IC50, and AAI values were between 0.07 and 0.10. The best parameters were shown by ethanol extract. All data were statistically analyzed. Overall, extracts showed potential for further investigation and use.

  8. Dissolution test of herbal medicines containing Passiflora sp.

    Directory of Open Access Journals (Sweden)

    Ane R. T. Costa

    2011-05-01

    Full Text Available The dissolution test is an essential tool to assess the quality of herbal medicines in the solid dosage form for oral use. This work aimed to evaluate the dissolution behavior of three herbal medicines in the form of capsules and tablet containing Passiflora, produced with powder or dried extract. Assay of total flavonoids and dissolution methods were validated and obtained results allowed the quantification of flavonoids with precision, accuracy and selectivity. The percentage of total flavonoids found was 2% for capsule A (containing only powder, 0.97% for capsule B (containing only dried extract and 5.5% for tablet. Although the content was lower, the release of flavonoids present in the capsule containing dried extract was 12% higher over 30 min, with dissolved percentage values of 87 and 75, for the capsules containing extract and powder, respectively. The tablet containing dried extract presented dissolution of 76%, despite the higher content of flavonoids, which may be due to pharmacotechnical problems. Obtained data demonstrated the need to implement these tests in the quality control of herbal medicines, confirming the release of the active ingredients that underlie the pharmacological action of these medicines.

  9. Estudos anatômicos e ultraestruturais de sistemas de regeneração in vitro de Passiflora cincinnata Masters e Passiflora edulis Sims (Passifloraceae)

    OpenAIRE

    Rocha, Diego Ismael

    2011-01-01

    O presente estudo teve como objetivo descrever, através de análises anatômicas e ultraestruturais, o processo de regeneração in vitro de Passiflora cincinnata Masters, via embriogênese somática, a partir de embriões zigóticos e de Passiflora edulis Sims, via organogênese, a partir de explantes radiculares. Embriões zigóticos maduros de P. cincinnata foram colocados em meio de indução MS suplementado com 18,1 μM de 2,4-D e 4,4 μM de BAP. Embriões somáticos originaram-se a partir de z...

  10. Progress & Frontiers in PV Performance

    Energy Technology Data Exchange (ETDEWEB)

    Deline, Chris; DiOrio, Nick; Jordan, Dirk; Toor, Fatima

    2016-09-12

    PowerPoint slides for a presentation given at Solar Power International 2016. Presentation includes System Advisor Model (SAM) introduction and battery modeling, bifacial PV modules and modeling, shade modeling and module level power electronics (MLPE), degradation rates, and PVWatts updates and validation.

  11. PV supply chain growing pains

    International Nuclear Information System (INIS)

    Wilkins, A.

    2010-01-01

    This article discussed issues involving the supply chain for photovoltaic (PV) equipment that is emerging in Ontario as a result of the Feed-in-Tariff (FIT) program that was launched in late 2009. The rapidly developing PV supply chain may not be taking a sustainable path. The domestic-content requirement is making manufacturers outlay capital to set up manufacturing in Ontario without reliable market data. Only a small number of dealer/installers have any meaningful experience designing and installing grid-tie PV. Until recently, wholesale distributors designed and supplied most grid-tie PV systems in Canada, and solar dealers/installers or electricians or electrical contractors did the installation. Instead of selling directly to dealer/installers, solar manufacturers should develop strong relationships with wholesalers, who have system design experience and product training. This would allow manufacturers to focus on their core strength, reach more customers, and keep lower inventory levels. Wholesale distributors in turn provide dealer/installers with expertise in product and system design, training from a range of manufacturers, marketing and logistics support, and immediate access to inventory. Manufacturers generally lack appropriate accounting, engineering, marketing, and logistics services to deal with a multitude of active accounts, and they are not structured to work with architects and engineers to do complete system design. Partnering with wholesale distributors allows manufacturers to take on the residential and small-scale commercial sectors by building brand awareness and increasing market share and sales across Canada. 2 figs.

  12. Irradiation effects on the active substances of Passiflora spp; Efeito da irradiacao nos principios ativos de Passiflora spp

    Energy Technology Data Exchange (ETDEWEB)

    Koseki, Paula M.; Rela, Paulo Rela; Villavicencio, Anna Lucia C. H. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Centro de Tecnologia das Radiacoes. Lab. de Analise e Deteccao de Alimentos]. E-mail: villavic@net.ipen.br; Freitas, Paulo C. D.; Bacchi, Elfriede M. [Sao Paulo Univ., SP (Brazil). Faculdade de Ciencias Farmaceuticas]. E-mail: lenach@usp.br

    2000-07-01

    Plants are used as medicines and foods since the old times, acting and influencing significantly in the men/vegetal relation. Nowadays it is increasing the interest for phytotherapic pharmaceuticals and natural active principles, as alkalis, flavonoids, essential oils, tanning barks and others. The concern with the microbe contamination of the vegetable raw material is object of studies as well as the development of appropriate techniques for the reduction of these microorganisms. Thus being, the irradiation process is recognized as safe for an enormous variety of products and applications. It is effective in the reduction of the growth of pathogenic organisms and in the increase of the useful life of the nourishing products, for example. With intention to observe the possible modifications in the chemical constituent of vegetal dyes of maracock (Passiflora edulis and P. alata) caused by the gamma radiation in the doses of 0, 5, 10, 15, 20, 25 and 30 kGy. After the extraction of the dust of the vegetal drug for the percolating process, the dye was submitted to the irradiation at a Gamma Cell source of {sup 60}Co and using its technique of chromatography in thin layer and the reading of the absorption in specter UV was possible to observe that they had not substantial alterations in the chromatographic profiles and specters UV of the solutions submitted to the different doses.

  13. City and County Solar PV Training Program, Module 2: Screening and Identifying PV Projects

    Energy Technology Data Exchange (ETDEWEB)

    Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-04-09

    When screening and identifying PV projects, cities and counties should understand the different factors that impact the technical and economic potential of a PV project, the steps of the PV screening process, and how to use REopt Lite to screen a site for PV and storage project potential.

  14. In vitro culture from mature seeds of Passiflora species Regeneração e cultura in vitro de espécies de Passiflora

    Directory of Open Access Journals (Sweden)

    Flavia Guzzo

    2004-02-01

    Full Text Available The genus Passiflora comprises hundred species, mainly native of the South American tropics and rainforests, which are grouped into 21 subgenera. Some species are widely studied for their economic importance and are chiefly cultivated for production of fruit juice. To obtain a continuous source of material for a screening of secondary metabolites, zygotic embryo culture was attempted for 62 Passiflora species, starting from seeds mainly collected in the wild. Twenty nine of these species produced calli, which had very different growth rates. Plants were successfully regenerated from calli of 13 different species. For 25 of the responsive species this is the first report of in vitro culture.O gênero Passiflora compõe centenas de espécies, a maioria de origem dos trópicos e das florestas da América do Sul, as quais são agrupadas em 21 subgêneros. Algumas espécies foram intensamente estudadas por sua importância econômica e são cultivadas principalmente para a produção de suco de fruta. Cultura de 29 espécies de Passiflora foram obtidos a partir de embriões zigóticos e de culturas de endosperma. Foram obtidos diferentes tipos de calos de crescimento, de tal forma que plantas foram regeneradas a partir de calos de 13 espécies diferentes. Não haviam sido ainda relatadas culturas in vitro para 25 das espécies trabalhadas.

  15. A Survey of Passiflora foetida L. and Associated Weed Species on ...

    African Journals Online (AJOL)

    A survey was conducted in the research field of the Institute of Agricultural Research and Training, Obafemi Awolowo University Ile-Ife, Ballah sub-station in southern Guinea savanna of Nigeria during 2010 to 2011 cropping season with an objective to determine the relative abundance of Passiflora foetida L. and predict the ...

  16. A HPTLC densitometric determination of flavonoids from Passiflora alata, P. edulis, P. incarnata and P. caerulea and comparison with HPLC method.

    Science.gov (United States)

    Pereira, Cintia A M; Yariwake, Janete H; Lanças, Fernando M; Wauters, Jean-Noël; Tits, Monique; Angenot, Luc

    2004-01-01

    A high-performance thin layer chromatographic (HPTLC) method was developed in order to determine quantitatively the flavonoids in leaves of Passiflora alata, P. edulis, P. caerulea and P. incarnata. The content of orientin and isoorientin was determined, and the results were compared with those obtained using a quantitative HPLC-UV method. The latter employed rutin as standard and was developed to analyse flavonoid content from Passiflora leaves for the purpose of ensuring the quality of Passiflora phytomedicines. The results obtained using the two methods indicate that there are qualitative and quantitative differences in the flavonoids of the reference Passiflora species studied. The two methods were also employed to analyse commercial samples to illustrate their application in qualitative ('fingerprint') and quantitative determination, demonstrating their feasibility in the quality control of flavonoids from crude Passiflora drugs and phytomedicines. The HPLC conditions used are also suitable for the quantitative analysis of aqueous extracts (Passiflora infusions).

  17. Grid Integrated Distributed PV (GridPV) Version 2.

    Energy Technology Data Exchange (ETDEWEB)

    Reno, Matthew J.; Coogan, Kyle

    2014-12-01

    This manual provides the documentation of the MATLAB toolbox of functions for using OpenDSS to simulate the impact of solar energy on the distribution system. The majority of the functio ns are useful for interfacing OpenDSS and MATLAB, and they are of generic use for commanding OpenDSS from MATLAB and retrieving information from simulations. A set of functions is also included for modeling PV plant output and setting up the PV plant in th e OpenDSS simulation. The toolbox contains functions for modeling the OpenDSS distribution feeder on satellite images with GPS coordinates. Finally, example simulations functions are included to show potential uses of the toolbox functions. Each function i n the toolbox is documented with the function use syntax, full description, function input list, function output list, example use, and example output.

  18. Biología floral de Passiflora foetida (Passifloraceae

    Directory of Open Access Journals (Sweden)

    María T. Amela García

    1998-06-01

    Full Text Available Un experimento reproductivo muestra que Passiflora foetida es autocompatible. Observaciones de las características florales y de los visitantes durante la antesis, más el análisis del polen transportado, permitieron identificar el síndrome floral (melitofilia y las funciones de cada visitante. La antesis ocurre desde las 6 hasta las 11 hs. Se identificaron 3 fases florales: 1 estigmas por encima de las anteras, 2 estigmas a la altura de las anteras, 3 estigmas por encima de las anteras; los radii, los pétalos y los sépalos se incurvan. Los estigmas están receptivos durante toda la antesis. La concentración de azúcares del néctar es 34 %. El color predominante en el espectro visible es el blanco. En el espectro UV, los estambres y el gineceo contrastan con el limen y el androginóforo; pueden ser una guía de néctar. Tres especies de himenópteros fueron los visitantes más frecuentes y constantes: Ptiloglossa tarsata (Colletidae siempre contactan las anteras y los estigmas cuando liban, transportan un alto porcentaje de polen de P. foetida y visitan flores en fase 1 y 2; pueden ser considerados los principales polinizadores. Pseudaugochloropsis sp. (Halictidae raramente contactan las anteras o los estigmas cuando perforan el limen para acceder al néctar y visitan flores en fase 2 y 3; son ladrones de néctar que raramente polinizan. Augochlorella sp. (Halictidae recolectan polen sin tocar los estigmas y visitan flores en fase 2 y 3; son hurtadores de polen.A reproductive experiment shows that Passiflora foetida is autocompatible. Observations of floral characteristics and visitors during anthesis, plus the analysis of pollen allowed identification of floral syndrome (melittophily and functions for each visitor. Anthesis occurs from 6 to 11 AM. Three floral phases were identified: 1 stigmas above anthers, 2 stigmas at anther level, 3 stigmas above anthers; radii, petals and sepals become incurved. The stigmas are receptive during the

  19. Dual protective effect of Passiflora incarnata in epilepsy and associated post-ictal depression.

    Science.gov (United States)

    Singh, Bhupinder; Singh, Damanpreet; Goel, Rajesh Kumar

    2012-01-06

    Passiflora incarnata L. (Passifloraceae) has been used for the treatment of epilepsy in several traditional systems of medicine. The aerial parts of Passiflora incarnata contain multiple bioactive metabolites such as, flavonoids (like, chrysin that show CNS depressant activity by agonizing GABA-benzodiazepine receptor), amino acids (like, GABA), harmala alkaloids (reversible monoamine oxidase-A inhibitor), etc. In view of this, the present study was designed to investigate dual protective effect of the hydroethanolic extract of Passiflora incarnata in pentylenetetrazol (PTZ)-induced seizure and associated post-ictal depression. Different groups of mice were administered with repeated subconvulsive doses of PTZ (50mg/kg; i.p.) at an interval of 5 days for 15 days. From 5th to 15th day the animals in different groups were administered daily with varying doses of hydroethanolic extract of Passiflora incarnata (150, 300, and 600mg/kg; i.p.), diazepam (2mg/kg; i.p.) and vehicle. On every 5th day, after PTZ treatment, seizure severity (score) was noted. Following convulsive episodes the locomotor activity (using actophotometer) and immobility period (using forced swim test) were also determined. On 15th day after behavioral assessment, the brain serotonin and noradrenaline levels were determined using spectrofluorometric methods. Treatment with the extract significantly (p<0.05) reduced the seizure severity and immobility period as compared to vehicle control, in a dose and time-dependent manner. Moreover, the extract treatment retained the serotonin and noradrenaline levels of the brain. The results of present study concluded that the hydroethanolic extract of Passiflora incarnata suppress PTZ-induced seizures, and ameliorates its associated post-ictal depression, which has been found to be get worsened with the standard antiepileptic drug, diazepam. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  20. Glycosidic inhibitors of melanogenesis from leaves of Passiflora edulis.

    Science.gov (United States)

    Zhang, Jie; Koike, Ryosuke; Yamamoto, Ayako; Ukiya, Motohiko; Fukatsu, Makoto; Banno, Norihiro; Miura, Motofumi; Motohashi, Shigeyasu; Tokuda, Harukuni; Akihisa, Toshihiro

    2013-10-01

    A new flavonoid glycoside, chrysin 6-C-β-rutinoside (chrysin α-L-rhamnopyranosyl-(1→6)-C-β-glucopyranoside; 2), and two new triterpene glycosides, (31R)-31-O-methylpassiflorine (7) and (31S)-31-O-methylpassiflorine (8), along with 14 known glycosides, including three flavonoid glycosides, 1, 3, and 4, six triterpene glycosides, 5, 6, and 9-12, three cyano glycosides, 13-15, and two other glycosides, 16 and 17, were isolated from a MeOH extract of the leaves of Passiflora edulis (passion flower; Passifloraceae). The structures of new compounds were elucidated on the basis of extensive spectroscopic analysis and comparison with literature data. Upon evaluation of compounds 1-17 against the melanogenesis in the B16 melanoma cells induced with α-melanocyte-stimulating hormone (α-MSH), three compounds, isoorientin (1), 2, and (6S,9R)-roseoside (17), exhibited inhibitory effects with 37.3-47.2% reduction of melanin content with no, or almost no, toxicity to the cells (90.8-100.2% cell viability) at 100 μM. Western blot analysis showed that compound 2 reduced the protein levels of MITF, TRP-1, and tyrosinase, in a concentration-dependent manner while exerted almost no influence on the level of TRP-2, suggesting that this compound inhibits melanogenesis on the α-MSH-stimulated B16 melanoma cells by, at least in part, inhibiting the expression of MITF, followed by decreasing the expression of TRP-1 and tyrosinase. In addition, compounds 1-17 were evaluated for their inhibitory effects against the EpsteinBarr virus early antigen (EBV-EA) activation induced by 12-O-tetradecanoylphorbol-13-acetate (TPA) in Raji cells. Copyright © 2013 Verlag Helvetica Chimica Acta AG, Zürich.

  1. Studies on floral biology of passion fruit (passiflora spp.)

    International Nuclear Information System (INIS)

    Kishore, K.; Pathak, K.A.; Shukla, R.; Bharali, R.

    2010-01-01

    Floral biology of purple, yellow, giant and Passiflora foetida was studied at the ICAR Research Complex, Mizoram Centre, Kolasib, Mizoram, India during 2005-07. Purple, giant and P. foetida had major bloom during March-April, July-August and September-October. While major bloom in yellow was mainly during May-June and September-October. Purple, giant and P. foetida had the maximum duration of bloom of 42.4, 22.5 and 32.6 days, respectively during March-April with the maximum duration of effective bloom of 12.5 8.6 and 10.4 days in purple, giant and P. foetida, respectively. Yellow had the maximum duration of bloom for 28.4 days and effective bloom of 10.5 days during May-June. Most of the flowers of purple (54.5%) and giant (58.5%) opened between 6-7 hrs, while the maximum per cent of anthesis in yellow (70%) took place between 12-13 hrs. Pollen dehiscence and pollination in purple and giant mainly occurred between 7-8 hrs, while 13-14 hrs was the major period of pollen dehiscence and pollination in yellow. The earliest anthesis (5-6 hrs), anther dehiscence (6-7 hrs) and pollination (6-7 hrs) were recorded in P. foetida. The maximum stigma receptivity was recorded on the day of anthesis in all the passion fruits. Completely curved style was more common in all passion fruits that gave the maximum fruit set. The maximum number of bees observed between 7-8 hrs in purple and giant and between 13-14 hrs in yellow. The most common pollinating bee in purple, giant and yellow was Apis mellifera, while A. cerena was in P. foetida. (author)

  2. Optimal design of PV and HP system

    DEFF Research Database (Denmark)

    Nepper-Rasmussen, Bjarke Christian; Rasmussen, Theis Bo

    2015-01-01

    electric energy demand of the HP to hours where excess PV power is present. The self-consumption of the PV energy affects the overall net present value (NPV). In this paper, a method which maximizes the NPV by finding the cost-optimal combination of PV, HP and BT sizes, is proposed. Results show......Methods of utilizing residential produced photovoltaic (PV) power by converting to thermal energy through heat pumps (HP) are present in literature, where thermal energy is dispersed as either heat or hot water at the instant moment of PV production. In this paper an alternative solution...

  3. Antioxidants and sensory properties of the infusions of wild passiflora from Brazilian savannah: potential as functional beverages.

    Science.gov (United States)

    Pineli, Lívia de L de O; Rodrigues, Juliana da S Q; Costa, Ana M; de Lima, Herbert C; Chiarello, Marileusa D; Melo, Lauro

    2015-05-01

    The study of biodiversity for species recovery and sustainable use has encouraged research with plants from Brazilian savannah. We aimed to characterize chemical and sensory properties of infusions of passifloras, due to their potential as functional beverages. Infusions and hydroalcoholic extracts of four species of wild passifloras, three varieties of Passiflora edulis and a commercial passiflora tea were evaluated for total phenolics (TPs), total flavonoids (TFs), condensed tannins (CTs), and antioxidant activity (DPPH and FRAP). Free-choice Profile and acceptance, compared with green tea, were performed for sensory characterization. In general, infusions had higher levels of TPs and CTs than hydroalcoholic extracts, which in turn had higher levels of TFs. Infusion of P. nitida showed higher amounts of TPs and antioxidant activity. Acceptance of passiflora infusions was similar or higher than that of green tea, except for P. alata. P. setacea presented a sensory profile similar to other commercial teas and higher acceptance by a group of consumers. Passiflora infusions showed different degrees of suitability as acceptable functional beverage. Identification of phenolics and other bitter compounds is needed to understand the intense bitterness of P. alata, as it did not present the highest contents of TPs, CTs and TFs. © 2014 Society of Chemical Industry.

  4. Lightning protection of PV systems

    OpenAIRE

    Pons, Enrico; Tommasini, Riccardo

    2013-01-01

    Lightning strikes can affect photovoltaic (PV) generators and their installations, involving also the inverter's electronics. It is therefore necessary to evaluate the risk connected to lightning strikes in order to adopt the correct protective measures for the system. The Standard IEC (EN) 62305-2 reports the procedures for the risk calculation and for the choice of proper lightning protection systems. Usually the technical guidelines suggest protecting with SPDs (surge protective devices) b...

  5. 100 KW pv system design

    International Nuclear Information System (INIS)

    Khan, N.; Abas, N.

    2010-01-01

    This paper reports the design of a 100kw photovolatic (PV) system for 10,000 ft/sup 2/ roof building. It explain the necessary design steps for medium power PV system specifications of associated accessories for large size building solar electrification. A comparison between various solar technologies and their ancillary anchors is provided to guide the young electric power and renewable energy engineers. It is to prove that hybrid photovolatic thermal (PVT) technology is more efficient than simple photovolatic (PV), photovolatic concentrator (PVC) or stand-alone solar thermal heating systems. We have been using fossil fuels from 1859 to 2009. Oil triggered population growth rate which in turn increased energy demand for iil. A 200 years close loop positive feedback has amplified oil production rate for few thousand barrels to 86-87 billion barrels. Today the world population is burning oil at rate of 1000 barrels/sec. The oil reserves are likely to end by 2050 (worst case) or 2100 (best case). At 1.7% growth rate the current global population might double to 12 billion barrels and electric power demand will increase from current 15 TW to TW. Unfortunately oil reserves would be breathing last and global warning would be at its climax. To cope with upcoming power, water water and energy cataclysms, it is more than essential to go for sustainable and renewable and renewable energy education and lifestyles. I hope this design venture will create interest among power and energy students, engineers and professional engine. (author)

  6. Passiflora incarnata L.: ethnopharmacology, clinical application, safety and evaluation of clinical trials.

    Science.gov (United States)

    Miroddi, M; Calapai, G; Navarra, M; Minciullo, P L; Gangemi, S

    2013-12-12

    The genus Passiflora incarnata Linnaeus comprises approximately 520 species belonging to the Passifloraceae family. The majority of these species are vines found in Central or South America, with rare occurrence in North America, Southeast Asia and Australia. The genus Passiflora incarnata has long been used in traditional herbal medicine for the treatment of insomnia and anxiety in Europe, and it has been used as a sedative tea in North America. Furthermore, this plant has been used for analgesic, anti-spasmodic, anti-asthmatic, wormicidal and sedative purposes in Brazil; as a sedative and narcotic in Iraq; and for the treatment of disorders such as dysmenorrhoea, epilepsy, insomnia, neurosis and neuralgia in Turkey. In Poland, this plant has been used to treat hysteria and neurasthenia; in America, it has been used to treat diarrhoea, dysmenorrhoea, neuralgia, burns, haemorrhoids and insomnia. Passiflora incarnata L. has also been used to cure subjects affected by opiate dependence in India. This review aims to provide up-to-date information about the pharmacology, clinical efficacy and clinical safety of Passiflora incarnata L. based on the scientific literature. In particular, the methodological accuracy of clinical trials is analysed in accordance with current consolidated guidelines on reporting the clinical efficacy of herbal medicine, offering new insight into opportunities for future research and development. A bibliographic investigation was performed by examining the available data on Passiflora incarnata L. from globally accepted scientific databases and search engines (Pubmed, Scopus and Web of Science, SciFinder and Google Scholar). We selected studies, case reports, and reviews addressing the pharmacology and safety of Passiflora incarnata. Although numerous Passiflora incarnata L. derivative products have been commercialised as alternative anxiolytic and sedative remedies based on their long tradition of use, their supposed efficacy does not appear

  7. PV-CAD: an integrated tool for designing PV facades; PV-CAD - Ein integriertes Werkzeug zur Auslegung von PV-Fassaden

    Energy Technology Data Exchange (ETDEWEB)

    Giese, H.; Viotto, M. [Inst. fuer Solare Energieversorgungstechnik (ISET) e.V., Kassel (Germany); Esser, M.; Pukrop, D. [Univ. Oldenburg (Germany). Abt. Energie- und Halbleiterforschung; Stellbogen, D. [Zentrum fuer Sonnenergie- und Wasserstoff-Forschung, Stuttgart (Germany)

    1997-12-31

    PV-CAD provides PV system planners with a practice-oriented tool for an efficient design of PV facades. Being compatible with the standard programmes of the architects` and electrical engineering sectors it can be used on already existing systems and allows the user to draw on previously acquired knowedge. Its open interfaces permit the integration of further design tools. PV CAD works under Microsoft Windows for which it has the necessary graphic user interface. Its compliance to PC standards opens up a wide range of applications and permits its use also on inexpensive computers. Thanks to its promotion by the Federal Ministry for Education, Science, Research, and Technology under the research project ``Computer programmes for the design of photovoltaic facades`` PV-CAD is available at a moderate price. PV-CAD permits an efficient planning of solar facades and therefore has the potential to stimulate the use of PV on buildings. (orig.) [Deutsch] Mit PV-CAD steht dem Anlagenplaner ein anwendungsorientiertes Werkzeug zur Verfuegung, das eine rationelle Auslegung von PV-Fassaden ermoeglicht. Die Kompatibilitaet zu Standardprogrammen aus dem Architektur- und Elektrosektor erlaubt die Nutzung bereits vorhandener Systeme und damit erworbener Kenntnisse. Offene Schnittstellen gestatten die Einbindung weiterer Entwurfswerkzeuge. PV-CAD arbeitet unter Microsoft-Windows und verfuegt ueber die entsprechende grafische Benutzerschnittstelle. Die Kompatibilitaet zum PC-Standard eroeffnet eine sehr breite Anwenderbasis und ermoeglicht den Einsatz des Programms auch auf preiswerten Rechnern. Aufgrund der Foerderung durch das Bundesministerium fuer Bildung, Wissenschaft, Forschung und Technologie im Rahmen des Forschungsprojekts `Rechnerprogramm zur Auslegung von Photovoltaik-Fassaden` steht PV-CAD preiswert zur Verfuegung. PV-CAD ermoeglicht eine effiziente Planung von Solarfassaden und kann daher dem PV-Einsatz in Gebaeuden weitere Impulse geben. (orig.)

  8. Expression patterns ofPassiflora edulis APETALA1/FRUITFULLhomologues shed light onto tendril and corona identities.

    Science.gov (United States)

    Scorza, Livia C T; Hernandes-Lopes, Jose; Melo-de-Pinna, Gladys F A; Dornelas, Marcelo C

    2017-01-01

    Passiflora (passionflowers) makes an excellent model for studying plant evolutionary development. They are mostly perennial climbers that display axillary tendrils, which are believed to be modifications of the inflorescence. Passionflowers are also recognized by their unique flower features, such as the extra whorls of floral organs composed of corona filaments and membranes enclosing the nectary. Although some work on Passiflora organ ontogeny has been done, the developmental identity of both Passiflora tendrils and the corona is still controversial. Here, we combined ultrastructural analysis and expression patterns of the flower meristem and floral organ identity genes of the MADS-box AP1 / FUL clade to reveal a possible role for these genes in the generation of evolutionary novelties in Passiflora . We followed the development of structures arising from the axillary meristem from juvenile to adult phase in P. edulis . We further assessed the expression pattern of P. edulis AP1 / FUL homologues ( PeAP1 and PeFUL ), by RT-qPCR and in situ hybridization in several tissues, correlating it with the developmental stages of P. edulis . PeAP1 is expressed only in the reproductive stage, and it is highly expressed in tendrils and in flower meristems from the onset of their development. PeAP1 is also expressed in sepals, petals and in corona filaments, suggesting a novel role for PeAP1 in floral organ diversification. PeFUL presented a broad expression pattern in both vegetative and reproductive tissues, and it is also expressed in fruits. Our results provide new molecular insights into the morphological diversity in the genus Passiflora . Here, we bring new evidence that tendrils are part of the Passiflora inflorescence. This points to the convergence of similar developmental processes involving the recruitment of genes related to flower identity in the origin of tendrils in different plant families. The data obtained also support the hypothesis that the corona

  9. Expression patterns of Passiflora edulis APETALA1/FRUITFULL homologues shed light onto tendril and corona identities

    Directory of Open Access Journals (Sweden)

    Livia C. T. Scorza

    2017-02-01

    Full Text Available Abstract Background Passiflora (passionflowers makes an excellent model for studying plant evolutionary development. They are mostly perennial climbers that display axillary tendrils, which are believed to be modifications of the inflorescence. Passionflowers are also recognized by their unique flower features, such as the extra whorls of floral organs composed of corona filaments and membranes enclosing the nectary. Although some work on Passiflora organ ontogeny has been done, the developmental identity of both Passiflora tendrils and the corona is still controversial. Here, we combined ultrastructural analysis and expression patterns of the flower meristem and floral organ identity genes of the MADS-box AP1/FUL clade to reveal a possible role for these genes in the generation of evolutionary novelties in Passiflora. Results We followed the development of structures arising from the axillary meristem from juvenile to adult phase in P. edulis. We further assessed the expression pattern of P. edulis AP1/FUL homologues (PeAP1 and PeFUL, by RT-qPCR and in situ hybridization in several tissues, correlating it with the developmental stages of P. edulis. PeAP1 is expressed only in the reproductive stage, and it is highly expressed in tendrils and in flower meristems from the onset of their development. PeAP1 is also expressed in sepals, petals and in corona filaments, suggesting a novel role for PeAP1 in floral organ diversification. PeFUL presented a broad expression pattern in both vegetative and reproductive tissues, and it is also expressed in fruits. Conclusions Our results provide new molecular insights into the morphological diversity in the genus Passiflora. Here, we bring new evidence that tendrils are part of the Passiflora inflorescence. This points to the convergence of similar developmental processes involving the recruitment of genes related to flower identity in the origin of tendrils in different plant families. The data obtained also

  10. Cytogenetic studies in some species of Passiflora L. (Passifloraceae: a review emphasizing Brazilian species

    Directory of Open Access Journals (Sweden)

    Margarete Magalhães Souza

    2008-04-01

    Full Text Available The Passifloraceae is represented by species of tropical and subtropical origin. The Passiflora is the richest genus with approximately 450 species, 200 of them being native to Brazil. Recent karyological studies have reported the basic chromosome number for the Passiflora genus as x = 6, whereas x = 9, x = 10 and x = 12 were established as secondary basic numbers. High rates of fertility occur in most Passiflora species, since both meiotic index and pollen viability are above 90%. Unusual meiotic behavior has been described in some taxa. Unviable pollen were observed in some diploids species. The genome size varies from 1.83 to 5.36 pg, and significant interspecific variance has been observed. Studies using the FISH methodology have shown that there are two to three rDNA 45S sites and one 5S site in the species analyzed. In this review, information about the above-mentioned studies is presented and discussed in detail.A família Passifloraceae é representada por espécies de origem tropical e subtropical. Passiflora é o gênero mais rico, com aproximadamente 450 espécies, cerca de 200 delas nativas do Brasil. Recentes estudos cariológicos têm relatado o número básico de cromossomos para o gênero Passiflora como sendo x = 6, enquanto x = 9, x = 10 e x = 12 foram considerados números básicos secundários. Altas taxas de fertilidade são observadas na maioria das espécies de Passiflora, uma vez que o índice meiótico e a viabilidade polínica apresentam-se acima de 90%.Comportamento meiótico irregular tem sido descrito para alguns taxas. Grãos de pólen inviáveis foram observados em espécies diplóides. O tamanho do genoma varia de 1,83 a 5,36 pg, e variação interespecífica significativa tem sido observada. Estudos usando a metodologia de hibridização in situ (FISH tem demonstrado haver de dois a três sites de DNAr 45S e um site de DNAr 5S nas espécies analisadas. Nesta revisão, informações sobre os estudos acima

  11. Multilocus Sequence Typing Reveals Relevant Genetic Variation and Different Evolutionary Dynamics among Strains of Xanthomonas arboricola pv. juglandis

    Directory of Open Access Journals (Sweden)

    Marco Scortichini

    2010-11-01

    Full Text Available Forty-five Xanthomonas arboricola pv. juglandis (Xaj strains originating from Juglans regia cultivation in different countries were molecularly typed by means of MultiLocus Sequence Typing (MLST, using acnB, gapA, gyrB and rpoD gene fragments. A total of 2.5 kilobases was used to infer the phylogenetic relationship among the strains and possible recombination events. Haplotype diversity, linkage disequilibrium analysis, selection tests, gene flow estimates and codon adaptation index were also assessed. The dendrograms built by maximum likelihood with concatenated nucleotide and amino acid sequences revealed two major and two minor phylotypes. The same haplotype was found in strains originating from different continents, and different haplotypes were found in strains isolated in the same year from the same location. A recombination breakpoint was detected within the rpoD gene fragment. At the pathovar level, the Xaj populations studied here are clonal and under neutral selection. However, four Xaj strains isolated from walnut fruits with apical necrosis are under diversifying selection, suggesting a possible new adaptation. Gene flow estimates do not support the hypothesis of geographic isolation of the strains, even though the genetic diversity between the strains increases as the geographic distance between them increases. A triplet deletion, causing the absence of valine, was found in the rpoD fragment of all 45 Xaj strains when compared with X. axonopodis pv. citri strain 306. The codon adaptation index was high in all four genes studied, indicating a relevant metabolic activity.

  12. Beneficial properties of Passiflora caerulea on experimental colitis.

    Science.gov (United States)

    Anzoise, M L; Marrassini, C; Bach, H; Gorzalczany, S

    2016-12-24

    Passiflora caerulea L. (Passifloraceae) is a medicinal plant commonly used in traditional medicine in South America for different pathologies associated with the gastrointestinal tract. In the present study, the activity of the ethanolic extract of P. caerulea on an experimental colitis model related to inflammatory bowel disease has been investigated. Colitis was induced by intracolonic instillation of a 2mL of 4% (v/v) acetic acid solution. Macroscopic scoring, myeloperoxidase activity and thiobarbituric acid reactive substances levels were evaluated on isolated colon mucosae. The histopathological studies of colon mucosae were performed by hematoxylin and eosin and Alcian blue staining. Diarrhoea was induced by the administration of castor oil (0.3mL/mouse). The first watery defecation time, the total amount of solid, semi-solid and watery stools and the amount of watery stools were determined. The effect of the extract on a cumulative concentration-response curve of acetylcholine and CaCl 2 on isolated rat jejunum was also evaluated. The phytochemical analysis was performed. The extract (250mg/kg, p.o.) induced a significant reduction in the weight/length ratio, the macroscopic lesion score, TBARS levels and the microscopic tissue damage when compared with the acetic acid-treated group of animals. P. caerulea (125mg/kg, p.o.) decreased significantly the amount of watery stools in the castor oil-induced-diarrhoea model. Moreover, the P. caerulea extract antagonized the jejunum contractions induced by Ach (E max for 0.3mg/mL: 76.25%; E max for 1mg/mL: 63.47%; E max for 3mg/mL: 42.01%) and CaCl 2 (E max for 0.3mg/mL: 75.69%; E max for1 mg/mL: 56.1%; E max for 3mg/mL: 53.4%). Isoorientin, vitexin, isovitexin, and vicenin-2 were identified in the extract. P. caerulea showed anti-inflammatory, anti-diarrhoeal and spasmolityc activities on preclinical models. Copyright © 2016. Published by Elsevier Ireland Ltd.

  13. Photovoltaics: PV takes off the UK

    International Nuclear Information System (INIS)

    Noble, Ray; Gregory, Jenny

    2000-01-01

    Despite historical ups and downs, there is still ambition to bring increasingly efficient photovoltaic (PV) systems to the market. PV for major remote telecommunications systems is now an established part of the market, many mobile phone systems are powered by PV and there is potential for increased use of home solar systems, especially in developing countries. Over the past few years, building-integrated PV (BIPV) has been on the increase. In 1999, global production from PV exceeded 200 MW and the UK installed capacity was greater than 1 MW. BIPV is a fast growing market and its characteristics and advantages are discussed. PV installations at Nottingham University, Greenwich Pavilion, BP Amoco Sunbury, Baglan Bay, BP filling stations, and Sainsbury's are described

  14. Adiabatic Rearrangement of Hollow PV Towers

    OpenAIRE

    Eric A Hendricks; Wayne H Schubert

    2010-01-01

    Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV). This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with...

  15. SunShot 2030 for Photovoltaics (PV): Envisioning a Low-Cost PV Future

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Wesley J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zuboy, Jarrett; Woodhouse, Michael A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-01

    This presentation summarizes the findings from the report 'SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future.' This presentation was given as a webinar on September 26, 2017.

  16. Processes and Materials for Flexible PV Arrays

    National Research Council Canada - National Science Library

    Gierow, Paul

    2002-01-01

    .... A parallel incentive for development of flexible PV arrays are the possibilities of synergistic advantages for certain types of spacecraft, in particular the Solar Thermal Propulsion (STP) Vehicle...

  17. Identification of the pattern of heterochromatin distribution in Passiflora species with C-banding.

    Science.gov (United States)

    Viana, A J C; Souza, M M

    2010-09-28

    We tested four C-banding protocols to obtain heterochromatic bands in the passion fruit species Passiflora edulis and P. cacaoensis (Passifloraceae). Three of these protocols had been previously described. The three published protocols were not adequate to obtain C-bands in these species. An adapted protocol demonstrated heterochromatin distribution in metaphasic chromosomes of species of Passiflora for the first time. The differentiated coloration for C-bands was obtained with immersion of the slides in 99% ethanol, 45% acetic acid (additional step), 0.2 N hydrochloric acid, hydroxide of barium, 45% acetic acid, and 2X standard saline citrate at four different temperatures. The C-bands were observed in the satellites and in the telomere and centromere regions of all chromosomes, both in P. edulis and in P. cacaoensis.

  18. Molecular investigations of pathogenesis-related Bet v 1 homologues in Passiflora (Passifloraceae).

    Science.gov (United States)

    Finkler, Carla; Giacomet, Carolina; Muschner, Valéria C; Salzano, Francisco M; Freitas, Loreta B

    2005-07-01

    The major birch pollen allergen, Bet v 1, responsible for allergic reactions in many areas of the world, is homologous to a large number of pathogenesis-related proteins (PRs), identified as PR10. As part of a long-range investigation of these types of proteins and of evolution in Passiflora, DNA sequences from eight Bet v 1 homologue isoforms were obtained from five species of this genus in Brazil, and their sequences compared among themselves and with 30 others from 8 different species, classified in different taxonomic units. The objective was a first characterization of these PRs in wild passionflowers, and their use for evolutionary and applied investigations. High interspecific, but low intraspecific variability was observed, as expected from multigenic families subjected to concerted evolution. The relationships obtained both within Passiflora and between it and seven other genera probably best reflect functional similarities than evolutionary history.

  19. Anxiolytic activity of a phytochemically characterized Passiflora incarnata extract is mediated via the GABAergic system.

    Science.gov (United States)

    Grundmann, Oliver; Wang, Jie; McGregor, Gerard P; Butterweck, Veronika

    2008-12-01

    The purpose of this research was to assess the anxiolytic properties of a phytochemically characterized commercial extract from Passiflora incarnata (PI; Passifloraceae) in the elevated plus maze test in mice. Using an HPLC method, the flavonoids homoorientin, orientin, vitexin, and isovitexin were identified as major compounds. Following oral administration, the extract exerted an anxiolytic effect that was comparable to diazepam (1.5 mg/kg) at a dose of 375 mg/kg and exhibited a U-shaped dose-response curve. In addition, antagonism studies using the GABA (A)/benzodiazepine receptor antagonist flumazenil and the 5-HT (1A)-receptor antagonist WAY-100 635 were conducted. The active dose was effectively antagonized by flumazenil, but not by WAY-100 635. This study is the first demonstration of the IN VIVO, GABA-mediated anxiolytic activity of an HPLC- characterized extract of Passiflora incarnata.

  20. Caracterização agromorfológica do maracujazeiro (Passiflora spp.

    Directory of Open Access Journals (Sweden)

    Crochemore Maria Lúcia

    2003-01-01

    Full Text Available Esse estudo descreve a variação genética de 55 acessos de Passiflora spp., constituídos de P. edulis, P. alata, P. coccinea, P. caerulea, P. foetida, P. giberti, P. macrocarpa, P. macrocarpa x alata, P. serrato digitata, P. suberosa e um acesso Passiflora sp. Vinte e dois descritores morfológicos foram avaliados sobre plantas isoladas em sistema de espaldeira e permitiram estruturar a diversidade encontrada. As relações filogenéticas entre os acessos, avaliadas pela análise de componentes principais e de distâncias genéticas, mostraram existir ampla diversidade entre as espécies estudadas. Algumas espécies mostraram caracteres monomórficos. Importante variabilidade foi observada dentro de P. alata e de P. edulis, e pequenas divergências foram encontradas entre os acessos da forma flavicarpa.

  1. Palinotaxonomia de Passiflora L. subg. Decaloba (DC. Rchb. (Passifloraceae no Brasil Palynotaxonomy of Passiflora L. subg. Decaloba (DC. Rchb. (Passifloraceae in Brazil

    Directory of Open Access Journals (Sweden)

    Michaele Alvim Milward-de-Azevedo

    2010-03-01

    Full Text Available Foram tratados, palinologicamente, 21 táxons de Passiflora L. subg. Decaloba (DC. Rchb. (Passifloraceae ocorrentes no Brasil, com o objetivo de contribuir para a caracterização, circunscrição e delimitação do subgênero, espécies e subespécie. Os grãos de pólen foram acetolisados, medidos, descritos e ilustrados sob microscopia de luz. Grãos de pólen não acetolisados foram usados na microscopia eletrônica de varredura. Os táxons possuem grãos de pólen grandes ou médios, isopolares, prolato-esferoidais, oblato-esferoidais, esferoidais ou subprolatos, 12-colpados, 12-colporados ou 6-colporados, 3 ou 6 mesocolpos, e presença ou ausência de opérculos, pseudopérculos e opérculos secundários, exina microrreticulada em P. truncata e heterorreticulada nas demais espécies. Foi confeccionada uma chave para a identificação das espécies com base nos dados polínicos, mostrando que características polínicas têm grande importância na taxonomia de Passiflora.The palynological study of 21 taxa of Passiflora L. subg. Decaloba (DC. Rchb. (Passifloraceae in Brazil aimed to contribute to a better characterization, as well as the circumscription and delimitation of the subgenus, species and subspecies. The pollen grains were acetolysed, measured, described and illustrated using light microscopy and scanning electron microscopy. The taxa have large or medium-sized pollen grains, isopolar, prolate spheroidal, oblate spheroidal, spheroidal or suprolate, 12-colpate, 12-colporate or 6-colporate, 3 or 6 mesocolpes, and presence or absence of opercules, pseudopercules and secondary opercules, microreticulate (P. truncata and heteroreticulate exine in the other species. An identification key with pollen characteristics is presented, showing the importance of pollen characteristics for Passiflora taxonomy.

  2. RESÍDUOS ORGÂNICOS NO CONTROLE DE Fusarium oxysporum f. sp. passiflorae EM MARACUJAZEIRO AMARELO (Passiflora edulis f. flavicarpa )

    OpenAIRE

    Renato Bernardes FERREIRA; Antonia Alice Costa RODRIGUES; Flávio Henrique R. MORAES; Erlen Keila Candido e SILVA; Ivaneide de Oliveira NASCIMENTO

    2015-01-01

    La fusariosis, es una importante enfermedad en el cultivo de maracuyá que causa una severa limitación en la producción de frutos y una reducción en la longevidad del cultivo. Este trabajo tuvo como objetivo, evaluar el efecto de residuos orgánicos i n vitro e in vivo como medida alternativa para el manejo de la fusariosis en el maracuyá, causada por Fusarium oxysporum f. sp. passiflorae. Se evaluaron seis concentraciones in vitro (0, 2, 4, 6, 8 y 10 %) en forma de extracto acuoso, e igual núm...

  3. Caracterización morfológica de especies del género Passiflora de Colombia Morphological characterization of Colombian Passiflora species

    Directory of Open Access Journals (Sweden)

    Mónica María Marín Tangarife

    2009-07-01

    Full Text Available Se caracterizaron 21 especies de Passiflora las que incluyeron tres subgéneros, mediante 66 descriptores cuantitativos y 100 cualitativos. El análisis de componentes principales (ACP de los descriptores cuantitativos identificó dos componentes con valor propio superior a 1, asociados con hoja y flor, los cuales explicaron 80% de la varianza total de las accesiones estudiadas. Con el análisis factorial de correspondencia múltiple (AFCM de los descriptores cualitativos se identificaron tres dimensiones, que explicaron 82% de la varianza total; a la segunda se asociaron tipo de crecimiento, número de flores por nudo y color de la última serie de los filamentos en el ápice; a la tercera, forma y margen de la bráctea, margen de la bráctea; y a la primera las demás variables cualitativas. El análisis de agrupamiento (distancias de 'city-block-Manhattan' evidenció dos grandes grupos, según la longitud del hipantio -especies con flor de hipantio corto y largo-. El análisis de clasificación también mostró que la morfología floral fue determinante en la discriminación infragenérica en Passiflora.21 Colombian Passiflora species, including three subgenera of the genus were morphologically characterized by using 66 quantitative and 100 qualitative descriptors. Principal components analysis of quantitative data identified two components with own value superior to one, associated respectivelly to leave and flower, which explained 80% of total variance of studied accessions. Factorial analysis of multiple correspondence permitted identify three dimensions, which explained 82% of total variance. Second dimension was associated with growth habit, number of flowers by knot and collor of the last filaments series in apex. Third dimension was associated with morphology and bracts margin, and the former whith others qualitative variables. Cluster analysis (city-block-Manhattan distances could to evidence two mayor groups, according to flower tube

  4. Uji Toksisitas Akut Ekstrak Etanol Kulit Buah Markisa Ungu (Passiflora edulis Sims.) Menggunakan Mencit

    OpenAIRE

    Pratama, Edo Kusda

    2016-01-01

    Indonesian had known, gathered and used several plants as an effort in order to prevent health problems since a long ago. One of the plants is very famous in Indonesia which known have many benefits is purple passion fruit or markisa (Passiflora edulis Sims). Purple passion fruit peel has antihypertensive activity, an antibacterial against Staphylococcus aureus and Escherichia coli bacteria, an also as a color for lipstick. The objective of this study was to determine the safety limit to use ...

  5. Pesticide residues in passifloras crops in regions of high production in Colombia

    OpenAIRE

    Dario A. Bastidas; Jairo A. Guerrero; Kris Wyckhuys

    2013-01-01

    As one of the most bio-diverse countries in the world, Colombia boasts a wide diversity of highly palatable tropical fruits. Even though Colombian fruit production has primarily targeted the domestic market, several fruit species, such as passion fruit (PassifloraSpp), are steadily gaining ground in the broader international arena.  Production of these crops and respond to raising domestic and international demand, many Colombian small-scale farmers use pesticides for pest and disease control...

  6. Biological activities and phytochemical profile of Passiflora mucronata from the Brazilian restinga

    Directory of Open Access Journals (Sweden)

    Marlon H. de Araujo

    Full Text Available ABSTRACT In general, Passiflora species have been reported for their folk medicinal use as sedative and anti-inflammatory. However, P. caerulea has already been reported to treat pulmonary diseases. Severe pulmonary tuberculosis, generally caused by Mycobacterium tuberculosis strains resistant to multiple drugs, can lead to deleterious inflammation and high mortality, encouraging new approaches in drug discovery. Thus, the aim of this work was to evaluate the Passiflora mucronata Lam., Passifloraceae, potential for tuberculosis treatment. Specifically, related to antimycobacterial activity and anti-inflammatory related effects (based on inhibition of nitric oxide, tumor necrosis factor-alpha production and antioxidant potential, as well as the chemical profile of P. mucronata. High performance liquid chromatography coupled with diode-array ultraviolet and mass spectrometer analyses of crude hydroalcoholic extract and ethyl acetate fraction showed the presence of flavonoids. Ethyl acetate fraction showed to be as antioxidant as Ginkgo biloba standard extract with EC50 of 14.61 ± 1.25 µg/ml. One major flavonoid isolated from ethyl acetate fraction was characterized as isoorientin. The hexane fraction and its main isolated compound, the triterpene β-amyrin, exhibited significant growth inhibitory activity against Mycobacterium bovis BCG (MIC50 1.61 ± 1.43 and 3.93 ± 1.05 µg/ml, respectively. In addition, Passiflora mucronata samples, specially hexane and dichloromethane fractions, as well as pure β-amyrin, showed a dose-related inhibition of lipopolysaccharide (LPS-induced nitric oxide production. In conclusion, Passiflora mucronata presented relevant biological potential and should be considered for further studies using in vivo pulmonary tuberculosis model.

  7. Ecological-evolutionary relationships in Passiflora alata from Rio Grande do Sul, Brazil.

    Science.gov (United States)

    Koehler-Santos, P; Lorenz-Lemke, A P; Salzano, F M; Freitas, L B

    2006-08-01

    The geographical distribution, ecological characteristics, flowering and fruiting times, and pollinating agents of Passiflora alata are considered and related to molecular genetic data gathered simultaneously. The first report on this species in Rio Grande do Sul was made in 1934, only in cultivated gardens. Approximately 20 years later, however, the species was already classified as efferata (wild) in Porto Alegre's suburbs. The data presented here, together with the DNA investigations, indicate that P. alata is actively colonizing previously unoccupied areas of this region.

  8. Identifikasi Penyebab Penyakit Layu pada Tanaman Markisa (Passiflora edulis Sims.) di Kecamatan Tiga Panah Kabupaten Karo

    OpenAIRE

    Karosekali, Relly

    2012-01-01

    Identification Caused of Wilt Disease on Passion Fruit (Passiflora edutis simm) in some Main area at Karo regency. Fusarium wilt disease is a main constraint in passion fruit productivity that spread in Indonesia, especially in some main area at Karo Regency, Nort Sumatera. Attacking of wilt disease caused plant died. Therefore, the interest of farmer to study about plantation of passion fruit is be lessen. The objectives of this research were : (1) to find out some fusarium species that caus...

  9. 40 CFR 180.1261 - Xanthomonas campestris pv. vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages.

    Science.gov (United States)

    2010-07-01

    ... and Pseudomonas syringae pv. tomato specific Bacteriophages. 180.1261 Section 180.1261 Protection of.... vesicatoria and Pseudomonas syringae pv. tomato specific Bacteriophages. An exemption from the requirement of... syringae pv. tomato specific bacteriophages in or on pepper and tomato. [74 FR 26536, June 3, 2009] ...

  10. The taxonomic significance of seed morphology in the Passiflora subgenus Astrophea (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Ana Carolina Mezzonato-Pires

    Full Text Available ABSTRACT The center of diversity for Passiflora subg. Astrophea is in low altitude areas of northern South America. The majority of species of this group are difficult to find in nature. Seed morphology was described in detail for 25 species of Passiflora subgenus Astrophea, a subgenus that until now did not exist. For morphological analysis, 20 seeds per species were measured for length, width and thickness, and the arithmetic means calculated. The seeds varied in length, width and thickness. Eight types of ornamentation were found. The margins varied among crestate, dentate, parted, entire and parted-crestate. The seed apex can be distinguished by the shape and position of the apical appendage. Seed shape varied among obovate, lanceolate, cordiform, and oblong to elliptical. An identification key was developed and a PCA was performed both using the principal morphological characters. Morphological characters of seeds are a new source of data for delimiting taxa with quite conflicting morphological boundaries, such as seen here with the Passiflora subgenus Astrophea. Furthermore, seed morphology is especially useful for the identification of specimens with only fruits and, consequently, seeds available.

  11. The rediscovery of Passiflora kwangtungensis Merr. (subgenus Decaloba supersection Disemma: a critically endangered Chinese endemic

    Directory of Open Access Journals (Sweden)

    Shawn Krosnick

    2013-06-01

    Full Text Available Passiflora kwangtungensis is a critically endangered Chinese species known from Guangxi, Guangdong, and Jiangxi Provinces. The species belongs to Passiflora subgenus Decaloba, supersection Disemma, section Octandranthus. Field observations decreased rapidly during the 1970s to 1980s, and it was suspected that this species might have been extirpated due to repeated deforestation events throughout southern China. In recent years, however, small isolated populations of this species have been rediscovered in Hunan Province, representing new locality records for P. kwangtungensis. New herbarium collections, color photographs, and silica gel collections have provided an unexpected opportunity to examine the evolutionary significance of this species. The current study presents a revised morphological description of P. kwangtungensis based on fresh material, along with an updated distribution map. Using nrITS sequence data, preliminary insights into the phylogenetic position of P. kwangtungensis are presented. Molecular data support the placement of P. kwangtungensis within supersection Disemma section Octandranthus. However, the exact placement of P. kwangtungensis within this lineage is unclear. The nrITS data suggest that P. kwangtungensis may be sister to a clade containing Passiflora from China, Nepal, India, and Southeast Asia. Morphologically, P. kwangtungensis displays the most similarity P. geminiflora (Nepal, India and P. henryi (China. Lastly, conservation status and recommendations are made for P. kwangtungensis following the IUCN Red List Criteria, where this species is classified as CR C1+C2a(i; D.

  12. Morphology and viability of pollen grains from passion fruit species (Passiflora spp.

    Directory of Open Access Journals (Sweden)

    Taliane Leila Soares

    2013-12-01

    Full Text Available The characterization and viability of pollen grains are useful tools to guide crosses in breeding programs. The objective of this study was to describe the morphological patterns and viability of pollen grains from five accessions of Passiflora edulis f. flavicarpa O. Deg. and five accessions of Passiflora setacea DC. Pollen morphology descriptions were made using light microscopy and scanning electron microscopy, whereas the viability analysis was performed by in vitro germination and histochemical analysis (Lugol's solution and 2,3,5-triphenyltetrazolium chloride. Pollen grains assessed for germination were inoculated in culture medium containing Ca(NO3.4H2O (0.03%, Mg(SO4.7H2O (0.02%, KNO3 (0.01%, H3BO3 (0.01%, sucrose (15% and agar (0.8%. Although P. edulis and P. setacea showed the same shape and type of pollen aperture, the two differed in terms of their morphology and exine ornamentation pattern. In vitro analysis showed that one of the P. edulis f. flavicarpa accessions (designated BGP 330 presented the highest germination rate (53.98% and longest pollen tube (2.18 mm. The histochemical analysis overestimated pollen viability when compared with the in vitro results. The results of this study contribute to the breeding of Passiflora species by increasing the understanding of their morphology and pollen grain viability.

  13. Adiabatic Rearrangement of Hollow PV Towers

    Directory of Open Access Journals (Sweden)

    Eric A Hendricks

    2010-10-01

    Full Text Available Diabatic heating from deep moist convection in the hurricane eyewall produces a towering annular structure of elevated potential vorticity (PV. This structure has been referred to as a hollow PV tower. The sign reversal of the radial gradient of PV satisfies the Charney-Stern necessary condition for combined barotropic-baroclinic instability. For thin enough annular structures, small perturbations grow exponentially, extract energy from the mean flow, and lead to hollow tower breakdown, with significant vortex structural and intensity change. The three-dimensional adiabatic rearrangements of two prototypical hurricane-like hollow PV towers (one thick and one thin are examined in an idealized framework. For both hollow towers, dynamic instability causes air parcels with high PV to be mixed into the eye preferentially at lower levels, where unstable PV wave growth rates are the largest. Little or no mixing is found to occur at upper levels. The mixing at lower and middle levels is most rapid for the breakdown of the thin hollow tower, consistent with previous barotropic results. For both hollow towers, this advective rearrangement of PV affects the tropical cyclone structure and intensity in a number of ways. First, the minimum central pressure and maximum azimuthal mean velocity simultaneously decrease, consistent with previous barotropic results. Secondly, isosurfaces of absolute angular momentum preferentially shift inward at low levels, implying an adiabatic mechanism by which hurricane eyewall tilt can form. Thirdly, a PV bridge, similar to that previously found in full-physics hurricane simulations, develops as a result of mixing at the isentropic levels where unstable PV waves grow most rapidly. Finally, the balanced mass field resulting from the PV rearrangement is warmer in the eye between 900 and 700 hPa. The location of this warming is consistent with observed warm anomalies in the eye, indicating that in certain instances the hurricane

  14. Molecular Genetic Variability of Commercial and Wild Accessions of Passion Fruit (Passiflora spp.) Targeting ex Situ Conservation and Breeding

    Science.gov (United States)

    Cerqueira-Silva, Carlos Bernard M.; Santos, Elisa S. L.; Jesus, Onildo N.; Vieira, João G. P.; Mori, Gustavo M.; Corrêa, Ronan X.; Souza, Anete P.

    2014-01-01

    Passiflora species are distributed throughout Latin America, and Brazil and Colombia serve as the centers of diversity for this genus. We performed cross-species amplification to evaluate 109 microsatellite loci in 14 Passiflora species and estimated the diversity and genetic structure of Passiflora cincinnata, Passiflora setaceae and Passiflora edulis. A total of 127 accessions, including 85 accessions of P. edulis, a commercial species, and 42 accessions of 13 wild species, were examined. The cross-species amplification was effective for obtaining microsatellite loci (average cross-amplification of 70%). The average number of alleles per locus (five) was relatively low, and the average diversity ranged from 0.52 in P. cincinnata to 0.32 in P. setacea. The Bayesian analyses indicated that the P. cincinnata and P. setacea accessions were distributed into two groups, and the P. edulis accessions were distributed into five groups. Private alleles were identified, and suggestions for core collections are presented. Further collections are necessary, and the information generated may be useful for breeding and conservation. PMID:25514245

  15. PV panel model based on datasheet values

    DEFF Research Database (Denmark)

    Sera, Dezso; Teodorescu, Remus; Rodriguez, Pedro

    2007-01-01

    This work presents the construction of a model for a PV panel using the single-diode five-parameters model, based exclusively on data-sheet parameters. The model takes into account the series and parallel (shunt) resistance of the panel. The equivalent circuit and the basic equations of the PV cell...

  16. Distributed PV Adoption - Sensitivity to Market Factors

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter; Sigrin, Ben

    2016-02-01

    NREL staff used the dSolar (distributed solar) model to forecast the adoption of distributed, behind-the-meter PV through the year 2050 for 9 different scenarios. The scenarios varied in their assumptions about a carbon tax, the cost of PV systems in the future, and what credit would be given for excess generation once current net metering policies expire.

  17. Identification and characterisation of Xanthomonas campestris pv

    African Journals Online (AJOL)

    Ednar Wulff

    2013-02-06

    Feb 6, 2013 ... Indiana 46514 USA) for identification of X. campestris pv. campestris following the instructions of the manufacturer. Acidovorax avenae subsp. avenae NCPPB 3353 a non- related plant pathogen to cabbage and Pseudomonas syringae pv. maculicola NCPPB 2039, a leaf spot pathogen of cabbage, served ...

  18. Initial development of passion fruit trees (Passiflora edulis f. flavicarpa, P. edulis f. edulis and P. alata grafted onto Passiflora cincinnata

    Directory of Open Access Journals (Sweden)

    Valdir Zucareli

    2014-10-01

    Full Text Available The present work aimed to evaluate the initial growth and leaf mineral levels in passion fruit trees (Passiflora edulis f. flavicarpa Deg., P. edulis f. edulis Sims. and P. alata Dryander grafted onto Passiflora cincinnata. To obtain seedlings, seeds were sown in plastic bags (500 mL and hypocotyl grafting was performed when seedlings reached the stage of two fully expanded leaves. Fifteen days after grafting, plants were transplanted to 10L pots filled with previously limed and fertilized soil. Each pot contained two plants and corresponded to one plot. For each commercial species studied as rootstock, experimental design was completely randomized, in 3x5 (plant type x time of harvest factorial arrangement, with four replicates of two plants per plot and five destructive harvests. Plant types were ungrafted P. cincinnata, ungrafted commercial passion fruit tree and commercial passion fruit tree grafted onto P. cincinnata. The first harvest was performed at 15 days after transplanting and the remaining ones at 14-day intervals (60, 74, 88, 102 and 116 DAS. At each harvest, the number of leaves per plant was counted, and leaf area, stem length, and stem, root, leaf and total dry matter were estimated. At the last harvest, the mineral composition (macro and micronutrients of plants was analyzed. In general, it was observed that grafting onto P. cincinnata did not interfere negatively with the initial development and mineral levels of commercial passion fruit trees, and this interference varied according to the used canopy.

  19. Evaluation of the antioxidant activity of passion fruit (Passiflora edulis and Passiflora alata) extracts on stimulated neutrophils and myeloperoxidase activity assays.

    Science.gov (United States)

    Zeraik, Maria Luiza; Serteyn, Didier; Deby-Dupont, Ginette; Wauters, Jean-Nöel; Tits, Monique; Yariwake, Janete H; Angenot, Luc; Franck, Thierry

    2011-09-15

    The antioxidant activity of methanol extracts from Passiflora edulis and Passiflora alata pulp, and P. edulis rinds, healthy or infected with the passion fruit woodiness virus (PWV), was investigated using the oxidant activities of the neutrophil and the neutrophil granule enzyme myeloperoxidase (MPO), both playing key roles in inflammation. The reactive oxygen species produced by stimulated neutrophils were evaluated by lucigenin-enhanced chemiluminescence (CL) and the activity of purified MPO was measured by SIEFED (Specific Immunological Extraction Followed by Enzymatic Detection), a technique for studying the direct interaction of a compound with the enzyme. The rind extracts of P. edulis possessed higher and dose-dependent inhibitory effects on CL response and on the peroxidase activity of MPO than total pulp extracts from both passion fruit species. The quantification of isoorientin in the extracts showed a correlation with their antioxidant activity, suggesting the potential of P. edulis rinds as functional food or as a possible source of natural flavonoids. Copyright © 2011 Elsevier Ltd. All rights reserved.

  20. Global PV markets and perspectives

    Energy Technology Data Exchange (ETDEWEB)

    Wolfsegger, Cristoph [European Photolvoltaic Industry Association (EPIA), Brussels, Belgium (Belgium)

    2007-06-15

    This presentation mainly talks about the global importance of the PV industry, not only in the environmental sphere but also in the economic sphere. It is firstly given the major information of the European Photovoltaic Industry Association (EPIA), where there can be found the lists of those full member countries that work as: components manufacturers, consulting, and associate members. Then, it is given a briefly explanation about the Alliance for Rural Electrification (ARE), and the reasons why the -PV systems- are almost the panacea to both the energy and the environmental issue. In addition, it is given the most relevant information about how to implement this system in those regions that have not yet implemented it. Besides, there are explained some of the benefits that this system has. It is shortly explained how this system is working in German and it is also shown a comparison chart about the photovoltaic feed-in tariffs. There are shown some graphics and charts having information related to the global markets and the global installations of PV systems and other issues related to them. [Spanish] Esta presentacion habla principalmente acerca de la importancia que hoy en dia tiene la industria fotovoltaica alrededor del mundo, esto no solo ocurre en el ambito ambiental sino tambien en el economico. En la primer parte se muestra la informacion mas importante acerca de la Asociacion Europea de la Industria Fotovoltaica (EPIA por sus siglas en ingles), en donde se encuentran las listas de los paises que son miembros permanentes trabajando como: fabricantes de componentes, asesores y miembros asociados. Enseguida, se da, de manera escueta, una explicacion acerca de la ARE, asi como las razones por las que los sistemas fotovoltaicos son casi la panacea tanto para los problemas ambientales como para los energeticos. Ademas, se explica la informacion mas relevante acerca de como implementar este sistema en aquellas partes del mundo que todavia no lo han realizado

  1. Learning in PV trends and future prospects

    International Nuclear Information System (INIS)

    Schaeffer, G.J.; De Moor, H.H.C.

    2004-06-01

    For large scale application of PV cost reduction is essential. It is shown in this study that the price evolution is on track and even accelerating the last 15 years. Using an experience curve approach a learning rate of little over 20% was found consistent with other studies. As data were collected for small rooftop grid connected systems, it could be shown that this learning rate is not only found for modules, but also for BOS (all costs apart from the modules) in Germany as well as in the Netherlands. Projections of the future price of PV systems show that a learning rate of at least 20% is needed to make introduction of PV affordable. It is very effective to invest in learning, thus increasing the learning rate, as well as developing market segments were the value of PV is higher, such as residential PV systems in southern Europe

  2. Power of design - the future of building-integrated PV

    International Nuclear Information System (INIS)

    Abbate, Cinzia

    2001-01-01

    This paper discusses strategies to make building integrated photovoltaic (PV) systems more acceptable and to allow PV material to compete with conventional construction material. The history of developments in building integration and difficulties encountered by architects wishing to use PV products are explored, and the Dutch Amersfoot project in Utrecht involving a new suburb of 501 house covered with PV panels is described. Questions raised regarding architectural integration of PV systems, and PV systems and the construction market are discussed. The Italian PV programme, financial and political constraints, and the positioning of PV on existing structures are reported

  3. Taxonomy, palynology and distribution notes of seven species of Passiflora L. (Passifloraceae s.s. newly recorded from Brazil

    Directory of Open Access Journals (Sweden)

    Ana Carolina Mezzonato-Pires

    2018-01-01

    Full Text Available Passiflora subgenus Astrophea is one of the five recognised subgenera of Passiflora. Brazil presents ca. 26 species of this subgenus with the majority distributed in the Amazon Basin. During the ongoing taxonomic revision of the Brazilian species of subg. Astrophea, seven species previously unknown for the country were recorded: Passiflora amoena, P. fuchsiiflora, P. jussieui, P. ovata, P. plumosa, P. quelchii, and P. tessmannii. The new records expand the species distribution ranges, especially for P. plumosa, which was exclusively known from its type locality and P. quelchii, which was known only for southeastern Guyana. The authors provide taxonomic and palynological descriptions, distribution maps and illustrations for these species, in the hope that the knowledge and understanding of Brazilian Passifloraceae s.s. will be improved.

  4. Taxonomy, palynology and distribution notes of seven species ofPassifloraL. (Passifloraceae s.s.) newly recorded from Brazil.

    Science.gov (United States)

    Mezzonato-Pires, Ana Carolina; Milward-de-Azevedo, Michaele Alvim; Mendonça, Cláudia Barbieri Ferreira; Gonçalves-Esteves, Vania

    2018-01-01

    Passiflora subgenus Astrophea is one of the five recognised subgenera of Passiflora . Brazil presents ca. 26 species of this subgenus with the majority distributed in the Amazon Basin. During the ongoing taxonomic revision of the Brazilian species of subg. Astrophea, seven species previously unknown for the country were recorded: Passiflora amoena , P. fuchsiiflora , P. jussieui , P. ovata , P. plumosa , P. quelchii , and P. tessmannii . The new records expand the species distribution ranges, especially for P. plumosa , which was exclusively known from its type locality and P. quelchii , which was known only for southeastern Guyana. The authors provide taxonomic and palynological descriptions, distribution maps and illustrations for these species, in the hope that the knowledge and understanding of Brazilian Passifloraceae s.s. will be improved.

  5. The use and limits of ITS data in the analysis of intraspecific variation in Passiflora L. (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Geraldo Mäder

    2010-01-01

    Full Text Available The discovery and characterization of informative intraspecific genetic markers is fundamental for evolutionary and conservation genetics studies. Here, we used nuclear ribosomal ITS sequences to access intraspecific genetic diversity in 23 species of the genus Passiflora L. Some degree of variation was detected in 21 of these. The Passiflora and Decaloba (DC. Rchb. subgenera showed significant differences in the sizes of the two ITS regions and in GC content, which can be related to reproductive characteristics of species in these subgenera. Furthermore, clear geographical patterns in the spatial distribution of sequence types were identified in six species. The results indicate that ITS may be a useful tool for the evaluation of intraspecific genetic variation in Passiflora.

  6. The use and limits of ITS data in the analysis of intraspecific variation in Passiflora L. (Passifloraceae).

    Science.gov (United States)

    Mäder, Geraldo; Zamberlan, Priscilla M; Fagundes, Nelson J R; Magnus, Tielli; Salzano, Francisco M; Bonatto, Sandro L; Freitas, Loreta B

    2010-01-01

    The discovery and characterization of informative intraspecific genetic markers is fundamental for evolutionary and conservation genetics studies. Here, we used nuclear ribosomal ITS sequences to access intraspecific genetic diversity in 23 species of the genus Passiflora L. Some degree of variation was detected in 21 of these. The Passiflora and Decaloba (DC.) Rchb. subgenera showed significant differences in the sizes of the two ITS regions and in GC content, which can be related to reproductive characteristics of species in these subgenera. Furthermore, clear geographical patterns in the spatial distribution of sequence types were identified in six species. The results indicate that ITS may be a useful tool for the evaluation of intraspecific genetic variation in Passiflora.

  7. Produção de néctar e visitas por abelhas em duas espécies cultivadas de Passiflora L. (Passifloraceae) Nectar production and bee visits in two cultivated species of Passiflora L. (Passifloraceae)

    OpenAIRE

    Isabela Galarda Varassin; Brunna Maria Setti Ximenes; Priscila Ambrósio Moreira; Mireille Maria Franco Zanon; Paula Elbl; Peter Löwenberg-Neto; Gabriel Augusto Rodrigues Melo

    2012-01-01

    A atividade dos polinizadores é afetada pela disponibilidade de recursos. Flores que produzem mais néctar podem ser mais visitadas e assim apresentar maior produção de frutos. O efeito da produção de néctar na atividade dos polinizadores foi testado em duas espécies cultivadas de maracujá, Passiflora alata Curtis e Passiflora edulis Sims, em Morretes, Paraná. Botões foram ensacados e o néctar acumulado das flores foi coletado em intervalos de 1 h. Em P. alata o volume e a concentração de solu...

  8. Expressão do gene ASYMMETRIC LEAVES1 (AS1) em explantes radiculares de Passiflora edulis Sims e organogênese in vitro em Passiflora setacea D.C. (Passifloraceae)

    OpenAIRE

    Vieira, Lorena Melo

    2011-01-01

    O presente estudo teve como objetivos caracterizar a expressão do gene ASYMMETRIC LEAVES1 (AS1), via hibridização in situ, durante a regeneração in vitro de segmentos radiculares de Passiflora edulis Sims, espécie comercialmente cultivada, e estabelecer um protocolo reproduzível via organogênese in vitro em Passiflora setacea, espécie silvestre. Explantes radiculares de P. edulis foram cultivados em meio MS, para indução de organogênese de ramos, suplementado com 2,35 μM de BA. Para dete...

  9. The market for photovoltaic (PV) technology

    International Nuclear Information System (INIS)

    Frantzis, L.; Vejtasa, K.M.

    1993-01-01

    This paper describes a study that was intended to provide the Electric Power Research Institute (EPRI) with a market analysis for photovoltaic (PV) technologies under development by EPRI and others. The analysis was to focus on markets and factors leading to significant incremental growth for PV demand, large enough to support more efficient scale PV manufacturing capacity. EPRI anticipates that PV ultimately could provide grid-connected power, however, the 1995--2010 market dynamics are uncertain. The specific objectives of this study, therefore, were to: determine what major future domestic US markets for PV technologies will emerge and provide enough volume to support significant improvements in manufacturing costs through manufacturing economies of scale; provide insight on what is needed to gain acceptance of PV technologies for electric power generation in those major markets; provide insight on when investments in demonstration and manufacturing facilities should be made and what is needed to be successful in each element of the business that these markets could support (e.g., technology development, manufacturing, sales, installation, and service); and provide key insights on the requirements for commercial success of PV in the utility sector

  10. First report and differential colonization of Passiflora species by the B biotype of Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) in Brazil.

    Science.gov (United States)

    Nunes, Endson S; Brown, Judith K; Moreira, Adriana G; Watson, Gillian; Lourenção, André L; Piedade, Sônia M S; Rezende, Jorge A M; Vieira, Maria L C

    2008-01-01

    This note is the first report of Bemisia tabaci (Gennadius) biotype B colonizing passionvine in Brazil. We examined the colonization of nine Passiflora species by a wild B type population under greenhouse conditions. P. amethystina Mikan was the most preferred species for oviposition and colonization, whereas P. suberosa L., P. coriacea Juss. and two commercially cultivated species, P. alata Curtis and P. edulis Sims f. flavicarpa Degener, were mostly uncolonised. P. morifolia Mast., P. cincinnata Mast., P. foetida L. and P. caerulea L. showed intermediate levels of colonization. Such differential colonization might suggest some degree of resistance by certain Passiflora species or oviposition preference by B. tabaci.

  11. First report and differential colonization of Passiflora species by the B biotype of Bemisia tabaci (Gennadius) (Hemiptera: Aleyrodidae) in Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Nunes, Endson S.; Vieira, Maria L.C. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Genetica]. E-mail: esnunes@carpa.ciagri.usp.br; mlcvieir@esalq.usp.br; Brown, Judith K. [University of Arizona, Tucson, AZ (United States). Dept. of Plant Sciences]. E-mail: jbrown@Ag.arizona.edu; Moreira, Adriana G.; Rezende, Jorge A.M. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Entomologia, Fitopatologia e Zoologia Agricola]. E-mails: agmoreir@esalq.usp.br; amrezen@esalq.usp.br; Watson, Gillian [California Dept. of Food and Agriculture, Sacramento, CA (United States)]. E-mail: gwatson@cdfa.ca.gov; Lourencao, Andre L. [Instituto Agronomico, Campinas, SP (Brazil). Centro de Pesquisa e Desenvolvimento de Fitossanidade]. E-mail: andre@iac.sp.gov.br; Piedade, Sonia M.S. [Escola Superior de Agricultura Luiz de Queiroz (ESALQ-USP), Piracicaba, SP (Brazil). Dept. de Ciencias Exatas]. E-mail: jsoniamsp@esalq.usp.br

    2008-11-15

    This note is the first report of Bemisia tabaci (Gennadius) biotype B colonizing passionvine in Brazil. We examined the colonization of nine Passiflora species by a wild B type population under greenhouse conditions. P. amethystina Mikan was the most preferred species for oviposition and colonization, whereas P. suberosa L., P. coriacea Juss. and two commercially cultivated species, P. alata Curtis and P. edulis Sims f. flavicarpa Degener, were mostly uncolonised. P. morifolia Mast., P. cincinnata Mast., P. foetida L. and P. caerulea L. showed intermediate levels of colonization. Such differential colonization might suggest some degree of resistance by certain Passiflora species or oviposition preference by B. tabaci. (author)

  12. Multifunctional a-Si PV systems

    Energy Technology Data Exchange (ETDEWEB)

    Peippo, K.; Lund, P.; Vartiainen, E. [Helsinki Univ. of Technology, Otaniemi (Finland). Advanced Energy Systems

    1998-10-01

    The optimal use of the various forms of solar energy (passive, active, daylighting, photovoltaics) in buildings calls for an optimal integration of the technologies. As energy conservation potential in space heating may soon be exhausted, electricity efficiency and on-site generation will play an increasing role in energy-conscious building design. There, dispersed PV systems integrated into buildings show a significant market potential, due to a number of benefits: no extra land area is required, PV-array may replace conventional cladding materials and become a building element. Moreover, the produced PV-electricity is more valuable for the building owner than for an electric utility

  13. Enraizamento de estacas de três espécies silvestres de Passiflora Cutting rooting of three wild Passiflora species

    Directory of Open Access Journals (Sweden)

    Marcelo Fideles Braga

    2006-08-01

    Full Text Available Em ambiente com nebulização controlada, estacas herbáceas com um par de folhas, contendo 2 ou 3 nós, foram testadas quanto ao enraizamento, utilizando-se de bandeja de poliestireno com célula de 95cm³ e saco plástico de 15x25x0,02cm com 1.730 cm³. Foram testadas estacas de Passiflora actinia, P. serrato-digitata e P. setacea. Observou-se que P. serrato-digitata apresentou 94,3% de estacas enraizadas com brotos e 2,4% de mortalidade; enquanto P. actinia e P. setacea apresentaram, respetivamente, 30,5% e 28,6% de estacas enraizadas com brotos e 56,8% e 60,7% de mortalidade. A alta mortalidade das estacas foi atribuída ao estado fenológico das matrizes de P. actinia e P. setacea e ao ataque de larvas de bradisia (Bradysia spp. Estacas com dois e três nós não apresentaram diferenças significativas, e o recipiente saco plástico de 1.730 cm³ proporcionou melhor desenvolvimento das mudas.Steam cuttings of three wild Passiflora species where tested for rooting in a mist regulated greenhouse. Cuttings with two or three buds were used with two kinds of containers: polystyrene trays with 95 cm³ cells and perforated plastic bags of 15x25x0.02cm, with 1,730 cm³. Passiflora serrato-digitata was the best, with 94.3% of rooted cuttings with shoots e only 2.4% of death cuttings. P. actinia and P. setacea showed , respectivelly, 30.5% and 28.6% of rooted cuttings and 56.8% and 60.7%, of death cuttings. The high death were attribute to phenological phases of P. actinia and P. setacea or injury caused by fungus-gnat larvae (Bradysia spp.. Cuttings with two or three buds didn't show differences among them. Plastic bags proporcioned the best results, increasing rooted cuttings and plant development.

  14. PV-hybrid and mini-grid

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-07-01

    Within the 5th European PV-hybrid and mini-grid conference 29th and 30th April, 2010 in Tarragona (Spain) the following lectures were held: (1) Overview of IEA PVPS Task 11 PV-hybrid systems within mini grids; (2) Photovoltaic revolution for deployment in developing countries; (3) Legal and financial conditions for the sustainable operation of mini-grids; (4) EU instruments to promote renewable energies in developing countries; (5) PV hybridization of diesel electricity generators: Conditions of profitability and examples in differential power and storage size ranges; (6) Education suit of designing PV hybrid systems; (7) Sustainable renewable energy projects for intelligent rural electrification in Laos, Cambodia and Vietnam; (8) Techno-economic feasibility of energy supply of remote villages in Palestine by PV systems, diesel generators and electric grid (Case studies: Emnazeil and Atouf villages); (9) Technical, economical and sustainability considerations of a solar PV mini grid as a tool for rural electrification in Uganda; (10) Can we rate inverters for rural electrification on the basis of energy efficiency?; (11) Test procedures for MPPT charge controllers characterization; (12) Energy storage for mini-grid stabilization; (13) Redox flow batteries - Already an alternative storage solution for hybrid PV mini-grids?; (14) Control methods for PV hybrid mini-grids; (15) Partial AC-coupling in mini-grids; (15) Normative issues of small wind turbines in PV hybrid systems; (16) Communication solutions for PV hybrid systems; (17) Towards flexible control and communication of mini-grids; (18) PV/methanol fuel cell hybrid system for powering a highway security variable message board; (19) Polygeneration smartgrids: A solution for the supply of electricity, potable water and hydrogen as fuel for transportation in remote Areas; (20) Implementation of the Bronsbergen micro grid using FACDS; (21) A revisited approach for the design of PV wind hybrid systems; (22

  15. Chromosome stickiness during meiotic behavior analysis of Passiflora serrato-digitata L. (PassifloraCEAE Aderência cromossômica durante a análise do comportamento meiótico de Passiflora serrato-digitata L (PassifloraCEAE

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Peres Kiihl

    2011-06-01

    Full Text Available Almost 90% of species of the genus Passiflora are native to the American continent, with high commercial value due to the fact that some species are used for human food while others have ornamental and medical qualities. Passiflora serrato-digitata is one of the species that integrates the Paraná Agronomic Institute germoplasm bank at its experimental base in Londrina, PR, Brazil. Collected flower buds were fixed in ethanol/acetic acid (3:1 v/v for 24h, transferred to 70% alcohol and stored under refrigeration. Slides were prepared by the squashing technique and stained with 1.0% propionic carmine; they were analyzed under an optic microscope. Irregularities in the chromosome segregation process of P. serrato-digitata have been verified by meiotic behavior analysis. These comprised precocious migration to poles in metaphase I and II, non-oriented chromosomes in metaphase plate in metaphase I and II, laggard chromosomes in anaphase I and II towards the formation of micronucleus in telophase I and II, and microspores in tetrads. Chromosome stickiness was another irregularity reported in the Passiflora genus for the first time. These irregularities which also contributed to the formation of monads, dyads and triads, resulted in normal imbalanced 2n and 4n microspores. According to the observed Meiotic Index of 71.83%, this species is not meiotically stable.Cerca de 90% das espécies do gênero Passiflora são nativas das Américas, sendo que aproximadamente 200 espécies são nativas do Brasil. Possuem grande importância comercial, pois algumas espécies são utilizadas na alimentação humana, outras apresentam propriedades medicinais e ornamentais. A espécie Passiflora serrato-digitata faz parte do banco de germoplasma do Instituto Agronômico do Paraná - IAPAR, estação experimental de Londrina, PR. Botões florais colhidos foram fixados em etanol/ácido acético (3:1 v/v por 24 horas, transferidos para álcool a 70% e acondicionado sob

  16. Transformerless PV inverters. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Borup, U.

    2009-12-15

    Since the start of the project the market for grid connected PV inverters have developed further. When the project started three - phase inverter were only available in high power systems. The technology developed within this project will enable three phase technology also to be implemented in string inverters for system down to 10 kW. We expect this to be very attractive due to the increased demand for symmetrical feed-in to the grid. The project relevance is therefore high and the sector continues to develop very much driven by technology. Especially the inverter technology is getting a lot of focus. The inverter systems are expected to take a much larger role in supporting the electrical grid in the future. The technology platform developed within the project is prepared to be extended with these utility functionalities. The main results of the project were: 1) A new technology concept for transformer-less inverters has been demonstrated with a number of prototypes. 2) Efficiency above 97,7% has been proven. 3) Efficiency and Maximum power point tracking has been optimized to ensure that almost all energy produced of the panels is transferred to the grid. 4) The platform is developed with a very fast control board, which enables extended functionality as demanding grid supporting functions in the future. Details about cost price and details about the control loop implementation is excluded from the report due to the competitive situation for Danfoss Solar Inverters A/S. (LN)

  17. Robust PV Degradation Methodology and Application

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, Dirk [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Deline, Christopher A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kimball, Greg [SunPower; Anderson, Mike [SunPower

    2017-11-15

    The degradation rate plays an important role in predicting and assessing the long-term energy generation of PV systems. Many methods have been proposed for extracting the degradation rate from operational data of PV systems, but most of the published approaches are susceptible to bias due to inverter clipping, module soiling, temporary outages, seasonality, and sensor degradation. In this manuscript, we propose a methodology for determining PV degradation leveraging available modeled clear-sky irradiance data rather than site sensor data, and a robust year-over-year (YOY) rate calculation. We show the method to provide reliable degradation rate estimates even in the case of sensor drift, data shifts, and soiling. Compared with alternate methods, we demonstrate that the proposed method delivers the lowest uncertainty in degradation rate estimates for a fleet of 486 PV systems.

  18. China PV Business and Applications Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Sherring, Chris (Sherring Energy Associates)

    1999-08-30

    This report provides an overview of photovoltaics (PV) business and applications in China. Although more than 70 million people in China are without access to grid electricity, many of the unelectrified regions benefit from considerable renewable resources, including good solar insolation. Current annual PV sales are still modest, however, and are estimated to be between 2.0 and 2.5 megawatts. This and other significant PV data, including information regarding the current status of key aspects of Chinese businesses, markets, and distribution channels, are included in the report. Detailed company profiles of Chinese business organizations and summaries of visits made to these companies (as well as to more remote sites in Inner Mongolia to examine PV usage by the end-use customer) in September-October 1998 are also presented.

  19. Robust PV Degradation Methodology and Application

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, Dirk [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Deline, Christopher A [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurtz, Sarah [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kimball, Gregory M. [SunPower Corporation; Anderson, Mike [SunPower Corporation

    2017-12-21

    The degradation rate plays an important role in predicting and assessing the long-term energy generation of photovoltaics (PV) systems. Many methods have been proposed for extracting the degradation rate from operational data of PV systems, but most of the published approaches are susceptible to bias due to inverter clipping, module soiling, temporary outages, seasonality, and sensor degradation. In this paper, we propose a methodology for determining PV degradation leveraging available modeled clear-sky irradiance data rather than site sensor data, and a robust year-over-year rate calculation. We show the method to provide reliable degradation rate estimates even in the case of sensor drift, data shifts, and soiling. Compared with alternate methods, we demonstrate that the proposed method delivers the lowest uncertainty in degradation rate estimates for a fleet of 486 PV systems.

  20. Leakage current measurement in transformerless PV inverters

    DEFF Research Database (Denmark)

    Kerekes, Tamas; Sera, Dezso; Mathe, Laszlo

    2012-01-01

    Photovoltaic (PV) installations have seen a huge increase during the last couple of years. Transformerless PV inverters are gaining more share of the total inverter market, due to their high conversion efficiency, small weight and size. Nevertheless safety should have an important role in case...... of these tranformerless systems, due to the missing galvanic isolation. Leakage and fault current measurement is a key issue for these inverter topologies to be able to comply with the required safety standards. This article presents the test results of two different current measurement sensors that were suggested...... to be used in commercial PV inverters for the measurement of leakage and fault ground currents. The German VDE0126–1–1 standard gives the limit for fault and leakage ground currents and all grid connected PV inverters have to comply with these limits and disconnect from the grid in case of a fault....

  1. Distributed PV Adoption in Maine Through 2021

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter; Sigrin, Ben

    2015-11-06

    NREL has used its dSolar (distributed solar) model to generate low-medium-high estimates of distributed PV adoption in Maine through 2021. This presentation gives a high-level overview of the model and modeling results.

  2. DNA polymorphism analysis of Xanthomonas campestris pv ...

    African Journals Online (AJOL)

    strand conformation polymorphism (SSCP) techniques using M13 and 16S rRNA primers, respectively, for genotyping of the phytopathogenic bacterium Xanthomonas campestris pv. campestris was studied. RAPD provided a simple, rapid, and ...

  3. Auxin and physical constraint exerted by the perianth promote androgynophore bending in Passiflora mucronata L. (Passifloraceae).

    Science.gov (United States)

    Rocha, D I; Monte Bello, C C; Sobol, S; Samach, A; Dornelas, M C

    2015-05-01

    The androgynophore column, a distinctive floral feature in passion flowers, is strongly crooked or bent in many Passiflora species pollinated by bats. This is a floral feature that facilitates the adaptation to bat pollination. Crooking or bending of plant organs are generally caused by environmental stimulus (e.g. mechanical barriers) and might involve the differential distribution of auxin. Our aim was to study the role of the perianth organs and the effect of auxin in bending of the androgynophore of the bat-pollinated species Passiflora mucronata. Morpho-anatomical characterisation of the androgynophore, including measurements of curvature angles and cell sizes both at the dorsal (convex) and ventral (concave) sides of the androgynophore, was performed on control flowers, flowers from which perianth organs were partially removed and flowers treated either with auxin (2,4-dichlorophenoxyacetic acid; 2,4-D) or with an inhibitor of auxin polar transport (naphthylphthalamic acid; NPA). Asymmetric growth of the androgynophore column, leading to bending, occurs at a late stage of flower development. Removing the physical constraint exerted by perianth organs or treatment with NPA significantly reduced androgynophore bending. Additionally, the androgynophores of plants treated with 2,4-D were more curved when compared to controls. There was a larger cellular expansion at the dorsal side of the androgynophores of plants treated with 2,4-D and in both sides of the androgynophores of plants treated with NPA. This study suggests that the physical constraint exerted by perianth and auxin redistribution promotes androgynophore bending in P. mucronata and might be related to the evolution of chiropterophily in the genus Passiflora. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

  4. Rating PV Power and Energy: Cell, Module, and System Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Emery, Keith

    2016-06-02

    A summary of key points related to research-level measurements of current vs. voltage measurement theory including basic PV operation, equivalent circuit, and concept of spectral error; PV power performance including PV irradiance sensors, simulators and commercial and generic I-V systems; PV measurement artifacts, intercomparisons, and alternative rating methods.

  5. A Practical Optimization Method for Designing Large PV Plants

    DEFF Research Database (Denmark)

    Kerekes, Tamas; Koutroulis, E.; Eyigun, S.

    2011-01-01

    Nowadays Photovoltaic (PV) plants have multi MW sizes, the biggest plants reaching tens of MW of capacity. Such large-scale PV plants are made up of several thousands of PV panels, each panel being in the range of 150-350W. This means that the design of a Large PV power plant is a big challenge...

  6. Building PV markets: customers and prices

    International Nuclear Information System (INIS)

    Haas, Reinhard

    2002-01-01

    What makes market deployment strategies for PV successful? A group of specialists (from IEA Task 7) has been looking at the progress made so far. Here, in the first of two articles based on their report, the author presents some of their findings, including benefits and barriers for defined groups of customers; how customers for PV systems are identified, and what they are willing to pay. It also looks at current prices in different countries, and their possible trends. (Author)

  7. Assay of quadranguloside, the major saponin of leaves of Passiflora alata, by HPLC-UV.

    Science.gov (United States)

    Reginatto, Flávio H; Gosmann, Grace; Schripsema, Jan; Schenkel, Eloir P

    2004-01-01

    An HPLC method with UV detection has been developed and validated in order to quantify quadranguloside, the main saponin of the leaves of Passiflora alata. The analysis was achieved by simple isocratic elution (with acetonitrile:aqueous phosphoric acid) using a Nova-Pak phenyl column. The amount of quadranguloside present in aqueous extracts from leaves of P. alata was estimated to be 22.2% (w/w), corresponding to 0.8% (w/w) in relation to dried leaves. The assay method described is simple, rapid, accurate and sensitive, and may form part of future drug authentication protocols.

  8. The combination of Passiflora alata and Valeriana officinalis on memory tasks in mice: comparison with diazepam

    Directory of Open Access Journals (Sweden)

    Helvo Slomp Junior

    2010-12-01

    Full Text Available The effect of a compound combining Valeriana officinalis and Passiflora alata extracts was tested on two mouse memory models: habituation and step-through inhibitory avoidance. Diazepam (1.0 and 2.5 mg/kg was used as a positive control. Acute diazepam (2.5 mg/kg before training impaired the habituation and performance in the inhibitory avoidance. On the other hand, acute phytotherapeutic compound (40-160 mg/kg, also before the training session, did not alter mouse behavior in these models. Repeated (15 days treatment with the compound also did not impair the habituation. At the doses used, no locomotor effect was found. Taken together, the results suggest that, contrary to diazepam, the anxiolytic Valeriana officinalis and Passiflora alata compound did not induce amnesia.Avaliou-se o efeito de um composto fitoterápico de Valeriana officinalis e Passiflora alata em dois modelos de memória em camundongos: habituação e esquiva inibitória tipo step-trough. Diazepam (1,0 e 2,5 mg/kg foi empregado como controle positivo. Agudamente, a administração de diazepam (2,5 mg/kg antes do treino prejudicou o desempenho na habituação e na esquiva inibitória. Por outro lado, a administração aguda do composto fitoterápico (40-160 mg/kg antes do treino não alterou o comportamento dos camundongos nestes modelos. Tratamento com o composto fitoterápico por 15 dias também não alterou o comportamento dos animais. Nas doses empregadas não se observou alteração da atividade motora. Os dados sugerem que, diverso do diazepam, este fitoterápico ansiolítico composto de Valeriana officinalis e Passiflora alata não causa amnésia.

  9. Aphrodisiac activity of methanol extract of leaves of Passiflora incarnata Linn in mice.

    Science.gov (United States)

    Dhawan, Kamaldeep; Kumar, Suresh; Sharma, Anupam

    2003-04-01

    The aphrodisiac properties of the methanol extract of leaves of Passiflora incarnata Linn. have been evaluated in mice by observing the mounting behaviour. The methanol extract of P. incarnata exhibited significant aphrodisiac behaviour in male mice at all doses, i.e. 75, 100 and 150 mg/kg. Amongst these, the highest activity was observed with the 100 mg/kg dose when the mountings were calculated about 95 min after the administration of the test extracts. Copyright 2003 John Wiley & Sons, Ltd.

  10. Maracujá-doce: o autor, a obra e a data da publicação de Passiflora alata (Passifloraceae Sweet-passion-fruit: the autor, data and publication of the scientific name of Passiflora alata (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Luís Carlos Bernacci

    2003-08-01

    Full Text Available O maracujazeiro-doce (Passiflora alata Curtis é uma espécie nativa da América do Sul, especialmente do Brasil, cujo cultivo tem se expandido em função do preço alcançado pelos frutos. Vários trabalhos de pesquisa foram realizados com esta espécie, quase todos com imprecisões na citação do nome científico. Com o objetivo de avaliar a extensão desses equívocos e identificar a forma cientificamente correta de citar a espécie, foram investigados o autor e a data de publicação do nome científico do maracujá-doce, em estudos taxonômicos. Concluiu-se que a espécie deve ser citada como Passiflora alata Curtis, conforme publicado originalmente em 1788, no periódico Botanical Magazine.The author, data and publication of the scientific name of the sweet passion-fruit had been investigated. A series of mistakes occurred in relation to the correct citation of the species. The aim of the present paper was to evaluate the problems and identify the scientific correct form of Passiflora alata nomenclature. The species must be cited as Passiflora alata Curtis and was published originally in 1788, in the Botanical Magazine.

  11. PV Obelisk - Information system with photovoltaics

    International Nuclear Information System (INIS)

    Ruoss, D.; Rasmussen, J.

    2004-01-01

    This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed

  12. Environmental impact of PV cell waste scenario.

    Science.gov (United States)

    Bogacka, M; Pikoń, K; Landrat, M

    2017-12-01

    Rapid growth of the volume of waste from PV cells is expected in the following years. The problem of its utilization seems to be the most important issue for future waste management systems. The environmental impacts of the PV recycling scenario are presented in the manuscript. The analysis is based on the LCA approach and the average data available in specialized databases for silicon standard PV cell is used. The functional unit includes parameters like: efficiency, composition, surface area. The discussion on the environmental impact change due to the location of the PV production and waste processing plants is presented in the manuscript. Additionally, the discussion on the environmental effect of substituting different energy resources with PV cells is presented in the manuscript. The analysis of the PV cell life cycle scenario presented in the article was performed using the SIMA PRO software and data from Ecoinvent 3.0 database together with additional data obtained from other sources. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. The Value of Transparency in Distributed Solar PV Markets

    Energy Technology Data Exchange (ETDEWEB)

    OShaughnessy, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zamzam, Ahmed S [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-12-01

    Market transparency refers to the degree of customer awareness of product options and fair market prices for a given good. In The Value of Transparency in Distributed Solar PV Markets, we use residential solar photovoltaic (PV) quote data to study the value of transparency in distributed solar PV markets. We find that improved market transparency results in lower installation offer prices. Further, the results of this study suggest that PV customers benefit from gaining access to more PV quotes.

  14. Is solar PV generated electricity cheap in South Africa?

    CSIR Research Space (South Africa)

    Roro, Kittessa T

    2015-07-01

    Full Text Available Recent reported utility scale PV prices 222 % decrease in investment in 2013, despite record capacity additions of more than 32 % Solar PV Global Capacity Additions & Investment, 2004-2013 Main reason: Module prices are getting lower! Sources: REN21... curve: Volume + 100 % → Price -20 %Source: Navigant / PSE 2013 12 Contents Global PV overview South African PV market overview Recent reported utility scale PV prices 13 Integrated Resource Plan 2010 (IRP 2010, promulgated version) plans capacity...

  15. Assessing the PV business opportunities in Greece

    International Nuclear Information System (INIS)

    Patlitzianas, Konstantinos D.; Skylogiannis, Georgios K.; Papastefanakis, Dimitrios

    2013-01-01

    Highlights: • An approach of qualitative judgments for the PV opportunities through the assessing of the licenses’ value in Greece. • It can be supplied in other countries by applying different weights to the criteria. • It can be used by everyone in order to find a suitable PV investment without the need of experts in the field. - Abstract: Greece, as a member of the European Union (EU), has undertaken the obligation to meet the expected goals for the penetration of Renewable Energy Sources (RES) in the national energy balance in compliance with “20–20–20” goals (20% of the Gross Energy Consumption and 40% of the Gross Electricity Consumption should be covered by RES). Although the development of RES, and particularly of Photovoltaic (PV), in Greece during the last years has presented a satisfactory growth, the country is still far away from the above goals. The main reason for this delay is that – except the financial crisis – many licenses are inactive and waiting funding in order to be utilized. Additionally, the latest law (L.4152/2013) has forbidden the interconnection of new PV power Plants to the grid until the end of 2013. The above fact determines the significance of the existing PV Licenses in achieving the national goals. The aim of this paper is to present an integrated approach of qualitative judgments for the PV business opportunities through the assessing of the licenses’ value in Greece. The approach, which is based on a Multi Criteria Decision Making (MCDM) theory of quantifying multiple qualitative judgments, takes into account the real factors which can affect the expected production and cost of the PV installation and therefore the RoI (Return of Investment)

  16. Optimization of PV-based energy production by dynamic PV-panel/inverter configuration

    DEFF Research Database (Denmark)

    Paasch, Kasper; Nymand, Morten; Haase, Frerk

    This paper investigates the possible increase in annual energy production of a PV system with more than one MPPT (maximum power point tracker) input channels under Nordic illumination conditions, in case a concept of dynamic switching of the PV panels is used at the inputs of the inverters....

  17. Pollen morphology of selected species of Passiflora L. (Passifloraceae from the Atlantic Forest

    Directory of Open Access Journals (Sweden)

    Ana Carolina Mezzonato-Pires

    2015-09-01

    Full Text Available Pollen grains from twelve species of the Passifloraceae family from the Brazilian Atlantic Forest were analyzed: Passiflora subg. Astrophea (1sp., P.subg. Decaloba (1sp. and P.subg. Passiflora (10spp.. The current study aims to acquire additional information and feature the pollen morphology of the herein studied species to help setting a more precise taxa delimitation. Acetolyzed pollen grains were measured, described and illustrated using light and scanning electron microscopy. The pollen grains were medium or large sized, oblate spheroidal, suboblate, prolate spheroidal and subprolate; 4-colpate (P. kermesina, 6-12-pantocolporate (P. mediterranea, 6-colpate (P. mucronata, 6-colporate (P. pentagona, 12-colporate (P. misera or 6-syncolpate (in most species. The presence of reticulate sexine, pseudopercula, pontopercula and/or opercula was observed. The endoaperture was just found in P. pentagonaand P. misera. It was concluded that pollen morphology is an important source of taxonomic features useful for distinguishing species and characterizing the three subgenera. The current study provides additional information that, along with other previously published studies, will enable a better understanding of phylogenetic relations among these strains.

  18. Paternal, maternal, and biparental inheritance of the chloroplast genome in Passiflora (Passifloraceae): implications for phylogenetic studies.

    Science.gov (United States)

    Hansen, A Katie; Escobar, Linda K; Gilbert, Lawrence E; Jansen, Robert K

    2007-01-01

    Patterns of inheritance of the chloroplast genome in Passiflora were analyzed by examining the progeny from both interspecific and intraspecific crosses. Artificial crosses of field-collected material were performed in greenhouses at The University of Texas at Austin. DNA from fresh leaf material was analyzed by Southern blot techniques to identify the donor of the chloroplast genome. Initially, single progeny were analyzed for 11 crosses; two intraspecific crosses demonstrated maternal inheritance, whereas the nine interspecific crosses had paternal inheritance. Subsequently, the donor of the chloroplast genome was determined for multiple progeny in seven crosses. Passiflora oerstedii × P. retipetala showed strict paternal inheritance in all of 17 progeny. A series of five crosses and backcrosses between P. oerstedii and P. menispermifolia demonstrated strictly paternal inheritance. Finally, when 15 progeny were analyzed for the P. costaricensis × P. costaricensis cross, 12 of the 15 showed maternal inheritance, whereas the remaining three were biparental. Interestingly, all interspecific crosses had primarily paternal inheritance, whereas all intraspecific crosses had primarily maternal inheritance. The implications of heteroplasmy on phylogenetic analyses of chloroplast DNA are discussed.

  19. Medicinal potential of Passiflora foetida L. plant extracts: biological and pharmacological activities.

    Science.gov (United States)

    Asadujjaman, Md; Mishuk, Ahmed Ullah; Hossain, Md Aslam; Karmakar, Utpal Kumar

    2014-03-01

    To investigate analgesic, antidiarrhoeal and cytotoxic activities of the ethanol extract of Passiflora foetida L. (Passifloraceae) by three experimental methods. Analgesic activity of the ethanol extract of Passiflora foetida L. (EEPF) acetic acid-induced writhing inhibition in mice. The method of castor oil-induced diarrhoea in mice was utilized to evaluate antidiarrhoeal activity. The cytotoxic activity of EEPF was explored with a brine shrimp lethality bioassay. The extract showed 68.75% and 30.00% inhibition of writhe at the doses of 500 and 250 mg/kg body weight, respectively. The extract increased the mean latent period prior to diarrhoeal onset to about 1.55 h and 1.17 h, and decreased the mean number of stools to 4.4 and 5.6 at the doses of 500 and 250 mg/kg body weight. The extract also demonstrated cytotoxic activity in the brine shrimp lethality assay, and the median lethal concentration for brine shrimp nauplii was 80 μg/mL. The results suggest that the plant extract has analgesic and antidiarrhoeal activities, supporting its uses in traditional medicine. The results also demonstrate that the plant extract possesses cytotoxic activities.

  20. Bioactive amines in Passiflora are affected by species and fruit development.

    Science.gov (United States)

    Bomtempo, Larissa L; Costa, Ana Maria; Lima, Herbert; Engeseth, Nicki; Gloria, Maria Beatriz A

    2016-11-01

    Bioactive amines were determined in selected passion fruit species and throughout fruit development. The same amines (spermine, spermidine, agmatine, putrescine and tryptamine) were found in four Passiflora species (2008-2010 growing seasons) at different concentrations: P. alata had higher polyamines (spermine+spermidine, 8.41mg/100g); P. setacea and P. nitida had higher putrescine (>7.0mg/100g); and P. setacea had higher agmatine contents (1.37mg/100g) compared to the others. The indolamine tryptamine was present at low concentrations in all species (~0.05mg/100g). P. nitida and P. alata had the highest soluble solids (~18°Brix); P. edulis had the lowest pH (2.97) and P. nitida the highest pH (4.19). Throughout P. setacea fruit development, the concentrations of spermidine, putrescine and agmatine decreased; spermine contents did not change; and pH decreased. Fruit shelf life and some of the health promoting properties of Passiflora and their synthesis are modulated by species. Copyright © 2016 Elsevier Ltd. All rights reserved.

  1. LC and UV determination of flavonoids from Passiflora alata medicinal extracts and leaves.

    Science.gov (United States)

    Müller, Simony D; Vasconcelos, Sonia B; Coelho, Michelly; Biavatti, Maique W

    2005-02-23

    The leaves of Passiflora alata Curtis (an official species in the Brazilian Pharmacopoeia) are used to treat anxiety, as antispasmodics and sedatives. The development of new analytical methods for analysing flavonoids in Passiflora species is needed in order to improve the quality assurance of the plant and derived extracts and phytomedicines. A survey on the profile of flavonoids and content of isovitexin in the leaves and fluidextract of P. alata through LC was carried out, comparing its chromatographic profiles with a commercial P. incarnata fluidextract. Also, the concentration of the total flavonoids of extracts and leaves according to phamarcopoeial photometrical methods was determined and discussed. The fluidextract of P. alata was produced in accordance with the Pharmacopoeia Helvetica method; the presence of isovitexin in both species (which have distinct chromatographic profiles) was evidenced, this being the major flavonoid compound in the P. incarnata (1.198 g%), but not in P. alata (0.018 g%) fluidextract. Only traces of vitexin could be observed in the P. alata, as well as the absence of the other tested flavonoids: orientin and swertisin (P. incarnata markers), hyperoside, rutin, hesperidin and clorogenic acid. The LC developed method was shown to be appropriated for the qualitative and quantitative analyses and for differentiate species, suitable to be applied to commercial sample analysis. The spectrophotometrical results of three different methods described for P. incarnata were not comparable, the best performance being the British Pharmacopoeia method.

  2. Occupational respiratory allergic disease induced by Passiflora alata and Rhamnus purshiana.

    Science.gov (United States)

    Giavina-Bianchi, P F; Castro, F F; Machado, M L; Duarte, A J

    1997-11-01

    There has been an increase in the incidence of occupational asthma along with better understanding of its pathophysiologic mechanisms and etiologic factors. There are no reports of patients with asthma and rhinitis to Passiflora alata (passion flower) and Rhamnus purshiana (cascara sagrada). We describe two substances of plant origin as causal agents of occupational allergic respiratory diseases in a patient who worked in a pharmacy devoted to the manual preparation of products. Skin testing and Western blot confirmed the sensitization of the patient to these plant extracts in vivo and in vitro, respectively. Bronchial challenge confirmed the cause-effect relationship between the allergen exposure and the diseases. We conclude that Passiflora and cascara sagrada are two new etiologic agents of IgE-mediated occupational asthma and rhinitis. The present study also serves to alert physicians to the risks associated with work in pharmacies devoted to manual preparation of plant extracts, emphasizing the importance of the use of protective measures in these environments.

  3. Applying design of experiments (DOE to flavonoid extraction from Passiflora alata and P. edulis

    Directory of Open Access Journals (Sweden)

    Peky Noriega

    2012-03-01

    Full Text Available The Passifloraceae family is extensively used in native Brazilian folk medicine to treat a wide variety of diseases. The problem of flavonoid extraction from Passiflora was treated by application of design of experiments (DOE, as an experiment with mixture including one categorical process variable. The components of the binary mixture were: ethanol (component A and water (component B; the categorical process variable: extraction method (factor C was varied at two levels: (+1 maceration and (-1 percolation. ANOVA suggested a cubic model for P. edulis extraction and a quadratic model for P. alata.These results indicate that the proportion of components A and B in the mixture is the main factor involved in significantly increasing flavonoid extraction. In regard to the extraction methods, no important differences were observed, which indicates that these two traditional extraction methods could be effectively used to extract flavonoids from both medicinal plants. The evaluation of antioxidant activity of the extract by ORAC method showed that P. edulis displays twice as much antioxidant activity as P. alata. Considering that maceration is a simple, rapid and environmentally friendly extraction method, in this study, the optimized conditions for flavonoid extraction from these Passiflora species is maceration with 75% ethanol for P. edulis and 50% ethanol for P. alata.

  4. Anti-Trichomonas vaginalis activity of saponins from Quillaja, Passiflora, and Ilex species.

    Science.gov (United States)

    Rocha, Tábitha Dahmer; de Brum Vieira, Patrícia; Gnoatto, Simone Cristina Baggio; Tasca, Tiana; Gosmann, Grace

    2012-06-01

    Trichomonas vaginalis is a flagellated protozoan that causes trichomonosis, the most prevalent non-viral STD worldwide. The pathogen has been associated with serious health consequences including predisposition to cervical cancer and adverse pregnancy outcomes and infertility. It also acts as a co-factor in HIV transmission and acquisition. The 5-nitroimidazole drugs are used in the treatment, however, treatment noncompliance is observed, and a growing number of T. vaginalis isolates resistant to the drugs have been related. Saponins are natural products possessing many biological activities such as antiprotozoan activity. The aim of this study was to evaluate the anti-T. vaginalis activity of saponins from Quillaja, Passiflora, and Ilex species. Saponins from Passiflora alata and Quillaja saponaria presented the best anti-T. vaginalis activity (MIC = 0.025%). In addition, all samples induced erythrocyte lysis and LDH release. As far as we know, this is the first report demonstrating the potential anti-T. vaginalis activity of these saponins.

  5. Alum-type adjuvant effect of non-haemolytic saponins purified from Ilex and Passiflora spp.

    Science.gov (United States)

    Silveira, F; Rossi, S; Fernández, C; Gosmann, G; Schenkel, E; Ferreira, F

    2011-12-01

    Five saponins purified from the leaves of three Ilex species (saponins 1 and 2 from I. dumosa; saponin 3 from I. argentina; saponin 4 from I. paraguariensis) and from Passiflora alata (saponin 5) were evaluated for their in vitro haemolytic activity and in vivo immunostimulatory ability in a mouse model using tetanus toxoid (TT) as a model antigen. The assayed saponins showed very weak or no haemolytic activity over the tested concentration range. Mice were immunized twice with TT formulated with pure saponins 1-5, or with a mixture of saponins from Quillaja saponaria, aluminum hydroxide gel or saline, which were used as controls. The elicited humoral response was evaluated by means of the time course of specific serum antibody levels up to day 131 post-priming (total IgG and isotypes); the cellular response was tested through a delayed-type hypersensitivity (DTH) assay. The assayed saponins, in particular saponins 3 and 5, showed an adjuvant effect similar to that of alum for all tested parameters. The immunostimulating potential of these compounds deserves further investigation, especially taking into account that some Ilex spp. and Passiflora alata are native crops of widespread use and economical importance in Latin America. Copyright © 2011 John Wiley & Sons, Ltd.

  6. In vitro pollen germination and pollen viability in passion fruit (Passiflora spp.

    Directory of Open Access Journals (Sweden)

    Taliane Leila Soares

    2013-12-01

    Full Text Available The use of Passiflora species for ornamental purposes has been recently developed, but little is known about pollen viability and the potential for crossing different species. The objective of this study was to evaluate the pollen viability of six Passiflora species collected from different physiological stages of development through in vitro germination and histochemical analysis using dyes. The pollen was collected in three stages (pre-anthesis, anthesis and post-anthesis. Three compositions of culture medium were used to evaluate the in vitro germination, and two dyes (2,3,5-triphenyltetrazolium chloride, or TTC, and Lugol's solution were used for the histochemical analysis. The culture medium containing 0.03% Ca(NO3 4H2O, 0.02% of Mg(SO4 .7H2O, 0.01% of KNO3, 0,01% of H3BO3, 15% sucrose, and 0.8% agar, pH 7.0, showed a higher percentage of pollen grains germinated. Anthesis is the best time to collect pollen because it promotes high viability and germination. The Lugol's solution and TTC dye overestimated the viability of pollen, as all accessions showed high viability indices when compared with the results obtained in vitro.

  7. Caracterização de preparações extrativas obtidas de Passiflora alata Curtis

    Directory of Open Access Journals (Sweden)

    ANDREAS S. L. MENDEZ

    2011-06-01

    Full Text Available O presente trabalho teve como objetivo fazer uma análise comparativa da qualidade de preparações extrativas obtidas de Passiflora alata Curtis, além de descrever esse processo. O extrato líquido foi obtido por refluxo utilizando água como solvente em proporção 1:10. A preparação líquida foi submetida à secagem em spray dryer utilizando aerosil® e fosfato de cálcio como adjuvantes tecnológicos. A eficiência de extração foi avaliada através da determinação do resíduo seco e do teor de flavonoides totais por técnica de espectrofotometria no UV. O extrato seco foi avaliado quanto à viabilidade tecnológica a partir da determinação das características de granulometria e da estabilidade em ambientes de umidade relativa controlada. O teor de flavonoides totais para o extrato seco apresentou redução quando comparado à solução extrativa, indicando possível influência do processo de secagem na composição do material. Os resultados de caracterização tecnológica demonstraram que o processo de secagem utilizado garante uma uniformidade de tamanho particular, embora seja observada uma tendência de higroscopicidade do material em ambientes de elevada umidade relativa. As técnicas empregadas se mostraram viáveis para uso em ensaios quali-quantitativos aplicados à determinação da qualidade dos extratos desenvolvidos. Palavras-chave: Passiflora alata Curtis; Preparações extrativas; Spray-drying; Flavonoides totais; Caracterização tecnológica. ABSTRACT Characterization of extracts prepared from Passiflora alata Curtis This paper describes a process to prepare liquid and dried aqueous extracts from aerial parts of Passiflora alata Curtis (sweet passionfruit and reports a comparative analysis of the extractive preparations obtained. The extractive solution was obtained by refluxing the plant material with water in the proportion 1:10 (w/v. The aqueous extract was dried in a spray-dryer, with Aerosil® and calcium

  8. Comparative metabolite profiling and fingerprinting of genus Passiflora leaves using a multiplex approach of UPLC-MS and NMR analyzed by chemometric tools.

    Science.gov (United States)

    Farag, Mohamed A; Otify, Asmaa; Porzel, Andrea; Michel, Camilia George; Elsayed, Aly; Wessjohann, Ludger A

    2016-05-01

    Passiflora incarnata as well as some other Passiflora species are reported to possess anxiolytic and sedative activity and to treat various CNS disorders. The medicinal use of only a few Passiflora species has been scientifically verified. There are over 400 species in the Passiflora genus worldwide, most of which have been little characterized in terms of phytochemical or pharmacological properties. Herein, large-scale multi-targeted metabolic profiling and fingerprinting techniques were utilized to help gain a broader insight into Passiflora species leaves' chemical composition. Nuclear magnetic resonance spectroscopy (NMR) and mass spectrometry (MS) spectra of extracted components derived from 17 Passiflora accessions and from different geographical origins were analyzed using multivariate data analyses. A total of 78 metabolites were tentatively identified, that is, 20 C-flavonoids, 8 O-flavonoids, 21 C, O-flavonoids, 2 cyanogenic glycosides, and 23 fatty acid conjugates, of which several flavonoid conjugates are for the first time to be reported in Passiflora spp. To the best of our knowledge, this study provides the most complete map for secondary metabolite distribution within that genus. Major signals in (1)H-NMR and MS spectra contributing to species discrimination were assigned to those of C-flavonoids including isovitexin-2″-O-xyloside, luteolin-C-deoxyhexoside-O-hexoside, schaftoside, isovitexin, and isoorientin. P. incarnata was found most enriched in C-flavonoids, justifying its use as an official drug within that genus. Compared to NMR, LC-MS was found more effective in sample classification based on genetic and/ or geographical origin as revealed from derived multivariate data analyses. Novel insight on metabolite candidates to mediate for Passiflora CNS sedative effects is also presented.

  9. Prospects for PV: a learning curve analysis

    International Nuclear Information System (INIS)

    Zwaan, Bob van der; Rabi, A.

    2003-01-01

    This article gives an overview of the current state-of-the-art of photovoltaic electricity technology, and addresses its potential for cost reductions over the first few decades of the 21st century. Current PV production cost ranges are presented, both in terms of capacity installation and electricity generation, of single crystalline silicon, multi-crystalline silicon, amorphous silicon and other thin film technologies. Possible decreases of these costs are assessed, as expected according to the learning-curve methodology. We also estimate how much PV could gain if external costs (due to environmental and health damage) of energy were internalised, for example by an energy tax. Our conclusions are that, (1) mainly due its high costs, PV electricity is unlikely to play a major role in global energy supply and carbon emissions abatement before 2020, (2) extrapolating learning curves observed in the past, one can expect its costs to decrease significantly over the coming years, so that a considerable PV electricity share world-wide could materialise after 2020, (3) niche-market applications, e.g. using stand-alone systems in remote areas, are crucial for continuing 'the ride along the learning curve', (4) damage costs of conventional (fossil) power sources are considerable, and their internalisation would improve the competitiveness of PV, although probably not enough to close the current cost gap. (author)

  10. Caracterización de Daños de Moscas del Género Dasiops (Diptera: Lonchaeidae en Passiflora spp. (Passifloraceae Cultivadas en Colombia / Characterization of Damage of the Genus Dasiops Flies (Diptera: Lonchaeidae from Cultivated Passiflora (Passiflor

    Directory of Open Access Journals (Sweden)

    Maikol Yohanny Santamaría Galindo

    2014-03-01

    Full Text Available Resumen. Las moscas del género Dasiops Rondani constituyen la plaga más limitante en cultivos de pasifloras en Colombia, por lo que el reconocimiento de especies es importante para la toma de decisiones de vigilancia y control. Se caracterizaron los síntomas y daños producidos por moscas Dasiops spp.. en botones florales y frutos de maracuyá (Passiflora edulis f. flavicarpa Sims, gulupa (Passiflora edulis f. edulis Sims, granadilla (Passiflora ligularis Juss y curuba (Passiflora tripartita var. mollissima Nielsen y Jorgensen. En botones florales de maracuyá, gulupa y granadilla con longitud mayor a 1 cm, la infestación se manifestó con amarillamiento y arrugamiento general. En frutos de gulupa y granadilla, la infestación se evidenció por arrugamiento del epicarpio en frutos inmaduros. En curuba, la infestación en frutos se caracterizó por un estrechamiento en la parte basal, apical o media del fruto. La infestación en botones florales estuvo entre 0,0 y 9,9% en tanto que en frutos presentó un rango entre 0,3 y 28,5%. No obstante, en maracuyá y gulupa se registraron botones florales infestados pero sin los síntomas descritos; en tanto que en gulupa y granadilla se observó el mismo fenómeno en frutos. Este estudio provee a agricultores y técnicos herramientas para el reconocimiento de infestación por moscas Dasiops spp. en cultivos de pasifloras como elemento fundamental para la toma decisiones para la vigilancia y control fitosanitario. / Abstract. The flies of the gender Dasiops Rondani are the most limiting plague in pasifloras crops in Colombia, thus species identification is important for decision making for monitoring and control. The symptoms and damage caused by Dasiops spp. flies in flower buds and fruits of yellow passion fruit (Passiflora edulis f. flavicarpa Sims, purple passion fruit (Passiflora edulis f. edulis Sims, sweet passion fruit (Passiflora ligularis Juss and banana passion fruit (Passiflora tripartita

  11. PV Systems Reliability Final Technical Report.

    Energy Technology Data Exchange (ETDEWEB)

    Lavrova, Olga [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flicker, Jack David [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Johnson, Jay [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Armijo, Kenneth Miguel [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Gonzalez, Sigifredo [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Schindelholz, Eric John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorensen, Neil R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Yang, Benjamin Bing-Yeh [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    The continued exponential growth of photovoltaic technologies paves a path to a solar-powered world, but requires continued progress toward low-cost, high-reliability, high-performance photovoltaic (PV) systems. High reliability is an essential element in achieving low-cost solar electricity by reducing operation and maintenance (O&M) costs and extending system lifetime and availability, but these attributes are difficult to verify at the time of installation. Utilities, financiers, homeowners, and planners are demanding this information in order to evaluate their financial risk as a prerequisite to large investments. Reliability research and development (R&D) is needed to build market confidence by improving product reliability and by improving predictions of system availability, O&M cost, and lifetime. This project is focused on understanding, predicting, and improving the reliability of PV systems. The two areas being pursued include PV arc-fault and ground fault issues, and inverter reliability.

  12. Quantifying Soiling Loss Directly From PV Yield

    Energy Technology Data Exchange (ETDEWEB)

    Deceglie, Michael G.; Micheli, Leonardo; Muller, Matthew

    2018-01-01

    Soiling of photovoltaic (PV) panels is typically quantified through the use of specialized sensors. Here, we describe and validate a method for estimating soiling loss experienced by PV systems directly from system yield without the need for precipitation data. The method, termed the stochastic rate and recovery (SRR) method, automatically detects soiling intervals in a dataset, then stochastically generates a sample of possible soiling profiles based on the observed characteristics of each interval. In this paper, we describe the method, validate it against soiling station measurements, and compare it with other PV-yield-based soiling estimation methods. The broader application of the SRR method will enable the fleet scale assessment of soiling loss to facilitate mitigation planning and risk assessment.

  13. Terawatt Challenge for Thin-Film PV

    Energy Technology Data Exchange (ETDEWEB)

    Zweibel, K.

    2005-08-01

    The evolution of PV into one of the world's largest industries is not going to happen without major unforeseen problems. However, this study attempts to address the obvious ones, so that we can put aside the mythology of PV (for example, that it is only ''boutique power'' or that one must pave the world with it to be useful) and get on with changing the world's energy infrastructure. With the years of rapid market growth now under way in PV, the author is sure this will not be the last effort to understand the real potential and pitfalls of meeting the Challenge.

  14. POWERED LED LIGHTING SUPPLIED FROM PV CELLS

    Directory of Open Access Journals (Sweden)

    Tirshu M.

    2011-12-01

    Full Text Available The paper deals with practical realization of efficient lighting system based on LED’s of 80W total power mounted on corridor ceiling total length of which is 120m and substitutes existing traditional lighting system consisting of 29 lighting blocks with 4 fluorescent lamps each of them and summary power 2088W. Realized lighting system is supplied from two photovoltaic panels of power 170W. Generated energy by PV cells is accumulated in two accumulators of 75Ah capacity and from battery by means of specialized convertor is applied to lighting system. Additionally, paper present data measured by digital weather station (solar radiation and UV index, which is mounted near of PV cells and comparative analyze of solar energy with real energy generated by PV cells is done. Measured parameters by digital weather station are stored by computer in on-line mode.

  15. Real time PV manufacturing diagnostic system

    Energy Technology Data Exchange (ETDEWEB)

    Kochergin, Vladimir [MicroXact Inc., Blacksburg, VA (United States); Crawford, Michael A. [MicroXact Inc., Blacksburg, VA (United States)

    2015-09-01

    The main obstacle Photovoltaic (PV) industry is facing at present is the higher cost of PV energy compared to that of fossil energy. While solar cell efficiencies continue to make incremental gains these improvements are so far insufficient to drive PV costs down to match that of fossil energy. Improved in-line diagnostics however, has the potential to significantly increase the productivity and reduce cost by improving the yield of the process. On this Phase I/Phase II SBIR project MicroXact developed and demonstrated at CIGS pilot manufacturing line a high-throughput in-line PV manufacturing diagnostic system, which was verified to provide fast and accurate data on the spatial uniformity of thickness, an composition of the thin films comprising the solar cell as the solar cell is processed reel-to-reel. In Phase II project MicroXact developed a stand-alone system prototype and demonstrated the following technical characteristics: 1) ability of real time defect/composition inconsistency detection over 60cm wide web at web speeds up to 3m/minute; 2) Better than 1mm spatial resolution on 60cm wide web; 3) an average better than 20nm spectral resolution resulting in more than sufficient sensitivity to composition imperfections (copper-rich and copper-poor regions were detected). The system was verified to be high vacuum compatible. Phase II results completely validated both technical and economic feasibility of the proposed concept. MicroXact’s solution is an enabling technique for in-line PV manufacturing diagnostics to increase the productivity of PV manufacturing lines and reduce the cost of solar energy, thus reducing the US dependency on foreign oil while simultaneously reducing emission of greenhouse gasses.

  16. Variación morfológica de tres especies de curubas (Passiflora tripartita var. mollissima, P. tarminiana y P. mixta) y sus híbridos en el Valle del Cauca (Colombia) Morphological variation of three banana passion fruit species (Passiflora tripartita var. mollissima, P. tarminiana and P. mixta) and their hybrids in the Cauca Valley (Colombia)

    OpenAIRE

    Sophie Primot; Geo Coppens d'Eeckenbrugge; Vincent Rioux; John Albeiro Ocampo Pérez; François Garcin

    2005-01-01

    Se estudió la variación morfológica entre ocho accesiones de las tres principales especies de curubas cultivadas y silvestres del Valle del Cauca, Passiflora tripartita var. mollissima (curuba de Castilla), Passiflora tarminiana (curuba india) y Passiflora mixta (curuba de monte) y 11 de sus híbridos, usando el análisis de componentes principales y el método de clasificación del vecino más próximo en 105 caracteres cualitativos y cuantitativos. Siete componentes principales explican 84% de la...

  17. Novel Methods to Determine Feeder Locational PV Hosting Capacity and PV Impact Signatures

    Energy Technology Data Exchange (ETDEWEB)

    Reno, Matthew J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Coogan, Kyle [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Seuss, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Broderick, Robert Joseph [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-05-01

    Often PV hosting capacity analysis is performed for a limited number of distribution feeders. For medium - voltage distribution feeders, previous results generally analyze less than 20 feeders, and then the results are extrapolated out to similar types of feeders. Previous hosting capacity research has often focused on determining a single value for the hosting capacity for the entire feeder, whereas this research expands previous hosting capacity work to investigate all the regions of the feeder that may allow many different hosting capacity values wit h an idea called locational hosting capacity (LHC)to determine the largest PV size that can be interconnected at different locations (buses) on the study feeders. This report discusses novel methods for analyzing PV interconnections with advanced simulati on methods. The focus is feeder and location - specific impacts of PV that determine the locational PV hosting capacity. Feeder PV impact signature are used to more precisely determine the local maximum hosting capacity of individual areas of the feeder. T he feeder signature provides improved interconnection screening with certain zones that show the risk of impact to the distribution feeder from PV interconnections.

  18. Economic perspective of PV electricity in Oman

    International Nuclear Information System (INIS)

    Al-Badi, A.H.; Albadi, M.H.; Al-Lawati, A.M.; Malik, A.S.

    2011-01-01

    Solar and wind energies are likely to play an important role in the future energy generation in Oman. This paper utilizes average daily global solar radiation and sunshine duration data of 25 locations in Oman to study the economic prospects of solar energy. The study considers a solar PV power plant of 5-MW at each of the 25 locations. The global solar radiation varies between slightly greater than 4 kWh/m 2 /day at Sur to about 6 kWh/m 2 /day at Marmul while the average value in the 25 locations is more than 5 kWh/m 2 /day. The results show that the renewable energy produced each year from the PV power plant varies between 9000 MWh at Marmul and 6200 MWh at Sur while the mean value is 7700 MWh of all the 25 locations. The capacity factor of PV plant varies between 20% and 14% and the cost of electricity varies between 210 US$/MWh and 304 US$/MWh for the best location to the least attractive location, respectively. The study has also found that the PV energy at the best location is competitive with diesel generation without including the externality costs of diesel. Renewable energy support policies that can be implemented in Oman are also discussed. -- Research highlights: → The global solar radiation values for 25 locations in Oman are obtained using satellite data that are corrected by data from ground stations. → The study considers a solar PV power plant of 5-MW to calculate the capacity factor (CF) and the cost of energy (COE) at each of the 25 locations. → The study has found that the CF of PV plant varies between 20% and 14% and the corresponding COE varies between 210 US$/MWh and 304 US$/MWh for the best location to the least attractive location, respectively. → The study has found that the PV energy at the best location is competitive with diesel generation without including the externality costs of diesel. → Since PV energy is not competitive with fossil fuel-based generation in most locations renewable energy support mechanisms have been

  19. Updating Interconnection Screens for PV System Integration

    Energy Technology Data Exchange (ETDEWEB)

    Coddington, M.; Mather, B.; Kroposki, B.; Lynn, K.; Razon, A.; Ellis, A.; Hill, R.; Key, T.; Nicole, K.; Smith, J.

    2012-02-01

    This white paper evaluates the origins and usefulness of the capacity penetration screen, offer short-term solutions which could effectively allow fast-track interconnection to many PV system applications, and considers longer-term solutions for increasing PV deployment levels in a safe and reliable manner while reducing or eliminating the emphasis on the penetration screen. Short-term and longer-term alternatives approaches are offered as examples; however, specific modifications to screening procedures should be discussed with stakeholders and must ultimately be adopted by state and federal regulatory bodies.

  20. Seasonal energy storage - PV-hydrogen systems

    Energy Technology Data Exchange (ETDEWEB)

    Leppaenen, J. [Neste Oy/NAPS (Finland)

    1998-10-01

    PV systems are widely used in remote areas e.g. in telecommunication systems. Typically lead acid batteries are used as energy storage. In northern locations seasonal storage is needed, which however is too expensive and difficult to realise with batteries. Therefore, a PV- battery system with a diesel backup is sometimes used. The disadvantages of this kind of system for very remote applications are the need of maintenance and the need to supply the fuel. To overcome these problems, it has been suggested to use hydrogen technologies to make a closed loop autonomous energy storage system

  1. Estabelecimento in vitro e micropropagação de maracujá silvestre (Passiflora foetida L. In vitro establishment and micropropagation of Passiflora foetida L.

    Directory of Open Access Journals (Sweden)

    W.S. Soares

    2012-01-01

    Full Text Available Entre as espécies do gênero Passiflora, a P. foetida L. apresenta a maior variabilidade genética e tem grande importância medicinal, pois é usada no tratamento de doenças como asma, icterícia, e na forma de emplastros, para as erisipelas e doenças de pele com inflamação. Portanto, são necessários estudos que visem a micropropagação e conservação. As sementes de P. foetida L. apresentam dormência e muitas vezes, levam alguns meses para germinar, produzindo mudas desuniformes e de baixo vigor. Neste sentido, a cultura de tecidos apresenta-se como uma forma alternativa a propagação. Assim, o objetivo do trabalho foi estabelecer e micropropagar P. foetida L., para formação de um banco de germoplasma. Para tanto, sementes foram escarificadas, desinfestadas e inoculadas em meio MS(½ sem reguladores de crescimento e cultivados por 66 dias. Explantes de hipocótilos obtidos de plantas germinadas in vitro, foram cultivados no mesmo meio suplementado com 1,0 mg L-1 de BAP. Na fase de estabelecimento, 45% dos explantes brotaram e formaram gemas axilares. 88,9% dos explantes de hipocótilo induziram brotação e 11,1% produziram calos. Plântulas regeneradas com 1,82 cm de altura, com raízes foram aclimatadas.Among the species of the genus Passiflora, P. foetida L. presents highest genetic variability and also great medicinal importance. This species is used in the treatment of diseases such as asthma, jaundice, and in the form of poultices for erysipelas and skin diseases with inflammation. Therefore, studies are needed to preserve them. Its seeds present dormancy and often take several months to germinate. The tissue culture is a alternative form to propagate species. The objective was to establish and micropropagation P. foetida L., and create a germplasm bank. Seeds were scarified, disinfected, and inoculated on MS medium (½ without regulators for 66 days. Hypocotyls explants obtained of seedlings in vitro germinated were

  2. Regeneração in vitro de Passiflora suberosa a partir de discos foliares In vitro regeneration of Passiflora suberosa from leaf discs

    Directory of Open Access Journals (Sweden)

    Alessandra Cristina Boffino de Almeida Monteiro

    2000-09-01

    Full Text Available A regeneração in vitro de plantas de Passiflora suberosa foi obtida a partir de discos foliares. Folhas foram retiradas de plantas germinadas em casa de vegetação, imersas em solução comercial de hipoclorito de sódio (3:1, durante 20 minutos. Discos foliares de 0,5 cm de diâmetro, com a face adaxial em contato com o meio de cultura, foram introduzidos em placa de petri. Organogênese foi obtida utilizando-se meio MS acrescido de 0,5 ou 1,0 mg L-1 de BAP (6-benzilaminopurina. Após 4 a 8 semanas, observou-se formação de calos nas bordas dos discos foliares. Os calos formados foram transferidos para meio MSM, acrescido de 1,0 mg L-1 de GA3 (ácido giberélico, sob fotoperíodo de 16 horas. Desenvolvimento de gemas adventícias foi obtido a partir dos calos, sendo estas alongadas e enraizadas no mesmo meio de cultura, após periódicas repicagens, e aclimatadas em casa de vegetação.In vitro regeneration of plantlets was obtained from Passiflora suberosa leaf discs. Leaves from plants germinated in the greenhouse were collected and immersed in commercial sodium hypochlorite solution (3:1, during 20 minutes. Leaf discs (0.5 cm in diameter were obtained and placed with the adaxial side in contact with the culture medium in petri dishes. Organogenesis was obtained when MS medium was supplemented with 0.5 or 1.0 mg L-1 BAP (6-benzylaminopurine, after four to eight weeks, callus proliferated from the edge of the discs. After induction, calli were transferred to modified MS media supplemented with1.0 mg L-1 GA3, under 16-hour photoperiod. Development of adventitious shoots was obtained from the callus tissues and the shoots were elongated and rooted in the same culture medium and acclimatized in the greenhouse.

  3. Análisis de adnc-aflp para la expresión diferencial de genes en la interacción manihot esculenta grantz (yuca) xanthomonas axonopodis pv. manihotis

    OpenAIRE

    Santaella, M.; Suárez, E.; González, C.; López, C.; Restrepo, S.; Badillo, A.; Verdier, V.

    2011-01-01

    Desarrollar patrones ADNc - AFLP, para identificar fragmentos expresados diferencialmente entre dos variedades de yuca, una resistente y una susceptible a la bacteriosis. Aislar, secuenciar y analizar los fragmentos seleccionados. Corroborar la expresión diferencial de estos fragmentos mediante "northern blots".

  4. Análisis de ADNC-AFLP para la expresión diferencial de genes en la interacción Manihot esculenta Grantz (Yuca Xanthomonas axonopodis pv. Manihotis

    Directory of Open Access Journals (Sweden)

    M. Santaella

    2001-07-01

    Full Text Available Desarrollar patrones ADNc - AFLP, para identificar fragmentos expresados diferencialmente entre dos variedades de yuca, una resistente y una susceptible a la bacteriosis. Aislar, secuenciar y analizar los fragmentos seleccionados. Corroborar la expresión diferencial de estos fragmentos mediante "northern blots".

  5. Análisis de ADNC-AFLP para la expresión diferencial de genes en la interacción Manihot esculenta Grantz (Yuca) Xanthomonas axonopodis pv. Manihotis

    OpenAIRE

    Verdier V.; Badillo A.; López C.; González C.; Suárez E.; Santaella M.; Restrepo S.

    2001-01-01

    Desarrollar patrones ADNc - AFLP, para identificar fragmentos expresados diferencialmente entre dos variedades de yuca, una resistente y una susceptible a la bacteriosis. Aislar, secuenciar y analizar los fragmentos seleccionados. Corroborar la expresión diferencial de estos fragmentos mediante "northern blots".

  6. National survey report on PV power applications in Switzerland 2006

    International Nuclear Information System (INIS)

    Huesser, P.; Hostettler, T.

    2007-01-01

    This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.

  7. A Practical Irradiance Model for Bifacial PV Modules

    Energy Technology Data Exchange (ETDEWEB)

    Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford

    2017-06-21

    A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using ray tracing software.

  8. Design optimization of grid-connected PV inverters

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2011-01-01

    The DC/AC inverters are the key elements in grid-connected PV energy production systems. In this paper, new design optimization techniques focused on transformerless (very high efficiency) PV inverters are proposed. They have been developed based on an analysis of the deficiencies of the current......, state-of-the-art PV inverters design technology, which limits the amount of PV energy supplied into the electric grid. The influences of the electric grid regulations and standards and the PV array operational characteristics on the design of grid-connected PV inverters have also been considered....... The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy injected into the electric grid by the optimized PV installation....

  9. A Practical Irradiance Model for Bifacial PV Modules: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Marion, Bill; MacAlpine, Sara; Deline, Chris; Asgharzadeh, Amir; Toor, Fatima; Riley, Daniel; Stein, Joshua; Hansen, Clifford

    2017-06-15

    A model, suitable for a row or multiple rows of photovoltaic (PV) modules, is presented for estimating the backside irradiance for bifacial PV modules. The model, which includes the effects of shading by the PV rows, is based on the use of configuration factors (CFs) to determine the fraction of a source of irradiance that is received by the backside of the PV module. Backside irradiances are modeled along the sloped height of the PV module, but assumed not to vary along the length of the PV row. The backside irradiances are corrected for angle-of-incidence losses and may be added to the front side irradiance to determine the total irradiance resource for the PV cell. Model results are compared with the measured backside irradiances for NREL and Sandia PV systems, and with results when using the RADIANCE ray tracing program.

  10. Image analysis of PV module electroluminescence

    Science.gov (United States)

    Lai, T.; Ramirez, C.; Potter, B. G.; Simmons-Potter, K.

    2017-08-01

    Electroluminescence imaging can be used as a non-invasive method to spatially assess performance degradation in photovoltaic (PV) modules. Cells, or regions of cells, that do not produce an infra-red luminescence signal under electrical excitation indicate potential damage in the module. In this study, an Andor iKon-M camera and an image acquisition tool provided by Andor have been utilized to obtain electroluminescent images of a full-sized multicrystalline PV module at regular intervals throughout an accelerated lifecycle test (ALC) performed in a large-scale environmental degradation chamber. Computer aided digital image analysis methods were then used to automate degradation assessment in the modules. Initial preprocessing of the images was designed to remove both background noise and barrel distortion in the image data. Image areas were then mapped so that changes in luminescent intensity across both individual cells and the full module could be identified. Two primary techniques for image analysis were subsequently investigated. In the first case, pixel intensity distributions were evaluated over each individual PV cell and changes to the intensities of the cells over the course of an ALC test were evaluated. In the second approach, intensity line scans of each of the cells in a PV module were performed and variations in line scan data were identified during the module ALC test. In this report, both the image acquisition and preprocessing technique and the contribution of each image analysis approach to an assessment of degradation behavior will be discussed.

  11. MPPT algorithm for voltage controlled PV inverters

    DEFF Research Database (Denmark)

    Kerekes, Tamas; Teodorescu, Remus; Liserre, Marco

    2008-01-01

    This paper presents a novel concept for an MPPT that can be used in case of a voltage controlled grid connected PV inverters. In case of single-phase systems, the 100 Hz ripple in the AC power is also present on the DC side. Depending on the DC link capacitor, this power fluctuation can be used...

  12. Xanthan gum production by Xanthomonas campestris pv ...

    African Journals Online (AJOL)

    Cassava starch is a main renewable bio-resource with low price and mass production in Guangxi, China. It was used as carbon source in growing Xanthomonas campestris pv. campestris 8004 (Xcc 8004) for xanthan gum production in this study. The xanthan gum yield of gelatinized cassava starch was higher than that of ...

  13. PV-mooduli toodang suurfarmis / Teolan Tomson

    Index Scriptorium Estoniae

    Tomson, Teolan, 1932-

    2015-01-01

    Artiklis uuritakse PV-paneelide tootlikkuse langust nende vastastikuse varjutamise tõttu. Näidatakse, et Eesti oludes on soovitav kasutada paneelide madalaid kaldenurki ja suhtelist reavahet, mis ületab paneeli kõrguse pooleteistkordset väärtust

  14. TRNSYS HYBRID wind diesel PV simulator

    Energy Technology Data Exchange (ETDEWEB)

    Quinlan, P.J.A.; Mitchell, J.W.; Klein, S.A.; Beckman, W.A.; Blair, N.J. [Univ. of Wisconsin, Madison, WI (United States)

    1996-12-31

    The Solar Energy Laboratory (SEL) has developed a wind diesel PV hybrid systems simulator, UW-HYBRID 1.0, an application of the TRNSYS 14.2 time-series simulation environment. An AC/DC bus links up to five diesels and wind turbine models, along with PV modules, a battery bank, and an AC/DC converter. Multiple units can be selected. PV system simulations include solar angle and peak power tracking options. Weather data are Typical Meteorological Year data, parametrically generated synthesized data, or external data files. PV performance simulations rely on long-standing SEL-developed algorithms. Loads data are read as scalable time series. Diesel simulations include estimated fuel-use and waste heat output, and are dispatched using a least-cost of fuel strategy. Wind system simulations include varying air density, wind shear and wake effects. Time step duration is user-selectable. UW-HYBRID 1.0 runs in Windows{reg_sign}, with TRNSED providing a customizable user interface. 12 refs., 6 figs.

  15. Solar PV Industry in Jiangsu Province [China

    International Nuclear Information System (INIS)

    2010-03-01

    Jiangsu Province is a leading province in China both in terms of Solar PV application as well as its implementation. The Netherlands Business Support Office in Nanjing reports on the photovoltaic solar cell industry in Jiangsu Province with details on opportunities for foreign investors; applications of solar energy in the province; Chinese government; relevant organizations; and key Chinese players in this sector.

  16. Final Technical Report: PV Fault Detection Tool.

    Energy Technology Data Exchange (ETDEWEB)

    King, Bruce Hardison [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Christian Birk [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    The PV Fault Detection Tool project plans to demonstrate that the FDT can (a) detect catastrophic and degradation faults and (b) identify the type of fault. This will be accomplished by collecting fault signatures using different instruments and integrating this information to establish a logical controller for detecting, diagnosing and classifying each fault.

  17. PV System Component Fault and Failure Compilation and Analysis.

    Energy Technology Data Exchange (ETDEWEB)

    Klise, Geoffrey Taylor; Lavrova, Olga; Gooding, Renee Lynne

    2018-02-01

    This report describes data collection and analysis of solar photovoltaic (PV) equipment events, which consist of faults and fa ilures that occur during the normal operation of a distributed PV system or PV power plant. We present summary statistics from locations w here maintenance data is being collected at various intervals, as well as reliability statistics gathered from that da ta, consisting of fault/failure distributions and repair distributions for a wide range of PV equipment types.

  18. Fault Detection and Performance Monitoring in PV Systems

    OpenAIRE

    Vasco Brogueira Andrade

    2017-01-01

    Given the exponential growth of the PV sector in recent years and the market?s overall need for new PV monitoring solutions, this dissertation aims at creating an automatic fault detection tool for PV systems, more specifically for shading and soiling situations. By detecting deviations in the measured PV systems? data patterns, this tool aims at providing essential information for the deployment of the right maintenance strategy for each situation.

  19. Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.

  20. CARACTERÍSTICAS NUTRICIONALES Y ANTIOXIDANTES DE LA FRUTA CURUBA LARGA (Passiflora mollisima Bailey

    Directory of Open Access Journals (Sweden)

    DIANA CAROLINA CHAPARRO R

    Full Text Available La presente revisión muestra el valor nutricional y el impacto para la salud humana del consumo de la fruta curuba larga (Passiflora mollisima Bailey, con base a las características nutricionales y antioxidantes. Pertenece a la familia de las pasifloráceas, es originaria de la zona andina del continente americano y en Colombia se cultiva principalmente en las cordilleras oriental y occidental. Esta fruta es fuente de vitaminas A, C y riboflavina; contiene potasio, fósforo, magnesio, sodio, cloro, hierro; aporta cantidades moderadas de carbohidratos y calóricas. El contenido de fenoles, flavonoides y carotenoides confiere la capacidad de captar radicales libres causantes del estrés oxidativo, éste relacionado con el origen y desarrollo de enfermedades cardiovasculares, neurodegenerativas y el cáncer.

  1. Antiulcer and antioxidant activity of ethanolic extract of Passiflora foetida L.

    Science.gov (United States)

    Sathish, R.; Sahu, Alok; Natarajan, K.

    2011-01-01

    Passiflora foetida L. (Passifloraceae), a widely growing perennial climber, has been used in traditional medicine for treating many ailments. The objective of the present study was to evaluate the effects of ethanolic extract of P. foetida (EEPF) whole plant on gastric ulcer. The antiulcer effects of EEPF at 100 and 200 mg/kg doses were evaluated on ethanol and aspirin-induced gastric ulcer models. The antioxidant parameters and histological changes in gastric tissue of ulcer rats were also determined in both the models. P. foetida treatment significantly (P < 0.01) reduced the ulcer index and significantly (P < 0.01) increased the gastric pH of both ethanol and aspirin-induced ulcer rats. P. foetida showed significant (P < 0.01) reduction in lipid peroxidation and increase in reduced glutathione levels. The observations confirm that EEPF whole plant has antiulcer and antioxidant activities. PMID:21713043

  2. Effect of nectar secretion rate on pollination success of Passiflora coccinea (Passifloraceae) in the Central Amazon.

    Science.gov (United States)

    Fischer, E; Leal, I R

    2006-05-01

    The pollination of Passiflora coccinea by the hummingbird Phaethornis superciliosus was studied in Central Amazon, Brazil. We hypothesized that a greater nectar secretion rate (NSR) increases the pollination success of single flowers through Ph. superciliosus visiting behavior. For control flowers, NSR was an increasing function of flower base diameter (FBD). The total number of Ph. superciliosus probes per flower was an increasing function of FBD. Additionally, deposition of pollen on stigmas increased with the cumulative number of Ph. superciliosus probes. Our results show that larger P. coccinea flowers secrete nectar at higher rates, are probed more times during each hummingbird visit and are more successful at pollination. This seems to be the first non-manipulative study describing such an effect of NSR on the pollination of single flowers in nature.

  3. The sedative activity of flavonoids from Passiflora quadrangularis is mediated through the GABAergic pathway.

    Science.gov (United States)

    Gazola, Andressa Corneo; Costa, Geison Modesti; Zucolotto, Silvana Maria; Castellanos, Leonardo; Ramos, Freddy Alejandro; de Lima, Thereza Christina Monteiro; Schenkel, Eloir Paulo

    2018-04-01

    The aim of this study was to investigate the sedative activity of the aqueous leaf extract of Passiflora quadrangularis, a species that is widely cultivated and consumed in South America, and to identify its main constituents and elucidate the involvement of the GABAergic pathway in its mechanism of action. The bioguided fractionation of the crude extract showed a positive relationship between the sedative activity of the extract and its flavonoids. The methods employed to identify and isolate its main flavonoids resulted in the identification of vitexin-2''-O-xyloside, vitexin-2''-O-glucoside, orientin-2''-O-xyloside and orientin-2''-O-glucoside. Vitexin-2"-O-xyloside, the major flavonoid of the extract, showed sedative activity after oral administration in mice. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  4. Development and characterization of microsatellite markers for the wild South American Passiflora cincinnata (Passifloraceae).

    Science.gov (United States)

    Cerqueira-Silva, Carlos B M; Santos, Elisa S L; Souza, Alisson M; Mori, Gustavo M; Oliveira, Eder J; Corrêa, Ronan X; Souza, Anete P

    2012-04-01

    We developed the first set of microsatellite markers for the passion fruit, Passiflora cincinnata, to provide tools for further study of its genetic diversity and to support current conservation and genetic studies. We used a microsatellite-enriched library approach to isolate and characterize 25 new molecular markers. Seven primer pairs successfully amplified polymorphic microsatellite regions, with an average of five alleles per locus. The mean values of expected and observed levels of heterozygosity were 0.516 and 0.525, respectively. The microsatellite markers identified in this study may be valuable tools for population genetic studies, and this set of markers also may be useful in the design of a genetic conservation strategy, mating system, and hybridization studies.

  5. Exploring the role of auxin in the androgynophore movement in Passiflora.

    Science.gov (United States)

    Scorza, Livia C T; Dornelas, Marcelo Carnier

    2015-01-01

    The flowers of the species belonging to the genus Passiflorashow a range of features that are thought to have arisen as adaptations to different pollinators. Some Passiflora species belonging to the subgenus Decaloba sect. Xerogona, show touch-sensitive motile androgynophores. We tested the role of auxin polar transport in the modulation of the androgynophore movement by applying auxin (IAA) or an inhibitor of auxin polar transport (NPA) in the flowers. We recorded the movement of the androgynophore during mechano-stimulation and analyzed the duration, speed, and the angle formed by the androgynophore before and after the movement, and found that both IAA and NPA increase the amplitude of the movement in P. sanguinolenta. We hypothesize that auxin might have a role in modulating the fitness of these Decaloba species to different pollination syndromes and demonstrate that an interspecific hybrid between insect- and hummingbird-pollinated Xerogona species present a heterosis effect on the speed of the androgynophore movement.

  6. Exploring the role of auxin in the androgynophore movement in Passiflora

    Directory of Open Access Journals (Sweden)

    Livia C.T. Scorza

    2015-09-01

    Full Text Available The flowers of the species belonging to the genus Passiflorashow a range of features that are thought to have arisen as adaptations to different pollinators. Some Passiflora species belonging to the subgenus Decaloba sect. Xerogona, show touch-sensitive motile androgynophores. We tested the role of auxin polar transport in the modulation of the androgynophore movement by applying auxin (IAA or an inhibitor of auxin polar transport (NPA in the flowers. We recorded the movement of the androgynophore during mechano-stimulation and analyzed the duration, speed, and the angle formed by the androgynophore before and after the movement, and found that both IAA and NPA increase the amplitude of the movement in P. sanguinolenta. We hypothesize that auxin might have a role in modulating the fitness of these Decaloba species to different pollination syndromes and demonstrate that an interspecific hybrid between insect- and hummingbird-pollinated Xerogona species present a heterosis effect on the speed of the androgynophore movement.

  7. Yellow passion fruit seed oil (Passiflora edulis f. flavicarpa: physical and chemical characteristics

    Directory of Open Access Journals (Sweden)

    Cassia Roberta Malacrida

    2012-02-01

    Full Text Available The aim of this study was to determine the chemical composition -physico-chemical properties, fatty acid and tocopherol compositions and total phenolic compounds -and evaluate the radical-scavenging activity of crude oil extracted from passion fruit (Passiflora edulis f. flavicarpa seeds, aiming to use the agro-industrial by-products. The oil seed extraction was performed by Soxhlet method and the oil yield from the seeds was 30.39%. The oil showed high levels of unsaturated fatty acids (87.59%, including mainly linoleic (73.14% and oleic (13.83% acids, tocopherol (499.30 mg/kg and phenolic compounds (1,314.13 mg GAE/kg. The physico-chemical characteristics were similar to those of other edible oils and the oil showed significant antioxidant activity. Therefore, the potential utilization of the passion fruit seed oil as a raw material for food, chemical and pharmaceutical industries could be favorable.

  8. Effect of nectar secretion rate on pollination success of Passiflora coccinea (Passifloraceae in the Central Amazon

    Directory of Open Access Journals (Sweden)

    E. Fischer

    Full Text Available The pollination of Passiflora coccinea by the hummingbird Phaethornis superciliosus was studied in Central Amazon, Brazil. We hypothesized that a greater nectar secretion rate (NSR increases the pollination success of single flowers through Ph. superciliosus visiting behavior. For control flowers, NSR was an increasing function of flower base diameter (FBD. The total number of Ph. superciliosus probes per flower was an increasing function of FBD. Additionally, deposition of pollen on stigmas increased with the cumulative number of Ph. superciliosus probes. Our results show that larger P. coccinea flowers secrete nectar at higher rates, are probed more times during each hummingbird visit and are more successful at pollination. This seems to be the first non-manipulative study describing such an effect of NSR on the pollination of single flowers in nature.

  9. ANTAGONISMO IN VITRO DE Trichoderma harzianum Rifai SOBRE Fusarium oxysporum Schlecht f. sp passiflorae EN MARACUYÁ (Passiflora edulis Sims var. Flavicarpa DEL MUNICIPIO ZONA BANANERA COLOMBIANA ANTAGONISM IN VITRO OF Trichoderma harzianum Rifai AGAINST Fusarium oxysporum Schlecht f. sp passiflorae IN PASSION FRUIT (Passiflora edulis Sims var. Flavicarpa FROM COLOMBIAN BANANERA ZONE MUNICIPALITY

    Directory of Open Access Journals (Sweden)

    Reinel José Fernández Barbosa

    2009-06-01

    Full Text Available Fusarium oxysporum Schlecht f. sp passiflorae causa la marchitez del maracuyá (Passiflora edulis Sims var. Flavicarpa, afectando su rendimiento. En la búsqueda de alternativas para su control se realizó la presente investigación con el objetivo de determinar la capacidad antagónica de 6 aislamientos de Trichoderma harzianum sobre dicho patógeno. Se evaluaron 3 aislamientos comerciales (TCC-001, TCC-005 y TCC-006 y 3 aislamientos nativos de suelo cultivado con palma de aceite en el Centro de Investigación Caribia de Corpoica (TCN-009, TCN-010, TCN-014. Se hizo la prueba in vitro empleando la técnica de cultivo dual en platos Petri con Agar Sabouraud. Se evaluó competencia por nutrientes y espacio, micoparasitismo y porcentaje de inhibición del crecimiento radial (PICR, por 10 días a 28 ºC. Se estableció un diseño completamente aleatorio, con 13 tratamientos y 3 repeticiones. Todos los aislamientos de T. harzianum superaron en crecimiento a F. oxysporum con radios de de 7,42 cm en cultivo dual. Mientras que el patógeno mostró un radio de 1,99 cm. TCN-009 y TCC-006 expresaron los mejores radios al crecer 4 veces mas rápido que F. oxysporum y reducir 3 veces menos el RCP con respecto al testigo, sin diferencias significativas entre estos tratamientos (P=0,0001; además, produjeron el mayor PICR a los 10 días con valores de 64,61 y 65,91%, respectivamente. No hubo diferencias significativas al comparar los aislamientos comerciales y nativos; sin embargo, por la naturaleza autóctona TCN-009, resulta ser a nivel in vitro, el aislamiento mas promisorio en el biocontrol de F. oxysporum por hallarse en condiciones agroclimáticas similares en la Zona Bananera Colombiana.Fusarium oxysporum Schlecht f. sp passiflorae cause withering of the passion fruit (Passiflora edulis Sims var. Flavicarpa, affecting their performance. In the search of alternatives for its control was carried out the present investigation with the objective of

  10. Evaluation of physiological potentiality of sweet passion-fruit seeds (Passiflora alata Dryander) submitted to storage

    OpenAIRE

    Osipi, Elisete Aparecida Fernandes; Nakagawa, João

    2005-01-01

    Averiguou-se a influência de três condições ambientais na capacidade de armazenamento da semente do maracujá-doce (Passiflora alata Dryander): ambiente não controlado (embaladas em saco de papel), câmara seca (embaladas em saco de papel) e câmara fria (embaladas em saco de polietileno). Nesses tratamentos, avaliaram-se o teor de água e as porcentagens de germinação, de plântulas anormais, de sementes dormentes e a de mortas, no decorrer de seis meses e após um ano. A germinação não diferiu en...

  11. Antioxidant activity and physicochemical analysis of passion fruit (Passiflora glandulosa Cav. pulp native to Cariri region

    Directory of Open Access Journals (Sweden)

    Abelardo Barbosa Moreira Lima-Neto

    2017-11-01

    Full Text Available The objective of this study was to determine the proximal composition, the physical and chemical characteristics and the in vitro antioxidant capacity (DPPH, ABTS and FRAP of the pulp of the wild passion fruit (Passiflora glandulosa Cav. from Cariri region, Ceara, Brazil. The results showed that the proximal composition and the caloric value of this passion fruit are similar to other species, but with a high ascorbic acid content. The fruit pulp showed low level of antioxidant activity and low level of polyphenolic compounds followed by three methodologies used. Due to high levels of titratable acidity (3.52 and total soluble solids (17.80° Brix, this fruit can be considered as a high value fruit for commerce. However, it is a species of passion fruit with few studies described in the literature, and more research is needed to assess its nutritional and functional potential.

  12. Impact of Rooftop Solar PV on Residential Distribution Network

    DEFF Research Database (Denmark)

    Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte; Pillai, Jayakrishnan Radhakrishna

    Increased environmental awareness in recent years has encouraged rapid growth of renewable energy sources especially solar PV and wind. Among them, small scale solar PV has been gaining more momentum especially at residential level. Even today moderate penetration of grid tied rooftop solar PV has...

  13. Impedance characterization of PV modules in outdoor conditions

    DEFF Research Database (Denmark)

    Oprea, Matei-lon; Thorsteinsson, Sune; Spataru, Sergiu

    2016-01-01

    Impedance spectroscopy (IS) has been used for laboratory characterizations of photovoltaic (PV) technologies under well controlled conditions. This work applies IS for outdoor characterization of PV panels, in order to observe the effect of irradiance (G) and temperature (T) on the PV module...

  14. The possibility of developing hybrid PV/T solar system

    Science.gov (United States)

    Dobrnjac, M.; Zivkovic, P.; Babic, V.

    2017-05-01

    An alternative and cost-effective solution to developing integrated PV system is to use hybrid photovoltaic/thermal (PV/T) solar system. The temperature of PV modules increases due to the absorbed solar radiation that is not converted into electricity, causing a decrease in their efficiency. In hybrid PV/T solar systems the reduction of PV module temperature can be combined with a useful fluid heating. In this paper we present the possibility of developing a new hybrid PV/T solar system. Hybrid PV/T system can provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation. We developed PV/T prototype consisted of commercial PV module and thermal panel with our original solution of aluminium absorber with special geometric shapes. The main advantages of our combined PV/T system are: removing of heat from the PV panel; extending the lifetime of photovoltaic cells; excess of the removing heat from PV part is used to heat the fluid in the thermal part of the panel; the possibility of using on the roof and facade constructions because less weight.

  15. Parameter extraction and estimation based on the PV panel outdoor ...

    African Journals Online (AJOL)

    This work presents a novel approach to predict the voltage-current (V-I) characteristics of a PV panel under varying weather conditions to estimate the PV parameters. Outdoor performance of the PV module (AP-PM-15) was carried out for several times. The experimental data obtained are validated and compared with the ...

  16. High Resolution PV Power Modeling for Distribution Circuit Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Norris, B. L.; Dise, J. H.

    2013-09-01

    NREL has contracted with Clean Power Research to provide 1-minute simulation datasets of PV systems located at three high penetration distribution feeders in the service territory of Southern California Edison (SCE): Porterville, Palmdale, and Fontana, California. The resulting PV simulations will be used to separately model the electrical circuits to determine the impacts of PV on circuit operations.

  17. Remote and Centralized Monitoring of PV Power Plants

    DEFF Research Database (Denmark)

    Kopacz, Csaba; Spataru, Sergiu; Sera, Dezso

    2014-01-01

    the inverters within each PV plant. The monitoring software stores the PV measurements in a data warehouse optimized for managing and data mining large amounts of data, from where it can be later visualized, analyzed and exported. By combining PV production measurements data with I-V curve measurements...

  18. Voltage rise mitigation for solar PV integration at LV grids

    DEFF Research Database (Denmark)

    Yang, Guangya; Marra, Francesco; Juamperez Goñi, Miguel Angel

    2015-01-01

    Solar energy from photovoltaic (PV) is among the fastest developing renewable energy systems worldwide. Driven by governmental subsidies and technological development, Europe has seen a fast expansion of solar PV in the last few years. Among the installed PV plants, most of them are situated at t...

  19. Assessing the need for better forecasting and observability of pv

    DEFF Research Database (Denmark)

    Alet, Pierre-Jean; Efthymiou, Venizelos; Graditi, Giorgio

    2017-01-01

    In its review of the challenges and opportunities associated with massive deployment of solar PV generation, the Grid integration working group of the ETIP PV identified forecasting and observability as critical technologies for the planning and operation of the power system with large PV...

  20. parameter extraction and estimation based on the pv panel outdoor

    African Journals Online (AJOL)

    userpc

    PV panel under varying weather conditions to estimate the PV parameters. Outdoor performance of the PV module (AP-PM-15) was carried out for several times. The .... Performance. Analysis of Different Photovoltaic. Technologies Based on MATLAB. Simulation. In Northwest University. Science, Faculty of Science Annual.

  1. EFFECTS OF STORAGE PERIODS AND METHODS OF OVERCOMING DORMANCY IN SEEDS OF PASSIFLORA

    Directory of Open Access Journals (Sweden)

    Telma Miranda dos Santos

    2012-07-01

    Full Text Available The aim of this work was to evaluate the effects of storage period and treatement with hot water at 50ºC or scarification on dormancy break down on Passiflora mucronata seeds. The storage periods were 0, 1, 4 and 12 months. The seeds were sown onto Germitest paper roll and incubated in a germination chamber under 20ºC/8h-30ºC/16h alternate temperature, at 16-h photoperiod (fluorescent light at 32 mol m-2 s-1 irradiance. The percent germination was evaluated, and the seeds germinated on moistened Germitest paper rolls in distilled water at a ratio of two and a half times the paper weight. The seeds were transferred to a germination chamber with alternating temperatures of 20-30º C and photoperiod of 16 h until the end of the experiment at 31 days. The experiment was analyzed as completely randomized designed with four replications, in which each plot was constituted by 50 seeds. The storage periods had significant effect on the variable studied, where the higher germination was obtained at freshly harvested seeds. At the first month of evaluation the germination decreased. After 4 and 12 months of storage, no germination was detected. The treatment with hot water at 50º or scarification favored the germination of the Passiflora seeds stored by one and four months, however even with the stimulus of the treatments, the values of final germination were low. The treatments were not efficient to stimulate the seed germination stored by 12 months.

  2. PV Obelisk - Information system with photovoltaics; PV-Obelisk Orientierungssystem mit Photovoltaik

    Energy Technology Data Exchange (ETDEWEB)

    Ruoss, D.; Rasmussen, J.

    2004-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) describes the development of an information system powered by a photovoltaic (PV) array. As an innovative approach, the 'PV-Obelisk' project is the combination of PV with a multi-functional pillar made of natural stone in an aesthetic way. The PV modules serve both as a power supply and as a design element. Two initial prototypes led the way to a third, optimised consumer configuration that was planned to guarantee maximum user frequency. Test operation in front of the 'Heidiland' motor way restaurant confirmed the market analyses made and delivered the expected results. The product, whose three LCD displays are updated via a mobile telephony-based text-message system, proved its technical reliability and showed a high user frequency. Because of the high overall energy consumption, PV power can only partially contribute to the energy supply needed. Various compromises in the technical and aesthetic areas are discussed that were made for the sake of product acceptance in the market. The range of application areas for such a 'PV Obelisk' are discussed and the need for early co-ordination with urban planners is stressed.

  3. Effects of bark flour of Passiflora edulis on food intake, body weight and behavioral response of rats

    Directory of Open Access Journals (Sweden)

    Dandara A.F. Figueiredo

    Full Text Available ABSTRACT Effects of treatment with the bark flour of Passiflora edulis Sims, Passifloraceae, were evaluated. Adult male Wistar rats were treated for 30 days (130 mg/kg, p.o. with the albedo flour, flavedo and full bark of P. edulis, corresponding to albedo associated with flavedo. Behavioral response observed after treatment with bark flour P. edulis showed sedative effects by the reduction of exploratory activity and increased duration of immobility in the open field test for the group of animals that received the albedo flour associated with the flavedo. Sedative effects were observed in the absence of motor incoordination or muscle relaxation. Food intake of experimental animals was not changed, but the weight gain was decreased both in animals that received only albedo flour, and in those who received the full bark flour. The full bark flour of Passiflora showed sedative effects, without anxiolytic effect detectable and muscle relaxation or motor incoordination, and reduces body weight gain.

  4. Chemical profiles of traditional preparations of four South American Passiflora species by chromatographic and capillary electrophoretic techniques

    Directory of Open Access Journals (Sweden)

    Geison Modesti Costa

    Full Text Available ABSTRACT Several species of the genus Passiflora are distributed all over South America, and many of these species are used in popular medicine, mainly as sedatives and tranquilizers. This study analyzes the chemical profile of extracts of four Passiflora species used in folk medicine, focusing on the flavonoids, alkaloids and saponins. We employed simple and fast fingerprint analysis methods by high performance liquid chromatography, ultra performance liquid chromatography and capillary electrophoresis techniques. The analysis led to the detection and identification of C-glycosylflavonoids in all the plant extracts, these being the main constituents in P. tripartita var. mollissima and P. bogotensis. Saponins were observed only in P. alata and P. quadrangularis, while harmane alkaloids were not detected in any of the analyzed extracts in concentrations higher than 0.0187 ppm, the detection limit determined for the UPLC method.

  5. Anatomia comparada da antera de espécies de Passiflora L.(Passifloraceae) do Rio Grande do Sul

    OpenAIRE

    Greta Aline Dettke

    2009-01-01

    Passiflora L. é o maior dos gêneros de Passifloraceae, com cerca de 530 espécies, e ocorre predominantemente no continente americano. Compreende trepadeiras herbáceas ou lenhosas com gavinhas, raramente ervas, arbustos ou pequenas árvores. A sistemática de Passiflora, assim como de Passifloraceae, não está ainda bem resolvida, pois são frágeis os limites de circunscrição de vários subgêneros, seções e séries e a última revisão sistemática dos gêneros americanos data do século passado. Esta cl...

  6. Efecto de la escarificación y la dosis del ácido giberélico (AG3) en la germinación de semilla de curuba (Passiflora mollisima) Efecto de la escarificación y la dosis del ácido giberélico (AG3) en la germinación de semilla de curuba (Passiflora mollisima)

    OpenAIRE

    Cardozo Gutiérrez Rito Hernán

    1988-01-01

    The trials made on banana passion fruit seeds germination (Passiflora mollisima(HBK) Bailey, under laboratory specifications show that the testa delays the water absortion and it is the critic factor on the germination. AG3 increases the germination remarkably and strengthens the effects of the scarification considerably.

    Los ensayos de la germinación de semilla de curuba (Passiflora mollisima (HBK) Bailey en condiciones de ...

  7. Relações ecológico-evolutivas em Passiflora alata do Rio Grande do Sul, Brasil

    OpenAIRE

    Santos, Patrícia Koehler dos; Lorenz-Lemke, Aline Pedroso; Salzano, Francisco Mauro; Freitas, Loreta Brandao de

    2006-01-01

    The geographical distribution, ecological characteristics, flowering and fruiting times, and pollinating agents of Passiflora alata are considered and related to molecular genetic data gathered simultaneously. The first report on this species in Rio Grande do Sul was made in 1934, only in cultivated gardens. Approximately 20 years later, however, the species was already classified as efferata (wild) in Porto Alegre's suburbs. The data presented here, together with the DNA investigations, indi...

  8. Heterologous primer transferability and access to microsatellite loci polymorphism in ‘somnus’ passion fruit tree (Passiflora setacea DC

    Directory of Open Access Journals (Sweden)

    Douglas de Almeida Pereira

    2015-09-01

    Full Text Available Primer pairs that access microsatellite loci, initially constructed through the genome of Passiflora edulis Sims flavicarpa and P. alata, were tested concerning their ability to access microsatellite loci in ‘somnus’ passion fruit tree (P. setacea individuals. Seven out of the thirty one primer pairs tested were able to access DNA polymorphism in the genome of this wild Passiflora species, by evaluating six natural populations, located in a transition area between the biomes Caatinga and Cerrado, in the state of Bahia, Brazil. The number of alleles/loci was small, oscillating from 1 to 4. The average heterozygosity observed per locus in all populations ranged from 0.13 to 0.40. There was transference of heterologous microsatellite primer pairs from the Passiflora genus to ‘somnus’ passion fruit tree, constituting a new set of primers that access random co-dominant locus in this species, useful for conservationist purposes and pre-improvement of ‘somnus’ passion fruit tree.

  9. Morphometric analysis of Passiflora leaves: the relationship between landmarks of the vasculature and elliptical Fourier descriptors of the blade.

    Science.gov (United States)

    Chitwood, Daniel H; Otoni, Wagner C

    2017-01-01

    Leaf shape among Passiflora species is spectacularly diverse. Underlying this diversity in leaf shape are profound changes in the patterning of the primary vasculature and laminar outgrowth. Each of these aspects of leaf morphology-vasculature and blade-provides different insights into leaf patterning. Here, we morphometrically analyze >3300 leaves from 40 different Passiflora species collected sequentially across the vine. Each leaf is measured in two different ways: using 1) 15 homologous Procrustes-adjusted landmarks of the vasculature, sinuses, and lobes; and 2) Elliptical Fourier Descriptors (EFDs), which quantify the outline of the leaf. The ability of landmarks, EFDs, and both datasets together are compared to determine their relative ability to predict species and node position within the vine. Pairwise correlation of x and y landmark coordinates and EFD harmonic coefficients reveals close associations between traits and insights into the relationship between vasculature and blade patterning. Landmarks, more reflective of the vasculature, and EFDs, more reflective of the blade contour, describe both similar and distinct features of leaf morphology. Landmarks and EFDs vary in ability to predict species identity and node position in the vine and exhibit a correlational structure (both within landmark or EFD traits and between the two data types) revealing constraints between vascular and blade patterning underlying natural variation in leaf morphology among Passiflora species. © The Author 2017. Published by Oxford University Press.

  10. On Distributed PV Hosting Capacity Estimation, Sensitivity Study, and Improvement

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Fei; Mather, Barry

    2017-07-01

    This paper first studies the estimated distributed PV hosting capacities of seventeen utility distribution feeders using the Monte Carlo simulation based stochastic analysis, and then analyzes the sensitivity of PV hosting capacity to both feeder and photovoltaic system characteristics. Furthermore, an active distribution network management approach is proposed to maximize PV hosting capacity by optimally switching capacitors, adjusting voltage regulator taps, managing controllable branch switches and controlling smart PV inverters. The approach is formulated as a mixed-integer nonlinear optimization problem and a genetic algorithm is developed to obtain the solution. Multiple simulation cases are studied and the effectiveness of the proposed approach on increasing PV hosting capacity is demonstrated.

  11. Technologies to Increase PV Hosting Capacity in Distribution Feeders: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Fei; Mather, Barry; Gotseff, Peter

    2016-08-01

    This paper studies the distributed photovoltaic (PV) hosting capacity in distribution feeders by using the stochastic analysis approach. Multiple scenario simulations are conducted to analyze several factors that affect PV hosting capacity, including the existence of voltage regulator, PV location, the power factor of PV inverter and Volt/VAR control. Based on the conclusions obtained from simulation results, three approaches are then proposed to increase distributed PV hosting capacity, which can be formulated as the optimization problem to obtain the optimal solution. All technologies investigated in this paper utilize only existing assets in the feeder and therefore are implementable for a low cost. Additionally, the tool developed for these studies is described.

  12. PV Working with Industry, 2nd Quarter, 2000

    Energy Technology Data Exchange (ETDEWEB)

    Poole, L.; Moon, S.

    2000-06-29

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The Second Quarter, 2000, issue is titled ``Our Shared PV Future''. It contains a review of several important PV-related meetings held in the prior three months: the NCPV Program Review, the 16 European PV Conference, and year-2000 Earth Day activities in Denver, CO. The editorialist is Paul Maycock, Publisher of PV News.

  13. Accelerating residential PV expansion: demand analysis for competitive electricity markets

    International Nuclear Information System (INIS)

    Duke, Richard; Williams, Robert; Payne, Adam

    2005-01-01

    This article quantifies the potential market for grid-connected, residential photovoltaic (PV) electricity integrated into new homes built in the US. It complements an earlier supply-side analysis by the authors that demonstrates the potential to reduce PV module prices below $1.5/W p by scaling up existing thin-film technology in 100 MW p /yr manufacturing facilities. The present article demonstrates that, at that price, PV modules may be cost effective in 125,000 new home installations per year (0.5 GW p /yr). While this market is large enough to support multiple scaled up thin-film PV factories, inefficient energy pricing and demand-side market failures will inhibit prospective PV consumers without strong public policy support. Net metering rules, already implemented in many states to encourage PV market launch, represent a crude but reasonable surrogate for efficient electricity pricing mechanisms that may ultimately emerge to internalize the externality benefits of PV. These public benefits include reduced air pollution damages (estimated costs of damage to human health from fossil fuel power plants are presented in Appendix A), deferral of transmission and distribution capital expenditures, reduced exposure to fossil fuel price risks, and increased electricity system reliability for end users. Thus, net metering for PV ought to be implemented as broadly as possible and sustained until efficient pricing is in place. Complementary PV 'buydowns' (e.g., a renewable portfolio standard with a specific PV requirement) are needed to jumpstart regional PV markets

  14. Simulation of Distributed PV Power Output in Oahu Hawaii

    Energy Technology Data Exchange (ETDEWEB)

    Lave, Matthew Samuel [Sandia National Lab. (SNL-CA), Livermore, CA (United States)

    2016-08-01

    Distributed solar photovoltaic (PV) power generation in Oahu has grown rapidly since 2008. For applications such as determining the value of energy storage, it is important to have PV power output timeseries. Since these timeseries of not typically measured, here we produce simulated distributed PV power output for Oahu. Simulated power output is based on (a) satellite-derived solar irradiance, (b) PV permit data by neighborhood, and (c) population data by census block. Permit and population data was used to model locations of distributed PV, and irradiance data was then used to simulate power output. PV power output simulations are presented by sub-neighborhood polygons, neighborhoods, and for the whole island of Oahu. Summary plots of annual PV energy and a sample week timeseries of power output are shown, and a the files containing the entire timeseries are described.

  15. Optimal Design of Modern Transformerless PV Inverter Topologies

    DEFF Research Database (Denmark)

    Saridakis, Stefanos; Koutroulis, Eftichios; Blaabjerg, Frede

    2013-01-01

    The design optimization of H5, H6, neutral point clamped, active-neutral point clamped, and conergy-NPC transformerless photovoltaic (PV) inverters is presented in this paper. The components reliability in terms of the corresponding malfunctions, affecting the PV inverter maintenance cost during...... the operational lifetime period of the PV installation, is also considered in the optimization process. According to the results of the proposed design method, different optimal values of the PV inverter design variables are derived for each PV inverter topology and installation site. The H5, H6, neutral point...... clamped, active-neutral point clamped and conergy-NPC PV inverters designed using the proposed optimization process feature lower levelized cost of generated electricity and lifetime cost, longer mean time between failures and inject more PV-generated energy into the electric grid than their nonoptimized...

  16. Simultaneous determination of alkaloids and flavonoids from aerial parts of Passiflora species and dietary supplements using UPLC-UV-MS and HPTLC.

    Science.gov (United States)

    Avula, Bharathi; Wang, Yan-Hong; Rumalla, Chidananda Swamy; Smillie, Troy J; Khan, Ikhlas A

    2012-09-01

    A rapid UPLC method was developed for the simultaneous analysis of five indole alkaloids (harmalol, harmol, harmane, harmaline and harmine) and four flavonoids (orientin, isoorientin, vitexin, and isovitexin) from the aerial parts of Passiflora incarnata L. (Passifloraceae), other species of Passiflora (P. violacea Veil., P. edulis Sims., P. suberosa L., P. morifolia Mast. and P. quadrangularis L.), Peganum harmala, and dietary supplements that claim to contain Passiflora. The separation was achieved within eight minutes by using C-18 column, a water/acetonitrile mobile phase, both containing formic acid, using a gradient system and a temperature of 35 degrees C. The method was validated for linearity, repeatability, limits of detection (LOD), and limits of quantification (LOQ). The wavelength used for quantification with the diode array detector was 340 nm for flavonoids and alkaloids. The developed method is simple, economic, fast and especially suitable for quality control analysis of flavonoids and alkaloids in plant samples and dietary supplements. The compounds (including isoschaftoside and schaftoside) in plant samples and commercial products of Passiflora were identified and confirmed by UPLC-MS. A HPTLC method was also developed for the chemical fingerprint analysis of Passiflora samples.

  17. Caracterização genética de espécies de Passiflora por marcadores moleculares análogos a genes de resistência Genetic characterization of Passiflora species via resistance genes analog markers

    Directory of Open Access Journals (Sweden)

    Mariana da Silva Paula

    2010-03-01

    Full Text Available O cultivo comercial do maracujá é afetado por diversos problemas fitossanitários, os quais contribuem para quebras de produção e significativa redução da vida útil dos plantios. Em algumas situações, a incidência de doenças pode inviabilizar o cultivo do maracujá. Fontes de resistência a distintas doenças têm sido identificadas em acessos de espécies de Passiflora. Neste trabalho, buscou-se avaliar a diversidade genética de acessos de oito espécies silvestres (P. setacea, P. nitida, P. serratodigitata, P. caerulea, P. gibertii, P. odontophyla, P. edulis e P. coccinea e de um híbrido interespecífico (P. setacea x P. coccinea, utilizando marcadores moleculares análogos a genes de resistência (RGAs. Verificou-se uma grande diversidade no perfil eletroforético de RGAs nos acessos de Passiflora, permitindo a anotação de 96 amplicons polimórficos entre, pelo menos, um par de acessos. Os níveis de dissimilaridade genética (calculados exclusivamente com os marcadores RGAs variaram entre 0,40 e 0,89 nos acessos das espécies de Passiflora avaliadas. A análise de sequência de um subgrupo destes amplicons obtidos com primers RGAs indicou que estas bandas correspondem a regiões genômicas que contêm segmentos (motivos com identidade aos encontrados em genes de resistência previamente caracterizados em outras espécies vegetais. Desta forma, os dados indicam a existência de um repertório variado de marcadores do tipo RGA em Passiflora que podem ser potencialmente úteis em sistemas de caracterização molecular de germoplasma e em programas de melhoramento genético visando à resistência a doenças nesta cultura.The commercial cultivation of passion fruit can be affected by many diseases, which might induce sever fruit yield losses and significant life cycle reduction of the crop. In some situations disease incidence can make the passion fruit production not economically viable. Sources of resistance against several

  18. Percutaneous vertebroplasty (pv): indications, contraindications, and technique

    International Nuclear Information System (INIS)

    Hoffmann, R.T.; Jakobs, T.F.; Wallnoefer, A.; Reiser, M.F.; Helmberger, T.K.

    2003-01-01

    Percutaneous vertebroplasty (pv) is a worldwide increasingly performed interventional therapeutic procedure. This article addresses indications, patient preparation, technical requirements and approach as well as possible complications of percutaneous vertebroplasty. Percutaneous vertebroplasty is a technique consisting in an injection of bone cement into a vertebral body under imaging guidance. This procedure is performed to relief pain and support the mechanical stability in partially collapsed vertebral bodies. In the management of spinal compression fractures secondary to osteoporosis, myeloma, osteolytic metastases and aggressive hemangiomas, percutaneous vertebroplasty yields analgesic effect, and provides additional fortification in weakened segments of the vertebral column. Contraindications include major bleeding disorders, radicular pain and pain caused by compression of the myelon. Percutaneous vertebroplasty results in prompt pain relief and rapid rehabilitation. In experienced hands, using correct technique, pv is a safe and effective procedure for treating pain, caused either by osteoporotic or malignant vertebral compression fractures. (orig.) [de

  19. Materials Testing for PV Module Encapsulation

    Energy Technology Data Exchange (ETDEWEB)

    Jorgensen, G.; Terwilliger, K.; Glick, S.; Pern, J.; McMahon, T.

    2003-05-01

    Important physical properties of materials used in PV module packaging are presented. High-moisture-barrier, high-resistivity, adhesion-promoting coatings on polyethyl-ene terephthalate (PET) films have been fabricated and characterized for use in PV module application and com-pared to standard polymer backsheet materials. Ethylene vinyl acetate (EVA) and an encapsulant replacement for EVA are studied for their water vapor transmission rate (WVTR) and adhesion properties. WVTR, at test conditions up to 85C/100% relative humidity (RH), and adhesion val-ues are measured before and after filtered xenon arc lamp ultraviolet (UV) exposure and damp heat exposure at 85C/85% RH. Water ingress is quantified by weight gain and embedded humidity sensors.

  20. Efeito de reguladores vegetais no desenvolvimento de mudas de Passiflora alata Curtis Effect of plant regulators on Passiflora alata seedlings development

    Directory of Open Access Journals (Sweden)

    Anísio de Oliveira

    2005-04-01

    Full Text Available O principal fator limitante à produção de mudas enxertadas de maracujazeiro é o elevado tempo para a sua formação. Assim, objetivou-se avaliar o efeito de reguladores vegetais no desenvolvimento de mudas de Passiflora alata Curtis, a serem empregadas como porta-enxerto, visando a reduzir o tempo para atingir o ponto de enxertia. O delineamento experimental empregado foi o inteiramente casualisado, em esquema fatorial 4x5 (4 reguladores vegetais x 5 concentrações, com 4 repetições de 25 plantas por parcela. Os tratamentos foram constituídos por 0,0 mg L-1 (testemunha; 25 mg L-1; 50 mg L-1; 75 mg L-1, e 100 mg L-1 de Benziladenina (BA, GA4+7 + Fenilmetil-aminopurina (GA4+7+CK, Ácido giberélico (GA3 e Cloreto de chlormequat (CCC. Avaliaram-se o comprimento e o diâmetro do caule, o número de folhas, o comprimento e a fitomassa seca de raíz, do caule, das folhas e total. Os dados foram submetidos à análise de variância e de regressão polinomial, sendo realizado desdobramento quando houve efeito significativo da interação.Os reguladores não promoveram respostas significativas para o comprimento e a massa seca de raiz, do caule, de folhas e total. Porém, GA4+7+Fenilmetil-aminopurina foi o regulador que incrementou o comprimento do caule, o diâmetro e o número de folhas, promovendo maior desenvolvimento às mudas e reduzindo o tempo para a formação do porta-enxerto, de três a oito meses, para dois meses (63 dias.The limiting main factor to the passion flower grafted seedlings production is the long time necessary for its formation. So, this work aimed, to evaluate the effects of vegetal regulators, at Passiflora alata Curtis seedlings development, aiming to reduce time for the seedling to reach the grafting point. The experimental design was completely randomized, with a 4 x 5 (plant growth regulator x concentrations factorial and four replicates, with 25 seedlings per parcel. The treatments were as follow: Benzyladenine, GA

  1. [Extract of Passiflora edulis in the healing of colonic anastomosis in rats: a tensiometric and morphologic study].

    Science.gov (United States)

    Bezerra, José Antonio Ferreira; Campos, Antonio Carlos L; Vasconcelos, Paulo Roberto Leitão de; Nicareta, Jean Ricardo; Ribeiro, Elaine Rossi; Sebastião, Ana Paula Martins; Urdiales, Akihito Inca A; Moreira, Marlus; Borges, Alessandra Miguel

    2006-01-01

    Investigation of new substances with therapeutic effects have been done trying to isolate, extract or purify new compounds of vegetable origin. The Passiflora edulis (maracujá) species from the Plassifloracia family, originated from the tropical and subtropical regions of the american continent, is found all over Brazil. It is commonly used as a sedative, painkiller and anti-inflammatory drug and also for the treatment of skin wounds, lesions and Erisipelae. To evaluate the wound healing in colonic anastomosis in rats that received an hydro-alcoholic extract of Passiflora edulis peri-operatively. 40 wistar rats were used distributed into two groups of 20 rats each, named: Passiflora edulis group (GP) and control group (GC). The rats of each group were separated into two subgroups of 10 animals each and were evaluated on the 3rd and 7th postoperative days. The surgical procedure consisted of a section of the left colon, 5 cm above the peritoneal reflexion with preservation of the vascular elements. Intestinal continuity was restored by an end-to-end single layer anastomosis. The Passiflora edulis group received an intraperitoneal application of the hydro-alcoholic extract in the dosage of 250 mg/kg. The control-group received one intraperitoneal dose of a saline with the same volume of the GP. The parameters evaluated were: macroscopic aspects of the wall and abdominal cavity, perianastomotic (adherences), bursting pressure, inflammatory tissue reaction on the anastomotic wound. The macroscopic aspects did not differ between the groups. No rupture in the anastomotic wound was seen in any rat. Regarding the bursting pressure, it was noticed that the average pressure was significantly higher in the subgroup that received the Passiflora edulis extract on the 3rd day (P3) (42.6 +/- 17.8 mmHg vs. 25.4 +/- 14.1 mmHg, p=0.028), as compared to the control sub-group (C3). However, on the 7th day, bursting pressure was similar in both groups (p=0.447). Rats from the C7 sub

  2. Energy balance of the global photovoltaic (PV) industry--is the PV industry a net electricity producer?

    Science.gov (United States)

    Dale, Michael; Benson, Sally M

    2013-04-02

    A combination of declining costs and policy measures motivated by greenhouse gas (GHG) emissions reduction and energy security have driven rapid growth in the global installed capacity of solar photovoltaics (PV). This paper develops a number of unique data sets, namely the following: calculation of distribution of global capacity factor for PV deployment; meta-analysis of energy consumption in PV system manufacture and deployment; and documentation of reduction in energetic costs of PV system production. These data are used as input into a new net energy analysis of the global PV industry, as opposed to device level analysis. In addition, the paper introduces a new concept: a model tracking energetic costs of manufacturing and installing PV systems, including balance of system (BOS) components. The model is used to forecast electrical energy requirements to scale up the PV industry and determine the electricity balance of the global PV industry to 2020. Results suggest that the industry was a net consumer of electricity as recently as 2010. However, there is a >50% that in 2012 the PV industry is a net electricity provider and will "pay back" the electrical energy required for its early growth before 2020. Further reducing energetic costs of PV deployment will enable more rapid growth of the PV industry. There is also great potential to increase the capacity factor of PV deployment. These conclusions have a number of implications for R&D and deployment, including the following: monitoring of the energy embodied within PV systems; designing more efficient and durable systems; and deploying PV systems in locations that will achieve high capacity factors.

  3. An Analysis of Open World PvP in LOTRO's PvMP as a Case Study for PvP Games

    Directory of Open Access Journals (Sweden)

    Toh Weimin

    2014-11-01

    Full Text Available This article focuses on the analysis of emergent gameplay, based on a case study of the author's subjective gameplay experience of Player versus Monster Player (PvMP in The Lord of the Rings Online (LOTRO. The argument presented here is that although there is a core system of Player versus Player (PvP which LOTRO shares with other online games, each type of online game has a specific kind of PvP system which attracts players to engage in the gameplay. For instance, the open world sandbox type of PvP attracts certain players to play in LOTRO's PvMP. One of the main aims of this study is thus to investigate some of the core systems of PvP gameplay in open world sandbox PvP. In this article, LOTRO is shown to offer unique opportunities for studying emergent gameplay in open world games, with particular relevance to PvP studies. Two of the core systems of PvP discussed include the design of the simple gameplay rules to support emergent gameplay, and the community's attitudes towards player's behaviours. The types of emergent gameplay discussed include free play versus negotiated fair play, the players' utilisation of strategies in open world PvP to support collaborative and competitive gameplay, and the changing dynamics of open ended gameplay. It is hoped that the analysis provided in this article would form the­ basis of future work on a more general framework for understanding PvP in other online games.

  4. Integrating Solar PV in Utility System Operations

    Energy Technology Data Exchange (ETDEWEB)

    Mills, A.; Botterud, A.; Wu, J.; Zhou, Z.; Hodge, B-M.; Heany, M.

    2013-10-31

    This study develops a systematic framework for estimating the increase in operating costs due to uncertainty and variability in renewable resources, uses the framework to quantify the integration costs associated with sub-hourly solar power variability and uncertainty, and shows how changes in system operations may affect these costs. Toward this end, we present a statistical method for estimating the required balancing reserves to maintain system reliability along with a model for commitment and dispatch of the portfolio of thermal and renewable resources at different stages of system operations. We estimate the costs of sub-hourly solar variability, short-term forecast errors, and day-ahead (DA) forecast errors as the difference in production costs between a case with “realistic” PV (i.e., subhourly solar variability and uncertainty are fully included in the modeling) and a case with “well behaved” PV (i.e., PV is assumed to have no sub-hourly variability and can be perfectly forecasted). In addition, we highlight current practices that allow utilities to compensate for the issues encountered at the sub-hourly time frame with increased levels of PV penetration. In this analysis we use the analytical framework to simulate utility operations with increasing deployment of PV in a case study of Arizona Public Service Company (APS), a utility in the southwestern United States. In our analysis, we focus on three processes that are important in understanding the management of PV variability and uncertainty in power system operations. First, we represent the decisions made the day before the operating day through a DA commitment model that relies on imperfect DA forecasts of load and wind as well as PV generation. Second, we represent the decisions made by schedulers in the operating day through hour-ahead (HA) scheduling. Peaking units can be committed or decommitted in the HA schedules and online units can be redispatched using forecasts that are improved

  5. PV solar electricity: status and future

    Science.gov (United States)

    Hoffmann, Winfried

    2006-04-01

    Within the four main market segments of PV solar electricity there are already three areas competitive today. These are off-grid industrial and rural as well as consumer applications. The overall growth within the past 8 years was almost 40 % p.a. with a "normal" growth of about 18 % p.a. for the first three market segments whereas the grid connected market increased with an astonishing 63 % p.a. The different growth rates catapulted the contribution of grid connected systems in relation to the total market from about one quarter 6 years ago towards more than three quarters today. The reason for this development is basically due to industry-politically induced market support programs in the aforementioned countries. It is quite important to outline under which boundary conditions grid connected systems will be competitive without support programs like the feed in tariff system in Germany, Spain and some more to come in Europe as well as investment subsidies in Japan, US and some other countries. It will be shown that in a more and more liberalized utility market worldwide electricity produced by PV solar electricity systems will be able to compete with their generating cost against peak power prices from utilities. The point of time for this competitiveness is mainly determined by the following facts: 1. Price decrease for PV solar electricity systems leading to an equivalent decrease in the generated cost for PV produced kWh. 2. Development of a truly liberalized electricity market. 3. Degree of irradiation between times of peak power demand and delivery of PV electricity. The first topic is discussed using price experience curves. Some explanations will be given to correlate the qualitative number of 20 % price decrease for doubling cumulative worldwide sales derived from the historic price experience curve with a more quantitative analysis based on our EPIA-Roadmap (productivity increase and ongoing improvements for existing technologies as well as development

  6. Ethanolic extract of Passiflora edulis Sims leaves inhibits protein glycation and restores the oxidative burst in diabetic rat macrophages after Candida albicans exposure

    Directory of Open Access Journals (Sweden)

    Carolina Fernandes Ribas Martins

    2015-12-01

    Full Text Available abstract This study was conducted to evaluate the effects of the ethanolic extract of Passiflora edulis leaves on blood glucose, protein glycation, NADPH oxidase activity and macrophage phagocytic capacity after Candida albicans exposure in diabetic rats. The Passiflora edulis Sims leaves were dried to 40°C, powdered, extracted by maceration in 70% ethanol, evaporated under reduced pressure and lyophilised. The biochemical tests performed were total phenolic content (TP as determined by the Folin-Ciocalteu assay, trapping potential DPPH assay and total iron-reducing potential. Diabetes was induced by alloxan injection. Protein glycation was determined by AGE and fructosamine serum concentrations. Extract-treated diabetic animals demonstrated lower fructosamine concentrations compared with the diabetic group. Our results suggest that ethanolic Passiflora edulis Sims leaf extraction may have beneficial effects on diabetes and may improve glycaemic control in diabetic rats.

  7. Parallel experimental study of a novel super-thin thermal absorber based photovoltaic/thermal (PV/T) system against conventional photovoltaic (PV) system

    OpenAIRE

    Peng Xu; Xingxing Zhang; Jingchun Shen; Xudong Zhao; Wei He; Deying Li

    2015-01-01

    Photovoltaic (PV) semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T) panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the...

  8. Development of pollen grain in yellow passion-fruit (Passiflora edulis f. flavicarpa; Passifloraceae

    Directory of Open Access Journals (Sweden)

    Margarete Magalhães de Souza

    2000-06-01

    Full Text Available To clarify events occurring during pollen grain formation in yellow passion-fruit (Passiflora edulis f. flavicarpa, floral buds were collected at different stages of development. After bracket, petal and sepal removal the anthers were fixed, dehydrated, embedded in paraffin wax, sectioned at 10 mum and after differential dying with safranin O and fast green, mounted in Canada balsam and observed under optical microscope. Formation of the male gamete followed the normal pattern for angiosperms. Observation covered final sporogenic mass phase up to pollen grain formation; microsporangium tissue modifications were also observed. Microsporogenesis was characterized by sporogenic tissue differentiation in microsporic mother cells, followed by meiosis and resulting in tetrads. Microgametogenesis began with callose microspore release, subsequent mitosis, in addition to radial and tangential tapetum wall degradation, parietal layer compression nearer to the tapetum and endothecium widening, terminating in mature pollen grain formation.Visando elucidar os processos que ocorrem durante a formação dos grãos de pólen em maracujá amarelo (Passiflora edulis f. flavicarpa, foram coletados botões em diferentes estádios de desenvolvimento. As anteras foram desidratadas, embebidas em parafina, cortadas a 10 mm e, após a coloração diferencial com safranina e verde rápido, montadas em bálsamo do Canadá e observadas sob microscópio óptico. A formação do gameta masculino seguiu padrão normal para angiospermas. A observação foi iniciada na fase final de massa esporogênica indo até a formação do grão de pólen, tendo sido também observadas as modificações ocorridas nos tecidos do microsporângio. A microsporogênese foi caracterizada pela diferenciação do tecido esporogênico em células-mãe de micrósporos, passando por meiose e resultando em tétrades. A microgametogênese iniciou-se com a liberação dos micrósporos da calose, os

  9. Begin at the beginning: A BAC-end view of the passion fruit (Passiflora) genome.

    Science.gov (United States)

    Santos, Anselmo Azevedo; Penha, Helen Alves; Bellec, Arnaud; Munhoz, Carla de Freitas; Pedrosa-Harand, Andrea; Bergès, Hélène; Vieira, Maria Lucia Carneiro

    2014-09-26

    The passion fruit (Passiflora edulis) is a tropical crop of economic importance both for juice production and consumption as fresh fruit. The juice is also used in concentrate blends that are consumed worldwide. However, very little is known about the genome of the species. Therefore, improving our understanding of passion fruit genomics is essential and to some degree a pre-requisite if its genetic resources are to be used more efficiently. In this study, we have constructed a large-insert BAC library and provided the first view on the structure and content of the passion fruit genome, using BAC-end sequence (BES) data as a major resource. The library consisted of 82,944 clones and its levels of organellar DNA were very low. The library represents six haploid genome equivalents, and the average insert size was 108 kb. To check its utility for gene isolation, successful macroarray screening experiments were carried out with probes complementary to eight Passiflora gene sequences available in public databases. BACs harbouring those genes were used in fluorescent in situ hybridizations and unique signals were detected for four BACs in three chromosomes (n=9). Then, we explored 10,000 BES and we identified reads likely to contain repetitive mobile elements (19.6% of all BES), simple sequence repeats and putative proteins, and to estimate the GC content (~42%) of the reads. Around 9.6% of all BES were found to have high levels of similarity to plant genes and ontological terms were assigned to more than half of the sequences analysed (940). The vast majority of the top-hits made by our sequences were to Populus trichocarpa (24.8% of the total occurrences), Theobroma cacao (21.6%), Ricinus communis (14.3%), Vitis vinifera (6.5%) and Prunus persica (3.8%). We generated the first large-insert library for a member of Passifloraceae. This BAC library provides a new resource for genetic and genomic studies, as well as it represents a valuable tool for future whole genome

  10. DESENVOLVIMENTO DE MUDAS DE MARACUJAZEIRO-AZEDO ENXERTADAS EM ESPÉCIES SILVESTRES DE Passiflora

    Directory of Open Access Journals (Sweden)

    MARCOS ANTONIO DELL'ORTO MORGADO

    2015-06-01

    Full Text Available O maracujazeiro-azedo é acometido por diversas doenças, sendo que as do sistema radicular tendem a inviabilizar o cultivo em diversas regiões; entretanto, há espécies de Passifloras que se demonstram resistentes, sendo que tornam necessários estudos sobre a influência pela enxertia destas espécies no maracujazeiro-azedo. Portanto, objetivou-se estudar a viabilidade da enxertia e o desenvolvimento inicial de maracujazeiro-azedo (Passiflora edulis enxertado sobre P. alata, P. cincinnata, P. edulis, P. gibertii, P. morifolia e P. mucronata, comparadas com P. edulis não enxertado, proveniente de sementes. Aos 60 dias após a semeadura, foi realizada a enxertia por garfagem e, por um período de 105 dias, avaliaram-se a sobrevivência dos enxertos, altura da planta, comprimento dos internódios, número de folhas, diâmetro do porta-enxerto e do enxerto, área foliar e a massa da matéria seca da parte aérea e das raízes. A sobrevivência da enxertia foi superior a 90%, exceto na combinação P. edulis/P. morifolia que não apresentou brotações do enxerto e, posteriormente, morreram. A combinação P. edulis/P. gibertii tiveram menor altura do que P. edulis/P. mucronata, porém com semelhantenúmero de folhas, demonstrando que o P. gibertii teve efeito ananizante, devido à redução do comprimento dos internódios. O maior diâmetro do enxerto foi apresentado por P. edulis/P. edulis, indicando maior compatibilidade de enxertia dentro da mesma espécie. Dentre as espécies silvestres utilizadas como porta-enxerto, P. mucronata proporcionou maior desenvolvimento da parte aérea.

  11. Caracterización fisiológica del fruto de gulupa (Passiflora edulis Sims), en condiciones del bosque húmedo montano bajo de Colombia

    OpenAIRE

    Franco, Germán

    2013-01-01

    Resumen: Los “frutales alto-andinos”, se consideran como frutos agradables, generalmente se comercializan y consumen en fresco, tienen corta vida en poscosecha debido a su alta actividad metabólica, lo que afecta su calidad y dificulta el transporte y comercialización en forma natural. El género Passiflora cuenta con gran número de especies comestibles, de las cuales pocas han sido estudiadas, la gulupa (Passiflora edulis Sims), es una de ellas. En Colombia ha adquirido importancia nacional, ...

  12. The Value of Transparency in Distributed Solar PV Markets

    Energy Technology Data Exchange (ETDEWEB)

    OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-10-09

    Distributed solar photovoltaic (PV) markets are relatively non-transparent: PV price and product information is not readily available, searching for this information is costly (in terms of time and effort), and customers are mostly unfamiliar with the new technology. Quote aggregation, where third-party companies collect PV quotes on behalf of customers, may be one way to increase PV market transparency. In this paper, quote aggregation data are analyzed to study the value of transparency for distributed solar PV markets. The results suggest that easier access to more quotes results in lower prices. We find that installers tend to offer lower prices in more competitive market environments. We supplement the empirical analysis with key findings from interviews of residential PV installers.

  13. Estudo comparativo do perfil de ácidos graxos em semente de Passifloras nativas do cerrado brasileiro A comparative study of fatty acids profile of Passiflora seed from Brazilian savana

    Directory of Open Access Journals (Sweden)

    Renata Miranda Lopes

    2010-06-01

    Full Text Available No mundo, existem mais de 580 espécies de maracujazeiros, grande parte nativa da América Tropical e Subtropical, principalmente no Brasil. Os programas de melhoramento utilizam uma parte pequena dos recursos genéticos disponíveis, já que o potencial deste material geralmente não está suficientemente caracterizado. O objetivo deste trabalho foi a caracterização do teor de lipídios e do perfil de ácidos graxos presentes nas sementes de 03 espécies nativas silvestres de maracujás (Passiflora cincinnata, P. setacea e P. nitida, empregando o maracujá comercial (P.edulis como referência. Os lipídios totais foram extraídos com éter de petróleo em extrator tipo Soxhlet. O perfil dos ésteres metílicos foi caracterizado por cromatografia a gás, usando detector de ionização de chama. A espécie P. setacea apresentou o maior teor de óleo (31,2-33,5%, seguida por P. nitida (29,5-32,3% e P. cincinnata (16,7-19,2%. O óleo de P. setacea apresentou 64,7% de ácido linoleico, 19,7% de oleico e 10,2% de ácido palmítico; o óleo de P. nitida apresentou os ácidos mirístico (0,6%, palmítico (15,3%, palmitoleico (2,0%, oleico (24,8%, linoleico (51,7% e um ácido graxo incomum às outras espécies de Passiflora, o láurico (0.4%; já o óleo de P. cincinnata apresentou os ácidos oleico (11,0%, palmítico (10,2% e linoleico (74,3%. O ácido linoleico foi predominante nas três espécies estudadas. Todas as espécies apresentaram ácido vacênico (0,3-0,6%, descrito pela primeira vez no gênero Passiflora.There are more 580 species of passion fruit in world, majority native from America Tropical and Subtropical, especially Brazil. Breeding programs use small part of genetic resources available, because potential of this material is not sufficiently characterized. The objective of this work was the characterization of lipids content and fatty acids profile present in the seeds of 03 species of wild native passion fruit (Passiflora

  14. Photovoltaic (PV) energy in the Netherlands and Switzerland. A comparison

    International Nuclear Information System (INIS)

    Van der Loo, F.; Spiessens, P.

    1995-01-01

    The development of photovoltaic (PV) energy in Switzerland and the Netherlands is compared for a number of aspects. The Swiss have realized more PV capacity. Also the economic conditions to develop PV are better in Switzerland than in the Netherlands. In Switzerland the public support is mobilized for solar energy while in the Netherlands a social basis is created for wind energy. 3 ills., 3 tabs

  15. Improving the efficiency of photovoltaic (PV) panels by oil coating

    International Nuclear Information System (INIS)

    Abd-Elhady, M.S.; Fouad, M.M.; Khalil, T.

    2016-01-01

    Highlights: • It is possible to improve the efficiency of PV panels by increasing the amount of light transmitted to the panel. • Coating PV panels by a fine layer of Labovac oil increases the amount of sun light transmitted to the panel. • Coating PV panels by a fine layer of Labovac oil increases the power output of the panel. • Coating PV panels with a layer of Labovac oil has to be applied in cold countries and not in hot regions. - Abstract: The objective of this research is to develop a new technique for improving the efficiency of Photovoltaic (PV) panels. This technique is done by coating the front surface of the PV panel by a fine layer of oil in order to increase the amount of light transmitted to the panel, and consequently its efficiency. Different types of oils are examined, including both mineral oils and natural oils. In case of mineral oils; vacuum pump oil (Labovac oil), engine oil (Mobil oil) and brake oil (Abro oil) are examined, while in case of natural oils; olive and sunflower oils are examined. An experimental setup has been developed to examine the performance of the PV panels as a function of oil coatings. The experimental setup consists of an artificial sun, the PV panel under investigation, a cooling system and a measuring system to measure the performance of the panel. It has been found that coating the PV panel with a fine layer of Labovac oil, ∼1 mm thick, improves the efficiency of the PV panel by more than 20%, and this is due to the high transmissivity of the Labovac oil compared to other oils. However, the Labovac oil has a drawback which is overheating of the panel due to its high transmissivity. Coating of PV panels with a fine layer of Labovac oil should be done only in cold regions, in order to avoid the heating effect that can decrease the power output of PV panels.

  16. NREL PV Working With Industry Newsletter: 4th Quarter 1999

    Energy Technology Data Exchange (ETDEWEB)

    Moon, S.; Poole, L.

    2000-03-03

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The Fourth Quarter, 1999 issue, titled ''Knowledge is PV Power'' focuses on the contribution of the university-based subcontractors to the PV Program. The editorialist is Robert Birkmire, Director of the Institute of Energy Conversion, which is affiliated with the University of Delaware.

  17. PV window - Development and demonstrations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Haugaard, P.

    2011-05-15

    Using the results from the EU project RenewTransnet, which focused on the development of a pane with integrated solar cells, the goal of this project is to develop these principles into a window solution. This window solution is targeted to Danish building tradition and architecture. It is expected that an elegant PV-window solution for both new and retrofit buildings is developed during this project, and which appearance can be customized to each building. Based on results from a related projects carried out by Gaia Solar, the window solution will have the potential of being approximately 30% cheaper than similar products on the market. In this project this price reduction is the objective of the development of a window solution. The project team has succeeded in developing a 2-layer PV-window with glass / glass lamination with EVA as foil, which is 35% cheaper than similar products on the market. Since the price for the frame-profile does not differ significantly at market level, the price comparison is made on the basis of the developed PV-pane. The objective of 30 % price reduction in relation to similar products on the market is met. A special production process to the making glass/glass lamination with EVA as foil has been developed, in which a frame is put around the module which intends both to remove the unwanted tension along the edges, and to prevent the significant spillage of EVA from the module under pressure and prevent the invasive bubbles along the edge of module. Since the developed production method for making glass/glass modules with EVA is simple, a further cost reduction will primarily be in a reduction of the price of the cell. The project process has resulted in the development of a product, which due to continuous restrictions in the building regulations, will be very attractive in future buildings. (LN)

  18. Ancillary services provided by PV power plants

    Directory of Open Access Journals (Sweden)

    Antonio PIERNO

    2016-07-01

    Full Text Available Renewable energy sources are widely utilized in distributed generation systems, and, recently, they are also considered for providing ancillary services. The paper is focused on PV plants, a survey of the most interesting papers published in the literature in the last decade is reported and the main characteristics of the technical proposals, with their advantages and limits, are evidenced. The results are schematically shown in a table that immediately gives the opportunity to be aware of what was already done, representing a reference tool.

  19. Ultra Accelerated Testing of PV Module Components

    Energy Technology Data Exchange (ETDEWEB)

    Pitts, J. R.; King, D. E.; Bingham, C.; Czanderna, A. W.

    1998-10-28

    Using concentrated natural sunlight at the NREL High Flux Solar Furnace, we have exposed several materials to acceleration factors of up to 400 times the normal outdoor UV exposure dose. This accelerated rate allows the exposure of materials such that a year of outdoor exposure can be simulated in about 5 hours. We have studied the solarization of cerium containing glass, the degradation of ethylene vinyl acetate laminated between borosilicate glass, and the yellowing of standard polystyrene test coupons. The first two candidates are of interest to the photovoltaics (PV) program, and the last candidate material is a widely used dosimeter for ultra violet (UV) exposure in accelerated weathering chambers

  20. Considerations on modelling grid-integrated PV

    CSIR Research Space (South Africa)

    Carter-Brown, Clinton

    2017-08-01

    Full Text Available /ZAR assumed Sources: http://www.energy.gov.za/files/renewable-energy-status-report/Market-Overview-and-Current-Levels-of-Renewable-Energy- Deployment-NERSA.pdf; http://www.saippa.org.za/Portals/24/Documents/2016/Coal%20IPP%20factsheet.pdf; http... became cost competitive to conventionals during the last decade (PV: last 2-3 years) • Subsidy-driven market creation in first-mover renewables regions (US, Europe, Japan) led to technology improvements and mass manufacturing In matured markets...

  1. Interharmonics from Grid-Connected PV Systems

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2017-01-01

    As the penetration level of grid-connected Photovoltaic (PV) systems increases, the power quality is one of the major concerns for system operators and the demands are becoming even stricter. The impact of interharmonics on the grid has been acknowledged in recent research when considering a large...... of the Maximum Power Point Tracking (MPPT) algorithm is one of the sources that induce interharmonics in the grid current, especially at low-power operating conditions. Accordingly, three mitigation solutions are discussed to address this issue, and simulations have been carried out to verify the effectiveness...

  2. Comportamento de maracujazeiros (Passiflora spp. quanto à morte prematura Behavior of passionfruit (Passiflora spp.in relation to premature death of plants

    Directory of Open Access Journals (Sweden)

    Givanildo Roncatto

    2004-12-01

    Full Text Available Na Universidade Estadual Paulista, Câmpus de Jaboticabal-SP, estudou-se o comportamento de Passifloráceas quanto à morte prematura de plantas, cultivadas em local com histórico da doença. O objetivo do trabalho foi avaliar o comportamento de diversos "acessos" de populações e espécies de maracujazeiros em relação a esta doença, sendo que as plantas resistentes deverão ser utilizadas como porta-enxertos de formas comerciais de maracujá-amarelo (Passiflora edulis Sims f. flavicarpa e em programas de melhoramento genético. As espécies utilizadas foram P. edulis Sims, P. edulis Sims f. flavicarpa Degener, P. nitida H.B.K., P. cincinnata, P. giberti, P. laurifolia, P. morifolia, P. foetida e P. capsularis. Em local com histórico da doença, plantaram-se mudas em número variável e em épocas distintas. A condução das plantas e os tratos culturais foram os recomendados para o maracujá-amarelo. A morte prematura das plantas ocorreu entre dois meses e dois anos da cultura no campo. P. giberti e P. nitida mostraram-se resistente à doença, independentemente do local de origem. Entre os demais "acessos", não se encontraram fontes promissoras de resistência. Entretanto, novos "acessos" e novas espécies deverão ser estudadas na busca da resistência.The behavior of passionfruit, cultivated in sites with disease history, as to premature death, was researched at Universidade Estadual Paulista, Campus of Jaboticabal, SP. The purpose of the research was to evaluate the behavior of acesses and passionfruit species related to this disease, whereas resistant plants are to be used as yellow passionfruit rootstocks, as well as in breeding programs. The species P. edulis Sims, P. edulis Sims f. flavicarpa Degener, P. nitida H.B.K., P. cincinnata, P. giberti, P. laurifolia, P. morifolia, P. foetida, P. capsularis were used. In a site with a known record of the disease, the plants were planted in a variable number and at distinct times. Plant

  3. Accelerating residential PV expansion: supply analysis for competitive electricity markets

    International Nuclear Information System (INIS)

    Payne, Adam; Williams, Robert H.; Duke, Richard

    2001-01-01

    Photovoltaic (PV) technology is now sufficiently advanced that market support mechanisms such as net metering plus a renewable portfolio standard (RPS) could induce rapid PV market growth in grid-connected applications. With such support mechanisms, markets would be sufficiently large that manufacturers could profitably build and operate 100 MW p /yr PV module factories, and electricity costs for residential rooftop PV systems would compare favorably with residential electricity prices in certain areas (e.g., California and the greater New York region in the US). This prospect is illustrated by economic and market analyses for one promising technology (amorphous silicon thin-film PV) from the perspectives of both module manufacturers and buyers of new homes with rooftop PV systems. With public policies that reflect the distributed and environmental benefits offered by PV-and that can sustain domestic PV market demand growth at three times the historical growth rate for a period of the order of two decades - PV could provide 3% of total US electricity supply by 2025. (Author)

  4. Fault Analysis and Detection in Microgrids with High PV Penetration

    Energy Technology Data Exchange (ETDEWEB)

    El Khatib, Mohamed [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hernandez Alvidrez, Javier [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Ellis, Abraham [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-05-01

    In this report we focus on analyzing current-controlled PV inverters behaviour under faults in order to develop fault detection schemes for microgrids with high PV penetration. Inverter model suitable for steady state fault studies is presented and the impact of PV inverters on two protection elements is analyzed. The studied protection elements are superimposed quantities based directional element and negative sequence directional element. Additionally, several non-overcurrent fault detection schemes are discussed in this report for microgrids with high PV penetration. A detailed time-domain simulation study is presented to assess the performance of the presented fault detection schemes under different microgrid modes of operation.

  5. Solar Energy: Incentives to Promote PV in EU27

    Directory of Open Access Journals (Sweden)

    María del P. Pablo-Romero

    2013-11-01

    Full Text Available The growth in the use of renewable energies in the EU has been remarkable. Among these energies is PV. The average annual growth rate for the EU-27 countries in installed PV capacity in the period 2005-2012 was 41.2%. While the installed capacity of PV has reached almost 82 % of National Renewable Energy Action Plan (NREAP targets for the EU-27 countries for 2020, it is still far from being used at its full potential. Over recent years, several measures have been adopted in the EU to enhance and promote PV. This paper undertakes a complete review of the state of PV power in Europe and the measures taken to date to promote it in EU-27. 25 countries have adopted measures to promote PV. The most widespread measure to promote PV use is Feed- in Tariffs. Tariffs are normally adjusted, in a decreasing manner, annually. Nevertheless, currently, seven countries have decided to accelerate this decrease rate in view of cost reduction of the installations and of higher efficiencies. The second instrument used to promote PV in the EU-27 countries is the concession of subsidies. Nevertheless, subsidies have the disadvantage of being closely linked to budgetary resources and therefore to budgetary constraints. In most EU countries, subsidies for renewable energy for PV are being lowered. Twelve EU-27 countries adopted tax measures. Low-interest loans and green certificate systems were only sparingly used.

  6. Evaluation of a solar PV tracking prototype on tropic regions

    Directory of Open Access Journals (Sweden)

    Cristian Manuel Agudelo Restrepo

    2016-06-01

    Full Text Available Nowadays climate change is a big concern for human society, due to our high dependence on fossil fuels. A great amount of research effort is focused in solar photovoltaic (PV systems, particularly on the improvement of the conversion efficiency. One technique commonly used is the tracking systems, where the solar PV moves with the sun in order to capture the maximum direct solar radiation. This paper presents a solar PV single-axis tracking system prototype, and a comparison regarding its energy conversion efficiency with a fixed solar PV installation. The system was tested in Fusagasugá, Colombia, which is located in the tropics region.

  7. NREL PV Working With Industry, v. 27, Third Quarter 2000

    Energy Technology Data Exchange (ETDEWEB)

    Poole, L.; Nahan, R.

    2000-09-12

    NREL PV Working With Industry is a quarterly newsletter devoted to the research, development, and deployment performed by NREL staff in concert with their industry and university partners. The third quarter, contains articles on several important PV-related conferences held in the prior three months: the REAP/HBCU Conference and the IPS-2000 Photochemistry Conference. The issue also contains a preview article of the PV Specialists conference held in Alaska in September. The editorialist is John Benner, PV Specialist Conference Program Chairman.

  8. Solar photovoltaic (PV) energy; latest developments in the building integrated and hybrid PV systems

    International Nuclear Information System (INIS)

    Zahedi, A.

    2006-01-01

    Environmental concerns are growing and interest in environmental issues is increasing and the idea of generating electricity with less pollution is becoming more and more attractive. Unlike conventional generation systems, fuel of the solar photovoltaic energy is available at no cost. And solar photovoltaic energy systems generate electricity pollution-free and can easily be installed on the roof of residential as well as on the wall of commercial buildings as grid-connected PV application. In addition to grid-connected rooftop PV systems, solar photovoltaic energy offers a solution for supplying electricity to remote located communities and facilities, those not accessible by electricity companies. The interest in solar photovoltaic energy is growing worldwide. Today, more than 3500MW of photovoltaic systems have been installed all over the world. Since 1970, the PV price has continuously dropped [8]. This price drop has encouraged worldwide application of small-scale residential PV systems. These recent developments have led researchers concerned with the environment to undertake extensive research projects for harnessing renewable energy sources including solar energy. The usage of solar photovoltaic as a source of energy is considered more seriously making future of this technology looks promising. The objective of this contribution is to present the latest developments in the area of solar photovoltaic energy systems. A further objective of this contribution is to discuss the long-term prospect of the solar photovoltaic energy as a sustainable energy supply. [Author

  9. Interconnection of inverter dominated PV-hybrid systems; Vernetzung stromrichterdominierter PV-Hybridsysteme

    Energy Technology Data Exchange (ETDEWEB)

    Landau, M.; Engler, A.; Geipel, R.; Strauss, P. [Institut fuer Solare Energieversorgungstechnik (ISET), Kassel (Germany); Heinzemann, T.; Rothert, M. [SMA System-, Mess- und Anlagentechnik - Regelsysteme GmbH, Niestetal (Germany)

    2004-07-01

    In the bay of Gaidouromandra on the Greek island of Kythnos two three phase power supply systems were set up and operated within the frame of two European projects from 2000 to 2001. One is a PV-battery system and the other one is a PV-battery-diesel system. A speciality of both systems is the distributed PV-generation with the solar panels and PV-inverters (Sunny Boy {sup registered}) installed on the properties of several inhabitants. With the combination of both supply systems and changing the grid topology from three to single phase operation the problems further developments and a lot of system advantages could be demonstrated. The implementation of the new SELFSYNC {sup registered} multi master control method resulted in further improvement concerning available peak power and system reliability. In June 2003 the two three phase supply systems were converted into one single phase system. First operation experience is available and reported on. It is shown, that a suitable grid topology and interconnection result in advantages for the overall supply system. The benefits of the parallel operation of three Sunny Island {sup registered} battery inverters on a single phase are: (1) less inverters necessary, (2) lower idle consumption of the overall system, (3) increased power of the single phase and (4) redundancy. (orig.)

  10. Experimental investigation of PV modules recycling; PV module recycle no jikkenteki kento

    Energy Technology Data Exchange (ETDEWEB)

    Unagida, H.; Kurokawa, K. [Tokyo University of Agriculture and Technology, Tokyo (Japan); Sakuta, K.; Otani, K.; Murata, K. [Electrotechnical Laboratory, Tsukuba (Japan)

    1997-11-25

    Recycling, cost/energy analysis and recovery experiment were made on crystalline silicon PV modules with EVA(ethylene vinyl acetate)-laminated structure. The life of modules is dependent not on performance deterioration of PV cells themselves but on yellowing or poor transmittance of EVA caused by ultraviolet ray, and disconnection between cells by thermal stress. Recovery is carried out in 3 stages of cell, wafer and material. Recovery in the stages of cell and wafer results in considerable reduction of energy and cost. The recovery experiment was carried out using PV module samples prepared by cutting the modules into 25times15mm pieces after removing Al frames from the used modules, peeling back sheets and cutting off EVA. Since a nitric acid process at 70-80degC can dissolve EVA effectively, it is promising for reuse of surface glass and PV cells as they are. This process is also carried out under a condition around room temperature and pressure, contributing to cost reduction and energy saving for recycling. Generation of harmful NOx is only a problem to be solved. 2 refs., 6 figs., 1 tab.

  11. Molecular identification of a new begomovirus infecting yellow passion fruit (Passiflora edulis) in Colombia.

    Science.gov (United States)

    Vaca-Vaca, Juan Carlos; Carrasco-Lozano, Emerson Clovis; López-López, Karina

    2017-02-01

    The complete genome sequence of a bipartite begomovirus (genus Begomovirus, family Geminiviridae) infecting yellow passion fruit (Passiflora edulis) in the state of Valle del Cauca (Colombia) has been determined. The complete DNA-A and DNA-B components were determined to be 2600 and 2572 nt in length, respectively. The DNA-A showed the highest nucleotide sequence identity (87.2 %) to bean dwarf mosaic virus (M88179), a begomovirus found in common bean crops in Colombia, and only 77.4 % identity to passion fruit severe leaf distortion virus (FJ972767), a begomovirus identified infecting passion fruit in Brazil. Based on its sequence identity to all other begomoviruses known to date and in accordance with the ICTV species demarcation criterion for the genus Begomovirus (≥91 % sequence identity for the complete DNA-A), the name passion fruit leaf distortion virus is proposed for this new begomovirus. To our knowledge, this is the first report of a bipartite begomovirus affecting passion fruit in Colombia and the second report of a geminivirus affecting this crop worldwide.

  12. Nutritional Composition and Antioxidant Properties of the Fruits of a Chinese Wild Passiflora foetida.

    Science.gov (United States)

    Song, Ya; Wei, Xiao-Qun; Li, Mei-Ying; Duan, Xue-Wu; Sun, Yuan-Ming; Yang, Rui-Li; Su, Xiang-Dong; Huang, Ri-Ming; Wang, Hong

    2018-02-19

    The aim of this work was to evaluate the main nutrients and their antioxidant properties of a Chinese wild edible fruit, Passiflora foetida , collected from the ecoregion of Hainan province, China. The analytical results revealed that P. foetida fruits were rich in amino acids (1097 mg/100 g in total), minerals (595.75 mg/100 g in total), and unsaturated fatty acids (74.18 g/100 g in total fat). The lyophilized powder of edible portion contained the higher polyphenols content than the inedible portion powder. The UPLC-Q-TOF-MS E analysis of the extractable and non-extractable phenolics indicated the presence of 65 compounds including 39 free phenolics, 14 insoluble-glycoside-phenolics, and 22 insoluble-ester-phenolics. In addition, the non-extractable phenolics obtained by alkali hydrolysis showed significant antioxidant activities by/through DPPH and ABTS radical scavenging. These findings of P. foetida fruits, for the first time, suggest that these polyphenol-rich fruits may have potential nutraceutical efficacies.

  13. Pollen: ovule ratio and its relationship with other reproductive traits in some Passiflora species (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Amela García, María Teresa

    2014-12-01

    Full Text Available The pollen/ovule (P/O ratio has been used as predictor of the reproductive system of angiosperms (lowest P/O values correspond to obligate autogamous species while the highest correlate with obligate xenogamous species but it does not keep for all the taxa. The relation of P/O index with pollen and stigma size, flower diameter, pollen vitality, stigmatic area/pollen-bearing area of the pollinators ratio (SA/PBA, taxonomy and breeding system was analyzed in four Passiflora species with different degree of compatibility, pollination system and taxonomic placement. P/O of the self-compatible species (with shorter anthesis, scarce pollinator visits or minor longevity was lower than P/O of the self-incompatible ones. The P/O values of the outcrossers could be related with the highly efficient pollination performed by the frequently visiting Xylocopa species; these bees transport Passiflora pollen in a usually monospecific mass on the thorax, resembling grouped pollen dispersal. All the taxa exhibited pollen with unimodal size and high vitality, except for P. misera, in which pollen size was bimodal, with similar quantities of grains in both classes, the large being more vital than the small ones. Correlations of P/O were positive with flower size, negative with stigma area/pollen-bearing area of the pollinator, null with stigma area and not significant with pollen size. The P/O ratio did not reflect taxonomic affinities; this index and the breeding system were more related with pollinator type, anthesis, flower size and SA/PBA than with pollen grain or stigma size.La utilidad del índice polen/óvulos (P/O para predecir el sistema reproductivo de las Angiospermas (los valores más bajos corresponden a especies autógamas obligadas mientras que los valores más altos a especies xenógamas obligadas no siempre ocurre. Analizamos la relación del P/O respecto del tamaño del polen y estigma, diámetro floral, viabilidad polínica, proporción

  14. BIOLOGÍA FLORAL Y REPRODUCTIVA DE LA GULUPA PASSIFLORA EDULIS SIMS F. EDULIS

    Directory of Open Access Journals (Sweden)

    Angel-Coca Catalina

    2011-12-01

    Full Text Available Se estudió la biología floral y reproductiva de Passiflora edulis f. edulis en cultivos ubicados en la Cordillera Oriental en los Andes colombianos (Buenavista, Boyacá. La flor presentó antesis entre las 6 y las 8 hrs, la longevidad floral promedio fue de 25 hrs. Se reconocieron cuatro fases fenológicas: (1 Femenina con hercogamia (2 Homógama con hercogamia (3 Homógama sin hercogamia y (4 Senescente. Aunque el estigma está receptivo durante todas las fases florales, se obtuvo mayor producción de frutos en las fases segunda y tercera. La donación del polen, en su mayoría ocurrió en la fase dos con una viabilidad del 96%. El néctar mostró una tendencia ascendente durante la vida floral. Los experimentos de polinización indican que la gulupa es una variedad altamente autocompatible, pero requiere de los polinizadores para producir una buena cosecha, pues sólo el 33% de los frutos se forma sin el acceso de éstos. Los resultados sugieren que la gulupa tiene una estrategia floral mixta con el potencial para promover endogamia y entrecruzamiento genético, y que la conservación de las abejas polinizadoras es crucial en la productividad de este frutal.

  15. Multivariate analysis of backcross progeny of Passiflora L. (Passifloraceae) for pre-breeding genotype selection.

    Science.gov (United States)

    Melo, C A F; Souza, M M; Sousa, A G R; Viana, A P; Santos, E A

    2015-11-30

    The Ward-MLM procedure was used to evaluate genetic variation in four backcross progenies and in their parents, hybrid F1 HD13 and donor parent Passiflora sublanceolata. Sixteen quantitative descriptors and five qualitative characteristics of relevance to ornamental flower production were assessed. Using the pseudo-F and pseudo-T² criteria, we identified four groups among these plants in two evaluation periods. In both evaluations, the BC1 plants showed greater dissimilarity to their recurrent parent, but showed high genetic similarity with the P. sublanceolata parent. The first two canonical variables produced by the Ward-MLM procedure accounted for over 90% of the variation in both evaluation periods, enabling the representation of diversity through two-dimensional graphics. Groups II and IV were formed in the first assessment period. Groups I and IV formed in the second period and showed plants with selection potential. We found that it was essential to use both qualitative and quantitative variables for this analysis. Assessments of quantitative descriptors indicate that the selection of BC1 plants can be performed in any of the four progenies. Because of the similarities observed for some floral descriptors between BC1 and the P. sublanceolata parent, a second generation backcross was not recommended. However, the selection of BC1 plants for evaluation and direct use as an ornamental cultivar, or as a resource in other breeding programs, can be recommended.

  16. Passiflora tarminiana fruits reduce UVB-induced photoaging in human skin fibroblasts.

    Science.gov (United States)

    Bravo, Karent; Duque, Luisa; Ferreres, Federico; Moreno, Diego A; Osorio, Edison

    2017-03-01

    Skin aging is a complex process that is strongly affected by UV radiation, which stimulates the production of reactive oxygen species (ROS) in the epidermis and dermis and subsequently causes skin damage. Among the major consequences are increased collagen degradation and reduced collagen synthesis. Previous reports have demonstrated the beneficial effects of polyphenols for healthy skin. Passiflora tarminiana Coppens & V.E. Barney, a species of the Passifloraceae family, is widely distributed in South America and is rich in flavonoids. We show that UVB radiation increases metalloproteinase 1 (MMP-1) and reduces procollagen production in human dermal fibroblast (HDF) cells in a dose- and time-dependent manner. We examined the antioxidant and antiaging effects of the extract and fractions of P. tarminiana fruits. The fractions showed high polyphenol content (620mg EAG/g) and antioxidant activity, as measured by ORAC (4097μmol ET/g) and ABTS (2992μmol ET/g) assays. The aqueous fraction drastically inhibited the collagenase enzyme (IC 50 0.43μg/mL). The extract and fractions presented photoprotective effects by reducing UVB-induced MMP-1 production, increasing UVB-inhibited procollagen production, and decreasing ROS production after UVB irradiation in HDF. Finally, the polyphenol contents of the extracts and fractions from P. tarminiana were analyzed by HPLC-DAD-ESI-MS n , and procyanidins and glycosylated flavonoids were identified. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Chemical studies on curuba (Passiflora mollissima (Kunth) L. H. Bailey) fruit flavour.

    Science.gov (United States)

    Conde-Martínez, Natalia; Sinuco, Diana Cristina; Osorio, Coralia

    2014-08-15

    The odour-active volatiles of curuba fruit (Passiflora mollissima (Kunth) L. H. Bailey) were isolated by solvent assisted flavour evaporation (SAFE). GC-O and GC-MS analyses identified linalool, hexyl acetate, 1,8-cineole, and butyl acetate as key aroma compounds of this fruit. Other odorants relevant because of their contribution to the overall aroma were: 2-methylpropyl acetate, (Z)-3-hexen-1-ol, and (Z)-3-hexenyl acetate. Sulphur compounds, 3-sulfanylhexyl acetate and methional, were reported here for first time as odour-active volatiles in curuba. By HPLC-ESI-MS analyses of glycosidic mixtures and GC-MS analyses of volatiles released enzymatically with a glucosidase, (Z)-3-hexenyl β-D-glucopyranoside and linalyl β-D-glucopyranoside were identified as aroma precursors in P. mollissima fruit. Thermal treatment of the glycosidic mixture at native pH of fruit gave furanoid cis- and trans-linalool oxides, as well as, α-terpineol, compounds that exhibit flowery odour notes. Biogenic relationships among odour-active volatiles and their glycosidic precursors were also proposed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Nutritional Composition and Antioxidant Properties of the Fruits of a Chinese Wild Passiflora foetida

    Directory of Open Access Journals (Sweden)

    Ya Song

    2018-02-01

    Full Text Available The aim of this work was to evaluate the main nutrients and their antioxidant properties of a Chinese wild edible fruit, Passiflora foetida, collected from the ecoregion of Hainan province, China. The analytical results revealed that P. foetida fruits were rich in amino acids (1097 mg/100 g in total, minerals (595.75 mg/100 g in total, and unsaturated fatty acids (74.18 g/100 g in total fat. The lyophilized powder of edible portion contained the higher polyphenols content than the inedible portion powder. The UPLC-Q-TOF-MSE analysis of the extractable and non-extractable phenolics indicated the presence of 65 compounds including 39 free phenolics, 14 insoluble-glycoside-phenolics, and 22 insoluble-ester-phenolics. In addition, the non-extractable phenolics obtained by alkali hydrolysis showed significant antioxidant activities by/through DPPH and ABTS radical scavenging. These findings of P. foetida fruits, for the first time, suggest that these polyphenol-rich fruits may have potential nutraceutical efficacies.

  19. Effects of altitudinal variation on pollination in purple passion fruit crops (passiflora edulis f. edulis)

    International Nuclear Information System (INIS)

    Medina Gutierrez, Julian; Ospina Torres, Rodulfo; Nates Parra, Guiomar

    2012-01-01

    The purpose of this paper is to study in two crops of purple passion fruit Passiflora edulis f. edulis harvested at different altitudes (2225 m.a.s.l. and 1657 m.a.s.l.) in the municipality of Buenavista - Boyaca, located in the eastern Mountain range of Colombia, in order to familiarize with visitors and pollinators. This study reveals that in both crops there were differences found in composition, the number of visitors and pollinators. In the crop at 2225 m.a.s.l., 7 species were registered, while 18 species were recorded at the 1657 m.a.s.l. crop. In order to achieve this, collected material by the visitors and the floral structures with which they approach, were observed; at the same time four experiments took place: passive pollination, natural pollination, manual pollination and pollinator's efficiency. These experiments established that pollinator species are: in C1 Apis mellifera, and in C2 and Xylocopa frontalis, Xylocopa lachnea and Epicharis sp.

  20. Passiflora incarnata L. Improves Spatial Memory, Reduces Stress, and Affects Neurotransmission in Rats.

    Science.gov (United States)

    Jawna-Zboińska, Katarzyna; Blecharz-Klin, Kamilla; Joniec-Maciejak, Ilona; Wawer, Adriana; Pyrzanowska, Justyna; Piechal, Agnieszka; Mirowska-Guzel, Dagmara; Widy-Tyszkiewicz, Ewa

    2016-05-01

    Passiflora incarnata L. has been used as a medicinal plant in South America and Europe since the 16th century. Previous pharmacological studies focused mainly on the plant's sedative, anxiolytic, and anticonvulsant effects on the central nervous system and its supporting role in the treatment of addiction. The aim of the present study was to evaluate the behavioral and neurochemical effects of long-term oral administration of P. incarnata. The passionflower extract (30, 100, or 300 mg/kg body weight/day) was given to 4-week-old male Wistar rats via their drinking water. Tests were conducted after 7 weeks of treatment. Spatial memory was assessed in a water maze, and the levels of amino acids, monoamines, and their metabolites were evaluated in select brain regions by high performance liquid chromatography (HPLC). We observed reduced anxiety and dose-dependent improvement of memory in rats given passionflower compared to the control group. In addition, hippocampal glutamic acid and cortical serotonin content were depleted, with increased levels of metabolites and increased turnover. Thus, our results partially confirmed the proposed mechanism of action of P. incarnata involving GABAA receptors. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  1. THE USE OF EXTRACTS FROM PASSIFLORA SPP. IN HELPING THE TREATMENT OF ACANTHAMOEBIASIS.

    Science.gov (United States)

    Hadas, Edward; Ozarowski, Marcin; Derda, Monika; Thiem, Barbara; Cholewinski, Marcin; Skrzypczak, Lukasz; Gryszczynska, Agnieszka; Piasecka, Anna

    2017-05-01

    Chronic progressive diseases of the central nervous system such as granulomatous amoebic encephalitis, amoebic keratitis, amoebic pneumonitis and also skin infections caused by free-living amoebae (Acanhamoeba spp.) are a significant challenge for pharmacotherapy. This is due to the lack of effective treatment because of encystation, which makes the amoebae highly resistant to anti-amoebic drugs. A very inter- esting and promising source of future drugs in this area are plant materials obtained not only from the habitat but also from plant in vitro culture as an alternative source of biomaterials. Alcoholic extracts from leaves of Passiflora incarnata, P. caerulea, P. alata (Passifloraceae) and from callus cultures were evaluated in vito for amoebicidal activity. Phytochemical analysis showed that all extracts contained phenolic compounds including flavonoids? Biological study revealed that all extracts showed amoebostatic and amoebicidal properties in concentrations from 4 to 12 mg/mL. Extracts of P. alata leaf and callus showed the most effective activities (IC5, 4.01 mg/mL, IC,5 7.29 mg/mL, respectively) after 48 h of exposure, which was correlated with the highest concentration of total phenolics and flavonoids in comparison with other extracts.

  2. Protective effects of Passiflora alata extract pretreatment on carbon tetrachloride induced oxidative damage in rats.

    Science.gov (United States)

    Rudnicki, M; Silveira, M M; Pereira, T V; Oliveira, M R; Reginatto, F H; Dal-Pizzol, F; Moreira, J C F

    2007-04-01

    The leaf extract of Passiflora alata Dryander (P. alata) has been demonstrated to possess antioxidant activity in vitro. The aim of this study was to investigate the effects of P. alata leaf extract pretreatment on carbon tetrachloride-treated rats. Male Wistar rats were randomly allocated into four groups: group 1 (control - vehicle), group 2 and 3 (P. alata extract - 1 and 5mg/kg, respectively) and group 4 (trolox - 0.18mg/kg). Rats received daily pretreatment by oral gavage for 30 days followed by a single dose of CCl(4) (3ml/kg i.p. in vegetable oil) on the 30th day and were killed after 6h. The pretreatment with the P. alata extract provided significant protection to liver, evidenced by lower degree of necrosis, decreased lipid peroxidation (TBARS) and higher catalase and superoxide dismutase activities. Additionally, pretreated-rats with P. alata (5mg/kg) showed significantly decreased cardiac TBARS levels. Our results indicate that a low oral dose of P. alata leaf extract has both hepato and cardioprotective effects on rats treated with CCl(4).

  3. Developmental exposure to Passiflora incarnata induces behavioural alterations in the male progeny.

    Science.gov (United States)

    Bacchi, André D; Ponte, Bianca; Vieira, Milene L; de Paula, Jaqueline C C; Mesquita, Suzana F P; Gerardin, Daniela C C; Moreira, Estefânia G

    2013-01-01

    Passiflora incarnata is marketed in many countries as a phytomedicine and is prescribed mainly as a sedative and anxiolytic. Even though the directions of most marketed phytomedicines recommend them to be used under medical supervision, reproductive and developmental studies are sparse and not mandatory for regulatory purposes. To evaluate the reproductive and developmental toxicity of P. incarnata, Wistar female rats were gavaged with 30 or 300 mg kg(-1) of this herb from gestational Day (GD) 0 to postnatal Day (PND) 21. P. incarnata treatment did not influence dams' bodyweight or food intake or their reproductive performance (post-implantation loss, litter size, litter weight). There was also no influence on the physical development of pups (bodyweight gain, day of vaginal opening or preputial separation) or their behaviour in the open-field at PND 22, 35 and 75. Sexual behaviour was disrupted in adult male pups exposed to 300 mg kg(-1) of P. incarnata; in this group, only 3 out of 11 pups were sexually competent. This behavioural disruption was not accompanied by alterations in plasma testosterone levels, reproductive-related organs and glands weights or sperm count. It is hypothesised that aromatase inhibition may be involved in the observed effect.

  4. Molecular fingerprinting of Fusarium oxysporum f. sp. passiflorae isolates using AFLP markers

    Directory of Open Access Journals (Sweden)

    Aline dos Santos Silva

    2013-04-01

    Full Text Available Fusarium oxysporum f. sp. passiflorae W.L. Gordon (FOP is one of the most important fungal pathogens of passion fruits. Understanding molecular variation of isolates from different areas is of utmost importance. Molecular fingerprinting on 14 isolates of FOP were conducted using AFLP molecular markers (Amplified Fragment Length Polymorphism, and their genetic variability were estimated. Twenty-five AFLP primer combinations were selected for amplification of FOP isolates and one for Fusarium oxysporum f. sp. cubense W.C. Snyder & H.N. Hansen (FOC, resulting in 99% polymorphic fragments, with an average of 40 fragments per primer combination. Specific fingerprints could be generated for most of the isolates evaluated; we observed a high power of discrimination of the AFLP primer combinations, with the presence/absence of up to 26 specific fragments per isolate. Thus, specific fingerprinting was obtained for 10 of the 15 isolates analyzed. The values of the polymorphic information content, the index and the resolving power of the markers showed wide variation and reflected the high informative contents of the primers used in the characterization of the FOP isolates. The FOP isolates were divided into four groups, irrespective of their geographic origins, with the allocation of 5, 7, 1 and 1 FOP isolates into Groups II, III, IV and V, respectively. A wide genetic diversity was observed in FOP isolates, which should be taken into consideration when implementing strategies for the improvement of passion fruit in the search for cultivars with multiple resistance to different isolates.

  5. Projecting of PV facades in consideration of PV-specific operating conditions; Besonderheiten bei der Projektierung von Photovoltaik-Fassadenanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Decker, B.; Grimmig, B.; Mencke, D. [Institut fuer Solarenergieforschung GmbH Hameln/Emmerthal (ISFH), Emmerthal (Germany). Gruppe Photovoltaik-Systeme; Stellbogen, D. [Zentrum fuer Sonnenenergie- und Wasserstoff-Forschung Baden-Wuerttemberg (ZSW), Stuttgart (Germany). Fachgebiet Photovoltaische Anlagentechnik

    1998-02-01

    PV facades can provide several additional functions such as weather protection, thermal insulation, daylighting or sun protection. On the other hand, specific operating conditions for PV facades must be taken into account when selecting components and designing the system. Depending on ventilation conditions, there is a large range of maximum module temperatures. South-oriented PV facades receive about 30% less yearly irradiation than an optimally inclined PV generator, hence reflection losses are approximately 4% higher. The maximum of yearly irradiation lies only in the 400-600 W/m{sup 2} range. Surrounding buildings and/or vegetation can impair performance of the PV-facades. For a south-oriented PV facade an annual yield in the range of 470-560 kwh/kW{sub p}.a has been prodicted which was verified by operating results of eight PV facades. (orig.) [Deutsch] Photovoltaik (PV) Fassaden ermoeglichen neben der Stromerzeugung zusaetzliche Funktionen wie Wetterschutz bzw. Waermedaemmung des Gebaeudes oder Tageslichtnutzung bzw. Sonnenschutz der Innenraeume. Allerdings muessen fassadenspezifische Betriebsbedingungen, bei der Komponentenauswahl und Systemauslegung beruecksichtigt werden. Unterschiedliche Hinterlueftungsbedingungen fuehren zu einer grossen Bandbreite der maximalen Modultemperatur. PV-Suedfassaden empfangen etwa 30% weniger Jahreseinstrahlung als ein optimal geneigter PV-Generator. Die Haelfte der jaehrlichen Einstrahlung trifft mit Einfallswinkeln groesser 50 auf die vertikal angeordneten Module wodurch die Reflexionsverluste um ca. 4% hoeher sind. Das Maximum der Jahreseinstrahlung liegt nur um 400-600 W/m{sup 2} und erreicht selten Werte ueber 800 W/m{sup 2}. Umliegende Gebaeude oder Vegetation koennen zu Teilabschattungen des Generators fuehren. Fuer eine vertikale PV-Suedfassade wird ein Jahresenergieertrag in Hoehe von 470-560 kWh/kW{sub p}.a prognostiziert, der anhand der Betriebsergebnisse von acht PV-Fassadenanlagen verifiziert werden konnte

  6. ANFIS-based estimation of PV module equivalent parameters: application to a stand-alone PV system with MPPT controller

    OpenAIRE

    KULAKSIZ, Ahmet Afşin

    2012-01-01

    The performance and system cost of photovoltaic (PV) systems can be improved by employing high-efficiency power conditioners with maximum power point tracking (MPPT) methods. Fast implementation and accurate operation of MPPT controllers can be realized by modeling the characteristics of PV modules, obtaining equivalent parameters. In this study, adaptive neuro-fuzzy inference systems (ANFISs) have been used to obtain 3 of the parameters in a single-diode model of PV cells, namely serie...

  7. Variación morfológica de tres especies de curubas (Passiflora tripartita var. mollissima, P. tarminiana y P. mixta) y sus híbridos en el Valle del Cauca (Colombia)

    OpenAIRE

    Primot,Sophie; d'Eeckenbrugge,Geo Coppens; Rioux,Vincent; Pérez,John Albeiro Ocampo; Garcin,François

    2005-01-01

    Se estudió la variación morfológica entre ocho accesiones de las tres principales especies de curubas cultivadas y silvestres del Valle del Cauca, Passiflora tripartita var. mollissima (curuba de Castilla), Passiflora tarminiana (curuba india) y Passiflora mixta (curuba de monte) y 11 de sus híbridos, usando el análisis de componentes principales y el método de clasificación del vecino más próximo en 105 caracteres cualitativos y cuantitativos. Siete componentes principales explican 84% de la...

  8. Morfología de Passiflora: una guía para la descripción de sus especies

    Directory of Open Access Journals (Sweden)

    Miguel Macgayver Bonilla Morales

    2015-03-01

    Full Text Available Las pasifloras son un grupo de plantas que tienen uso desde periodos precolombinos por el sabor de sus frutos, sin embargo, en los últimos siglosse han encontrado compuestos de importancia farmacéutica para la salud humana. Desde esta perspectiva, conocer las especies mediante sus caracteres morfológicos permitirá explorar la variabilidadexistente a nivel intra e inter especifico, y también definir a futuro su importancia económicapor su uso potencial. Por tal motivo, el objetivo de esta investigación fue definir e ilustrar los caracteres morfológicos más utilizados en Passiflora L. para estudios de diversidad, caracterización y taxonomía en Colombia. De esta manera, se establecieron los ítems de hábito, raíz, tallo, estípula,hoja, flor, inflorescencia, fruto y semilla con sus respectivas descripciones que relacionan la taxonomía actual de Passiflora. Adicional, se añadióun componente de polinización que determinó las principales relaciones florísticas y polinizadores como insectos, aves y mamíferos. Se concluyeque el entendimiento de las estructuras morfológicas en Passiflora servirá de guía para trabajos de caracterización de germoplasma y revisionestaxonómicas como eje para describir nuevas especies. 

  9. The potential market for PV building products

    International Nuclear Information System (INIS)

    1998-01-01

    This study was carried out by ECOTEC Research and Consulting Limited (ECOTEC) in collaboration with the Newcastle Photovoltaic Application Centre (NPAC) and ECD Energy and Environment (ECD) under the Department of Trade and Industry's (DTI) New and Renewable Energy Programme (contract reference S/P2/00277/00/00). The aim was to assess the future market potential for building-integrated photovoltaic (BIPV) products in terms of current product availability, product development needs, the nature and size of the potential market, and the opportunities for government and the PV supply industry to work together to develop the market. The study itself comprised a review of existing BIPV products, an analysis of the development of the world market for BIPV, a market research survey of building professionals, and meetings of two 'focus groups' drawn from the PV 'supply side' and from buildings professionals. In principle, BIPV products can be used in virtually any type of building, but the main applications are considered to be housing and offices. (author)

  10. Development of NIL processes for PV applications

    Science.gov (United States)

    Hauser, H.; Tucher, N.; Tokai, K.; Schneider, P.; Wellens, Ch.; Volk, A.; Barke, S.; Müller, C.; Glinsner, T.; Bläsi, B.

    2015-03-01

    Due to its high resolution and applicability for large area patterning, Nanoimprint Lithography (NIL) is a promising technology for photovoltaic (PV) applications. However, a successful industrial application of NIL processes is only possible if large-area processing on thin, brittle and potentially rough substrates can be achieved in a high-throughput process. In this work, the development of NIL processes using the novel SmartNILTM technology from EV Group with a focus on PV applications is described. We applied this tooling to realize a honeycomb texture (8 μm period) on the front side of multicrystalline silicon solar cells leading to an improvement in optical efficiency of 7% relative and a total efficiency gain of 0.5% absolute compared to the industrial standard texture (isotexture). On the rear side of monocrystalline silicon solar cells, we realized diffraction gratings to make use of light trapping effects. An absorption enhancement of up to 35% absolute at a wavelength of 1100 nm is demonstrated. Furthermore, we combined photolithography and NIL processes to introduce features for metal contacts into honeycomb master structures, which initially were realized using interference lithography. As final application, we investigated the realization of very fine contact fingers with prismatic shape in order to minimize reflection losses.

  11. Analysis of passion fruit rinds (Passiflora edulis: isoorientin quantification by HPTLC and evaluation of antioxidant (radical scavenging capacity

    Directory of Open Access Journals (Sweden)

    Maria Luiza Zeraik

    2012-01-01

    Full Text Available The content of isoorientin in passion fruit rinds (Passiflora edulis fo. flavicarpa O. Degener was determined by HPTLC (high performance thin layer chromatography with densitometric analysis. The results revealed a higher amount of isoorientin in healthy rinds of P. edulis (92.275 ± 0.610 mg L-1 than in rinds with typical symptoms of PWV (Passion fruit Woodiness Virus infection (28.931 ± 0.346 mg L-1. The HPTLC data, allied to assays of radical scavenging activity, suggest the potential of P. edulis rinds as a natural source of flavonoids or as a possible functional food.

  12. Genetic variabilitty of morphological, agronomic and cytogenetics characters of sweet passion-fruit populations (Passiflora alata Curtis)

    OpenAIRE

    Meletti, Laura Maria Molina; Bernacci, Luis Carlos; Soares-Scott, Marta Dias; Azevedo Filho, Joaquim Adelino de; Martins, Antonio Lúcio Mello

    2003-01-01

    O maracujazeiro-doce (Passiflora alata Curtis) é uma espécie polimorfa, com significativas variações quanto ao tamanho e formato dos frutos, peso, espessura da casca, coloração de polpa e número de sementes por fruto. A propagação por sementes predomina e amplia a variabilidade entre as plantas cultivadas. Foi feita a caracterização morfológica, agronômica e citogenética dos acessos Mogi-Guaçu, Grande, Jaboticabal, Ouro-Miúdo, Campinas, Gomo e CENARGEN. Os acessos 'Mogi-Guaçu' e 'Grande' fora...

  13. Estudo comparativo do perfil de ácidos graxos em semente de Passifloras nativas do cerrado brasileiro

    OpenAIRE

    Lopes,Renata Miranda; Sevilha,Anderson Cássio; Faleiro,Fábio Gelape; Silva,Dijalma Barbosa Da; Vieira,Roberto Fontes; Agostini-Costa,Tânia da Silveira

    2010-01-01

    No mundo, existem mais de 580 espécies de maracujazeiros, grande parte nativa da América Tropical e Subtropical, principalmente no Brasil. Os programas de melhoramento utilizam uma parte pequena dos recursos genéticos disponíveis, já que o potencial deste material geralmente não está suficientemente caracterizado. O objetivo deste trabalho foi a caracterização do teor de lipídios e do perfil de ácidos graxos presentes nas sementes de 03 espécies nativas silvestres de maracujás (Passiflora cin...

  14. MORFOANATOMÍA DE LAS GLÁNDULAS EN CUATRO ESPECIES DE PASSIFLORA L. (PASSIFLORACEAE) DE VENEZUELA

    OpenAIRE

    JÁUREGUI DAMELIS; GARCÍA MARINA; PÉREZ DELIS

    2002-01-01

    Se estudió la morfoanatomía de las glándulas secretoras presentes en cuatro especiesde Passiflora: P. foetida var. moritziana, P. oerstedii, P. suberosa y P. tuberosacon el fin de aportar información de valor diagnóstico como apoyo a la sistemáticadel género. Las muestras foliares se procesaron siguiendo técnicas convencionalesusadas tanto para microscopía óptica como para microscopía electrónica de barrido.Los resultados revelan diferencias notorias entre las cuatro especies, en lo referente...

  15. Impact of residential PV adoption on Retail Electricity Rates

    International Nuclear Information System (INIS)

    Cai, Desmond W.H.; Adlakha, Sachin; Low, Steven H.; De Martini, Paul; Mani Chandy, K.

    2013-01-01

    The price of electricity supplied from home rooftop photo voltaic (PV) solar cells has fallen below the retail price of grid electricity in some areas. A number of residential households have an economic incentive to install rooftop PV systems and reduce their purchases of electricity from the grid. A significant portion of the costs incurred by utility companies are fixed costs which must be recovered even as consumption falls. Electricity rates must increase in order for utility companies to recover fixed costs from shrinking sales bases. Increasing rates will, in turn, result in even more economic incentives for customers to adopt rooftop PV. In this paper, we model this feedback between PV adoption and electricity rates and study its impact on future PV penetration and net-metering costs. We find that the most important parameter that determines whether this feedback has an effect is the fraction of customers who adopt PV in any year based solely on the money saved by doing so in that year, independent of the uncertainties of future years. These uncertainties include possible changes in rate structures such as the introduction of connection charges, the possibility of PV prices dropping significantly in the future, possible changes in tax incentives, and confidence in the reliability and maintainability of PV. -- Highlights: •Households who install PV reduce their electricity consumption from the grid. •Electricity rates must increase for utility companies to recover its fixed costs. •However, higher electricity rates give households more incentives to adopt PV. •We find that this feedback has significant impact on PV uptake only in later years. •Utility companies could lose a significant fraction of high consumption customers

  16. National survey report on PV power applications in Switzerland 2006

    Energy Technology Data Exchange (ETDEWEB)

    Huesser, P. [Nova Energie GmbH, Aarau (Switzerland); Hostettler, T. [Ingenieurbuero Hostettler, Berne (Switzerland)

    2007-07-01

    This annual report was published by the Swiss Federal Office of Energy (SFOE) as part of the International Energy Agency's work on the exchange and dissemination of information on photovoltaic power systems (PVPS). The political situation in Switzerland with regard to the promotion of photovoltaics (PV) and new legislation in the energy area is discussed. The report provides information on installed PV power, costs and prices and the Swiss PV industry. Examples of PV applications are presented and data on the cumulative installed PV power in various application sectors is presented and discussed. Highlights, major projects and various demonstration and field-test programmes are dealt with, as are public budgets for market stimulation. Figures on the development, production and prices of PV cells and modules are presented. Swiss balance-of-system products are reviewed, as are PV-related services and the value of the Swiss PV business. A review of non-technical factors and new initiatives completes the report.

  17. PV O&M Cost Model and Cost Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Walker, Andy

    2017-03-15

    This is a presentation on PV O&M cost model and cost reduction for the annual Photovoltaic Reliability Workshop (2017), covering estimating PV O&M costs, polynomial expansion, and implementation of Net Present Value (NPV) and reserve account in cost models.

  18. Molecular characterization of Pseudomonas syringae pv. tomato isolates from Tanzania

    DEFF Research Database (Denmark)

    Shenge, K.C.; Stephan, D.; Mabagala, R. B.

    2008-01-01

    Bacterial speck caused by Pseudomonas syringae pv. tomato is an emerging disease of tomato in Tanzania. Following reports of outbreaks of the disease in many locations in Tanzania, 56 isolates of P. syringae pv. tomato were collected from four tomato- producing areas and characterized using patho...

  19. Linearised model for PV panel power output variation with changes ...

    Indian Academy of Sciences (India)

    PALLAVI BHARADWAJ

    This equivalent resistance represents the load seen at the PV panel terminals. It is dependent on the actual power drawn by the system and the interfacing converter between the PV panels and the load. Thus it is a function of the converter duty ratio and load characteristics. Due to the disturbance, output characteristics of ...

  20. Linearised model for PV panel power output variation with changes ...

    Indian Academy of Sciences (India)

    PALLAVI BHARADWAJ

    2017-10-26

    Oct 26, 2017 ... which can be the PV panel current or the real power. In this work a linearised model is derived to relate the change in system input, namely: irradiance and temperature, with its output, namely: array current and power. The proposed model is experimentally verified with tests run on PV panels, when they are ...

  1. NREL Suite of Tools for PV and Storage Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Elgqvist, Emma M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Salasovich, James A [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-04-03

    Many different factors such as the solar resource, technology costs and incentives, utility cost and consumption, space available, and financial parameters impact the technical and economic potential of a PV project. NREL has developed techno-economic modeling tools that can be used to evaluate PV projects at a site.

  2. PVSOFT99 - Photovoltaic (PV) System Sizing And Simulation Software

    African Journals Online (AJOL)

    A computer program (PVSOFT99) has been developed for sizing and simulation of stand-alone photovoltaic (PV) systems. Two distinct PV sizing algorithms, one based on the worst case and the other on the reliability concept, have been incorporated in the program. The reliability concept is generalized in that variation of ...

  3. Control of Single-Stage Single-Phase PV inverter

    DEFF Research Database (Denmark)

    Ciobotaru, Mihai; Teodorescu, Remus; Blaabjerg, Frede

    2005-01-01

    In this paper the issue of control strategies for single-stage photovoltaic (PV) inverter is addressed. Two different current controllers have been implemented and an experimental comparison between them has been made. A complete control structure for the single-phase PV system is also presented...

  4. Diversidade genética de espécies do gênero Passiflora com o uso da estratégia Ward-MLM

    Directory of Open Access Journals (Sweden)

    Claudia Lougon Paiva

    2014-06-01

    Full Text Available O uso de espécies silvestres de maracujá tem resultado em progresso no melhoramento genético da cultura. No entanto, o uso dessas tem sido incipiente, devido à existência de poucas informações sobre a diversidade genética disponível. Tais atividades são essenciais para que os recursos genéticos do gênero Passiflora sejam utilizados com sucesso. Este trabalho objetivou quantificar a diversidade genética existente entre onze espécies do gênero Passiflora (Passiflora edulis, P. mucronata, P. setacea, P. pentagona, P. caerulea, P. gibertii, P. cincinnata, P. suberosa, P. micropetala, P. alata e P.coccinea. Foram utilizados descritores morfológicos qualitativos e quantitativos, sendo analisados conjuntamente por meio do procedimento Ward-MLM (Modified Location Model. Os acessos foram reunidos em cinco grandes grupos, sendo os caracteres relacionados às flores os que mais contribuíram para a diversidade genética dos acessos. O método de Ward-MLM possibilitou distinguir os subgêneros analisados, e houve uma clara separação entre as espécies. Vasta diversidade foi encontrada no gênero Passiflora, que pode ser explorada em programas de melhoramento do maracujazeiro.

  5. On the Impacts of PV Array Sizing on the Inverter Reliability and Lifetime

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2018-01-01

    , the total energy yield can be increased under weak solar irradiance conditions. However, oversizing the PV array will increase the loading of PV inverters, which may have undesired influence on the PV inverter reliability and lifetime. In that case, it may result in a negative impact on the overall PV......To enable a more wide scale utilization of PV systems, the cost of PV energy should be comparable to or even lower than other energy sources. Due to the relatively low cost of PV modules, oversizing PV arrays becomes a common approach to reduce the cost of PV energy in practice. By doing so...... energy cost, due to the increased maintenance for the PV inverters. With the above concern, this paper evaluates the reliability and lifetime of PV inverters considering the PV array sizing. The evaluation is based on the mission profile of the installation sites in Denmark and Arizona, where...

  6. Optimum Design Of On Grid Pv System Using Tracking System

    Directory of Open Access Journals (Sweden)

    Saeed Mansour

    2015-05-01

    Full Text Available Abstract The fossil fuel is a main issue in the world due to the increase of fossil fuel cost and the depletion of the fossil fuel with continuous increasing demand on electricity. With continuous decrease of PV panels cost it is interesting to consider generation of electricity from PV system. To provide electric energy to a load in a remote area where electric grid utility is not available or connection with grid utility is available there are two approaches of photovoltaic system PV without tracking system Fixed System and PV with tracking systems. The result shows that the energy production by using PV with tracking system generates more energy in comparison with fixed panels system. However the cost per produced KWH is less in case of using fixed panels. This is the backbone in choice between two approaches of photovoltaic system. In this work a system design and cost analysis for two approaches of photovoltaic system are considered.

  7. Overview of Recent Grid Codes for PV Power Integration

    DEFF Research Database (Denmark)

    Craciun, Bogdan-Ionut; Kerekes, Tamas; Sera, Dezso

    2012-01-01

    The challenge to bring down the cost of produced photovoltaic (PV) power had a major impact on the PV market and in consequence the grid operators experienced higher and higher PV power penetration. The growing share of this decentralized generation plants started to affect the grid stability...... and Distribution System Operators (DSOs) had to keep the safety and reliability of the network under strict rules and regulations. The aim of the paper is to realize a survey of recent Grid Codes (GC) and regulations for grid connected PV systems. The focus is on grid interface requirements, power quality concerns...... and Anti-Islanding (AI) issues regarding PV systems connected to low voltage (LV) and medium voltage (MV) levels of the network....

  8. Review of Solar PV Market Development in East Africa

    DEFF Research Database (Denmark)

    Hansen, Ulrich Elmer; Pedersen, Mathilde Brix; Nygaard, Ivan

    While the diffusion of solar home systems in Kenya has been market-based for some years, the diffusion of PV in most other Sub-Saharan African countries has been driven by government and donor-supported projects aimed at serving specific needs for electricity while at the same time creating...... a national niche market for PV. This practice is rapidly changing and, as in industrialised countries, there is evidence of a transition towards more market-based diffusion and private-sector involvement for PV systems for private consumers, institutions and villages. This transition has been facilitated...... the development of PV markets not only in terms of installed capacity and market volume, but also with regard to local industry and PV business development. The paper concludes by drawing attention to particular factors that have been used in the literature to explain disparities in market...

  9. A global strategy for the European PV industry

    Energy Technology Data Exchange (ETDEWEB)

    Viaud, M.; Despotou, E.; Latour, M. [European Photovoltaic Industry Association (EPIA) secretariat, Brussels (Belgium); Hoffmann, W.; Macias, E.; Cameron, M.; Laborde, E. [European Photovoltaic Industry Association (EPIA), Brussels (Belgium)

    2004-07-01

    The objective was to develop a comprehensive strategy that answers to the need of today European PV industry. Namely: - Develop PV markets in Europe - Develop export markets. - Position the European PV industry within the European political environment and support the effort of national actors in their local objectives. This method lends itself to brainstorming to create actions and synergies, on order to achieve strategy objectives. The whole work is based on working groups clearly defined on the purpose, where all EPIA members are invited to participate. The overall first results are presented during the 19. EU PV Conference in Paris and EPIA will do recommendations on actions to be undertaken in the future. This strategy is co-financed by EPIA members and the 6. Framework Programme for research of the European Commission through the PV Catapult project. (authors)

  10. PV-DSM: Policy actions to speed commercialization

    International Nuclear Information System (INIS)

    Hoff, T.; Wenger, H.J.; Keane, D.M.

    1993-01-01

    Pacific Gas and Electric Company (PG ampersand E) recently applied Demand-Side Management (DSM) evaluation techniques to photovoltaic (PV) technology to develop the concept of photovoltaics as a Demand-Side Management option (PV-DSM). The analysis demonstrated that PV-DSM has the potential to be economically attractive. Two criticisms in response to that analysis are that the assumptions of 25 year financing and a 25 year evaluation period are unrealistic. This paper responds to those criticisms and documents the mathematical relationships to calculate the value of PV-DSM from a customer's perspective. It demonstrates how regulatory and government agencies could implement policies to resolve both issues and speed PV commercialization

  11. Costs of Residential Solar PV Plants in Distribution Grid Networks

    DEFF Research Database (Denmark)

    Kjær, Søren Bækhøj; Yang, Guangya; Ipsen, Hans Henrik

    2015-01-01

    In this article we investigate the impact of residential solar PV plants on energy losses in distribution networks and their impact on distribution transformers lifetime. Current guidelines in Denmark states that distribution transformers should not be loaded with more than 67% solar PV power...... called “Availability Tariff”. According to the Danish Energy Regulatory Authority, the Availability Tariff must cover the exact expenses, with energy savings etc. from the solar PV plants taken into consideration. Our conclusion is that a distribution network, which represents a typical residential...... to avoid accelerated loss of life. If a solar PV plant causes this limit to be exceeded, the particular owner has to pay for upgrading the transformer. Distribution Network Operators also charge an annual tariff from the solar PV plants to cover the expenses to keep the grid capacity available, the so...

  12. Status of High Performance PV: Polycrystalline Thin-Film Tandems

    Energy Technology Data Exchange (ETDEWEB)

    Symko-Davies, M.

    2005-02-01

    The High-Performance Photovoltaic (HiPerf PV) Project was initiated by the U.S. Department of Energy to substantially increase the viability of photovoltaics (PV) for cost-competitive applications so that PV can contribute significantly to our energy supply and our environment. The HiPerf PV Project aims at exploring the ultimate performance limits of existing PV technologies, approximately doubling their sunlight-to-electricity conversion efficiencies during its course. This work includes bringing thin-film cells and modules toward 25% and 20% efficiencies, respectively, and developing multijunction concentrator cells and modules able to convert more than one-third of the sun's energy to electricity (i.e., 33% efficiency). This paper will address recent accomplishments of the NREL in-house research effort involving polycrystalline thin-film tandems, as well as the research efforts under way in the subcontracted area.

  13. A global strategy for the European PV industry

    International Nuclear Information System (INIS)

    Viaud, M.; Despotou, E.; Latour, M.; Hoffmann, W.; Macias, E.; Cameron, M.; Laborde, E.

    2004-01-01

    The objective was to develop a comprehensive strategy that answers to the need of today European PV industry. Namely: - Develop PV markets in Europe - Develop export markets. - Position the European PV industry within the European political environment and support the effort of national actors in their local objectives. This method lends itself to brainstorming to create actions and synergies, on order to achieve strategy objectives. The whole work is based on working groups clearly defined on the purpose, where all EPIA members are invited to participate. The overall first results are presented during the 19. EU PV Conference in Paris and EPIA will do recommendations on actions to be undertaken in the future. This strategy is co-financed by EPIA members and the 6. Framework Programme for research of the European Commission through the PV Catapult project. (authors)

  14. Costs of Residential Solar PV Plants in Distribution Grid Networks

    DEFF Research Database (Denmark)

    Kjær, Søren Bækhøj; Yang, Guangya; Ipsen, Hans Henrik

    2015-01-01

    In this article we investigate the impact of residential solar PV plants on energy losses in distribution networks and their impact on distribution transformers lifetime. Current guidelines in Denmark states that distribution transformers should not be loaded with more than 67% solar PV power...... to avoid accelerated loss of life. If a solar PV plant causes this limit to be exceeded, the particular owner has to pay for upgrading the transformer. Distribution Network Operators also charge an annual tariff from the solar PV plants to cover the expenses to keep the grid capacity available, the so...... called “Availability Tariff”. According to the Danish Energy Regulatory Authority, the Availability Tariff must cover the exact expenses, with energy savings etc. from the solar PV plants taken into consideration. Our conclusion is that a distribution network, which represents a typical residential...

  15. Do feed-in tariffs drive PV cost or viceversa?

    International Nuclear Information System (INIS)

    Antonelli, Marco; Desideri, Umberto

    2014-01-01

    Highlights: • The distribution of PV installations on the territory is not a function of the solar radiation. • Cost of PV plants were adapted to the FIT framework. • The FIT for PV in Italy was considered an incentive to financial investment. • The FIT for PV in Italy did not stimulate the development of national PV industry. - Abstract: A survey of the PV market in Italy was done studying a number of installations of different sizes whose economic data were known and assessed. The Italian market has experienced a boom in the PV market after the first mechanism of feed-in tariffs was promoted in 2005. The variations of the tariff structure in the following years have caused significant changes in the market structure in terms of average size and technical characteristics of installed plants. However, an Italian PV industry was not stimulated by the incentives and only companies involved in installation and maintenance were created. At the same time, the cost of the PV plants components, design and commissioning have followed quite a particular trend, which is more determined by the tariffs than by the market development and structure. It is quite clear that the costs of PV plants component are not driven by the amount of installations but by the tariffs, with a trend that follows the decreases in the incentives and not the global installed power. It is therefore very important to study the right tariff mechanisms and benefits to avoid financial disturbances on the market and to promote a real competitive market instead of a simple financial operation under a fake façade of green economy

  16. PV Performance Modeling Methods and Practices: Results from the 4th PV Performance Modeling Collaborative Workshop.

    Energy Technology Data Exchange (ETDEWEB)

    Stein, Joshua [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-03-01

    In 2014, the IEA PVPS Task 13 added the PVPMC as a formal activity to its technical work plan for 2014-2017. The goal of this activity is to expand the reach of the PVPMC to a broader international audience and help to reduce PV performance modeling uncertainties worldwide. One of the main deliverables of this activity is to host one or more PVPMC workshops outside the US to foster more international participation within this collaborative group. This report reviews the results of the first in a series of these joint IEA PVPS Task 13/PVPMC workshops. The 4th PV Performance Modeling Collaborative Workshop was held in Cologne, Germany at the headquarters of TÜV Rheinland on October 22-23, 2015.

  17. Vegetative propagation of Passiflora actinia by semihardwood cuttings/ Propagação vegetativa de Passiflora actinia por meio de estacas semilenhosas

    Directory of Open Access Journals (Sweden)

    João Carlos Possamai

    2001-05-01

    Full Text Available The purpose of this paper was to investigate the relationship between of bovine mastitis and the nutrients concentration in milk. Seventy-two Holstein cows were divided into 2 groups: G1 - clinically healthy cows (n = 36 and G2 - subclinical mastitis cows (n = 36. Both groups of animals were subjected to the California Mastitis Test – CMT, the somatic cell counting, and the microbiological examination. The concentrations of fat, matter protein, copper, iron, manganese and zinc in the milk sample were determined. The recorded data were statistically analyzed and presented the following means and standard-deviations, according to groups 1 and 2: fat (% 1.251 ± 0.676 and 1.662 ± 1.166 (p > 0.05; protein (% 3.373 ± 0.428 and 3.411 ± 0.348 (p > 0.05; somatic cell counting (after logarithmic basis 1.694 ± 0.632 and 2.909 ± 0.424 (p 0.05; iron (ppm 0.159 ± 0.047 and 0.191 ± 0.063 (p 0.05 and zinc (ppm 3.938 ± 1.221 and 3.658 ± 1.212 (p > 0.05. It was concluded that there were significant differences in the levels of SCC and iron between the two groups of animals.Foram conduzidos dois experimentos para verificar o efeito de diferentes concentrações de AIB (ácido indolbutírico e de etanol na propagação vegetativa de Passiflora actinia. Foram usadas estacas semilenhosas possuindo 4 nós e 2 folhas. No experimento com AIB foram testadas as seguintes concentrações: 0, 250, 500 e 1000 mg.L-1. No experimento com etanol os tratamentos foram os seguintes: testemunha, água, etanol 10%, etanol 30%, etanol 50% e etanol 70%. Todos os tratamentos foram aplicados por imersão da base das estacas (2cm durante 1 minuto. Em ambos experimentos o delineamento foi em blocos ao acaso com 5 repetições e 20 estacas por parcela. A estaquia foi realizada em câmara de nebulização, em tubetes de polietileno, contendo o substrato comercial Plantmax®. A avaliação foi feita 7 semanas após a instalação do experimento. Não foram observadas diferen

  18. Innovations in Wind and Solar PV Financing

    Energy Technology Data Exchange (ETDEWEB)

    Cory, K.; Coughlin, J.; Jenkin, T.; Pater, J.; Swezey, B.

    2008-02-01

    There is growing national interest in renewable energy development based on the economic, environmental, and security benefits that these resources provide. Historically, greater development of our domestic renewable energy resources has faced a number of hurdles, primarily related to cost, regulation, and financing. With the recent sustained increase in the costs and associated volatility of fossil fuels, the economics of renewable energy technologies have become increasingly attractive to investors, both large and small. As a result, new entrants are investing in renewable energy and new business models are emerging. This study surveys some of the current issues related to wind and solar photovoltaic (PV) energy project financing in the electric power industry, and identifies both barriers to and opportunities for increased investment.

  19. Analytical Improvements in PV Degradation Rate Determination

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, D. C.; Kurtz, S. R.

    2011-02-01

    As photovoltaic (PV) penetration of the power grid increases, it becomes vital to know how decreased power output may affect cost over time. In order to predict power delivery, the decline or degradation rates must be determined accurately. For non-spectrally corrected data several complete seasonal cycles (typically 3-5 years) are required to obtain reasonably accurate degradation rates. In a rapidly evolving industry such a time span is often unacceptable and the need exists to determine degradation rates accurately in a shorter period of time. Occurrence of outliers and data shifts are two examples of analytical problems leading to greater uncertainty and therefore to longer observation times. In this paper we compare three methodologies of data analysis for robustness in the presence of outliers, data shifts and shorter measurement time periods.

  20. Molecular detection of Xanthomonas oryzae pv. oryzae, Xanthomonas oryzae pv. oryzicola, and Burkholderia glumae in infected rice seeds and leaves

    Science.gov (United States)

    Polymerase chain reaction (PCR) is particularly useful for plant pathogen detection. In the present study, multiplex PCR and SYBR green real-time PCR were developed to facilitate simultaneous detection of three important rice pathogens, Xanthomonas oryzae pv. oryzae, X. oryzae pv. oryzicola, and Bur...

  1. Desenvolvimento de métodos espectrofotométricos de análise de flavonóides do \\"maracujá\\" (Passiflora alata e Passiflota edulis)

    OpenAIRE

    Alessandra Cristina Soares Pozzi

    2007-01-01

    \\"Maracujá\\" é o nome popular de várias espécies, dentre as quais Passiflora edulis e Passiflora alata (Passifloraceae). Esta última é uma planta medicinal amplamente utilizada no Brasil devido às suas propriedades ansiolíticas e sedativas, sendo também a espécie oficial da Farmacopéia Brasileira. Porém, freqüentemente ocorre a sua substituição indevida por Passiflora edulis, espécie usada para o preparo de sucos. Há também a confusão com a Passiflora incarnata, espécie usada na Europa, mas q...

  2. SunShot 2030 for Photovoltaics (PV): Envisioning a Low-cost PV Future

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Wesley J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Frew, Bethany A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Gagnon, Pieter J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, James [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Sun, Yinong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Woodhouse, Michael A. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-09-12

    In this report we summarize the implications, impacts, and deployment potential of reaching the SunShot 2030 targets for the electricity system in the contiguous United States. We model 25 scenarios of the U.S. power sector using the Regional Energy Deployment Systems (ReEDS) and Distributed Generation (dGen) capacity expansion models. The scenarios cover a wide range of sensitivities to capture future uncertainties relating to fuel prices, retirements, renewable energy capital costs, and load growth. We give special attention to the potential for storage costs to also rapidly decline due to its large synergies with low-cost solar. The ReEDS and dGen models project utility- and distributed-scale power sector evolution, respectively, for the United States. Both models have been designed with special emphasis on capturing the unique traits of renewable energy, including variability and grid integration requirements. Across the suite of scenarios modeled, we find that reaching the SunShot 2030 target has the potential to lead to significant capacity additions of PV in the United States. By 2050, PV penetration levels are projected to reach 28-46 percent of total generation. If storage also sees significant reductions in cost, then the 2050 solar penetration levels could reach 41-64 percent. PV deployment is projected to occur in all of the lower 48 states, though the specific deployment level is scenario dependent. The growth in PV is projected to be dominated by utility-scale systems, but the actual mix between utility and distributed systems could ultimately vary depending on how policies, system costs, and rate structures evolve.

  3. Valley of Death analysis for polymer PV technology; Valley of Death analyse voor polymere PV technologie

    Energy Technology Data Exchange (ETDEWEB)

    Schoots, K. [ECN Beleidsstudies, Petten (Netherlands)

    2013-12-15

    This report describes the results of a qualitative study of the barriers that actors involved in the development and commercialization of polymer solar cells, may encounter. The purpose of this socio-economic research is to identify these barriers for the (market) development of thin film polymeric PV technology and to develop strategies for them in order to overcome the constraints. The necessary data are collected from interviews with actors who are active in the development and deployment of conventional solar cells. Based on the results from this study, it is conclude that it is important for the Organic PV industry to carry out many market experiments beyond the built environment. The report provides recommendations with regard to the markets in which these experiments are most likely to succeed and which drivers should be taken into account [Dutch] Dit rapport beschrijft de resultaten van een kwalitatief onderzoek naar de barrieres die actoren, betrokken bij de ontwikkeling en marktintroductie van polymere zonnecellen, kunnen tegenkomen. Het doel van dit sociaal-economische onderzoek is deze barrieres voor de (markt)ontwikkeling van dunne film polymere PV technologie te identificeren en strategieen te ontwikkelen om ze voor te zijn of ze te overbruggen. De benodigde gegevens worden verzameld uit interviews met actoren die actief zijn in de ontwikkeling en uitrol van conventionele zonnecellen. Op basis van de resultaten uit dit onderzoek komen we tot de conclusie dat het voor de Organische PV sector belangrijk is veel marktexperimenten aan te gaan buiten de gebouwde omgeving. Het rapport geeft aanbevelingen in welke soort markten deze experimenten de meeste kans van slagen hebben en met welke drivers van marktpartijen rekening moet worden gehouden.

  4. INFLUÊNCIA DOS MEIOS DE CULTURA NA GERMINAÇÃO in vitro DE Passiflora suberosa L.

    Directory of Open Access Journals (Sweden)

    Quezia Pains Dutra

    2017-03-01

    Full Text Available O gênero Passiflora L. é o maior da família Passifloraceae, compreendendo cerca de 525 espécies.  No Brasil, 141 espécies são registradas, das quais  85 são endêmicas. Dentre as espécies encontradas no Estado do Espírito Santo, detacamos a Passiflora suberosa, tambem conhecida como maracujazinho-cortiça-preto que é uma espécie tropical, utilizada como planta medicinal. Em busca de conhecimento científico e de conservação da espécie, a cultura in vitro vem sendo empregada para propagação e melhoramento genético. Portanto, o objetivo deste trabalho, foi identificar a influência de diferentes meios de cultura na germinação in vitro de P. suberosa, com a finalidade de desenvolver estratégias para adaptação da cultura in vitro, a fim de obter plântulas em condições assépticas e controladas. Sementes de P. suberosa foram desinfestadas e inoculadas nos meios MS, MS½, AAS e B5. As respostas obtidas in vitro foram a formação de calos e obtenção de plântulas inoculadas nos meios MS, MS1/2 e B5.

  5. ISSR markers in wild species of Passiflora L. (Passifloraceae) as a tool for taxon selection in ornamental breeding.

    Science.gov (United States)

    Sousa, A G R; Souza, M M; Melo, C A F; Sodré, G A

    2015-12-28

    Inter simple sequence repeat (ISSR) molecular markers were developed and used to investigate interspecific genetic variation in 25 wild species of Passiflora preserved in an active germplasm bank (BAG-Passifloras); intraspecific diversity was also analyzed in P. cincinnata accessions. Of 31 primers tested, 20 identified polymorphic loci with a total of 331 bands, suggesting high polymorphism in the sample. Interspecific polymorphism was greater than intraspecific polymorphism. This is a common finding in studies of genetic variation using dominant markers. The ISSRs revealed species-specific amplification bands in 11 species; these bands ranged from 200 to 1000 bp, and they will be of use for developing SCAR markers for the identification of germplasm in further studies. The use of Jaccard's similarity coefficient to obtain a dendrogram by the UPGMA clustering method distributed the taxa into five major groups, with differences among grouping with respect to principal coordinate analysis. Despite the high cophenetic correlation coefficient (r = 0.94) of the dendrogram, taxonomic inconsistencies were observed; similar irregularities have been reported previously in studies using dominant markers. Intraspecific analysis of P. cincinnata accessions revealed a larger genetic distance between those from Bahia (P2) and from Minas Gerais (P2), indicating that both accessions have considerable potential as parents in a genetic improvement program for this species.

  6. Caracterización morfológica de especies del género Passiflora de Colombia

    Directory of Open Access Journals (Sweden)

    Mónica María Marín Tangarife

    2009-07-01

    Full Text Available Se caracterizaron 21 especies de Passiflora las que incluyeron tres subgéneros, mediante 66 descriptores cuantitativos y 100 cualitativos. El análisis de componentes principales (ACP de los descriptores cuantitativos identificó dos componentes con valor propio superior a 1, asociados con hoja y flor, los cuales explicaron 80% de la varianza total de las accesiones estudiadas. Con el análisis factorial de correspondencia múltiple (AFCM de los descriptores cualitativos se identificaron tres dimensiones, que explicaron 82% de la varianza total; a la segunda se asociaron tipo de crecimiento, número de flores por nudo y color de la última serie de los filamentos en el ápice; a la tercera, forma y margen de la bráctea, margen de la bráctea; y a la primera las demás variables cualitativas. El análisis de agrupamiento (distancias de 'city-block-Manhattan' evidenció dos grandes grupos, según la longitud del hipantio -especies con flor de hipantio corto y largo-. El análisis de clasificación también mostró que la morfología floral fue determinante en la discriminación infragenérica en Passiflora.

  7. GENETIC DIVERGENCE AMONG Passiflora cristalina Vanderpl & Zappi. GENOTYPES BASED ON FLOWER AND FRUIT CHARACTERISTICS

    Directory of Open Access Journals (Sweden)

    GREICIELE FARIAS DA SILVEIRA

    Full Text Available ABSTRACT This study aimed to evaluate the genetic divergence among Passiflora cristalina genotypes and quantify the relative contribution of 30 flower and fruit characteristics, seeking to support the preservation and characterization of genetic resources of the species for preservation and use in future breeding programs. We evaluated 150 fruit and 150 flowers collected in 15 genotypes with naturally occurring in the municipality of Alta Floresta, MT. The characterization of genotypes was performed through 30 morphological characteristics of flowers and fruits, 21 of these for flower and 9 for fruit. Data were evaluated using the principal components and cluster methods obtained by UPGMA method from the similarity matrix (Euclidian mean distance, using the Genes software. By principal component analysis, it has been found that the first three components have absorbed 52.11% of the accumulated variation. The characteristics that most contributed to the discrimination of genotypes were fresh fruit weight, stigma length, length of corona filaments, fruit width, petal width and pulp weight, which are more responsive for the selection of P.cristalina genotypes. Smaller contributions to diversity were obtained from anther width, bract width and fruit length. The smallest contributions for diversity were obtained from the following characteristics: anther width, bract width and fruit length. Through UPGMA clustering method, it was found that there is a large genetic divergence among genotypes analyzed because all genotypes were grouped with over 50% of dissimilarity. This study identified genotypes 4, 5 and 9 as the most divergent and therefore the most suitable for breeding in future breeding programs and genetic conservation of the species.

  8. Standardized Passiflora incarnata L. Extract Reverts the Analgesia Induced by Alcohol Withdrawal in Rats.

    Science.gov (United States)

    Schunck, Rebeca Vargas Antunes; Macedo, Isabel Cristina; Laste, Gabriela; de Souza, Andressa; Valle, Marina Tuerlinckx Costa; Salomón, Janaína L O; Nunes, Ellen Almeida; Campos, Andreia Cristina Wildner; Gnoatto, Simone Cristina Baggio; Bergold, Ana Maria; Konrath, Eduardo L; Dallegrave, Eliane; Arbo, Marcelo Dutra; Torres, Iraci L S; Leal, Mirna Bainy

    2017-08-01

    Passiflora incarnata L. (Passifloraceae) has been traditionally used for treatment of anxiety, insomnia, drug addiction, mild infections, and pain. The aim of this study was to investigate the effect of a commercial extract of P. incarnata in the analgesia induced by alcohol withdrawal syndrome in rats. In addition, brain-derived neurotrophic factor and interleukin-10 levels were evaluated in prefrontal cortex, brainstem, and hippocampus. Male adult rats received by oral gavage: (1: water group) water for 19 days, 1 day interval and water (8 days); (2: P. incarnata group) water for 19 days, 1 day interval and P. incarnata 200 mg/kg (8 days); (3: alcohol withdrawal group) alcohol for 19 days, 1 day interval and water (8 days); and (4: P. incarnata in alcohol withdrawal) alcohol for 19 days, 1 day interval and P. incarnata 200 mg/kg (8 days). The tail-flick and hot plate tests were used as nociceptive response measures. Confirming previous study of our group, it was showed that alcohol-treated groups presented an increase in the nociceptive thresholds after alcohol withdrawal, which was reverted by P. incarnata, measured by the hot plate test. Besides, alcohol treatment increased brain-derived neurotrophic factor and interleukin-10 levels in prefrontal cortex, which was not reverted by P. incarnata. Considering these results, the P. incarnata treatment might be a potential therapy in the alcohol withdrawal syndrome. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  9. Embryo sac development in yellow passion fruit Passiflora edulis f. flavicarpa (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Margarete Magalhães de Souza

    2002-01-01

    Full Text Available The yellow passion fruit, Passiflora edulis f. flavicarpa, is one of the most important Brazilian fruit crops. It is an allogamous, diploid, and self-incompatible species. It has hermaphrodite, solitary flowers, located in the leaf axils and protected by leaf bracts. The flower has an androgynophore, which is a straight stalk supporting its reproductive parts. There are usually five anthers, located at the tip of each of the five filaments. The ovary is borne just above the filaments, at the top of the androgynophore; there are three styles that are united at their base, and at the top there are three stigmas. The objective of this research was to observe embryo sac development in yellow passion flowers. Ovaries at different stages of development were fixed in FAA (formalin, acetic acid and alcohol solution, hydrated, stained with Mayer’s hemalum, and dehydrated. Ovules were cleared by using methyl salicylate, mounted on slides, and observed through a confocal scanning laser microscope. The yellow passion fruit ovule is bitegmic, crassinucellate, and anatropous, and its gametophyte development is of the Polygonum type. After meiosis, functional megaspores under go three successive mitotic divisions, resulting in an eight-nucleate megagametophyte: the egg apparatus at the micropylar end, two polar nuclei at the cell center, and three antipodals at the chalazal end. The egg apparatus is formed by an egg cell and two synergids, each with a filiform apparatus. The mature embryo sac has an egg cell, two synergids, two polar nuclei, and three antipodes, as has been described for most angiosperms.

  10. NARINGENIN ENHANCED EFFICIENCY OF GUS ACTIVITY IN Passiflora mollissima (H.B.K. Bailey

    Directory of Open Access Journals (Sweden)

    G.O. Cancino

    2004-06-01

    Full Text Available The flavonoid naringenin has been investigated as a possible vir gene inducer in Agrobacterium-mediated transformation in Passiflora mollissima, P. giberti and Nicotiana tabacum cv. Xanthi. The transformation efficiency percentage of explants showing blue GUS expression and the extent of staining following inoculation with Agrobacterium tumefaciens strains EHA 105 and 1065, carrying gus and nptII genes was enhanced with the supplementation of the co-cultivation medium with naringenin. Supplementation of medium with 100µM (strain EHA 105 and 300 µM (strain 1065 naringenin was most effective at enhancing mean (±s.e.m., n=3 GUS activity in leaf explants (20.3 ± 2.4%, strain EHA; 105; 6.0 ± 0.57%, strain 1065 and nodal segments (16.7 ± 2.4% strain EHA 105; 8.3 ± 0.57% strain 1065 of P. mollissima. In P. giberti and N. tabacum maximum GUS activity was obtained in leaf and root explants with 100µM naringenin for both strains analysed. Additionally, when naringenin was added to Luria Bertani (LB medium, both bacterial growth via optical density and colony forming units were higher when compared to control. This is the first report of the use of naringenin to enhance gene transfer from Agrobacterium to plants. These findings suggest that naringenin can be used as an alternative to acetosyringone for vir gene induction in Agrobacterium. This approach may be especially useful in plants that are generally recalcitrant to Agrobacterium-mediatedtransformation.

  11. Estimating fruitpulp carotenoid content from shell color in gulupa (Passiflora edulis Sims

    Directory of Open Access Journals (Sweden)

    Germán Franco

    2013-07-01

    Full Text Available La gulupa (Passiflora edulis Sims es un fruto aceptado en mercados europeos; pero, su corta vida en poscosecha limita la comercialización. Por lo tanto, es necesario, caracterizar algunos atributos de la maduración, para que el fruto mantenga las mejores condiciones de calidad. La investigación tuvo como objetivo estimar, a partir de los cambios de color del fruto y de su edad, la evolución de los carotenoides, mediante el uso de modelos que predijeran esta relación. Se utilizaron frutos con edad conocida para determinar el color con base en el espacio CIE L*, a* y b*. La colorimetría confirmó que hay evolución apreciable a partir de los 84 días después de floración (DDF, con color morado oscuro hacia los 98 DDF y púrpura muy oscuro a los 105 DDF. En frutos madurados en la planta, se apreció disminución en la luminosidad (L*, mientras que en las coordenadas a* el valor aumentó y el b* disminuyó, cambios que definen el color del fruto. Se observó una tendencia similar en frutos cosechados a partir de los 91 DDF. Tanto en los frutos madurados en la planta como en los cosechados, el contenido de carotenoides se incrementó a medida que la senescencia del fruto avanzaba. Modelos de regresión permitieron estimar el contenido de carotenoides: uno múltiple, con las coordenadas de color como predictoras y el otro polinomial, basado en la edad del fruto.

  12. [Biology of Holhymenia rubiginosa Breddin (Hemiptera: Coreidae) on Passiflora alata (Passifloraceae)].

    Science.gov (United States)

    Kolberg, Roberta; Redaelli, Luiza R; Canto-Silva, Celson R; Idalgo, Thiago D N

    2009-01-01

    The biology of Holhymenia rubiginosa Breddin is described on sweet-passion-fruit, Passiflora alata, and the developmental time, viability and thermal requirements of the egg stage, the developmental time and mortality of the nymphal stage, and adult longevity and reproductive parameters were assessed. Insects were reared at laboratory controlled conditions (25 + or - 1 degrees Celsius, 65 + or - 10% RH, photophase 12h) on branches of P. alata, 20% honey solution and pollen. The lower thermal threshold (10.8 degrees Celsius) and thermal requirements (140.8 DD) for egg development were determined using four temperatures (17, 21, 25 and 30 degrees Celsius). The average egg development time (days) and viability were 25.4 + or - 0.45, 88%; 13.2 + or - 0.28, 88%; 8.8 + or - 0.16, 94%; and 7.7 + or - 0.17, 92%, at 17, 21, 25 and 30 + or - 1 degrees Celsius, respectively. When reared at 25 + or - 1 degrees Celsius, the first instar had the shortest development time (4.0 + or - 0.02 days) and the second the longest (15.7 + or - 3.50 days), which also had the highest mortality (75%). Males and females had similar longevity (185.3 + or - 17.52 days for females and 133.6 + or - 18.94 days for males). Females mated 33.0 + or - 7.71 times, with a mean duration of 99.0 + or - 9.25 min, laying 11.5 + or - 2.55 eggs/female. Periods of pre-oviposition, oviposition and post-oviposition were respectively 96.4 + or - 18.08; 88.5 + or - 23.48 and 19.3 + or - 12.18 days.

  13. Potencial antioxidante y antimicrobiano de extractos acuosos e hidroalcohólicos de granadilla (Passiflora ligularis

    Directory of Open Access Journals (Sweden)

    Sergio Andrés Cabrera Navarro

    2014-09-01

    Full Text Available En el estudio se determinó la actividad antioxidante y antimicrobiana en extractos acuosos e hidroalcohólicos de Passiflora ligularis. Se utilizó el método de extracción por reflujo, empleando como solventes agua y etanol a 35% (v/v y 70% (v/v. Como material vegetal fueron utilizadas hojas y flores. Los resultados mostraron que tanto los extractos acuosos como los hidroalcoholicos presentan compuestos fenólicos, alcanzando contenidos máximos de 14.32 mg Eq Ac. Gal/g materia seca. También se determinaron los contenidos máximos de flavonoides totales equivalentes a 10.47 mg Eq Vitexina/g materia seca, en extractos hidroalcohólicos. La actividad antioxidante in vitro de los extractos fue evaluada utilizando la metodología de captación del radical libre (DPPH y poder reductor férrico (FRAP. En ambas metodologías se determinó que los extractos hidroalcohólicos presentan mayor actividad. El ensayo de actividad antimicrobial mostró que los extractos de P. ligularis tienen la capacidad de reducir el crecimiento tanto de E. coli (ATCC 25922 como de S. aureus (ATCC 25923, encontrando principalmente que los extractos acuosos poseen mayor poder de inhibición microbial que los hidroalcohólicos. En este trabajo también se observó correlación entre los fenoles y la actividad antioxidante (FRAP.

  14. Optimal Solar PV Arrays Integration for Distributed Generation

    Energy Technology Data Exchange (ETDEWEB)

    Omitaomu, Olufemi A [ORNL; Li, Xueping [University of Tennessee, Knoxville (UTK)

    2012-01-01

    Solar photovoltaic (PV) systems hold great potential for distributed energy generation by installing PV panels on rooftops of residential and commercial buildings. Yet challenges arise along with the variability and non-dispatchability of the PV systems that affect the stability of the grid and the economics of the PV system. This paper investigates the integration of PV arrays for distributed generation applications by identifying a combination of buildings that will maximize solar energy output and minimize system variability. Particularly, we propose mean-variance optimization models to choose suitable rooftops for PV integration based on Markowitz mean-variance portfolio selection model. We further introduce quantity and cardinality constraints to result in a mixed integer quadratic programming problem. Case studies based on real data are presented. An efficient frontier is obtained for sample data that allows decision makers to choose a desired solar energy generation level with a comfortable variability tolerance level. Sensitivity analysis is conducted to show the tradeoffs between solar PV energy generation potential and variability.

  15. Three junction holographic micro-scale PV system

    Science.gov (United States)

    Wu, Yuechen; Vorndran, Shelby; Ayala Pelaez, Silvana; Kostuk, Raymond K.

    2016-09-01

    In this work a spectrum splitting micro-scale concentrating PV system is evaluated to increase the conversion efficiency of flat panel PV systems. In this approach, the dispersed spectrum splitting concentration systems is scaled down to a small size and structured in an array. The spectrum splitting configuration allows the use of separate single bandgap PV cells that increase spectral overlap with the incident solar spectrum. This results in an overall increase in the spectral conversion efficiency of the resulting system. In addition other benefits of the micro-scale PV system are retained such reduced PV cell material requirements, more versatile interconnect configurations, and lower heat rejection requirements that can lead to a lower cost system. The system proposed in this work consists of two cascaded off-axis holograms in combination with a micro lens array, and three types of PV cells. An aspherical lens design is made to minimize the dispersion so that higher concentration ratios can be achieved for a three-junction system. An analysis methodology is also developed to determine the optical efficiency of the resulting system, the characteristics of the dispersed spectrum, and the overall system conversion efficiency for a combination of three types of PV cells.

  16. Kauai Island Utility Co-op (KIUC) PV integration study.

    Energy Technology Data Exchange (ETDEWEB)

    Ellis, Abraham; Mousseau, Tom (Knoxville, TN)

    2011-08-01

    This report investigates the effects that increased distributed photovoltaic (PV) generation would have on the Kauai Island Utility Co-op (KIUC) system operating requirements. The study focused on determining reserve requirements needed to mitigate the impact of PV variability on system frequency, and the impact on operating costs. Scenarios of 5-MW, 10-MW, and 15-MW nameplate capacity of PV generation plants distributed across the Kauai Island were considered in this study. The analysis required synthesis of the PV solar resource data and modeling of the KIUC system inertia. Based on the results, some findings and conclusions could be drawn, including that the selection of units identified as marginal resources that are used for load following will change; PV penetration will displace energy generated by existing conventional units, thus reducing overall fuel consumption; PV penetration at any deployment level is not likely to reduce system peak load; and increasing PV penetration has little effect on load-following reserves. The study was performed by EnerNex under contract from Sandia National Laboratories with cooperation from KIUC.

  17. What's stopping a huge expansion of the PV market?

    International Nuclear Information System (INIS)

    Varadi, P.F.

    1998-01-01

    Over the past 25 years the terrestrial PV industry has turned into a billion-dollar global business. The necessary technology is available and substantial market growth is continuing. It has often been said that the cost of PV must come down further before the technology really takes off. However the author argues here that the dominant segments of the market are not price-sensitive and that the future explosive expansion of PV markets will need financing on a global basis, assured quality in the products, and the institution of an extensive public-awareness programme of advertising, promotion and education. (author)

  18. PV Validation and Bankability Workshop: San Jose, California

    Energy Technology Data Exchange (ETDEWEB)

    Granata, J.; Howard, J.

    2011-12-01

    This report is a collaboration between Sandia National Laboratories, the National Renewable Energy Laboratory, and the Florida Solar Energy Center (FSEC). The report provides feedback from the U.S. Department of Energy's (DOE) Solar Program PV Validation and Bankability Workshop in San Jose, California on August 31, 2011. It focuses on the current state of PV in the United States, private funding to fund U.S. PV industry growth, roles and functions of the regional test center program, and ways to improve the current validation and bankability practices.

  19. PV Project Finance in the United States, 2016

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, David; Lowder, Travis; Schwabe, Paul

    2016-09-01

    This brief is a compilation of data points and market insights that reflect the state of the project finance market for solar photovoltaic (PV) assets in the United States as of the third quarter of 2016. This information can generally be used as a simplified benchmark of the costs associated with securing financing for solar PV as well as the cost of the financing itself (i.e., the cost of capital). Three sources of capital are considered -- tax equity, sponsor equity, and debt -- across three segments of the PV marketplace.

  20. State financed PV technology projects in Nigeria

    Energy Technology Data Exchange (ETDEWEB)

    Gyoh, L.; Gyoh, S. [Iceberg PVPS Consultants, Sheffield (United Kingdom)

    2004-07-01

    Despite the progress made by the democratic government of Nigeria to eradicate poverty, there are still millions of people without access to electricity. It would not be financially viable to extend the national electricity grid to each electoral ward, in remote locations in the country. The use of photovoltaic technology now brings electricity to many rural areas as part of the provision of basic needs by the Nigerian authorities. The Nasarawa State Government has embarked on the provision of all it electoral wards with solar powered water supply systems to carter for a mostly rural population of 3.4 million people. The Benue, Taraba, Bauchi and Jigawa State governments have embarked on similar schemes in Rural Water Supply, Health and the Educational sectors of the economy. Ambitious PV programmes, of this nature, inevitably face challenges in developing countries. The preliminary recommendations, of this ongoing study, have been made to address some of the potential challenges in some of the key areas. This paper reviews the implementation progress and suggests some of the lessons that might be learnt. (authors)

  1. State financed PV technology projects in Nigeria

    International Nuclear Information System (INIS)

    Gyoh, L.; Gyoh, S.

    2004-01-01

    Despite the progress made by the democratic government of Nigeria to eradicate poverty, there are still millions of people without access to electricity. It would not be financially viable to extend the national electricity grid to each electoral ward, in remote locations in the country. The use of photovoltaic technology now brings electricity to many rural areas as part of the provision of basic needs by the Nigerian authorities. The Nasarawa State Government has embarked on the provision of all it electoral wards with solar powered water supply systems to carter for a mostly rural population of 3.4 million people. The Benue, Taraba, Bauchi and Jigawa State governments have embarked on similar schemes in Rural Water Supply, Health and the Educational sectors of the economy. Ambitious PV programmes, of this nature, inevitably face challenges in developing countries. The preliminary recommendations, of this ongoing study, have been made to address some of the potential challenges in some of the key areas. This paper reviews the implementation progress and suggests some of the lessons that might be learnt. (authors)

  2. Promotional drivers for grid-connected PV

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Polo, A.; Hass, R.; Suna, D.

    2009-03-15

    This report for the International Energy Agency (IEA) made by Task 10 of the Photovoltaic Power Systems (PVPS) programme takes a look at promotional measures for grid-connected photovoltaic systems. The mission of the Photovoltaic Power Systems Programme is to enhance the international collaboration efforts which accelerate the development and deployment of photovoltaic solar energy. The objective of Task 10 is stated as being to enhance the opportunities for wide-scale, solution-oriented application of photovoltaics in the urban environment. The paper discusses the core objective of this study which was to analyse the success of various governmental regulatory programs and governmental and non-governmental marketing programs for grid-connected PV systems. To meet this objective, a review of the most important past and current programs around the world was conducted. The theoretical bases of supply and demand are explained and the types of existing strategies are documented in a second Section. In Chapter 3, various programs around the world are described. Chapter 4 focuses on defining success criteria which will be used for the analysis of the programs. Finally, the major conclusions drawn complete this analysis.

  3. PV GRID Advisory Paper. Consultation version: key recommendations

    Energy Technology Data Exchange (ETDEWEB)

    Barth, Bianca; Concas, Giorgia; Cossent, Rafael; Franz, Oliver; Frias, Pablo; Hermes, Roland; Lama, Riccardo; Loew, Holger; Mateo, Carlos; Rekinger, Manoel; Sonvilla, Paolo Michele; Vandenbergh, Michel

    2014-01-15

    PV GRID is a transnational collaborative effort under the umbrella of the Intelligent Energy Europe programme. The main project goal is to enhance photovoltaic (PV) hosting capacity in distribution grids while overcoming regulatory and normative barriers hampering the application of available technical solutions. The European PV GRID advisory paper aims at providing an overview of the issues and barriers that need to be addressed in order to enhance the distribution grid hosting capacity for PV and other distributed generation (DG).To this purpose, barriers are classified as either cross-cutting challenges or specific barriers, depending on whether they have an overarching, system-wide character or rather focus on one single issue such as curtailment, self-consumption or storage. Finally, a set of preliminary recommendations on how to overcome these issues is presented, allowing for the implementation of the identified technical solutions.

  4. Robustness analysis of the efficiency in PV inverters

    DEFF Research Database (Denmark)

    Pigazo, Alberto; Liserre, Marco; Blaabjerg, Frede

    2013-01-01

    During last years an increasing attention has been paid to the efficiency of grid-connected PV inverters. They are manufactured from a number of discrete components and by using a certain topology and control strategy. Hence, the performance of a certain PV inverter not only depends on the selected...... topology and control strategy but also on the characteristics of the employed components. The aim of this paper is evaluate the effect of physical variations associated to the main components on the overall efficiency of PV inverters. It is concluded that a statistical evaluation of the power converter...... provides a better understanding of the PV inverter performance and, in this sense, the definition of the European Efficiency must be reviewed in order to show the quality of the manufactured product....

  5. Control of Single-Stage Single-Phase PV inverter

    DEFF Research Database (Denmark)

    Ciobotaru, Mihai; Teodorescu, Remus; Blaabjerg, Frede

    2005-01-01

    In this paper the issue of control strategies for single-stage photovoltaic (PV) inverter is addressed. Two different current controllers have been implemented and an experimental comparison between them has been made. A complete control structure for the single-phase PV system is also presented......-forward; - and the grid current controller implemented in two different ways, using the classical proportional integral (PI) and the novel proportional resonant (PR) controllers. The control strategy was tested experimentally on 1.5 kW PV inverter........ The main elements of the PV control structure are: - a maximum power point tracker (MPPT) algorithm using the incremental conductance method; - a synchronization method using the phase-locked-loop (PLL), based on delay; - the input power control using the dc voltage controller and power feed...

  6. Measures for diffusion of solar PV in selected African countries

    DEFF Research Database (Denmark)

    Nygaard, Ivan; Hansen, Ulrich Elmer; Mackenzie, Gordon A.

    2017-01-01

    that governments’ strategies to promoting solar PV are moving from isolated projects towards frameworks for market development and that there are high expectations to upgrading in the PV value chain through local assembly of panels and local production of other system elements. Commonly identified measures include......This paper investigates how African governments are considering supporting and promoting the diffusion of solar PV. This issue is explored by examining so-called ‘technology action plans (TAPs)’, which were main outputs of the Technology Needs Assessment project implemented in 10 African countries...... from 2010 to 2013. The paper provides a review of three distinct but characteristic trajectories for PV market development in Kenya (private-led market for solar home systems), Morocco (utility-led fee-for service model) and Rwanda (donorled market for institutional systems). The paper finds...

  7. Heritage plaza parking lots improvement project- Solar PV installation

    Energy Technology Data Exchange (ETDEWEB)

    Hooks, Todd [Agua Caliente Indian Reservation, Palm Springs, CA (United States)

    2017-03-31

    The Agua Caliente Band of Cahuilla Indians (ACBCI or the “Tribe”) installed a 79.95 kW solar photovoltaic (PV) system to offset the energy usage costs of the Tribal Education and Family Services offices located at the Tribe's Heritage Plaza office building, 90I Tahquitz Way, Palm Springs, CA, 92262 (the "Project"). The installation of the Solar PV system was part of the larger Heritage Plaza Parking Lot Improvements Project and mounted on the two southern carport shade structures. The solar PV system will offset 99% of the approximately 115,000 kWh in electricity delivered annually by Southern California Edison (SCE) to the Tribal Education and Family Services offices at Heritage Plaza, reducing their annual energy costs from approximately $22,000 annually to approximately $200. The total cost of the proposed solar PV system is $240,000.

  8. Retaining the Value of PV at High Penetration Workshop

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, Sarah; Bolen, Michael

    2017-01-19

    PV prices have dropped and are now attractive without incentives for peaking applications in some locations. Modeling suggests and, empirically, some regions demonstrate that as PV penetration increases its value decreases, predominantly due to a decrease in energy and capacity value. It is not apparent what technologies and price may be needed for PV to supply tens of percent of electricity in the most economically efficient manner. A 1-day workshop was co-sponsored by EPRI and NREL with support from ASU. A dozen presentations and discussions introduced how the interplay of various technologies impact the value of PV, identified technical challenges and gaps impeding implementation, and discussed future R&D needs and opportunities.

  9. The PV Corrosion Fault Prognosis Based on Ensemble Kalman Filter

    Directory of Open Access Journals (Sweden)

    Radouane Ouladsine

    2017-01-01

    Full Text Available The degradation of photovoltaic (PV modules remains a major concern on the control and the development of the photovoltaic field, particularly, in regions with difficult climatic conditions. The main degradation modes of the PV modules are corrosion, discoloration, glass breaks, and cracks of cells. However, corrosion and discoloration remain the predominant degradation modes that still require further investigations. In this paper, a model-based PV corrosion prognostic approach, based on an ensemble Kalman filter (EnKF, is introduced to identify the PV corrosion parameters and then estimate the remaining useful life (RUL. Simulations have been conducted using measured data set, and results are reported to show the efficiency of the proposed approach.

  10. A comparison of design features of 80 pv-powered products

    NARCIS (Netherlands)

    Apostolou, G.; Reinders, A.H.M.E.

    2012-01-01

    In this paper 80 commercially available PV products have been analysed. The data set comprises 46 low power PV products in the range of 0 to 17 Wp and 34 PV products with a power of 17 Wp up to 27 kWp. The goal of our study is to investigate and evaluate features of PV products that are available on

  11. Impacts of Solar PV Arrays on Physicochemical Properties of Soil

    Science.gov (United States)

    Cagle, A.; Choi, C. S.; Macknick, J.; Ravi, S.; Bickhart, R.

    2017-12-01

    The deployment of renewable energy technologies, such as solar photovoltaics (PV), is rapidly escalating. While PV can provide clean, renewable energy, there is uncertainty regarding its potential positive and/or negative impacts on the local environment. Specifically, its effects on the physicochemical properties of the underlying soil have not been systematically quantified. This study facilitates the discussion on the effects of PV installations related to the following questions: i. How do soil moisture, infiltration rates, total organic carbon, and nitrogen contents vary spatially under a PV array? ii. How do these physicochemical properties compare to undisturbed and adjacent land covered in native vegetation? iii. Are these variations statistically significant to provide insight on whether PV installations have beneficial or detrimental impacts on soil? We address these questions through field measurements of soil moisture, infiltration, grain particle size distribution, total organic carbon, and nitrogen content at a 1-MW solar PV array located at the National Renewable Energy Laboratory in Golden, Colorado. We collect data via multiple transects underneath the PV array as as well as in an adjacent plot of undisturbed native vegetation. Measurements are taken at four positions under the solar panels; the east-facing edge, center area under the panel, west-facing edge, and interspace between panel rows to capture differences in sun exposure as well as precipitation runoff of panels. Measurements are collected before and after a precipitation event to capture differences in soil moisture and infiltration rates. Results of this work can provide insights for research fields associated with the co-location of agriculture and PV installations as well as the long term ecological impacts of solar energy development. Trends in physicochemical properties under and between solar panels can affect the viability of co-location of commercial crops in PV arrays, the

  12. Caracterização de Passiflora mucronata Lam.: nova alternativa de maracujá ornamental

    Directory of Open Access Journals (Sweden)

    Laura Maria Molina Meletti

    2011-10-01

    Full Text Available No Brasil, a família Passifloraceae possui ampla diversidade genética devido ao elevado número de espécies nativas, entretanto, o valor ornamental da família ainda é praticamente inexplorado. Passiflora mucronata Lam. é uma das espécies nativas que integram o Banco de Germoplasma de Maracujazeiros do Instituto Agronômico (IAC, que estão sendo caracterizadas para fins ornamentais, em condições de campo, objetivando sua utilização comercial. Foram avaliados desenvolvimento vegetativo, época de florescimento, período de antese, compatibilidade, viabilidade polínica, produção de frutos, comportamento germinativo e longevidade das sementes. As flores de P. mucronata são brancas, fosforescentes e têm antese noturna, atraindo mariposas e morcegos. A viabilidade polínica permaneceu elevada (75,8%, desde a antese (18h00min h até a manhã seguinte. A espécie mostrou-se autoincompatível. A polinização cruzada resultou em frutos ovoides, com 14,82g de peso médio, 4,59cm de diâmetro longitudinal por 2,73cm de diâmetro equatorial. A casca do fruto é delgada, amarelo-canária quando totalmente maduro. A polpa apresentou pouca suculência, sem aroma característico, mas sabor agradável. As sementes são achatadas, de coloração marrom-enegrecida, com dormência quando recém-colhidas, o que pode ser superado efetivamente com armazenamento em câmara fria e seca mais choque térmico, associados. A longevidade das sementes foi de cerca de um ano. Os acessos avaliados de P. mucronata evidenciaram se tratar de uma planta de vigor vegetativo intermediário, tolerante ao frio, com intenso florescimento, que se estende por um longo período do ano. Em função destas vantagens adicionais, pode ser utilizada como planta ornamental, uma alternativa dentro do grupo das trepadeiras indicadas para cercas vivas ou caramanchões.

  13. Hypoglycemic and hypolipidemic activity of aqueous leaf extract of Passiflora suberosa L

    Directory of Open Access Journals (Sweden)

    Hasani Prabodha Sudasinghe

    2018-02-01

    Full Text Available Leaves of Passiflora suberosa L. (Family: Passifloraceae; common name: wild passion fruit, devil’s pumpkin are used in Sri Lankan traditional medicine for treating diabetes. The present study investigated the in vivo ability of P. suberosa leaves to manage blood sugar status and associated cholesterol levels. Mechanisms of action and toxicity were also determined. Phytochemical screening of aqueous extracts of P. suberosa leaves and carbohydrate content of the leaves were determined according to previously published methods. In two group of male mice (n = 9, effects on fasting and random blood glucose levels (BGLs of different acute doses (0, 25, 50, 100 and 200 mg/kg of the aqueous leaf extract (ALE were evaluated at 1, 3, and 5 h post-treatment. In another set of mice, the fasting BGL was evaluated following treatment of 0 or 50 mg/kg ALE (dose prescribed in traditional medicine for 30 consecutive days. The lipid profile, some mechanism of ALE action (diaphragm glucose uptake, glycogen content in the liver and skeletal muscles and its toxicity (behavioural observation, food and water intake, hepatoxicity were also assessed following 30-day treatment. However, sucrose and glucose tolerance tests and intestinal glucose uptake were conducted to determine portion of mechanisms of action following single dose of 50 mg/kg ALE. Phytochemical screening revealed the presence of alkaloids, unsaturated sterols, triterpenes, saponins, flavonoids, tannins and proanthocyanidins. Carbohydrate content of the leaves was 12.97%. The maximum hypoglycemic effect was observed after 4 h of 50 and 100 mg/kg ALE administration. The extract decreased fasting BGL (18% following an oral sucrose challenge and inhibited (79% glucose absorption from the intestine. Correspondingly, the levels of glycogen in the liver (61% and in the skeletal muscles (57% were found be higher than that of the control group. The levels of total cholesterol (17% and tri

  14. Hypoglycemic and hypolipidemic activity of aqueous leaf extract ofPassiflora suberosaL.

    Science.gov (United States)

    Sudasinghe, Hasani Prabodha; Peiris, Dinithi C

    2018-01-01

    Leaves of Passiflora suberosa L. (Family: Passifloraceae; common name: wild passion fruit, devil's pumpkin) are used in Sri Lankan traditional medicine for treating diabetes. The present study investigated the in vivo ability of P. suberosa leaves to manage blood sugar status and associated cholesterol levels. Mechanisms of action and toxicity were also determined. Phytochemical screening of aqueous extracts of P. suberosa leaves and carbohydrate content of the leaves were determined according to previously published methods. In two group of male mice ( n  = 9), effects on fasting and random blood glucose levels (BGLs) of different acute doses (0, 25, 50, 100 and 200 mg/kg) of the aqueous leaf extract (ALE) were evaluated at 1, 3, and 5 h post-treatment. In another set of mice, the fasting BGL was evaluated following treatment of 0 or 50 mg/kg ALE (dose prescribed in traditional medicine) for 30 consecutive days. The lipid profile, some mechanism of ALE action (diaphragm glucose uptake, glycogen content in the liver and skeletal muscles) and its toxicity (behavioural observation, food and water intake, hepatoxicity) were also assessed following 30-day treatment. However, sucrose and glucose tolerance tests and intestinal glucose uptake were conducted to determine portion of mechanisms of action following single dose of 50 mg/kg ALE. Phytochemical screening revealed the presence of alkaloids, unsaturated sterols, triterpenes, saponins, flavonoids, tannins and proanthocyanidins. Carbohydrate content of the leaves was 12.97%. The maximum hypoglycemic effect was observed after 4 h of 50 and 100 mg/kg ALE administration. The extract decreased fasting BGL (18%) following an oral sucrose challenge and inhibited (79%) glucose absorption from the intestine. Correspondingly, the levels of glycogen in the liver (61%) and in the skeletal muscles (57%) were found be higher than that of the control group. The levels of total cholesterol (17%) and tri-glyceraldehyde levels

  15. Open-label observational study of the homeopathic medicine Passiflora Compose for anxiety and sleep disorders.

    Science.gov (United States)

    Villet, Stéphanie; Vacher, Véronique; Colas, Aurélie; Danno, Karine; Masson, Jean-Louis; Marijnen, Philippe; Bordet, Marie-France

    2016-02-01

    Anxiety and sleep disorders (SDS) are frequently treated with psychotropic drugs. Health authorities in France have been advised to improve access to alternative treatments such as homeopathic medicines. Our aim was to describe the socio-demographic characteristics and clinical progression of patients prescribed homeopathic medicine Passiflora Compose (PC) for anxiety and/or SDS. This was an open-label, observational study. Randomly selected general practitioners (GPs) known to prescribe homeopathic medicines recruited consecutive patients (≥18-years) prescribed PC. The following data were recorded at inclusion by the GP: socio-demographic data and anxiety severity (Hamilton anxiety rating scale or HAM-A); and by the patients: level of anxiety (STAI Spielberger self-assessment questionnaire) and SDS (Jenkins sleep scale or JSS). Anxiety and SDS were reassessed after 4 weeks of treatment using the same scales. A total of 639 patients (mean age: 46.3 ± 17.5 years; 78.6% female) were recruited by 98 GPs. Anxiety was present in 85.4% (HAM-A) and 93.3% (Spielberger State) at inclusion (mean scores: 17.8 ± 8.91 and 54.59 ± 11.69, respectively) and SDS was present in 74.0% (mean score: 15.24 ± 5.28). A total of 401 (62.7%) patients received PC alone and 167 (26.1%) PC + psychotropics. After 4 weeks, mean anxiety scores decreased by more than 7, 12 and 6 points (HAM-A, Spielberger State and Trait respectively), and SDS score by more than 4 points (JSS). Anxiety and/or SDS improved significantly in patients included on this study. PC could be an alternative to the use of psychotropic drugs for first intention treatment of anxiety and SDS. Further studies are needed to confirm those results. Copyright © 2015 The Faculty of Homeopathy. Published by Elsevier Ltd. All rights reserved.

  16. Morphological and anatomical analyses of the seed coats of sweet granadilla (Passiflora ligularis Juss. seeds

    Directory of Open Access Journals (Sweden)

    Cárdenas Hernández Julián

    2011-12-01

    Full Text Available

    The study of histology and morphology of seeds of genus Passiflora has been of high utility for the classification of species. In seeds of sweet granadilla, the histological characteristics and methodologies for their study are unknown. This study was aimed to know the tissue and morphological characteristics of the seed coats of seeds of sweet granadilla and to be able to determine its value in the differentiation of accessions. Five accessions collected in producing zones of the Province of Huila, Colombia, were analyzed. In morphological analysis, all accessions presented falsifoveate ornamentation and entire margin. The seeds presented high change in weight and size for every accession; there stood out the seeds of the accession PmN for presenting major size (7.42 mm long, weight (35.62 mg, homogeneity in these variables and a typical orange color. For the histological analysis, a protocol was adapted to realize sections of seed coats in parafin, by means of which one managed to obtain sections (7 μ that in the optical microscope show clearly three well differentiated layers, belonging, possibly, to exotegmen (internal layer, mesotesta (medium layer and exotesta (external layer. Every layer presented differences in the form of the cells, color and thickness, between the sections of the basal and medium parts of the seeds, but the differences between the analyzed accessions

  17. Caracterização de frutos e sementes em acessos de maracujá silvestre (Passiflora foetida L. Characterization of fruits and seeds of wild passion fruit (Passiflora foetida L..

    Directory of Open Access Journals (Sweden)

    W.S. Soares

    2011-01-01

    Full Text Available A espécie Passiflora foetida L.é uma trepadeira exótica cujas folhas e frutos possuem propriedades medicinais. No Brasil, a erva é utilizada na forma de extratos ou emplastros para erisipelas e doenças de pele com inflamação. O objetivo deste trabalho foi caracterizar cinco acessos de Passiflora foetida L. baseados em 17 descritores morfológicos O experimento foi conduzido em casa de vegetação em delineamento inteiramente ao acaso, com 15 repetições por genótipo. As variáveis analisadas foram cor da casca do fruto, formato do fruto, comprimento do fruto, diâmetro do fruto, massa fresca do fruto, comprimento do pedicelo, cor da polpa do fruto, espessura da casca, acidez titulável, sólidos solúveis, potencial hidrogeniônico, razão sólidos solúveis/ acidez titulável, comprimento da semente, diâmetro da semente, espessura da semente, massa fresca das sementes e o número de sementes por fruto. Os dados foram submetidos à análise de variância e teste de médias pelo teste Tukey a 5% de probabilidade. Houve diferença significativa pelo teste F a 5% de probabilidade, entre os genótipos para quase todas as características com exceção da espessura da casca, massa fresca do fruto, comprimento da semente e massa fresca das sementes. A característica que apresentou maior variação foi o teor de sólidos solúveis. E entre os genótipos, o acesso 5 foi o que apresentou as maiores médias pelo teste de Tukey a 5% de probabilidade, em todas as características analisadas, podendo ser utilizado em programas de melhoramento da espécie.The species Passiflora foetida L. é an exotic vine, which leaves and fruit have medicinal properties. In Brazil, the herbis used in the form of extracts or poultices for erysipelas and skin diseases with inflammation. The aim of this study was to characterize five Passiflora foetida L. accessions based on 17 morphological descriptors The experiment was conducted in a greenhouse in a completely

  18. Produção de néctar e visitas por abelhas em duas espécies cultivadas de Passiflora L. (Passifloraceae Nectar production and bee visits in two cultivated species of Passiflora L. (Passifloraceae

    Directory of Open Access Journals (Sweden)

    Isabela Galarda Varassin

    2012-03-01

    Full Text Available A atividade dos polinizadores é afetada pela disponibilidade de recursos. Flores que produzem mais néctar podem ser mais visitadas e assim apresentar maior produção de frutos. O efeito da produção de néctar na atividade dos polinizadores foi testado em duas espécies cultivadas de maracujá, Passiflora alata Curtis e Passiflora edulis Sims, em Morretes, Paraná. Botões foram ensacados e o néctar acumulado das flores foi coletado em intervalos de 1 h. Em P. alata o volume e a concentração de solutos no néctar aumentaram durante o período de antese, associados com o aumento da temperatura. Em P. edulis, o volume aumentou durante o período diurno da antese, e decresceu após as 18 horas. A concentração de solutos no néctar permaneceu constante. A taxa média de visitação de Xylocopa frontalis (Olivier em P. alata foi de 1,7 visitas/100flores/hora e em P. edulis foi de 6,6 visitas/100flores/hora, sendo constante durante a antese. A taxa média de visitação de Bombus morio (Swederus em P. alata foi de 5,8 visitas/100flores/hora, sendo mais alta no início da antese. A constância das visitas de X. frontalis deve estar associada à produção contínua de néctar em ambas as espécies de maracujazeiros. Como as espécies são xenogâmicas, a manutenção das visitas é importante para propiciar o fluxo de pólen entre indivíduos e assim garantir boa produção de frutos.Pollinator activity is affected by resource availability. Flowers that produce more nectar are visited more, which results in a greater fruit set. The effect of nectar production on pollinator activity was tested in two cultivated species of passion fruit, Passiflora alata Curtis and Passiflora edulis Sims, in Morretes, Paraná. Flower buds were bagged and the accumulated nectar of flowers was collected hourly. The volume and concentration of nectar of P. alata increased during anthesis, which was associated with rising temperatures. The volume of nectar of P

  19. Enxertia de maracujazeiro-azedo em estacas herbáceas enraizadas de espécies de passifloras nativas Grafting of passion fruit on rooted-herbaceous cuttings of wild passiflora species

    Directory of Open Access Journals (Sweden)

    Renata da Costa Chaves

    2004-04-01

    Full Text Available As doenças provocadas por patógenos do solo em maracujazeiro constituem-se em um dos principais problemas para essa cultura no Brasil. Uma das alternativas de controle dessas doenças seria a utilização de porta-enxertos resistentes. Várias espécies de passifloras nativas vêm apresentando resistência a essas doenças, mas a utilização destas como porta-enxertos oriundos de sementes tem sido dificultada pelas diferenças de diâmetro entre o porta-enxerto e o enxerto da espécie comercial, o que não aconteceria caso fossem utilizadas as estacas herbáceas como porta-enxerto. No presente experimento, utilizaram-se estacas herbáceas retiradas da parte mediana de ramos de plantas de Passiflora setacea (acesso EC-PS 1, P. nitida (acesso EC-PN 1, P. caerulea (acesso EC-PC 1, P. actinia (acesso EC-PA 1 e de um híbrido F1 entre P. setacea x P. edulis f. flavicarpa comercial e tratadas com ácido naftaleno acético (ANA a 500 mg/L e mantidas em câmaras de nebulização. As enxertias do tipo "garfagem lateral no topo" foram efetuadas aos 40; 55 e 70 dias após a coleta e plantio das estacas, utilizando garfos de uma única planta de maracujazeiro-azedo. As avaliações foram efetuadas aos 145 e 150 dias após o plantio das estacas, determinando-se a porcentagem de pegamento da enxertia e de enxertos brotados e o comprimento do broto do enxerto. A produção de mudas por enxertia em estacas herbáceas enraizadas de Passiflora nitida e do híbrido F1 (P. setacea x P. edulis f. flavicarpa foi tecnicamente viável.The soil born diseases cause expressive losses in passion fruit crops in Brazil. The use of resistant rootstocks is an alternative to control these diseases. Several wild species of Passifloraceae have presented resistance to soil born pathogens, but their utilization as rootstock from seeds has been limited mainly by differences of thickness between the rootstock and the graft of the commercial cultivars. These limitations could be

  20. NREL PV working with industry, Third quarter 1998

    Energy Technology Data Exchange (ETDEWEB)

    Moon, S.; Cook, G.

    1998-12-04

    This quarterly report encourages cooperative R and D by providing the US PV industry with information on activities and capabilities of the laboratories. This issue contains information on the CIS and CdTe R and D teams, an editorial by Richard King on the stand-out accomplishments of the PV Program, and an overview of the NCPV Program Review Meeting highlighting the strength of US photovoltaics.

  1. In the balance. The social costs and benefits of PV

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, C. [ECN Solar Energy, Petten (Netherlands)

    2013-10-16

    For more than a decade, the growth in PV markets surpassed expectations. Then, in 2012, the European market declined for the first time compared with the previous year. As policymakers' support for PV hesitates over the costs to society of this technology, it is timely to take an overview of the social costs and benefits, also referred to as the 'external costs', of PV electricity. In this article, these costs are put into perspective vis-a-vis those associated with conventional electricity-generating technologies. The external costs of electricity can be broken down into: (1) the environmental and health costs; (2) the costs of subsidies and energy security; and (3) the costs for grid expansion and reliability. Included in these costs are the increased insurance, health, social and environmental costs associated with damages to health, infrastructure and environment, as well as tax payments that subsidize producers of electricity or fuels, their markets and the electricity infrastructure. A life cycle assessment (LCA) of the environmental impact is used in the quantification of the associated environmental and health costs. Because the environmental footprint of PV electricity is highly dependent on the electricity mix used in PV module fabrication, the environmental indicators are calculated for PV electricity manufactured using different electricity mixes, and compared with those for the European electricity mix (UCTE), and electricity generated by burning 100% coal or 100% natural gas. In 2012 USD, coal electricity requires 19-29 eurocent/kWh above the market price, compared with 1-1.6 eurocent/kWh for PV manufactured with 100% coal electricity. The sum of the subsidies, avoided fossil-fuel imports and energy security, and the economic stimulation associated with PV electricity deployment, amounts to net external benefits. Integrating high penetrations of renewables, with the same reliability as we have today, appears to be fully feasible and

  2. Improvements in world-wide intercomparison of PV module calibration

    OpenAIRE

    Salis, E.; Pavanello, D.; Field, M.; Kräling, U.; Neuberger, F.; Kiefer, K.; Osterwald, C.; Rummel, S.; Levi, D.; Hishikawa, Y.; Yamagoe, K.; Ohshima, H.; Yoshita, M.; Müllejans, H.

    2017-01-01

    The calibration of the electrical performance for seven photovoltaic (PV) modules was compared between four reference laboratories on three continents. The devices included two samples in standard and two in high-efficiency crystalline silicon technology, two CI(G)S and one CdTe module. The reference value for each PV module parameter was calculated from the average of the results of all four laboratories, weighted by the respective measurement uncertainties. All single results were then anal...

  3. Influence of Special Weather on Output of PV System

    Science.gov (United States)

    Zhang, Zele

    2018-01-01

    The output of PV system is affected by different environmental factors, therefore, it is important to study the output of PV system under different environmental conditions. Through collecting data on the spot, collecting the output of photovoltaic panels under special weather conditions, and comparing the collected data, the output characteristics of the photovoltaic panels under different weather conditions are obtained. The influence of weather factors such as temperature, humidity and irradiance on the output of photovoltaic panels was investigated.

  4. Economic and policy analysis for solar PV systems in Indiana

    International Nuclear Information System (INIS)

    Jung, Jinho; Tyner, Wallace E.

    2014-01-01

    In recent years, the energy market in the US and globally is expanding the production of renewable energy. Solar energy for electricity is also expanding in the US. Indiana is one of the states expanding solar energy with solar photovoltaic (PV) systems. Therefore, we conduct benefit cost analysis with several uncertain input variables to determine the economics of adopting solar PV systems in Indiana based on policy instruments that could increase adoption of solar PV systems. The specific objectives are analyses of the cost distribution of solar PV systems compared with grid electricity in homes and estimating the probability that solar can be cheaper than electricity from grids under different policy combinations. We first do the analysis under current policy and then the analysis under potential policy options for a variety of scenarios. Also, the results inform government policy makers on how effective the alternative policies for encouraging solar PV systems are. The results show that current policies are important in reducing the cost of solar PV systems. However, with current policies, there is only 50–50 chance of solar being cheaper than electricity from grids. If potential policies are implemented, solar PV systems can be more economical than grid electricity. - Highlights: • We investigate the economics of solar PV systems based on policy instruments. • We do scenario analyses under different combinations of policies. • We examine the probability of solar being cheaper than grid electricity for each scenario. • With current policies, there is 50–50 chance of solar being cheaper than the grid. • With depreciation and carbon tax, solar is much more economical than the grid

  5. Developing solar: PV solar system markets in Africa

    International Nuclear Information System (INIS)

    Asali, Karim

    2002-01-01

    Governments, NGO's and UN organisations are increasingly convinced that renewable energies not only help to solve energy problems in Africa but are indispensable in alleviating regional disparities, social problems and bridging the digital gap. Still, many years after introducing high efficiency solar PV systems the necessary breakthrough of implementing them on a mass scale is still not a reality. The author provides perspectives on developing solar PV in Africa. (Author)

  6. Parallel experimental study of a novel super-thin thermal absorber based photovoltaic/thermal (PV/T system against conventional photovoltaic (PV system

    Directory of Open Access Journals (Sweden)

    Peng Xu

    2015-11-01

    Full Text Available Photovoltaic (PV semiconductor degrades in performance due to temperature rise. A super thin-conductive thermal absorber is therefore developed to regulate the PV working temperature by retrofitting the existing PV panel into the photovoltaic/thermal (PV/T panel. This article presented the parallel comparative investigation of the two different systems through both laboratory and field experiments. The laboratory evaluation consisted of one PV panel and one PV/T panel respectively while the overall field system involved 15 stand-alone PV panels and 15 retrofitted PV/T panels. The laboratory testing results demonstrated the PV/T panel could achieve the electrical efficiency of about 16.8% (relatively 5% improvement comparing with the stand-alone PV panel, and yield an extra amount of heat with thermal efficiency of nearly 65%. The field testing results indicated that the hybrid PV/T panel could enhance the electrical return of PV panels by nearly 3.5%, and increase the overall energy output by nearly 324.3%. Further opportunities and challenges were then discussed from aspects of different PV/T stakeholders to accelerate the development. It is expected that such technology could become a significant solution to yield more electricity, offset heating load freely and reduce carbon footprint in contemporary energy environment.

  7. Performance analysis of PV panel under varying surface temperature

    Directory of Open Access Journals (Sweden)

    Kumar Tripathi Abhishek

    2018-01-01

    Full Text Available The surface temperature of PV panel has an adverse impact on its performance. The several electrical parameters of PV panel, such as open circuit voltage, short circuit current, power output and fill factor depends on the surface temperature of PV panel. In the present study, an experimental work was carried out to investigate the influence of PV panel surface temperature on its electrical parameters. The results obtained from this experimental study show a significant reduction in the performance of PV panel with an increase in panel surface temperature. A 5W PV panel experienced a 0.4% decrease in open circuit voltage for every 1°C increase in panel surface temperature. Similarly, there was 0.6% and 0.32% decrease in maximum power output and in fill factor, respectively, for every 1°C increase in panel surface temperature. On the other hand, the short circuit current increases with the increase in surface temperature at the rate of 0.09%/°C.

  8. Fuzzy Logic Based MPPT Controller for a PV System

    Directory of Open Access Journals (Sweden)

    Carlos Robles Algarín

    2017-12-01

    Full Text Available The output power of a photovoltaic (PV module depends on the solar irradiance and the operating temperature; therefore, it is necessary to implement maximum power point tracking controllers (MPPT to obtain the maximum power of a PV system regardless of variations in climatic conditions. The traditional solution for MPPT controllers is the perturbation and observation (P&O algorithm, which presents oscillation problems around the operating point; the reason why improving the results obtained with this algorithm has become an important goal to reach for researchers. This paper presents the design and modeling of a fuzzy controller for tracking the maximum power point of a PV System. Matlab/Simulink (MathWorks, Natick, MA, USA was used for the modeling of the components of a 65 W PV system: PV module, buck converter and fuzzy controller; highlighting as main novelty the use of a mathematical model for the PV module, which, unlike diode based models, only needs to calculate the curve fitting parameter. A P&O controller to compare the results obtained with the fuzzy control was designed. The simulation results demonstrated the superiority of the fuzzy controller in terms of settling time, power loss and oscillations at the operating point.

  9. Review of Artificial Abrasion Test Methods for PV Module Technology

    Energy Technology Data Exchange (ETDEWEB)

    Miller, David C. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Muller, Matt T. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Simpson, Lin J. [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-08-01

    This review is intended to identify the method or methods--and the basic details of those methods--that might be used to develop an artificial abrasion test. Methods used in the PV literature were compared with their closest implementation in existing standards. Also, meetings of the International PV Quality Assurance Task Force Task Group 12-3 (TG12-3, which is concerned with coated glass) were used to identify established test methods. Feedback from the group, which included many of the authors from the PV literature, included insights not explored within the literature itself. The combined experience and examples from the literature are intended to provide an assessment of the present industry practices and an informed path forward. Recommendations toward artificial abrasion test methods are then identified based on the experiences in the literature and feedback from the PV community. The review here is strictly focused on abrasion. Assessment methods, including optical performance (e.g., transmittance or reflectance), surface energy, and verification of chemical composition were not examined. Methods of artificially soiling PV modules or other specimens were not examined. The weathering of artificial or naturally soiled specimens (which may ultimately include combined temperature and humidity, thermal cycling and ultraviolet light) were also not examined. A sense of the purpose or application of an abrasion test method within the PV industry should, however, be evident from the literature.

  10. Performance evaluation of stand alone hybrid PV-wind generator

    Energy Technology Data Exchange (ETDEWEB)

    Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H. [Faculty of Electrical Engineering, Universiti Teknikal Malaysia Melaka (UTeM), Hang Tuah Jaya, 76100 Melaka (Malaysia); Yahaya, M. S. [Faculty of Engineering Technology, Universiti Teknikal Malaysia Melaka (UTeM), Hang Tuah Jaya, 76100 Melaka (Malaysia)

    2015-05-15

    This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand.

  11. Residential Solar PV Systems in the Carolinas: Opportunities and Outcomes.

    Science.gov (United States)

    Alqahtani, Bandar Jubran; Holt, Kyra Moore; Patiño-Echeverri, Dalia; Pratson, Lincoln

    2016-02-16

    This paper presents a first-order analysis of the feasibility and technical, environmental, and economic effects of large levels of solar photovoltaic (PV) penetration within the services areas of the Duke Energy Carolinas (DEC) and Duke Energy Progress (DEP). A PV production model based on household density and a gridded hourly global horizontal irradiance data set simulates hourly PV power output from roof-top installations, while a unit commitment and real-time economic dispatch (UC-ED) model simulates hourly system operations. We find that the large generating capacity of base-load nuclear power plants (NPPs) without ramping capability in the region limits PV integration levels to 5.3% (6510 MW) of 2015 generation. Enabling ramping capability for NPPs would raise the limit of PV penetration to near 9% of electricity generated. If the planned retirement of coal-fired power plants together with new installations and upgrades of natural gas and nuclear plants materialize in 2025, and if NPPs operate flexibly, then the share of coal-fired electricity will be reduced from 37% to 22%. A 9% penetration of electricity from PV would further reduce the share of coal-fired electricity by 4-6% resulting in a system-wide CO2 emissions rate of 0.33 to 0.40 tons/MWh and associated abatement costs of 225-415 (2015$ per ton).

  12. Training and certification of PV installers in Europe

    International Nuclear Information System (INIS)

    Tsoutsos, Theocharis; Tournaki, Stavroula; Gkouskos, Zacharias; Masson, Gaetan; Holden, John; Huidobro, Ana; Stoykova, Evelina; Rata, Camelia; Bacan, Andro; Maxoulis, Christos; Charalambous, Anthi

    2013-01-01

    The European strategy for the coming decades sets specific targets for a sustainable growth, including reaching a 20% share of renewables in final energy consumption till 2020. To achieve this target, a number of initiatives and measures have been in force. Europe, is currently the largest market for PV systems with more than 75% of the annual worldwide installations in 2011. The favourable European policies as well as the Member States’ supporting legislations have resulted in high market growth for photovoltaics. Applying PV technologies however, requires high qualified technicians to install, repair and maintain them. Until today, national markets have been growing faster than the skilled PV installers force can satisfy. The PVTRIN, an Intelligent Energy Europe action, addresses these issues by developing a training and certification scheme for technicians active in the installation and maintenance of small scale PV systems. During the implementation of the action, a market research was conducted in the six participating countries in order to record the stakeholders’ attitudes, perceptions and considerations and to adapt the training methods, tools and materials to the national PV industry requirements and markets’ needs. Indicative results of this analysis as well as the current situation regarding relevant training and certification schemes are presented in this paper. - Highlights: ► Market research in six EU countries on PV professional Training and Certification needs. ► PVTRIN scheme integrates the national legislations and the market's needs. ► The different aspects (technical, institutional, financial) are presented

  13. Performance evaluation of stand alone hybrid PV-wind generator

    Science.gov (United States)

    Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H.; Yahaya, M. S.

    2015-05-01

    This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand.

  14. Performance evaluation of stand alone hybrid PV-wind generator

    International Nuclear Information System (INIS)

    Nasir, M. N. M.; Saharuddin, N. Z.; Sulaima, M. F.; Jali, Mohd Hafiz; Bukhari, W. M.; Bohari, Z. H.; Yahaya, M. S.

    2015-01-01

    This paper presents the performance evaluation of standalone hybrid system on Photovoltaic (PV)-Wind generator at Faculty of Electrical Engineering (FKE), UTeM. The hybrid PV-Wind in UTeM system is combining wind turbine system with the solar system and the energy capacity of this hybrid system can generate up to charge the battery and supply the LED street lighting load. The purpose of this project is to evaluate the performance of PV-Wind hybrid generator. Solar radiation meter has been used to measure the solar radiation and anemometer has been used to measure the wind speed. The effectiveness of the PV-Wind system is based on the various data that has been collected and compared between them. The result shows that hybrid system has greater reliability. Based on the solar result, the correlation coefficient shows strong relationship between the two variables of radiation and current. The reading output current followed by fluctuate of solar radiation. However, the correlation coefficient is shows moderate relationship between the two variables of wind speed and voltage. Hence, the wind turbine system in FKE show does not operate consistently to produce energy source for this hybrid system compare to PV system. When the wind system does not fully operate due to inconsistent energy source, the other system which is PV will operate and supply the load for equilibrate the extra load demand

  15. PVMirrors: Hybrid PV/CSP collectors that enable lower LCOEs

    Science.gov (United States)

    Fisher, Kate; Yu, Zhengshan Jason; Striling, Rob; Holman, Zachary

    2017-06-01

    The primary challenge with concentrating solar power (CSP) is that the conversion efficiency is low—and the cost high—compared to that of photovoltaics (PV), and the primary challenge with PV is that the energy generated cannot be stored cost effectively. We introduce a technology that hybridizes CSP and PV, resulting in power plants with high energy conversion efficiency and affordable storage. This is accomplished by replacing silvered troughs (or heliostat facets) with "PVMirrors" that and direct photons of each wavelength to the converter (PV or thermal) that may best use them. A PVMirror looks like a curved PV module that includes a spectrum-splitting dichroic mirror film; this film, which is the heart of the technology, transmits near-infrared light to the underlying silicon PV cells while reflecting both longer and shorter wavelengths to a thermal absorber tube. This paper investigates the optical performance of dichroic mirror film, the specularity of PVMirrors, and the anticipated levelized cost of energy (LCOE) from a PVMirror power plant. PVMirrors are found to decrease LCOE by more than 15% relative to CSP while retaining full dispatchability.

  16. Review of PV Inverter Technology Cost and Performance Projections

    Energy Technology Data Exchange (ETDEWEB)

    Navigant Consulting Inc.

    2006-01-01

    The National Renewable Energy Laboratory (NREL) has a major responsibility in the implementation of the U.S. Department of Energy's (DOE's) Solar Energy Technologies Program. Sandia National Laboratories (SNL) has a major role in supporting inverter development, characterization, standards, certifications, and verifications. The Solar Energy Technologies Program recently published a Multiyear Technical Plan, which establishes a goal of reducing the Levelized Energy Cost (LEC) for photovoltaic (PV) systems to $0.06/kWh by 2020. The Multiyear Technical Plan estimates that, in order to meet the PV system goal, PV inverter prices will need to decline to $0.25-0.30 Wp by 2020. DOE determined the need to conduct a rigorous review of the PV Program's technical and economic targets, including the target set for PV inverters. NREL requested that Navigant Consulting Inc.(NCI) conduct a review of historical and projected cost and performance improvements for PV inverters, including identification of critical barriers identified and the approaches government might use to address them.

  17. Continuing Developments in PV Risk Management: Strategies, Solutions, and Implications

    Energy Technology Data Exchange (ETDEWEB)

    Lowder, T.; Mendelsohn, M.; Speer, B.; Hill, R.

    2013-02-01

    As the PV industry matures, successful risk management practices will become more imperative to ensure investor confidence, control costs, and facilitate further growth. This report discusses several key aspects of risk management during the commercial- and utility-scale project life cycle, from identification of risks, to the process of mitigating and allocating those risks among project parties, to transferring those risks through insurance. The report also explores novel techniques in PV risk management, options to offload risks onto the capital markets, and innovative insurance policies (namely warranty policies) that address risks unique to the PV sector. One of the major justifications for robust risk management in the PV industry is the cost-reduction opportunities it affords. If the PV industry can demonstrate the capability to successfully manage its risks, thereby inspiring confidence in financiers, it may be able to obtain a lower cost of capital in future transactions. A lower cost of capital translates to a lower cost of energy, which will in turn enhance PV?s competitiveness at a time when it will have to rely less on subsidies to support its market penetration.

  18. Control Strategies for the DAB Based PV Interface System.

    Directory of Open Access Journals (Sweden)

    Hadi M El-Helw

    Full Text Available This paper presents an interface system based on the Dual Active Bridge (DAB converter for Photovoltaic (PV arrays. Two control strategies are proposed for the DAB converter to harvest the maximum power from the PV array. The first strategy is based on a simple PI controller to regulate the terminal PV voltage through the phase shift angle of the DAB converter. The Perturb and Observe (P&O Maximum Power Point Tracking (MPPT technique is utilized to set the reference of the PV terminal voltage. The second strategy presented in this paper employs the Artificial Neural Network (ANN to directly set the phase shift angle of the DAB converter that results in harvesting maximum power. This feed-forward strategy overcomes the stability issues of the feedback strategy. The proposed PV interface systems are modeled and simulated using MATLAB/SIMULINK and the EMTDC/PSCAD software packages. The simulation results reveal accurate and fast response of the proposed systems. The dynamic performance of the proposed feed-forward strategy outdoes that of the feedback strategy in terms of accuracy and response time. Moreover, an experimental prototype is built to test and validate the proposed PV interface system.

  19. Control Strategies for the DAB Based PV Interface System.

    Science.gov (United States)

    El-Helw, Hadi M; Al-Hasheem, Mohamed; Marei, Mostafa I

    2016-01-01

    This paper presents an interface system based on the Dual Active Bridge (DAB) converter for Photovoltaic (PV) arrays. Two control strategies are proposed for the DAB converter to harvest the maximum power from the PV array. The first strategy is based on a simple PI controller to regulate the terminal PV voltage through the phase shift angle of the DAB converter. The Perturb and Observe (P&O) Maximum Power Point Tracking (MPPT) technique is utilized to set the reference of the PV terminal voltage. The second strategy presented in this paper employs the Artificial Neural Network (ANN) to directly set the phase shift angle of the DAB converter that results in harvesting maximum power. This feed-forward strategy overcomes the stability issues of the feedback strategy. The proposed PV interface systems are modeled and simulated using MATLAB/SIMULINK and the EMTDC/PSCAD software packages. The simulation results reveal accurate and fast response of the proposed systems. The dynamic performance of the proposed feed-forward strategy outdoes that of the feedback strategy in terms of accuracy and response time. Moreover, an experimental prototype is built to test and validate the proposed PV interface system.

  20. Examples of successful architectural integration of PV: Germany

    International Nuclear Information System (INIS)

    Hagemann, I.B.

    2004-01-01

    In Germany building-integrated photovoltaics (BIPV) are developing rapidly, and much progress has been achieved in the past five years. BIPV can be used today in different ways on both existing and new buildings. Architects and designers are discovering BIPV. With the help of custom-made products available on the German market they are beginning to explore the technical limits of an aesthetic and structural integration of PV in buildings. As a result some exciting high-profile building projects with PV have been built, for example, the small service pavilion Meereslauschen in Steinhude or the new headquarters building of the Wood Trade Association in Munich. These projects show that the use of PV is very varied and offers opportunities for creative architects. However non-technical problems still need to be solved to allow a meaningful and widespread application of PV in the built environment. To decrease costs it is essential to develop further standard BIPV components. The aim of such developments should be to replace standard PV modules by products in which PV and structural building elements are melded into one design and structural unit. (author)

  1. Lifetime Evaluation of Grid-Connected PV Inverters Considering Panel Degradation Rates and Installation Sites

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2018-01-01

    Lifetime of PV inverters is affected by the installation sites related to different solar irradiance and ambient temperature profiles (also referred to as mission profiles). In fact, the installation site also affects the degradation rate of the PV panels, and thus long-term energy production...... and reliability. Prior-art lifetime analysis in PV inverters has not yet investigated the impact of PV panel degradations. This paper thus evaluates the lifetime of PV inverters considering panel degradation rates and mission profiles. Evaluations have been carried out on PV systems installed in Denmark...... and Arizona. The results reveal that the PV panel degradation rate has a considerable impact on the PV inverter lifetime, especially in the hot climate (e.g., Arizona), where the panel degrades at a faster rate. In that case, the PV inverter lifetime prediction can be deviated by 54%, if the impact of PV...

  2. NCBI nr-aa BLAST: CBRC-DNOV-01-1305 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1305 ref|NP_640667.1| vanillate O-demethylase oxygenase subunit [Xanth...omonas axonopodis pv. citri str. 306] gb|AAM35203.1| vanillate O-demethylase oxygenase subunit [Xanthomonas axonopodis pv. citri str. 306] NP_640667.1 5.1 38% ...

  3. MORFOANATOMÍA DE LAS GLÁNDULAS EN CUATRO ESPECIES DE PASSIFLORA L. (PASSIFLORACEAE DE VENEZUELA

    Directory of Open Access Journals (Sweden)

    JÁUREGUI DAMELIS

    2002-06-01

    Full Text Available Se estudió la morfoanatomía de las glándulas secretoras presentes en cuatro especiesde Passiflora: P. foetida var. moritziana, P. oerstedii, P. suberosa y P. tuberosacon el fin de aportar información de valor diagnóstico como apoyo a la sistemáticadel género. Las muestras foliares se procesaron siguiendo técnicas convencionalesusadas tanto para microscopía óptica como para microscopía electrónica de barrido.Los resultados revelan diferencias notorias entre las cuatro especies, en lo referentea posición, número, forma e histología de sus glándulas secretoras.

  4. SBSE-GC-ECD/FPD in the analysis of pesticide residues in Passiflora alata Dryander herbal teas.

    Science.gov (United States)

    Bicchi, Carlo; Cordero, Chiara; Iori, Cristina; Rubiolo, Patrizia; Sandra, Pat; Yariwake, Janete H; Zuin, Vania G

    2003-01-01

    Stir bar sorptive extraction (SBSE) in combination with GC-ECD/FPD analysis is here applied to the determination of the residues of 11 pesticides (hexachlorobenzene, lindane, chlorothalonil, parathion methyl, parathion ethyl, fenitrothion, malathion, dieldrin, alpha- and beta-endosulfan, and tetradifon) in herbal teas prepared with Passiflora alata Dryander spiked leaves. The method was optimized using spiked herbal teas in a range from 0.05 to 1 pg/microL for organochlorine pesticides and from 0.15 to 3 pg/microL for organophosphorus pesticides. The method is reproducible and repeatable with recoveries calculated from herbal teas prepared with spiked plant material versus spiked herbal teas, varying from about 30% for tetradifon to about 90% for parathion methyl and malathion. The limits of quantitation (LOQs) ranged from 0.017 pg/microL for lindane to 0.117 pg/microL for malathion.

  5. Large scale PV plants - also in Denmark. Project report

    Energy Technology Data Exchange (ETDEWEB)

    Ahm, P. (PA Energy, Malling (Denmark)); Vedde, J. (SiCon. Silicon and PV consulting, Birkeroed (Denmark))

    2011-04-15

    Large scale PV (LPV) plants, plants with a capacity of more than 200 kW, has since 2007 constituted an increasing share of the global PV installations. In 2009 large scale PV plants with cumulative power more that 1,3 GWp were connected to the grid. The necessary design data for LPV plants in Denmark are available or can be found, although irradiance data could be improved. There seems to be very few institutional barriers for LPV projects, but as so far no real LPV projects have been processed, these findings have to be regarded as preliminary. The fast growing number of very large scale solar thermal plants for district heating applications supports these findings. It has further been investigated, how to optimize the lay-out of LPV plants. Under the Danish irradiance conditions with several winter months with very low solar height PV installations on flat surfaces will have to balance the requirements of physical space - and cost, and the loss of electricity production due to shadowing effects. The potential for LPV plants in Denmark are found in three main categories: PV installations on flat roof of large commercial buildings, PV installations on other large scale infrastructure such as noise barriers and ground mounted PV installations. The technical potential for all three categories is found to be significant and in the range of 50 - 250 km2. In terms of energy harvest PV plants will under Danish conditions exhibit an overall efficiency of about 10 % in conversion of the energy content of the light compared to about 0,3 % for biomass. The theoretical ground area needed to produce the present annual electricity consumption of Denmark at 33-35 TWh is about 300 km2 The Danish grid codes and the electricity safety regulations mention very little about PV and nothing about LPV plants. It is expected that LPV plants will be treated similarly to big wind turbines. A number of LPV plant scenarios have been investigated in detail based on real commercial offers and

  6. Solar Photovoltaic (PV) Distributed Generation Systems - Control and Protection

    Science.gov (United States)

    Yi, Zhehan

    This dissertation proposes a comprehensive control, power management, and fault detection strategy for solar photovoltaic (PV) distribution generations. Battery storages are typically employed in PV systems to mitigate the power fluctuation caused by unstable solar irradiance. With AC and DC loads, a PV-battery system can be treated as a hybrid microgrid which contains both DC and AC power resources and buses. In this thesis, a control power and management system (CAPMS) for PV-battery hybrid microgrid is proposed, which provides 1) the DC and AC bus voltage and AC frequency regulating scheme and controllers designed to track set points; 2) a power flow management strategy in the hybrid microgrid to achieve system generation and demand balance in both grid-connected and islanded modes; 3) smooth transition control during grid reconnection by frequency and phase synchronization control between the main grid and microgrid. Due to the increasing demands for PV power, scales of PV systems are getting larger and fault detection in PV arrays becomes challenging. High-impedance faults, low-mismatch faults, and faults occurred in low irradiance conditions tend to be hidden due to low fault currents, particularly, when a PV maximum power point tracking (MPPT) algorithm is in-service. If remain undetected, these faults can considerably lower the output energy of solar systems, damage the panels, and potentially cause fire hazards. In this dissertation, fault detection challenges in PV arrays are analyzed in depth, considering the crossing relations among the characteristics of PV, interactions with MPPT algorithms, and the nature of solar irradiance. Two fault detection schemes are then designed as attempts to address these technical issues, which detect faults inside PV arrays accurately even under challenging circumstances, e.g., faults in low irradiance conditions or high-impedance faults. Taking advantage of multi-resolution signal decomposition (MSD), a powerful signal

  7. The prospects for cost competitive solar PV power

    International Nuclear Information System (INIS)

    Reichelstein, Stefan; Yorston, Michael

    2013-01-01

    New solar Photovoltaic (PV) installations have grown globally at a rapid pace in recent years. We provide a comprehensive assessment of the cost competitiveness of this electric power source. Based on data available for the second half of 2011, we conclude that utility-scale PV installations are not yet cost competitive with fossil fuel power plants. In contrast, commercial-scale installations have already attained cost parity in the sense that the generating cost of power from solar PV is comparable to the retail electricity prices that commercial users pay, at least in certain parts of the U.S. This conclusion is shown to depend crucially on both the current federal tax subsidies for solar power and an ideal geographic location for the solar installation. Projecting recent industry trends into the future, we estimate that utility-scale solar PV facilities are on track to become cost competitive by the end of this decade. Furthermore, commercial-scale installations could reach “grid parity” in about ten years, if the current federal tax incentives for solar power were to expire at that point. - Highlights: ► Assessment of the cost competitiveness of new solar Photovoltaic (PV) installations. ► Utility-scale PV installations are not yet cost competitive with fossil fuel power plants. ► Commercial-scale installations have already attained cost parity in certain parts of the U.S. ► Utility-scale solar PV facilities are on track to become cost competitive by the end of this decade

  8. Is rooftop solar PV at socket parity without subsidies?

    International Nuclear Information System (INIS)

    Hagerman, Shelly; Jaramillo, Paulina; Morgan, M. Granger

    2016-01-01

    Installations of rooftop solar photovoltaic (PV) technology in the United States have increased dramatically in recent years, in large part because of state and federal subsidies. In the future, such subsidies may be reduced or eliminated. From the homeowner's perspective, solar PV is competitive when it can produce electricity at a cost equivalent to the retail electricity rate, a condition sometimes referred to as “socket parity”. In assessing the economic viability of residential solar PV, most existing literature considers only a few locations and fails to consider the differences in PV system cost and electricity prices that exist across the U.S. We combined insolation data from more than 1000 locations, installation costs by region, and county-level utility rates to provide a more complete economic assessment of rooftop solar PV across the U.S. We calculated the break-even electricity prices and evaluated the reductions in installed costs needed to reach socket parity. Among the scenarios considered, we estimate that only Hawaii has achieved socket parity without the use of subsidies. With subsidies, six states reach socket parity, yet widespread parity is still not achieved. We find that high installation costs and financing rates are two of the largest barriers to socket parity. - Highlights: • We evaluate the economic viability of residential rooftop solar PV across the U.S. • Widespread socket parity has not been achieved in the U.S. without subsidies. • Net metering may be critical for the economic viability of rooftop solar PV.

  9. Plug and Play PV Systems for American Homes

    Energy Technology Data Exchange (ETDEWEB)

    Hoepfner, Christian [Fraunhofer USA, Inc., Boston, MA (United States)

    2016-12-22

    The core objectives of the Plug & Play PV Systems Project were to develop a PV system that can be installed on a residential rooftop for less than $1.50/W in 2020, and in less than 10 hours (from point of purchase to commissioning). The Fraunhofer CSE team’s approach to this challenge involved a holistic approach to system design – hardware and software – that make Plug & Play PV systems: • Quick, easy, and safe to install • Easy to demonstrate as code compliant • Permitted, inspected, and interconnected via an electronic process Throughout the three years of work during this Department of Energy SunShot funded project, the team engaged in a substantive way with inspectional services departments and utilities, manufacturers, installers, and distributors. We received iterative feedback on the system design and on ideas for how such systems can be commercialized. This ultimately led us to conceiving of Plug & Play PV Systems as a framework, with a variety of components compatible with the Plug & Play PV approach, including string or microinverters, conventional modules or emerging lightweight modules. The framework enables a broad group of manufacturers to participate in taking Plug & Play PV Systems to market, and increases the market size for such systems. Key aspects of the development effort centered on the system hardware and associated engineering work, the development of a Plug & Play PV Server to enable the electronic permitting, inspection and interconnection process, understanding the details of code compliance and, on occasion, supporting applications for modifications to the code to allow lightweight modules, for example. We have published a number of papers on our testing and assessment of novel technologies (e.g., adhered lightweight modules) and on the electronic architecture.

  10. A new Brazilian Passiflora leafminer: Spinivalva gaucha, gen. n., sp. n. (Lepidoptera, Gracillariidae, Gracillariinae), the first gracillariid without a sap-feeding instar.

    Science.gov (United States)

    Brito, Rosângela; Gonçalves, Gislene L; Vargas, Hector A; Moreira, Gilson R P

    2013-01-01

    Male, female, pupa, larva and egg of a new genus and species of Gracillariidae (Gracillariinae), Spinivalva gaucha Moreira and Vargas from southern Brazil are described and illustrated with the aid of optical and scanning electron microscopy. A preliminary analysis of mitochondrial DNA sequences including members of related lineages is also provided. The immature stages are associated with Passiflora actinia, Passiflora misera and Passiflora suberosa (Passifloraceae), and build mines on the adaxial leaf surface. Initially the mines are serpentine in shape, but later in larval ontogeny become a blotch type. Although the larvae are hypermetamorphic as in other Gracillariidae, there is no sap-feeding instar in Spinivalva gaucha; the larva feeds on the palisade parenchyma, thus producing granular frass during all instars. Pupation occurs outside the mine; prior to pupating, the larva excretes numerous bubbles that are placed in rows on the lateral margins of the cocoon external surface. This is the second genus of gracillariid moth described for the Atlantic Rain Forest, and the second gracillariid species known to be associated with Passifloraceae.

  11. Erratum to: Morphometric analysis of Passiflora leaves: the relationship between landmarks of the vasculature and elliptical Fourier descriptors of the blade.

    Science.gov (United States)

    Chitwood, Daniel H; Otoni, Wagner C

    2017-10-01

    Leaf shape among Passiflora species is spectacularly diverse. Underlying this diversity in leaf shape are profound changes in the patterning of the primary vasculature and laminar outgrowth. Each of these aspects of leaf morphology-vasculature and blade-provides different insights into leaf patterning. Here, we morphometrically analyze >3300 leaves from 40 different Passiflora species collected sequentially across the vine. Each leaf is measured in two different ways: using 1) 15 homologous Procrustes-adjusted landmarks of the vasculature, sinuses, and lobes; and 2) Elliptical Fourier Descriptors (EFDs), which quantify the outline of the leaf. The ability of landmarks, EFDs, and both datasets together are compared to determine their relative ability to predict species and node position within the vine. Pairwise correlation of x and y landmark coordinates and EFD harmonic coefficients reveals close associations between traits and insights into the relationship between vasculature and blade patterning. Landmarks, more reflective of the vasculature, and EFDs, more reflective of the blade contour, describe both similar and distinct features of leaf morphology. Landmarks and EFDs vary in ability to predict species identity and node position in the vine and exhibit a correlational structure (both within landmark or EFD traits and between the two data types) revealing constraints between vascular and blade patterning underlying natural variation in leaf morphology among Passiflora species. © The Authors 2017. Published by Oxford University Press.

  12. PV-BUK: Operating and maintenance costs of photovoltaic installations; PV-BUK - Betriebs- und Unterhaltskosten von PV-Anlagen - Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Stettler, S.; Toggweiler, P. [Enecolo AG, Moenchaltorf (Switzerland); Ruoss, D.; Schudel, P. [Envision, Lucerne (Switzerland); Kottmann, A.; Steinle, F. [BE Netz AG, Lucerne (Switzerland)

    2008-03-15

    This final report elaborated for the Swiss Federal Office of Energy (SFOE) takes a look at the results of a project carried out to determine the costs for facility management, to estimate future cost development and to propose activities for the further reduction of the operation and maintenance costs of photovoltaic systems. Information on the cost situation was collected by literature study, as well as in interviews and surveys with photovoltaic (PV) experts and the owners of PV installations. The discussion of the results at a workshop with about 20 Swiss PV experts is noted. The results are presented and discussed. These show that operating costs per kWh decrease with the size of the PV system. Figures are quoted. The major part of the costs are quoted as being those for spare parts, especially for the inverter. The authors are of the opinion that, in future, costs for facility management will further decrease, as they are partly linked to capital and insurance costs. Potential for optimisation is said to exist in several areas of facility management such as, for example, in system monitoring and fast reaction in the case of malfunctions.

  13. Performance of a PV module augmented by a plane reflector

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, G. E; Hussein, H. M. S; Mohamad, M. A [Dokki, Giza (Egypt)

    2000-07-01

    This paper presents a comparative experimental study on the performance of a PV module augmented by a south facing titled plane reflector and another identical one without reflector. The tilt angles of the two PV modules and reflector overhang are selected to be according to a previous theoretical study by the authors. The reflector tilt angle has been changed once a month so that the reflected beams from the plane reflector cover the total surface area of the PV module all days of every month during the high solar radiation period (i.e. three hours before and after solar noon). The study has been carried out on the two PV modules for a complete year under the actual atmospheric conditions of Cairo, Egypt. The measuring system used in the study comprises a data acquisition system, a computer, an electronic load and weather station. The experimental results indicate that the plane reflector enhances the yearly output energy of the PV module y about 22%. [Spanish] Este articulo presenta un estudio comparativo experimental sobre el rendimiento de un modulo de PV aumentado por un reflector plano inclinado mirando hacia el sur y otro identico sin reflector. Los angulos de inclinacion de los dos modulos y el reflector sobresaliente se seleccionan para que esten de acuerdo con un estudio teorico previo hecho por los autores. El angulo de inclinacion del reflector se cambio una vez al mes de manera que los rayos reflejados por el reflector plano cubrieran el area total de la superficie del modulo de PV todos los dias de cada mes durante el periodo de radiacion alto (o sea tres horas antes y despues del medio dia solar). El estudio ha sido llevado a cabo en dos modulos de PV durante un ano completo bajo condiciones atmosfericas reales de El Cairo, Egipto. El sistema de medicion usado en el estudio comprende un sistema de adquisicion de datos, una computadora, una memoria electronica y una estacion climatologica. Los resultados experimentales indican que el reflector plano

  14. Lifetime Evaluation of PV Inverters considering Panel Degradation Rates and Installation Sites

    DEFF Research Database (Denmark)

    Sangwongwanich, Ariya; Yang, Yongheng; Sera, Dezso

    2017-01-01

    The PV inverter lifetime is affected by the installed sites related to different solar irradiance and ambient temperature profiles. In fact, the installation site also affects the PV panel degradation rate, and thus the long-term power production. Prior-art lifetime analysis in PV inverters has...... not yet investigated the impact of panel degradation. This paper thus evaluates the lifetime of PV inverters considering panel degradation rates and installation sites. Evaluations have been carried out on PV systems installed in Denmark and Arizona. The results reveal that the PV panel degradation rate...... has a considerable impact on the PV inverter lifetime, especially in the hot climate (e.g., Arizona), where the panel degrades at a faster rate. In that case, the PV inverter lifetime estimation can be deviated by 54%, if the impact of PV panel degradation is not taken into account....

  15. Methods for the Optimal Design of Grid-Connected PV Inverters

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2011-01-01

    and the efficient processing of this power by the DC/AC inverter. In this paper two new methods are presented for the optimal design of a PV inverter power section, output filter and MPPT control strategy. The influences of the electric grid regulations and standards as well as the PV array operational......The DC/AC inverters are used in grid-connected PV energy production systems as the power processing interface between the PV energy source and the electric grid. The energy injected into the electric grid by the PV installation depends on the amount of power extracted from the PV power source...... characteristics on the design of grid-connected PV inverters have been considered. The proposed methods have been applied for the optimal design of PV inverters installed at various sites in Europe. The simulation results verify that the proposed optimization techniques enable the maximization of the PV energy...

  16. Intoxicação experimental por Passiflora foetida (Passifloraceae em caprinos

    Directory of Open Access Journals (Sweden)

    Fabrício K. de L. Carvalho

    2011-06-01

    Full Text Available Passiflora foetida é mencionada por produtores da região Nordeste como causa de intoxicação espontânea em animais. Este trabalho teve por objetivos avaliar a toxicidade de P. foetida em caprinos e determinar seu princípio ativo e a época do ano em que a mesma é tóxica. Inicialmente a planta administrada em duas doses diárias de 40g por kg de peso animal (g/kg coletada dois dias antes da administração não resultou tóxica. Posteriormente a planta administrada imediatamente após a coleta resultou tóxica nas doses que variaram de 4 a 8 g/kg, em quatro caprinos. O animal que recebeu 8g/kg apresentou sinais clínicos graves e recuperou-se após a administração de tiossulfato de sódio. Os demais caprinos apresentaram sinais menos graves e se recuperaram espontaneamente. Posteriormente, a planta foi administrada em diferentes épocas a 23 caprinos na dose de 10g/kg. A planta foi significativamente mais tóxica (P<0,05 na época seca; no total, dos 14 caprinos que receberam a planta na época seca, 11 apresentaram sinais clínicos de intoxicação e dos 13 caprinos que receberam a planta na época das chuvas, apenas 3 apresentaram sinais clínicos. Todos os animais que apresentaram sinais clínicos, se recuperaram após a administração de tiosulfato de sódio. Os sinais clínicos caracterizavam-se por apatia, pulso venoso positi-vo, ataxia, berros, taquicardia e taquipneia, midríase e decúbito esternal seguido por decúbito lateral. Antes de cada administração era feito o teste do papel picrosódico para estimar o teor de cianeto na planta, classificando a reação em discreta, leve, moderada e acentuada. As amostras com reação discreta não apresentaram toxicidade, as com reação leve induziram sinais leves e as com reação moderada causaram sinais graves ou moderados de intoxicação. Não foram observados testes com reação acentuada. Os resultados do trabalho demonstram que P. foetida é uma planta cianogênica que causa

  17. Solar Plus: A Holistic Approach to Distributed Solar PV

    Energy Technology Data Exchange (ETDEWEB)

    O' Shaughnessy, Eric [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ardani, Kristen [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cutler, Dylan [National Renewable Energy Lab. (NREL), Golden, CO (United States); Margolis, Robert [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2017-05-25

    Solar 'plus' refers to an emerging approach to distributed solar photovoltaic (PV) deployment that uses energy storage and controllable devices to optimize customer economics. The solar plus approach increases customer system value through technologies such as electric batteries, smart domestic water heaters, smart air-conditioner (AC) units, and electric vehicles We use an NREL optimization model to explore the customer-side economics of solar plus under various utility rate structures and net metering rates. We explore optimal solar plus applications in five case studies with different net metering rates and rate structures. The model deploys different configurations of PV, batteries, smart domestic water heaters, and smart AC units in response to different rate structures and customer load profiles. The results indicate that solar plus improves the customer economics of PV and may mitigate some of the negative impacts of evolving rate structures on PV economics. Solar plus may become an increasingly viable model for optimizing PV customer economics in an evolving rate environment.

  18. Thermal modelling of PV module performance under high ambient temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C.; Harrison, S.J. [Queen' s Univ., Kingston, ON (Canada). Dept. of Mechanical and Materials Engineering Solar Calorimetry Lab; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering

    2005-07-01

    When predicting the performance of photovoltaic (PV) generators, the actual performance is typically lower than test results conducted under standard test conditions because the radiant energy absorbed in the module under normal operation raises the temperature of the cell and other multilayer components. The increase in temperature translates to a lower conversion efficiency of the solar cells. In order to address these discrepancies, a thermal model of a characteristic PV module was developed to assess and predict its performance under real field-conditions. The PV module consisted of monocrystalline silicon cells in EVA between a glass cover and a tedlar backing sheet. The EES program was used to compute the equilibrium temperature profile in the PV module. It was shown that heat is dissipated towards the bottom and the top of the module, and that its temperature can be much higher than the ambient temperature. Modelling results indicate that 70-75 per cent of the absorbed solar radiation is dissipated from the solar cells as heat, while 4.7 per cent of the solar energy is absorbed in the glass cover and the EVA. It was also shown that the operating temperature of the PV module decreases with increased wind speed. 2 refs.

  19. Modelling of flow and heat transfer in PV cooling channels

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C.; Harrison, S.J. [Queen' s Univ., Kingston, ON (Canada). Dept. of Mechanical and Materials Engineering Solar Calorimetry Lab; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering

    2005-07-01

    Under sunny conditions, the temperature of photovoltaic (PV) modules can be 20 to 30 degrees C above the ambient air temperature. This affects the performance of PV modules, particularly in regions with hot climates. For silicon solar cells, the maximum power decreases between 0.4 and 0.5 per cent for every degree C of temperature increase above a reference value. In an effort to address this issue, this experimental and numerical study examined an active PV panel evaporative cooling scheme that is typically used in hot arid climates. The cooling system circulated cool air behind the PV modules, extracting heat and lowering solar cell temperature. A fluid dynamic and thermal model of the combined system was developed using the EES program in order to study the configuration of the cooling channel and the characteristics of the cooling flow. Heat transfer and flow characteristics in the cooling channel were then calculated along with pressure drop and fan power associated with the air-circulation. The net power output was also calculated. The objective was to design a cost efficient cooling system and to optimize its flow and pressure drop in order to maximize power output. The study demonstrated how the performance of the PV panel is influenced by the geometry of the cooling channel, the inlet air temperature and the air flow rate. 2 refs.

  20. Modelling PV modules' performance in Sahelian climates

    Energy Technology Data Exchange (ETDEWEB)

    Diarra, D.C.; Akuffo, F.O. [Kwame Nkrumah Univ. of Science and Technology, Kumasi (Ghana). Dept. of Mechanical Engineering

    2003-08-01

    This paper describes the development of a thermo-optical model designed to evaluate the temperature of a photovoltaic (PV) module in an effort to design a cost-effective cooling system for PV modules operating under high ambient temperatures. The power output of a PV module is greatly reduced when its temperature rises. This loss in efficiency is particularly significant in Sahelian regions where PV modules are subjected to high solar radiation intensities and high ambient temperatures. The newly developed thermo-optical model confirms that most of the heat in a PV module is generated in the solar cell. The results of the analysis include: the optical absorption, reflection and transmission of the solar radiation incident on the module; the temperature distribution in the module; and, the heat transfer through the top and bottom of the module. At incidence angles of 60 degrees, approximately three-quarters of the heat is generated in the solar cell. The optical efficiency is 88.44 per cent at normal incidence angle and 82.48 per cent when the incidence angle is 60 degrees. It was determined that the cooling system should be located as close as possible to the solar cell in order to increase the thermal heat flow from the cell. 4 refs., 3 tabs., 4 figs.

  1. Solar cell junction temperature measurement of PV module

    KAUST Repository

    Huang, B.J.

    2011-02-01

    The present study develops a simple non-destructive method to measure the solar cell junction temperature of PV module. The PV module was put in the environmental chamber with precise temperature control to keep the solar PV module as well as the cell junction in thermal equilibrium with the chamber. The open-circuit voltage of PV module Voc is then measured using a short pulse of solar irradiation provided by a solar simulator. Repeating the measurements at different environment temperature (40-80°C) and solar irradiation S (200-1000W/m2), the correlation between the open-circuit voltage Voc, the junction temperature Tj, and solar irradiation S is derived.The fundamental correlation of the PV module is utilized for on-site monitoring of solar cell junction temperature using the measured Voc and S at a short time instant with open circuit. The junction temperature Tj is then determined using the measured S and Voc through the fundamental correlation. The outdoor test results show that the junction temperature measured using the present method, Tjo, is more accurate. The maximum error using the average surface temperature Tave as the junction temperature is 4.8 °C underestimation; while the maximum error using the present method is 1.3 °C underestimation. © 2010 Elsevier Ltd.

  2. Solar Plus: A Holistic Approach to Distributed Solar PV

    Energy Technology Data Exchange (ETDEWEB)

    OShaughnessy, Eric J. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Ardani, Kristen B. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Cutler, Dylan S. [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M. [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-06-08

    Solar 'plus' refers to an emerging approach to distributed solar photovoltaic (PV) deployment that uses energy storage and controllable devices to optimize customer economics. The solar plus approach increases customer system value through technologies such as electric batteries, smart domestic water heaters, smart air-conditioner (AC) units, and electric vehicles We use an NREL optimization model to explore the customer-side economics of solar plus under various utility rate structures and net metering rates. We explore optimal solar plus applications in five case studies with different net metering rates and rate structures. The model deploys different configurations of PV, batteries, smart domestic water heaters, and smart AC units in response to different rate structures and customer load profiles. The results indicate that solar plus improves the customer economics of PV and may mitigate some of the negative impacts of evolving rate structures on PV economics. Solar plus may become an increasingly viable model for optimizing PV customer economics in an evolving rate environment.

  3. PV Reconfiguration Systems: a Technical and Economic Study

    Directory of Open Access Journals (Sweden)

    Caruso M.

    2017-03-01

    Full Text Available Dynamical electrical array reconfiguration strategies for grid-connected PV systems have been proposed as solution to improve energy production due to the mismatch effect of PV plants during partial shading conditions. Strategies are based on the use of dynamic connections between PV panels given by the employment of switches that allow for each panel the series, parallel or exclusion connections, physically changing the electrical connections between the related PV modules, consequentially modifying the layout of the plant. Usually the cost of the dynamic matrix is not taken into account. This novel work evaluates the economic advantages obtained by the use of reconfiguration strategies in PV systems, by taking into consideration the price of energy due to incentives in different European and non-European countries and correlates it with the employment of two types of reconfigurators, with different internal structures. For each of the incentives proposed by the different Countries, the main strength and weakness points of the possible investment are highlighted and critically analyzed. From this analysis, it can be stated that the adoption of reconfiguration systems, in certain cases, can be a very convenient solution.

  4. Design of direct solar PV driven air conditioner

    KAUST Repository

    Huang, Bin-Juine

    2015-12-05

    © 2015 Elsevier Ltd. Solar air conditioning system directly driven by stand-alone solar PV is studied. The air conditioning system will suffer from loss of power if the solar PV power generation is not high enough. It requires a proper system design to match the power consumption of air conditioning system with a proper PV size. Six solar air conditioners with different sizes of PV panel and air conditioners were built and tested outdoors to experimentally investigate the running probabilities of air conditioning at various solar irradiations. It is shown that the instantaneous operation probability (OPB) and the runtime fraction (RF) of the air conditioner are mainly affected by the design parameter rpL (ratio of maximum PV power to load power). The measured OPB is found to be greater than 0.98 at instantaneous solar irradiation IT > 600 W m-2 if rpL > 1.71 RF approaches 1.0 (the air conditioner is run in 100% with solar power) at daily-total solar radiation higher than 13 MJ m-2 day-1, if rpL > 3.

  5. Thermal performances of vertical hybrid PV/T air collector

    Science.gov (United States)

    Tabet, I.; Touafek, K.; Bellel, N.; Khelifa, A.

    2016-11-01

    In this work, numerical analyses and the experimental validation of the thermal behavior of a vertical photovoltaic thermal air collector are investigated. The thermal model is developed using the energy balance equations of the PV/T air collector. Experimental tests are conducted to validate our mathematical model. The tests are performed in the southern Algerian region (Ghardaïa) under clear sky conditions. The prototype of the PV/T air collector is vertically erected and south oriented. The absorber upper plate temperature, glass cover temperature, air temperature in the inlet and outlet of the collector, ambient temperature, wind speed, and solar radiation are measured. The efficiency of the collector increases with increase in mass flow of air, but the increase in mass flow of air reduces the temperature of the system. The increase in efficiency of the PV/T air collector is due to the increase in the number of fins added. In the experiments, the air temperature difference between the inlet and the outlet of the PV/T air collector reaches 10 ° C on November 21, 2014, the interval time is between 10:00 and 14:00, and the temperature of the upper plate reaches 45 ° C at noon. The mathematical model describing the dynamic behavior of the typical PV/T air collector is evaluated by calculating the root mean square error and mean absolute percentage error. A good agreement between the experiment and the simulation results is obtained.

  6. Planar holographic spectrum-splitting PV module design

    Science.gov (United States)

    Gordon, Michael; Zhang, Deming; Vorndran, Shelby; Russo, Juan M.; Luscombe, Christine K.; Shaheen, Sean E.; Kostuk, Raymond K.

    2012-10-01

    A design is presented for a planar spectrum-splitting photovoltaic (PV) module using Holographic Optical Elements (HOEs). A repeating array of HOEs diffracts portions of the solar spectrum onto different PV materials arranged in alternating strips. Several combinations of candidate PV materials are explored, and theoretical power conversion efficiency is quantified and compared for each case. The holograms are recorded in dichromated gelatin (DCG) film, an inexpensive material which is easily encapsulated directly into the panel. If desired, the holograms can focus the light to achieve concentration. The side-by-side split spectrum layout has advantages compared to a stacked tandem cell approach: since the cells are electrically isolated, current matching constraints are eliminated. Combinations of dissimilar types of cells are also possible: including crystalline, thin film, and organic PV cells. Configurations which yield significant efficiency gain using relatively inexpensive PV materials are of particular interest. A method used to optimize HOE design to work with a different candidate cells and different package aspect ratios is developed and presented. (Aspect ratio is width of the cell strips vs. the thickness of the panel) The relationship between aspect ratio and HOE performance properties is demonstrated. These properties include diffraction efficiency, spectral selectivity, tracking alignment sensitivity, and uniformity of cell illumination.

  7. Evaluación de la toxicidad del extracto metanólico de hojas de Passiflora edulis Sims (maracuyá, en ratas

    Directory of Open Access Journals (Sweden)

    Juan Rojas

    2009-09-01

    Full Text Available Objetivo: Determinar la toxicidad oral a dosis repetidas del extracto metanólico de las hojas de Passiflora edulis en ratas. Diseño: Estudio experimental. Institución: Instituto de Investigaciones Clínicas e Instituto de Patología, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Ratas albinas, adultas hembras y machos, y hojas de Passiflora edulis. Métodos: Las hojas Passiflora edulis recolectadas en Trujillo fueron desecadas a 38ºC, pulverizadas y macerado con metanol. Se filtró, concentró y liofilizó. Se conformó dos grupos experimentales de 10 ratas (5 de cada sexo. Un grupo fue control, al cual se le administró agua destilada, y el otro fue grupo tratado, al cual se le administró extracto metanólico de las hojas de Passiflora edulis, en dosis de 200 mg/kg, una vez/día, vía oral, durante 28 días. Se hizo diariamente observaciones clínicas a los animales, se controló el peso cada semana. Al final del experimento se realizó las determinaciones hematológicas y de bioquímica clínica y necropsia. Se extrajo los órganos para la determinación de su peso y estudio histopatológico. Principales medidas de resultados: Peso corporal, e indicadores hematológicos, bioquímicos e histopatológicos. Resultados: No se observó mortalidad ni alteraciones clínicas o hematológicas. La alanina aminotransferasa se incrementó muy ligeramente hasta 55,4 ± 4,9 U/L, en machos (VN = 35,1-53,5, y 53,8 ± 3,9 U/L (VN = 28,8-46,0, en hembras. En el estudio histopatológico se observó en un caso microvesículas focal de hepatocitos y dos casos de focos de necrosis tubular. Conclusiones: La administración oral a dosis repetidas durante 28 días del extracto metanólico de las hojas de Passiflora edulis en ratas no es tóxica.

  8. Photovoltaic Module Simulink Model for a Stand-alone PV System

    Science.gov (United States)

    Qi, Chen; Ming, Zhu

    Photovoltaic(PV) Module is indispensable of a stand-alone PV system. In this paper, a one-diode equivalent circuit-based versatile simulation model in the form of masked block PV module is proposed. By the model, it is allowed to estimate behavior of PV module with respect changes on irradiance intensity, ambient temperature and parameters of the PV module. In addition, the model is capable of function of Maximum Power Point Tracking (MPPT) which can be used in the dynamic simulation of stand-alone PV systems.

  9. Design optimization of transformerless grid-connected PV inverters including reliability

    DEFF Research Database (Denmark)

    Koutroulis, Eftichios; Blaabjerg, Frede

    2012-01-01

    This paper presents a new methodology for optimal design of transformerless Photovoltaic (PV) inverters targeting a cost-effective deployment of grid-connected PV systems. The optimal values and types of the PV inverter components are calculated such that the PV inverter Levelized Cost...... to the non-optimized PV inverter structures, the PV inverters designed using the proposed optimization methodology exhibit lower total manufacturing and lifetime maintenance cost and inject more energy into the electric-grid and by that minimizing LCOE....

  10. Generation of large-scale PV scenarios using aggregated power curves

    DEFF Research Database (Denmark)

    Nuño Martinez, Edgar; Cutululis, Nicolaos Antonio

    2017-01-01

    The contribution of solar photovoltaic (PV) power to the generation is becoming more relevant in modern power system. Therefore, there is a need to model the variability large-scale PV generation accurately. This paper presents a novel methodology to generate regional PV scenarios based on aggreg......The contribution of solar photovoltaic (PV) power to the generation is becoming more relevant in modern power system. Therefore, there is a need to model the variability large-scale PV generation accurately. This paper presents a novel methodology to generate regional PV scenarios based...

  11. PV as a core element of utility business plans

    International Nuclear Information System (INIS)

    Osborn, Don

    2000-01-01

    The author expounds the advantages and rationale for utility PV (photovoltaics) business strategies and discusses various initiatives being taken by some companies in the US. It is claimed that in perhaps 5-12 years the photovoltaics price will be competing with retail electricity and customer-owned utilities should be in a position to offer photovoltaics as an option rather than concede that business to someone else. Five specific reasons for investing in PVs are given and the message is that if you are not involved then get involved. The author describes his own company's commitments to PV and suggests that regulators and legislators should appreciate the long term interests of the ratepayer in that investment now in higher cost PV technology will lead to greater cost reductions in the future

  12. Comparative analysis of old, recycled and new PV modules

    Directory of Open Access Journals (Sweden)

    Haroon Ashfaq

    2017-01-01

    Full Text Available This paper presents comparative analysis of old, recycled and new PV modules. It is possible to recycle even very old products by modern standard processes in a value-conserving manner. About 90% of the materials recovered from solar panels can be recycled into useful products. Carbon emission and energy cost are low in manufacturing recycled SPV. Modules can be manufactured with recycled materials and reinstalled in systems as a full quality product with today’s technology good for another 25–30 years. Analysis of all the models of PV module is done with the help of MATLAB. This helps in comparison and proves the effectiveness of the recycled PV module based systems.

  13. Budgeting for Solar PV Plant Operations & Maintenance: Practices and Pricing.

    Energy Technology Data Exchange (ETDEWEB)

    Enbar, Nadav [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Weng, Dean [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2016-01-01

    With rising grid interconnections of solar photovoltaic (PV) systems, greater attention is being trained on lifecycle performance, reliability, and project economics. Expected to meet production thresholds over a 20-30 year timeframe, PV plants require a steady diet of operations and maintenance (O&M) oversight to meet contractual terms. However, industry best practices are only just beginning to emerge, and O&M budgets—given the arrangement of the solar project value chain—appear to vary widely. Based on insights from in-depth interviews and survey research, this paper presents an overview of the utility-scale PV O&M budgeting process along with guiding rationales, before detailing perspectives on current plant upkeep activities and price points largely in the U.S. It concludes by pondering potential opportunities for improving upon existing O&M budgeting approaches in ways that can benefit the industry at-large.

  14. Budgeting for Solar PV Plant Operations & Maintenance: Practices and Pricing.

    Energy Technology Data Exchange (ETDEWEB)

    Enbar, Nadav [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Weng, Dean [Electric Power Research Inst. (EPRI), Palo Alto, CA (United States); Klise, Geoffrey Taylor [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-12-01

    With rising grid interconnections of solar photovoltaic (PV) systems, greater attention is being trained on lifecycle performance, reliability, and project economics. Expected to meet production thresholds over a 20-30 year timeframe, PV plants require a steady diet of operations and maintenance (O&M) oversight to meet contractual terms. However, industry best practices are only just beginning to emerge, and O&M budgets—given the arrangement of the solar project value chain—appear to vary widely. Based on insights from in-depth interviews and survey research, this paper presents an overview of the utility-scale PV O&M budgeting process along with guiding rationales, before detailing perspectives on current plant upkeep activities and price points largely in the U.S. It concludes by pondering potential opportunities for improving upon existing O&M budgeting approaches in ways that can benefi t the industry at-large.

  15. National Survey Report of PV Power Applications in France 2014

    International Nuclear Information System (INIS)

    Kaaijk, Paul; Durand, Yvonnick

    2015-06-01

    The objective of Task 1 of the IEA Photovoltaic Power Systems Program is to promote and facilitate the exchange and dissemination of information on the technical, economic, environmental and social aspects of PV power systems. Task 1 activities support the broader PVPS objectives: to contribute to cost reduction of PV power applications, to increase awareness of the potential and value of PV power systems, to foster the removal of both technical and non-technical barriers and to enhance technology co-operation. An important deliverable of Task 1 is the annual Trends in photovoltaic applications report. In parallel, National Survey Reports are produced annually by each Task 1 participant. The PVPS web site www.iea-pvps.org also plays an important role in disseminating information arising from the program, including national information. This document is the French National Survey Report on photovoltaics for the year 2014

  16. Lessons Learned from the Photovoltaic Manufacturing Technology/PV Manufacturing R&D and Thin Film PV Partnership Projects

    Energy Technology Data Exchange (ETDEWEB)

    Margolis, R.; Mitchell, R.; Zweibel, K.

    2006-09-01

    As the U.S. Department of Energy's (DOE's) Solar Energy Technologies Program initiates new cost-shared solar energy R&D under the Solar America Initiative (SAI), it is useful to analyze the experience gained from cost-shared R&D projects that have been funded through the program to date. This report summarizes lessons learned from two DOE-sponsored photovoltaic (PV) projects: the Photovoltaic Manufacturing Technology/PV Manufacturing R&D (PVMaT/PVMR&D) project and the Thin-Film PV Partnership project. During the past 10-15 years, these two projects have invested roughly $330 million of government resources in cost-shared R&D and leveraged another $190 million in private-sector PV R&D investments. Following a description of key findings and brief descriptions of the PVMaT/PVMR&D and Thin-Film PV Partnership projects, this report presents lessons learned from the projects.

  17. Time series power flow analysis for distribution connected PV generation.

    Energy Technology Data Exchange (ETDEWEB)

    Broderick, Robert Joseph; Quiroz, Jimmy Edward; Ellis, Abraham; Reno, Matthew J.; Smith, Jeff; Dugan, Roger

    2013-01-01

    Distributed photovoltaic (PV) projects must go through an interconnection study process before connecting to the distribution grid. These studies are intended to identify the likely impacts and mitigation alternatives. In the majority of the cases, system impacts can be ruled out or mitigation can be identified without an involved study, through a screening process or a simple supplemental review study. For some proposed projects, expensive and time-consuming interconnection studies are required. The challenges to performing the studies are twofold. First, every study scenario is potentially unique, as the studies are often highly specific to the amount of PV generation capacity that varies greatly from feeder to feeder and is often unevenly distributed along the same feeder. This can cause location-specific impacts and mitigations. The second challenge is the inherent variability in PV power output which can interact with feeder operation in complex ways, by affecting the operation of voltage regulation and protection devices. The typical simulation tools and methods in use today for distribution system planning are often not adequate to accurately assess these potential impacts. This report demonstrates how quasi-static time series (QSTS) simulation and high time-resolution data can be used to assess the potential impacts in a more comprehensive manner. The QSTS simulations are applied to a set of sample feeders with high PV deployment to illustrate the usefulness of the approach. The report describes methods that can help determine how PV affects distribution system operations. The simulation results are focused on enhancing the understanding of the underlying technical issues. The examples also highlight the steps needed to perform QSTS simulation and describe the data needed to drive the simulations. The goal of this report is to make the methodology of time series power flow analysis readily accessible to utilities and others responsible for evaluating

  18. Sustainable recycling technologies for Solar PV off-grid system

    Directory of Open Access Journals (Sweden)

    Uppal Bhavesh

    2017-01-01

    Full Text Available Policy makers throughout the world have accepted climate change as a repercussion of fossil fuel exploitation. This has led the governments to integrate renewable energy streams in their national energy mix. PV off-grid Systems have been at the forefront of this transition because of their permanently increasing efficiency and cost effectiveness. These systems are expected to produce large amount of different waste streams at the end of their lifetime. It is important that these waste streams should be recycled because of the lack of available resources. Our study found that separate researches have been carried out to increase the efficiencies of recycling of individual PV system components but there is a lack of a comprehensive methodical research which details efficient and sustainable recycling processes for the entire PV off-grid system. This paper reviews the current and future recycling technologies for PV off-grid systems and presents a scheme of the most sustainable recycling technologies which have the potential for adoption. Full Recovery End-of-Life Photovoltaic (FRELP recycling technology can offer opportunities to sustainably recycle crystalline silicon PV modules. Electro-hydrometallurgical process & Vacuum technologies can be used for recovering lead from lead acid batteries with a high recovery rate. The metals in the WEEE can be recycled by using a combination of biometallurgical technology, vacuum metallurgical technology and other advanced metallurgical technologies (utrasonical, mechano-chemical technology while the plastic components can be effectively recycled without separation by using compatibilizers. All these advanced technologies when used in combination with each other provide sustainable recycling options for growing PV off-grid systems waste. These promising technologies still need further improvement and require proper integration techniques before implementation.

  19. Sustainable recycling technologies for Solar PV off-grid system

    Science.gov (United States)

    Uppal, Bhavesh; Tamboli, Adish; Wubhayavedantapuram, Nandan

    2017-11-01

    Policy makers throughout the world have accepted climate change as a repercussion of fossil fuel exploitation. This has led the governments to integrate renewable energy streams in their national energy mix. PV off-grid Systems have been at the forefront of this transition because of their permanently increasing efficiency and cost effectiveness. These systems are expected to produce large amount of different waste streams at the end of their lifetime. It is important that these waste streams should be recycled because of the lack of available resources. Our study found that separate researches have been carried out to increase the efficiencies of recycling of individual PV system components but there is a lack of a comprehensive methodical research which details efficient and sustainable recycling processes for the entire PV off-grid system. This paper reviews the current and future recycling technologies for PV off-grid systems and presents a scheme of the most sustainable recycling technologies which have the potential for adoption. Full Recovery End-of-Life Photovoltaic (FRELP) recycling technology can offer opportunities to sustainably recycle crystalline silicon PV modules. Electro-hydrometallurgical process & Vacuum technologies can be used for recovering lead from lead acid batteries with a high recovery rate. The metals in the WEEE can be recycled by using a combination of biometallurgical technology, vacuum metallurgical technology and other advanced metallurgical technologies (utrasonical, mechano-chemical technology) while the plastic components can be effectively recycled without separation by using compatibilizers. All these advanced technologies when used in combination with each other provide sustainable recycling options for growing PV off-grid systems waste. These promising technologies still need further improvement and require proper integration techniques before implementation.

  20. Industrial application of PV/T solar energy systems

    International Nuclear Information System (INIS)

    Kalogirou, S.A.; Tripanagnostopoulos, Y.

    2007-01-01

    Hybrid photovoltaic/thermal (PV/T) systems consist of PV modules and heat extraction units mounted together. These systems can simultaneously provide electrical and thermal energy, thus achieving a higher energy conversion rate of the absorbed solar radiation than plain photovoltaics. Industries show high demand of energy for both heat and electricity and the hybrid PV/T systems could be used in order to meet this requirement. In this paper the application aspects in the industry of PV/T systems with water heat extraction is presented. The systems are analyzed with TRNSYS program for three locations Nicosia, Athens and Madison that are located at different latitudes. The system comprises 300 m 2 of hybrid PV/T collectors producing both electricity and thermal energy and a 10 m 3 water storage tank. The work includes the study of an industrial process heat system operated at two load supply temperatures of 60 deg. C and 80 deg. C. The results show that the electrical production of the system, employing polycrystalline solar cells, is more than the amorphous ones but the solar thermal contribution is slightly lower. A non-hybrid PV system produces about 25% more electrical energy but the present system covers also, depending on the location, a large percentage of the thermal energy requirement of the industry considered. The economic viability of the systems is proven, as positive life cycle savings are obtained in the case of hybrid systems and the savings are increased for higher load temperature applications. Additionally, although amorphous silicon panels are much less efficient than the polycrystalline ones, better economic figures are obtained due to their lower initial cost, i.e., they have better cost/benefit ratio