360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

DEFF Research Database (Denmark)

Pu, Minhao; Xue, Weiqi; Liu, Liu

2010-01-01

We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...

The early years of string theory: The dual resonance model

International Nuclear Information System (INIS)

Ramond, P.

1987-10-01

This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story

Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

DEFF Research Database (Denmark)

Pu, Minhao; Liu, Liu; Xue, Weiqi

2010-01-01

We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator...

Dual temperature isotope exchange system

International Nuclear Information System (INIS)

Spevack, J.S.

1976-01-01

Improvements in the method for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. In a preferred embodiment the first is a vaporizable liquid and the auxiliary fluid a gas, comprising steps for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations

Experimental evidence for dual diffractive resonances in nucleon-nucleus scattering

International Nuclear Information System (INIS)

Ion, D.B.; Ion-Mihai, R.

1981-09-01

Experimental data on nucleon-nucleus scattering for laboratory momenta between 0.9:10 GeV/c are analysed in terms of the dual diffractive resonance (DDR) mechanism. The experimental data for all the nuclei are found to agree well with the predictions of the collective DDR states dominance. (authors)

Modelling and simulation of a thermally induced optical transparency in a dual micro-ring resonator.

Science.gov (United States)

Lydiate, Joseph

2017-07-01

This paper introduces the simulation and modelling of a novel dual micro-ring resonator. The geometric configuration of the resonators, and the implementation of a simulated broadband excitation source, results in the realization of optical transparencies in the combined through port output spectrum. The 130 nm silicon on insulator rib fabrication process is adopted for the simulation of the dual-ring configuration. Two titanium nitride heaters are positioned over the coupling regions of the resonators, which can be operated independently, to control the spectral position of the optical transparency. A third heater, centrally located above the dual resonator rings, can be used to red shift the entire spectrum to a required reference resonant wavelength. The free spectral range with no heater currents applied is 4.29 nm. For a simulated heater current of 7 mA (55.7 mW heater power) applied to one of the through coupling heaters, the optical transparency exhibits a red shift of 1.79 nm from the reference resonant wavelength. The ring-to-ring separation of approximately 900 nm means that it can be assumed that there is a zero ring-to-ring coupling field in this model. This novel arrangement has potential applications as a gas mass airflow sensor or a gas species identification sensor.

Dual and tri-band bandpass filters based on novel Π-shaped resonator

Science.gov (United States)

Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei

2014-05-01

A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.

Modelling and analysis of the transformer current resonance in dual active bridge converters

DEFF Research Database (Denmark)

Qin, Zian; Shen, Zhan; Blaabjerg, Frede

2017-01-01

Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency....... In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model...

Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

Energy Technology Data Exchange (ETDEWEB)

Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)

2017-12-15

Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

International Nuclear Information System (INIS)

Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian

2017-01-01

Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

Enhanced optical transmission through a star-shaped bull's eye at dual resonant-bands in UV and the visible spectral range.

Science.gov (United States)

Nazari, Tavakol; Khazaeinezhad, Reza; Jung, Woohyun; Joo, Boram; Kong, Byung-Joo; Oh, Kyunghwan

2015-07-13

Dual resonant bands in UV and the visible range were simultaneously observed in the enhanced optical transmission (EOT) through star-shaped plasmonic structures. EOTs through four types of polygonal bull's eyes with a star aperture surrounded by the concentric star grooves were analyzed and compared for 3, 4, 5, and 6 corners, using finite difference time domain (FDTD) method. In contrast to plasmonic resonances in the visible range, the UV-band resonance intensity was found to scale with the number of corners, which is related with higher order multipole interactions. Spectral positions and relative intensities of the dual resonances were analyzed parametrically to find optimal conditions to maximize EOT in UV-visible dual bands.

Electrostatic energy harvesting device with dual resonant structure for wideband random vibration sources at low frequency.

Science.gov (United States)

Zhang, Yulong; Wang, Tianyang; Zhang, Ai; Peng, Zhuoteng; Luo, Dan; Chen, Rui; Wang, Fei

2016-12-01

In this paper, we present design and test of a broadband electrostatic energy harvester with a dual resonant structure, which consists of two cantilever-mass subsystems each with a mass attached at the free edge of a cantilever. Comparing to traditional devices with single resonant frequency, the proposed device with dual resonant structure can resonate at two frequencies. Furthermore, when one of the cantilever-masses is oscillating at resonance, the vibration amplitude is large enough to make it collide with the other mass, which provides strong mechanical coupling between the two subsystems. Therefore, this device can harvest a decent power output from vibration sources at a broad frequency range. During the measurement, continuous power output up to 6.2-9.8 μW can be achieved under external vibration amplitude of 9.3 m/s 2 at a frequency range from 36.3 Hz to 48.3 Hz, which means the bandwidth of the device is about 30% of the central frequency. The broad bandwidth of the device provides a promising application for energy harvesting from the scenarios with random vibration sources. The experimental results indicate that with the dual resonant structure, the vibration-to-electricity energy conversion efficiency can be improved by 97% when an external random vibration with a low frequency filter is applied.

Self-dual spin-3 and 4 theories

International Nuclear Information System (INIS)

Aragone, C.; Khoudeir, A.

1991-08-01

We present self-dual pure spin-3 and 4 actions using the physical relevant Dreibein fields. Since these actions start with a Chern-Simons like kinetic term (and therefore cannot be obtained through dimensional reduction) one might wonder whether they need the presence of auxiliary, ghost-killing fields. It turns out that they must contain, also in this three dimensional case, auxiliary fields. Auxiliary scalars do not break self-duality; their free action does not contain kinetic terms. (author). 12 refs

Experimental results of high power dual frequency resonant magnet excitation at TRIUMF

International Nuclear Information System (INIS)

Reiniger, K.W.; Heritier, G.

1988-06-01

We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)

Theoretical approach for plasma series resonance effect in geometrically symmetric dual radio frequency plasma

International Nuclear Information System (INIS)

Bora, B.; Bhuyan, H.; Favre, M.; Wyndham, E.; Chuaqui, H.

2012-01-01

Plasma series resonance (PSR) effect is well known in geometrically asymmetric capacitively couple radio frequency plasma. However, plasma series resonance effect in geometrically symmetric plasma has not been properly investigated. In this work, a theoretical approach is made to investigate the plasma series resonance effect and its influence on Ohmic and stochastic heating in geometrically symmetric discharge. Electrical asymmetry effect by means of dual frequency voltage waveform is applied to excite the plasma series resonance. The results show considerable variation in heating with phase difference between the voltage waveforms, which may be applicable in controlling the plasma parameters in such plasma.

Apparatus for concentrating by dual temperature exchange

International Nuclear Information System (INIS)

Spevack, J.S.

1975-01-01

Improvements in an apparatus for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. The first fluid is a vaporizable liquid and the auxiliary fluid a gas, the apparatus having means for cascading the auxiliary fluid and the feed fluid in vapor and preferably also in liquid form. The apparatus also contains new combinations of means for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations of the system. The reactants in the example given are hydrogen sulfide gas and liquid water

Dual-band reflective polarization converter based on slotted wire resonators

Science.gov (United States)

Li, Fengxia; Zhang, Linbo; Zhou, Peiheng; Chen, Haiyan; Zhao, Rui; Zhou, Yang; Liang, Difei; Lu, Haipeng; Deng, Longjiang

2018-02-01

A dual-band and high-efficiency reflective linear polarization converter composed of a layer of slotted metal wires has been proposed. Both the simulated and experimental results indicate that the structure can convert a linearly polarized wave to its cross-polarized state for two distinct frequency bands under normal incidence: 9.8-15.1 and 19.2-25.7 GHz. This phenomenon is attributed to a resonance that corresponds to the "trapped mode" at 15.8 GHz. This mode is stable with structural parameters and incident angle at a relatively wide range, and thus becomes promising for dual-band (also multiband) devices design. By surface current distribution and electric field analysis, the operation mechanism has been illuminated, especially for the "trapped mode", identified by the equally but also oppositely directed currents in each unit cell.

Fluorescence and Magnetic Resonance Dual-Modality Imaging-Guided Photothermal and Photodynamic Dual-Therapy with Magnetic Porphyrin-Metal Organic Framework Nanocomposites

Science.gov (United States)

Zhang, Hui; Li, Yu-Hao; Chen, Yang; Wang, Man-Man; Wang, Xue-Sheng; Yin, Xue-Bo

2017-03-01

Phototherapy shows some unique advantages in clinical application, such as remote controllability, improved selectivity, and low bio-toxicity, than chemotherapy. In order to improve the safety and therapeutic efficacy, imaging-guided therapy seems particularly important because it integrates visible information to speculate the distribution and metabolism of the probe. Here we prepare biocompatible core-shell nanocomposites for dual-modality imaging-guided photothermal and photodynamic dual-therapy by the in situ growth of porphyrin-metal organic framework (PMOF) on Fe3O4@C core. Fe3O4@C core was used as T2-weighted magnetic resonance (MR) imaging and photothermal therapy (PTT) agent. The optical properties of porphyrin were well remained in PMOF, and PMOF was therefore selected for photodynamic therapy (PDT) and fluorescence imaging. Fluorescence and MR dual-modality imaging-guided PTT and PDT dual-therapy was confirmed with tumour-bearing mice as model. The high tumour accumulation of Fe3O4@C@PMOF and controllable light excitation at the tumour site achieved efficient cancer therapy, but low toxicity was observed to the normal tissues. The results demonstrated that Fe3O4@C@PMOF was a promising dual-imaging guided PTT and PDT dual-therapy platform for tumour diagnosis and treatment with low cytotoxicity and negligible in vivo toxicity.

A dual resonance model for high energy electroweak reactions

International Nuclear Information System (INIS)

Picard, Jean-Francois

1995-01-01

The aim of this work is to propose an original model for the weak interaction at high energy (about 1 TeV) that is inspired from resonance dual models established for hadron physics. The first chapter details the basis and assumptions of the standard model. The second chapter deals with various scenarios that go beyond the standard model and that involve a strong interaction and a perturbative approach to assess coupling. The third chapter is dedicated to the main teachings of hadron physics concerning resonances, the model of Regge poles and the concept of duality. We present our new model in the fourth chapter, we build a scenario in which standard fermions and the 3 massive gauge bosons would have a sub-structure alike that of hadrons. In order to give non-null values to the width of resonances we use the K matrix method, we describe this method in the last chapter and we apply it for the computation of the width of the Z 0 boson. Our model predicts a large spectra of states particularly with the 143-up-lets of ff-bar states. The K matrix method has allowed us to compute amplitudes for helicity, then to collapse them in amplitudes invariant with SU(2) and to project these amplitudes in partial waves of helicity. For most resonances partial widths are very low compared to their mass

Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.

Science.gov (United States)

Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun

2014-03-01

To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.

Dual temperature concentration system

International Nuclear Information System (INIS)

Spevack, J.S.

1975-01-01

In a dual temperature isotope exchange system--exemplified by exchange of deuterium and protium between water and hydrogen sulfide gas in hot and cold towers, in which the feed stream (water) containing the desired isotope is passed through a pair of towers maintained at different temperatures wherein it effects isotope exchange with countercurrently circulated auxiliary fluid (H 2 S) and is impoverished in said isotope and then disposed of, e.g. discharged to waste,--the flow of isotope enriched auxiliary fluid between said towers (hot H 2 S saturated with water vapor) is divided and a part thereof is adjusted in its temperature (to cold tower conditions) and then passed to the auxiliary fluid impoverishing (cold) tower, while the remainder of the divided flow of such enriched auxiliary fluid is passed through a subsequent isotope concentration treatment to produce a product more highly enriched in the desired isotope and wherein it is also adjusted in its temperature and is impoverished in said isotope during said subsequent treatment before it is delivered to the said auxiliary fluid impoverishing (cold) tower. Certain provisions are made for returning to the hot tower liquid carried as vapor by the remainder of the divided flow to the subsequent isotope concentration treatment, for recovering sensible and latent heat, and for reducing passage of auxiliary fluid to waste

Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams

Directory of Open Access Journals (Sweden)

Xiaohui Du

2016-01-01

Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.

Coupling technology for dual-purpose nuclear-desalting plants

International Nuclear Information System (INIS)

Jones, J.E. Jr.; Anderson, T.D.; Reed, S.A.

1976-11-01

Although the basic technology for the various components of nuclear dual-purpose plants is reasonably well developed, the techniques of coupling the elements together to form a reliable, economical system that will satisfy the diverse operating requirements are not well established. The purpose of the study reported is to examine the technical, economic, and safety considerations in coupling nuclear power plants with distillation units to form a dual-purpose power and water distillation plant. The basic coupling arrangement required to provide a large-scale dual-purpose water plant is to supply steam to the water plant from the exhaust of a back-pressure turbine. The principal component at the interface that may require major research and development is the back-pressure turbine. To satisfy the operational requirements, two major auxiliary systems will be needed. These are: (1) a prime-steam bypass system, and (2) auxiliary condensers. These systems will provide a degree of independence between water and power production and can be justified economically

Ultrasmall Dual-Band Metamaterial Antennas Based on Asymmetrical Hybrid Resonators

Directory of Open Access Journals (Sweden)

Ji-Xu Zhu

2016-01-01

Full Text Available A new type of hybrid resonant circuit model is investigated theoretically and experimentally. The resonant model consists of a right hand (RH patch part and a composite right and left handed (CRLH part (RH + CRLH, which determines a compact size and also a convenient frequency modulation characteristic for the proposed antennas. For experimental demonstration, two antennas are fabricated. The former dual-band antenna operating at f-1=3.5 GHz (Wimax and f+1=5.25 GHz (WLAN occupies an area of 0.21λ0×0.08λ0, and two dipolar radiation patterns are obtained with comparable gains of about 6.1 and 6.2 dB, respectively. The latter antenna advances in many aspects such as an ultrasmall size of only 0.16λ0×0.08λ0, versatile radiation patterns with a monopolar pattern at f0=2.4 GHz (Bluetooth, and a dipole one at f+1=3.5 GHz (Wimax and also comparable antenna gains. Circuit parameters are extracted and researched. Excellent performances of the antennas based on hybrid resonators predict promising applications in multifunction wireless communication systems.

Dual-mode ferromagnetic resonance in an FeCoB/Ru/FeCoB synthetic antiferromagnet with uniaxial anisotropy

Science.gov (United States)

Wang, Cuiling; Zhang, Shouheng; Qiao, Shizhu; Du, Honglei; Liu, Xiaomin; Sun, Ruicong; Chu, Xian-Ming; Miao, Guo-Xing; Dai, Youyong; Kang, Shishou; Yan, Shishen; Li, Shandong

2018-05-01

Dual-mode ferromagnetic resonance is observed in FeCoB/Ru/FeCoB trilayer synthetic antiferromagnets with uniaxial in-plane magnetic anisotropy. The optical mode is present in the (0-108 Oe) magnetic field range, where the top and bottom layer magnetizations are aligned in opposite directions. The strong acoustic mode appears, when the magnetic field exceeds the 300 Oe value, which corresponds to the flop transition in the trilayer. Magnetic field and angular dependences of resonant frequencies are studied for both optical (low-field) and acoustic (high field) modes. The low-field mode is found to be anisotropic but insensitive to the magnetic field value. In contrast, the high field mode is quasi-isotropic, but its resonant frequency is tunable by the value of the magnetic field. The coexistence of two modes of ferromagnetic resonance as well as switching between them with the increase in the magnetic field originates from the difference in the sign of interlayer coupling energy at the parallel and antiparallel configurations of the synthetic antiferromagnet. The dual-mode resonance in the studied trilayer structures provides greater flexibility in the design and functionalization of micro-inductors in monolithic microwave integrated circuits.

High-temperature superconducting coplanar-waveguide quarter-wavelength resonator with odd- and even-mode resonant frequencies for dual-band bandpass filter

Energy Technology Data Exchange (ETDEWEB)

Satoh, Kei; Takagi, Yuta; Narahashi, Shoichi [Research Laboratories, NTT DOCOMO, INC., 3-6 Hikari-no-oka Yokosuka, Kanagawa 239-8536 Japan (Japan); Nojima, Toshio, E-mail: satokei@nttdocomo.co.j [Graduate School of Information Science and Technology, Hokkaido University, Kita 14, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-0814 Japan (Japan)

2010-06-01

This paper presents a high-temperature superconducting coplanar-waveguide quarter-wavelength resonator that has two different resonant modes for use in a dual-band bandpass filter (DBPF). An RF filter with multiple passbands such as the DBPF is a basic element that is expected to achieve broadband transmission by using separated frequency bands aggregately and simultaneously in future mobile communication systems. The proposed resonator has a folded center conductor and two open stubs that are aligned close to it. The odd- and even-mode resonant frequencies are configured using the space between the folded center conductor and the open stubs. It is easy to configure the odd- and even-mode coupling coefficients independently because the two resonant modes have different current density distributions. Consequently, a DBPF with two different bandwidths can be easily designed. This paper presents three design examples for a four-pole Chebyshev DBPF with different combinations of fractional bandwidths in order to investigate the validity of the proposed resonator. This paper also presents measured results of the DBPF based on the design examples from the standpoint of experimental investigation. The designed and measured frequency responses confirm that the proposed resonator is effective in achieving DBPFs not only with two of the same bandwidths but also with two different bandwidths.

Covariant introduction of quark spin into the dual resonance model

International Nuclear Information System (INIS)

Iroshnikov, G.S.

1979-01-01

A very simple method of insertion of a quark spin into the dual resonance model of hadron interaction is proposed. The method is suitable for amplitudes with an arbitrary number of particles. The amplitude of interaction of real particles is presented as a product of contribution of oscillatory excitations in the (q anti q) system and of a spin factor. The latter is equal to the trace of the product of the external particle wave functions constructed from structural quarks and satisfying the relativistic Bargman-Wigner equations. Two examples of calculating the meson interaction amplitudes are presented

Dielectric Meta-Holograms Enabled with Dual Magnetic Resonances in Visible Light.

Science.gov (United States)

Li, Zile; Kim, Inki; Zhang, Lei; Mehmood, Muhammad Q; Anwar, Muhammad S; Saleem, Murtaza; Lee, Dasol; Nam, Ki Tae; Zhang, Shuang; Luk'yanchuk, Boris; Wang, Yu; Zheng, Guoxing; Rho, Junsuk; Qiu, Cheng-Wei

2017-09-26

Efficient transmission-type meta-holograms have been demonstrated using high-index dielectric nanostructures based on Huygens' principle. It is crucial that the geometry size of building blocks be judiciously optimized individually for spectral overlap of electric and magnetic dipoles. In contrast, reflection-type meta-holograms using the metal/insulator/metal scheme and geometric phase can be readily achieved with high efficiency and small thickness. Here, we demonstrate a general platform for design of dual magnetic resonance based meta-holograms based on the geometric phase using silicon nanostructures that are quarter wavelength thick for visible light. Significantly, the projected holographic image can be unambiguously observed without a receiving screen even under the illumination of natural light. Within the well-developed semiconductor industry, our ultrathin magnetic resonance-based meta-holograms may have promising applications in anticounterfeiting and information security.

Auxiliary cooling device for power plant

International Nuclear Information System (INIS)

Yamanoi, Kozo.

1996-01-01

An auxiliary cooling sea water pipeline for pumping up cooling sea water, an auxiliary cooling sea water pipeline and a primary side of an auxiliary cooling heat exchanger are connected between a sea water taking vessel and a sea water discharge pit. An auxiliary cooling water pump is connected to an auxiliary water cooling pipeline on the second side of the auxiliary cooling heat exchanger. The auxiliary cooling water pipeline is connected with each of auxiliary equipments of a reactor system and each of auxiliary equipments of the turbine system connected to a turbine auxiliary cooling water pipeline in parallel. During ordinary operation of the reactor, heat exchange for each of the auxiliary equipments of the reactor and heat exchange for each of the equipments of the turbine system are conducted simultaneously. Since most portions of the cooling devices of each of the auxiliary equipments of the reactor system and each of the auxiliary equipments of the turbine system can be used in common, the operation efficiency of the cooling device is improved. In addition, the space for the pipelines and the cost for the equipments can be reduced. (I.N.)

The Acquisition of Auxiliary Syntax: A Longitudinal Elicitation Study. Part 1: Auxiliary BE

Science.gov (United States)

Theakston, Anna L.; Rowland, Caroline F.

2009-01-01

Purpose: The question of how and when English-speaking children acquire auxiliaries is the subject of extensive debate. Some researchers posit the existence of innately given Universal Grammar principles to guide acquisition, although some aspects of the auxiliary system must be learned from the input. Others suggest that auxiliaries can be…

Auxiliary buildings

International Nuclear Information System (INIS)

Lakner, I.; Lestyan, E.

1979-01-01

The nuclear power station represents a complicated and a particular industrial project. Consequently, the design of the auxiliary buildings serving the power station (offices, kitchen, refreshment room, workshops, depots, water treatment plant building, boiler houses, etc.) requires more attention than usual. This chapter gives a short survey of the auxiliary buildings already completed and discusses the problems of their design, location and structure. (author)

Performance Improvement of Polymer Solar Cells by Surface-Energy-Induced Dual Plasmon Resonance.

Science.gov (United States)

Yao, Mengnan; Shen, Ping; Liu, Yan; Chen, Boyuan; Guo, Wenbin; Ruan, Shengping; Shen, Liang

2016-03-09

The surface plasmon resonance (SPR) effect of metal nanoparticles (MNPs) is effectively applied on polymer solar cells (PSCs) to improve power conversion efficiency (PCE). However, universality of the reported results mainly focused on utilizing single type of MNPs to enhance light absorption only in specific narrow wavelength range. Herein, a surface-energy-induced dual MNP plasmon resonance by thermally evaporating method was presented to achieve the absorption enhancement in wider range. The differences of surface energy between silver (Ag), gold (Au), and tungsten trioxide (WO3) compared by contact angle images enable Ag and Au prefer to respectively aggregate into isolated islands rather than films at the initial stage of the evaporation process, which was clearly demonstrated in the atomic force microscopy (AFM) measurement. The sum of plasmon-enhanced wavelength range induced by both Ag NPs (350-450 nm) and Au NPs (450-600 nm) almost cover the whole absorption spectra of active layers, which compatibly contribute a significant efficiency improvement from 4.57 ± 0.16 to 6.55 ± 0.12% compared to the one without MNPs. Besides, steady state photoluminescence (PL) measurements provide strong evidence that the SPR induced by the Ag-Au NPs increase the intensity of light absorption. Finally, ultraviolet photoelectron spectroscopy (UPS) reveals that doping Au and Ag causes upper shift of both the work function and valence band of WO3, which is directly related to hole collection ability. We believe the surface-energy-induced dual plasmon resonance enhancement by simple thermally evaporating technique might pave the way toward higher-efficiency PSCs.

Auxiliary verbs in Dinka

DEFF Research Database (Denmark)

Andersen, Torben

2007-01-01

Dinka, a Western Nilotic language, has a class of auxiliary verbs which is remarkable in the following four respects: (i) It is unusually large, comprising some 20 members; (ii) it is grammatically homogeneous in terms of both morphology and syntax; (iii) most of the auxiliary verbs correspond...... to adverbs in languages like English, while the rest are tense-aspect markers; and (iv) it is possible to combine several auxiliary verbs in a single clause. For some of the auxiliary verbs there are extant full verbs from which they have evolved. To some extent, therefore, it is possible to observe what...

HTS dual-band bandpass filters using stub-loaded hair-pin resonators for mobile communication systems

Energy Technology Data Exchange (ETDEWEB)

Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.

2014-09-15

Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.

The Hagedorn Spectrum and the Dual Resonance Model: An Old Love Affair

CERN Document Server

Veneziano, Gabriele

2016-01-01

In this contribution I recall how people working in the late 1960s on the dual resonance model came to the surprising discovery of a Hagedorn-like spectrum, and why they should not have been surprised. I will then turn to discussing the Hagedorn spectrum from a string theory viewpoint (which adds a huge degeneracy to the exponential spectrum). Finally, I will discuss how all this can be reinterpreted in the new incarnation of string theory through the properties of quantum black holes.

A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications

DEFF Research Database (Denmark)

Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng

2017-01-01

This paper proposes a dual-bridge (DB) LLC resonant converter for wide input applications. The topology is an integration of a half-bridge (HB) LLC circuit and a full-bridge (FB) LLC circuit. The fixed-frequency PWM control is employed and a range of twice the minimum input voltage can be covered....... Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...

Slow light based on plasmon-induced transparency in dual-ring resonator-coupled MDM waveguide system

International Nuclear Information System (INIS)

Zhan, Shiping; Li, Hongjian; He, Zhihui; Li, Boxun; Yang, Hui; Cao, Guangtao

2014-01-01

We report a theoretical and numerical investigation of the plasmon-induced transparency (PIT) effect in a dual-ring resonator-coupled metal–dielectric–metal waveguide system. A transfer matrix method (TMM) is introduced to analyse the transmission and dispersion properties in the transparency window. A tunable PIT is realized in a constant separation design. The phase dispersion and slow-light effect are discussed in both the resonance and non-resonance conditions. Finally, a propagation constant based on the TMM is derived for the periodic system. It is found that the group index in the transparency window of the proposed structure can be easily tuned by the period p, which provides a new understanding, and a group index ∼51 is achieved. The quality factor of resonators can also be effective in adjusting the dispersion relation. These observations could be helpful to fundamental research and applications for integrated plasmonic devices. (paper)

Steam generator auxiliary systems

International Nuclear Information System (INIS)

Heinz, A.

1982-01-01

The author deals with damage and defect types obtaining in auxiliary systems of power plants. These concern water/steam auxiliary systems (feed-water tank, injection-control valves, slide valves) and air/fluegas auxiliary systems (blowers, air preheaters, etc.). Operating errors and associated damage are not dealt with; by contrast, weak spots are pointed out which result from planning and design. Damage types and events are collected in statistics in order to facilitate damage evaluation for arriving at improved design solutions. (HAG) [de

Dual power, constant speed electric motor system

Science.gov (United States)

Kirschbaum, H.S.

1984-07-31

A dual capacity permanent split capacitor electric motor system is provided with a stator having main and auxiliary windings. The main stator winding includes two winding sections which are connected in parallel with each other and across a pair of line terminals while the auxiliary winding is connected in series with a capacitor to form a circuit branch which is connected between the line terminals for operation at a first output power level. Switching means are provided to reconnect the main stator winding sections in series with each other and in series with a second capacitor to form a circuit branch which is connected between the line terminals while the stator auxiliary winding is connected directly between the line terminals for operation at a second output power level. Automatic rotation reversal occurs when the motor switches from the first to the second output power level. 6 figs.

Dual power, constant speed electric motor system

Science.gov (United States)

Kirschbaum, Herbert S.

1984-01-01

A dual capacity permanent split capacitor electric motor system is provided with a stator having main and auxiliary windings. The main stator winding includes two winding sections which are connected in parallel with each other and across a pair of line terminals while the auxiliary winding is connected in series with a capacitor to form a circuit branch which is connected between the line terminals for operation at a first output power level. Switching means are provided to reconnect the main stator winding sections in series with each other and in series with a second capacitor to form a circuit branch which is connected between the line terminals while the stator auxiliary winding is connected directly between the line terminals for operation at a second output power level. Automatic rotation reversal occurs when the motor switches from the first to the second output power level.

LCC Resonant Multilevel Converter for X-ray Applications

Directory of Open Access Journals (Sweden)

A. M. Pernía

2017-10-01

Full Text Available Medical X-ray appliances use high-voltage power supplies that must be able to work with very different energy requirements. Two techniques can be distinguished in X-ray medical imaging: fluoroscopy and radioscopy. The former involves low power radiation with a long exposure time, while radioscopy requires large power during short radiographic exposure times. Since the converter has to be designed by taking into account the maximum power specification, it will exhibit a poor efficiency when operating at low power levels. Such a problem can be solved by using a new multilevel LCC topology. This topology is based on a classical series-parallel resonant topology, but includes an additional low-voltage auxiliary transformer whose function depends on the X-ray technique considered. When radioscopy operation is selected, the transformer will allow the power to be shared between two full-bridges. If fluoroscopy mode is activated, the auxiliary full bridge is disconnected and the magnetizing inductance of the auxiliary transformer is used to increase the resonant inductor in order to reduce the resonant currents, thus improving the efficiency of the converter.

White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 2: Radiation Dose and Iodine Sensitivity.

Science.gov (United States)

Foley, W Dennis; Shuman, William P; Siegel, Marilyn J; Sahani, Dushyant V; Boll, Daniel T; Bolus, David N; De Cecco, Carlo N; Kaza, Ravi K; Morgan, Desiree E; Schoepf, U Joseph; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

This is the second of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography. This paper, part 2, addresses radiation dose and iodine sensitivity in dual-energy computed tomography.

Generalized viscothermoelasticity theory of dual-phase-lagging model for damping analysis in circular micro-plate resonators

Science.gov (United States)

Grover, D.; Seth, R. K.

2018-05-01

Analysis and numerical results are presented for the thermoelastic dissipation of a homogeneous isotropic, thermally conducting, Kelvin-Voigt type circular micro-plate based on Kirchhoff's Love plate theory utilizing generalized viscothermoelasticity theory of dual-phase-lagging model. The analytical expressions for thermoelastic damping of vibration and frequency shift are obtained for generalized dual-phase-lagging model and coupled viscothermoelastic plates. The scaled thermoelastic damping has been illustrated in case of circular plate and axisymmetric circular plate for fixed aspect ratio for clamped and simply supported boundary conditions. It is observed that the damping of vibrations significantly depend on time delay and mechanical relaxation times in addition to thermo-mechanical coupling in circular plate under resonance conditions and plate dimensions.

Study of loading by beam of dual-resonator structure of linear electron accelerator

International Nuclear Information System (INIS)

Milovanov, O.S.; Smirnov, I.A.

1988-01-01

Loading by the beam of the accelerating structure of an Argus dual-resonator linear electron accelerator with a kinetic energy of ∼ 1 MeV and a pulsed beam current of up to 0.5 A is studied experimentally. It is shown that the conditions for stable single-frequency operation of the magnetron are disrupted and the acceleration process is cut off at certain electron-beam currents. Experimental curves of the maximum beam current and maximum electron efficiency of the Argus linear electron accelerator as functions of rf power are given

Proceedings: Power Plant Electric Auxiliary Systems Workshop

International Nuclear Information System (INIS)

1992-06-01

The EPRI Power Plant Electric Auxiliary Systems Workshop, held April 24--25, 1991, in Princeton, New Jersey, brought together utilities, architect/engineers, and equipment suppliers to discuss common problems with power plant auxiliary systems. Workshop participants presented papers on monitoring, identifying, and solving problems with auxiliary systems. Panel discussions focused on improving systems and existing and future plants. The solutions presented to common auxiliary system problems focused on practical ideas that can enhance plant availability, reduce maintenance costs, and simplify the engineering process. The 13 papers in these proceedings include: Tutorials on auxiliary electrical systems and motors; descriptions of evaluations, software development, and new technologies used recently by electric utilities; an analysis of historical performance losses caused by power plant auxiliary systems; innovative design concepts for improving auxiliary system performance in future power plants

Metamaterial Combining Electric- and Magnetic-Dipole-Based Configurations for Unique Dual-Band Signal Enhancement in Ultrahigh-Field Magnetic Resonance Imaging.

Science.gov (United States)

Schmidt, Rita; Webb, Andrew

2017-10-11

Magnetic resonance imaging and spectroscopy (MRI and MRS) are both widely used techniques in medical diagnostics and research. One of the major thrusts in recent years has been the introduction of ultrahigh-field magnets in order to boost the sensitivity. Several MRI studies have examined further potential improvements in sensitivity using metamaterials, focusing on single frequency applications. However, metamaterials have yet to reach a level that is practical for routine MRI use. In this work, we explore a new metamaterial implementation for MRI, a dual-nuclei resonant structure, which can be used for both proton and heteronuclear magnetic resonance. Our approach combines two configurations, one based on a set of electric dipoles for the low frequency band, and the second based on a set of magnetic dipoles for the high frequency band. We focus on the implementation of a dual-nuclei metamaterial for phosphorus and proton imaging and spectroscopy at an ultrahigh-field strength of 7 T. In vivo scans using this flexible and compact structure show that it locally enhances both the phosphorus and proton transmit and receive sensitivities.

Auxiliary Deep Generative Models

DEFF Research Database (Denmark)

Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

2016-01-01

Deep generative models parameterized by neural networks have recently achieved state-of-the-art performance in unsupervised and semi-supervised learning. We extend deep generative models with auxiliary variables which improves the variational approximation. The auxiliary variables leave...... the generative model unchanged but make the variational distribution more expressive. Inspired by the structure of the auxiliary variable we also propose a model with two stochastic layers and skip connections. Our findings suggest that more expressive and properly specified deep generative models converge...... faster with better results. We show state-of-the-art performance within semi-supervised learning on MNIST (0.96%), SVHN (16.61%) and NORB (9.40%) datasets....

30 CFR 57.6161 - Auxiliary facilities.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary facilities. 57.6161 Section 57.6161...-Underground Only § 57.6161 Auxiliary facilities. (a) Auxiliary facilities used to store explosive material near work places shall be wooden, box-type containers equipped with covers or doors, or facilities...

45 CFR 707.10 - Auxiliary aids.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 3 2010-10-01 2010-10-01 false Auxiliary aids. 707.10 Section 707.10 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION ON CIVIL RIGHTS ENFORCEMENT OF... § 707.10 Auxiliary aids. (a) The Agency shall furnish appropriate auxiliary aids where necessary to...

The sensitivity of auxiliary examinations in different stages of sporadic Creutzfeldt-Jakob disease

Directory of Open Access Journals (Sweden)

Jiao-jiao JIANG

2017-06-01

Full Text Available Objective To analyze the sensitivity of auxiliary examinations in different periods of sporadic Creutzfeldt-Jakob disease (sCJD. Methods The clinical data of 53 sCJD patients were retrospectively analyzed including the different stages of skull diffusion-weighted magnetic resonance imaging (DWI, 24-hour ambulatory electroencephalogram (EEG, 18F-FDG PET/CT (PET-CT and cerebrospinal fluid 14-3-3 protein. When calculating the sensitivity of an auxiliary examination, the diagnostic criteria were defined by combining the specific clinical manifestations with two or more positive results of other auxiliary examinations. Results There were 24, 53 and 22 sCJD patients, respectively, met the criterion of early (E, middle (M and later (L stage of disease (some patients fit 2 or 3 stages. The sensitivity of DWI (E: 58.3%, M: 85.4%, L: 94.7%, EEG (E: 45.8%, M: 62.7%, L: 77.8%, 14-3-3 protein in cerebrospinal fluid (E: 11.1%, M: 52.9% and PET-CT (E: 80%, M: 100% increased gradually with disease progression. The sensitivity of PET-CT was higher than the other auxiliary examinations for E and M stages; no PET-CT was conducted in L stage. High signal regions mainly distributed in the cortex in E and M stages, but in L stage, no significant difference was found on the distribution of high signal regions between cortex and basal ganglia. Conclusions The sensitivities of the auxiliary examinations were different for sCJD patients in different stages. Reexaminations in different periods may improve the sensitivity for sCJD diagnosis. The sensitivity of PET-CT was high, and the combination of PET-CT and other auxiliary examinations may play a key role in the diagnosis of sCJD. DOI: 10.11855/j.issn.0577-7402.2017.05.15

Dual-Resonant Implantable Circular Patch Antenna for Biotelemetry Communication

Directory of Open Access Journals (Sweden)

Rongqiang Li

2016-01-01

Full Text Available A compact broadband implantable circular patch antenna is designed and experimentally demonstrated for Medical Implant Communications Service (MICS band (402–405 MHz. Compared with other similar implantable antennas, the proposed antenna incorporates three advantages for biotelemetry communication. First, it can realize a broad impedance bandwidth by exhibiting dual resonances. Second, it can obtain a compact structure by introducing two arc-shaped slots, a rectangular slot and a circular slot on metal radiating patch. Finally, it can display a friendly shape by using a circular structure. The proposed antenna occupies a volume of about 431.5 mm3 (10.42 × 1.27π mm3, which is a compromise between miniaturization and bandwidth. The measured −10 dB impedance bandwidth is 55 MHz (385–440 MHz. Furthermore, the radiation performance and human body safety consideration of the antenna are examined and characterized.

Auxiliary mine ventilation manual

International Nuclear Information System (INIS)

Workplace Safety North

2010-01-01

An adequate ventilation system is needed for air quality and handling in a mine and is comprised of many different pieces of equipment for removing contaminated air and supplying fresh air and thereby provide a satisfactory working environment. This manual highlights auxiliary ventilation systems made up of small fans, ducts, tubes, air movers, deflectors and additional air flow controls which distribute fresh air delivered by the primary system to all areas. A review of auxiliary ventilation is provided. Design, operation and management issues are discussed and guidelines are furnished. This manual is limited to underground hard rock operations and does not address directly other, specific auxiliary systems, either in underground coal mines or uranium mines.

Auxiliary mine ventilation manual

Energy Technology Data Exchange (ETDEWEB)

Workplace Safety North

2010-07-01

An adequate ventilation system is needed for air quality and handling in a mine and is comprised of many different pieces of equipment for removing contaminated air and supplying fresh air and thereby provide a satisfactory working environment. This manual highlights auxiliary ventilation systems made up of small fans, ducts, tubes, air movers, deflectors and additional air flow controls which distribute fresh air delivered by the primary system to all areas. A review of auxiliary ventilation is provided. Design, operation and management issues are discussed and guidelines are furnished. This manual is limited to underground hard rock operations and does not address directly other, specific auxiliary systems, either in underground coal mines or uranium mines.

Implementation and Investigation of a Compact Circular Wide Slot UWB Antenna with Dual Notched Band Characteristics using Stepped Impedance Resonators

Directory of Open Access Journals (Sweden)

Yingsong Li

2012-04-01

Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.

Bistable energy harvesting enhancement with an auxiliary linear oscillator

Science.gov (United States)

Harne, R. L.; Thota, M.; Wang, K. W.

2013-12-01

Recent work has indicated that linear vibrational energy harvesters with an appended degree-of-freedom (DOF) may be advantageous for introducing new dynamic forms to extend the operational bandwidth. Given the additional interest in bistable harvester designs, which exhibit a propitious snap through effect from one stable state to the other, it is a logical extension to explore the influence of an added DOF to a bistable system. However, bistable snap through is not a resonant phenomenon, which tempers the presumption that the dynamics induced by an additional DOF on bistable designs would inherently be beneficial as for linear systems. This paper presents two analytical formulations to assess the fundamental and superharmonic steady-state dynamics of an excited bistable energy harvester to which is attached an auxiliary linear oscillator. From an energy harvesting perspective, the model predicts that the additional linear DOF uniformly amplifies the bistable harvester response magnitude and generated power for excitation frequencies less than the attachment’s resonance while improved power density spans a bandwidth below this frequency. Analyses predict bandwidths having co-existent responses composed of a unique proportion of fundamental and superharmonic dynamics. Experiments validate key analytical predictions and observe the ability for the coupled system to develop an advantageous multi-harmonic interwell response when the initial conditions are insufficient for continuous high-energy orbit at the excitation frequency. Overall, the addition of an auxiliary linear oscillator to a bistable harvester is found to be an effective means of enhancing the energy harvesting performance and robustness.

Mechanical (turbines and auxiliary equipment)

CERN Document Server

Sherry, A; Cruddace, AE

2013-01-01

Modern Power Station Practice, Volume 3: Mechanical (Turbines and Auxiliary Equipment) focuses on the development of turbines and auxiliary equipment used in power stations in Great Britain. Topics covered include thermodynamics and steam turbine theory; turbine auxiliary systems such as lubrication systems, feed water heating systems, and the condenser and cooling water plants. Miscellaneous station services, and pipework in power plants are also described. This book is comprised of five chapters and begins with an overview of thermodynamics and steam turbine theory, paying particular attenti

Comparison of collective Thomson scattering signals due to fast ions in ITER scenarios with fusion and auxiliary heating

DEFF Research Database (Denmark)

Salewski, Mirko; Asunta, O.; Eriksson, L.-G.

2009-01-01

Auxiliary heating such as neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH) will accelerate ions in ITER up to energies in the MeV range, i.e. energies which are also typical for alpha particles. Fast ions of any of these populations will elevate the collective Thomson...... functions of fast ions generated by NBI and ICRH are calculated for a steady-state ITER burning plasma equilibrium with the ASCOT and PION codes, respectively. The parameters for the auxiliary heating systems correspond to the design currently foreseen for ITER. The geometry of the CTS system for ITER...... is chosen such that near perpendicular and near parallel velocity components are resolved. In the investigated ICRH scenario, waves at 50MHz resonate with tritium at the second harmonic off-axis on the low field side. Effects of a minority heating scheme with He-3 are also considered. CTS scattering...

Auxiliary reactor for a hydrocarbon reforming system

Science.gov (United States)

Clawson, Lawrence G.; Dorson, Matthew H.; Mitchell, William L.; Nowicki, Brian J.; Bentley, Jeffrey M.; Davis, Robert; Rumsey, Jennifer W.

2006-01-17

An auxiliary reactor for use with a reformer reactor having at least one reaction zone, and including a burner for burning fuel and creating a heated auxiliary reactor gas stream, and heat exchanger for transferring heat from auxiliary reactor gas stream and heat transfer medium, preferably two-phase water, to reformer reaction zone. Auxiliary reactor may include first cylindrical wall defining a chamber for burning fuel and creating a heated auxiliary reactor gas stream, the chamber having an inlet end, an outlet end, a second cylindrical wall surrounding first wall and a second annular chamber there between. The reactor being configured so heated auxiliary reactor gas flows out the outlet end and into and through second annular chamber and conduit which is disposed in second annular chamber, the conduit adapted to carry heat transfer medium and being connectable to reformer reaction zone for additional heat exchange.

30 CFR 75.331 - Auxiliary fans and tubing.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans and tubing. 75.331 Section 75... HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.331 Auxiliary fans and tubing. (a) When auxiliary fans and tubing are used for face ventilation, each auxiliary fan shall be— (1...

46 CFR 63.25-1 - Small automatic auxiliary boilers.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Small automatic auxiliary boilers. 63.25-1 Section 63.25... AUXILIARY BOILERS Requirements for Specific Types of Automatic Auxiliary Boilers § 63.25-1 Small automatic auxiliary boilers. Small automatic auxiliary boilers defined as having heat-input ratings of 400,000 Btu/hr...

7 CFR 15b.37 - Auxiliary aids.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Auxiliary aids. 15b.37 Section 15b.37 Agriculture... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Other Aid, Benefits, or Services § 15b.37 Auxiliary aids... appropriate auxiliary aids to persons with impaired sensory, manual, or speaking skills, where necessary to...

30 CFR 57.8529 - Auxiliary fan systems

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fan systems 57.8529 Section 57.8529 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND NONMETAL MINE... Underground Only § 57.8529 Auxiliary fan systems When auxiliary fan systems are used, such systems shall...

Electromagnetic Form Factors of Hadrons in Dual-Large Nc QCD

International Nuclear Information System (INIS)

Dominguez, C. A.

2011-01-01

In this talk, results are presented of determinations of electromagnetic form factors of hadrons (pion, proton, and Δ(1236)) in the framework of Dual-Large N c QCD (Dual-QCD ∞ ). This framework improves considerably tree-level VMD results by incorporating an infinite number of zero-width resonances, with masses and couplings fixed by the dual-resonance (Veneziano-type) model.

A Low-Cost and Portable Dual-Channel Fiber Optic Surface Plasmon Resonance System.

Science.gov (United States)

Liu, Qiang; Liu, Yun; Chen, Shimeng; Wang, Fang; Peng, Wei

2017-12-04

A miniaturization and integration dual-channel fiber optic surface plasmon resonance (SPR) system was proposed and demonstrated in this paper. We used a yellow light-emitting diode (LED, peak wavelength 595 nm) and built-in web camera as a light source and detector, respectively. Except for the detection channel, one of the sensors was used as a reference channel to compensate nonspecific binding and physical absorption. We packaged the LED and surface plasmon resonance (SPR) sensors together, which are flexible enough to be applied to mobile devices as a compact and portable system. Experimental results show that the normalized intensity shift and refractive index (RI) of the sample have a good linear relationship in the RI range from 1.328 to 1.348. We used this sensor to monitor the reversible, specific interaction between lectin concanavalin A (Con A) and glycoprotein ribonuclease B (RNase B), which demonstrate its capabilities of specific identification and biochemical samples concentration detection. This sensor system has potential applications in various fields, such as medical diagnosis, public health, food safety, and environment monitoring.

33 CFR 5.47 - Auxiliary ensign.

Science.gov (United States)

2010-07-01

... matching blue Coast Guard Auxiliary emblem is centered. The white slash shall be at a 70 degree angle, rising away from the hoist. (c) The Auxiliary emblem consists of a disk with the shield of the Coat of...

Throughput Measurement of a Dual-Band MIMO Rectangular Dielectric Resonator Antenna for LTE Applications.

Science.gov (United States)

Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais

2017-01-13

An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.

Bi-Frequency Modulated Quasi-Resonant Converters: Theory and Applications

Science.gov (United States)

Zhang, Yuefeng

1995-01-01

To avoid the variable frequency operation of quasi -resonant converters, many soft-switching PWM converters have been proposed, all of them require an auxiliary switch, which will increase the cost and complexity of the power supply system. In this thesis, a new kind of technique for quasi -resonant converters has been proposed, which is called the bi-frequency modulation technique. By operating the quasi-resonant converters at two switching frequencies, this technique enables quasi-resonant converters to achieve the soft-switching, at fixed switching frequencies, without an auxiliary switch. The steady-state analysis of four commonly used quasi-resonant converters, namely, ZVS buck, ZCS buck, ZVS boost, and ZCS boost converter has been presented. Using the concepts of equivalent sources, equivalent sinks, and resonant tank, the large signal models of these four quasi -resonant converters were developed. Based on these models, the steady-state control characteristics of BFM ZVS buck, BFM ZCS buck, BFM ZVS boost, and BFM ZCS boost converter have been derived. The functional block and design consideration of the bi-frequency controller were presented, and one of the implementations of the bi-frequency controller was given. A complete design example has been presented. Both computer simulations and experimental results have verified that the bi-frequency modulated quasi-resonant converters can achieve soft-switching, at fixed switching frequencies, without an auxiliary switch. One of the application of bi-frequency modulation technique is for EMI reduction. The basic principle of using BFM technique for EMI reduction was introduced. Based on the spectral analysis, the EMI performances of the PWM, variable-frequency, and bi-frequency modulated control signals was evaluated, and the BFM control signals show the lowest EMI emission. The bi-frequency modulated technique has also been applied to the power factor correction. A BFM zero -current switching boost converter has

Properties of quasi-elastic processes due to exchange of one dual pomeron

International Nuclear Information System (INIS)

Gedalin, Eh.V.; Gurvich, E.G.

1975-01-01

The asymptotic (at S tending to infinity) characteristics of four-particle amplitudes of diffraction scattering of resonance states in the dual-resonance model is considered in the lower order of the dual theory of perturbations. It is shown that for transverse transferred momentum K→0, at least for part of the spectrum of states of the dual resonance model - i.e. of the transverse states -, the scattering amplitudes are zero, except for the elastically scattered ones, which are all identical. (author)

On a gauge theory of the self-dual field and its quantization

International Nuclear Information System (INIS)

Srivastava, P.P.

1990-01-01

A gauge theory of self-dual fields is constructed by adding a Wess-Zumino term to the recently studied formulation based on a second-order scalar field lagrangian carrying with it an auxiliary vector field to take care of the self-duality constraint in a linear fashion. The two versions are quantized using the BRST formulation following the BFV procedure. No violation of microcausality occurs and the action of the ordinary scalar field may not be written as the sum of the actions of the self- and anti-self-dual fields. (orig.)

The Acquisition of Auxiliary Syntax: A Longitudinal Elicitation Study. Part 2: The Modals and Auxiliary DO

Science.gov (United States)

Rowland, Caroline F.; Theakston, Anna L.

2009-01-01

Purpose: The study of auxiliary acquisition is central to work on language development and has attracted theoretical work from both nativist and constructivist approaches. This study is part of a 2-part companion set that represents a unique attempt to trace the development of auxiliary syntax by using a longitudinal elicitation methodology. The…

CAREM-25. Auxiliary systems

International Nuclear Information System (INIS)

Acosta, Eduardo; Amaya, Daniel; Carlevaris, Rodolfo; Patrignani, A.; Ramilo, L.; Santecchia, A.; Vindrola, C.

2000-01-01

CAREM is an innovative PWR reactor whose prototype will be of small power generation capacity (100MWt, about 25MWe).CAREM design is based on light water integrated reactor with slightly enriched uranium.In this work, a summary of the functions and most relevant design characteristics of main auxiliary systems associated to the chain of heat removal and physicochemical - radiological treatment of the cooling fluids of the CAREM-25 prototype is presented.Even though these auxiliary systems of the reactor are not safety system, they fulfill functions related with the nuclear safety at different operative modes of the reactor

CAREM-25. Auxiliary systems

International Nuclear Information System (INIS)

Acosta, Eduardo; Amaya, Daniel; Carlevaris, Rodolfo; Patrignani, Alberto; Santecchia, Alberto; Vindrola, Carlos; Ramilo, Lucia B.

2000-01-01

CAREM is an innovative PWR reactor whose prototype will be of small power generation capacity (100 M Wt, about 25 M We). CAREM design is based on light water integrated reactor with slightly enriched uranium. In this work, a summary of the functions and most relevant design characteristics of main auxiliary systems associated to the chain of heat removal and physicochemical - radiological treatment of the cooling fluids of the CAREM-25 prototype is presented. Even though these auxiliary systems of the reactor are not safety system, they fulfill functions related with the nuclear safety at different operative modes of the reactor. (author)

Compact Dual-Band Zeroth-Order Resonance Antenna

International Nuclear Information System (INIS)

Xu He-Xiu; Wang Guang-Ming; Gong Jian-Qiang

2012-01-01

A novel microstrip zeroth-order resonator (ZOR) antenna and its equivalent circuit model are exploited with two zeroth-order resonances. It is constructed based on a resonant-type composite right/left handed transmission line (CRLH TL) using a Wunderlich-shaped extended complementary single split ring resonator pair (W-ECSSRRP) and a series capacitive gap. The gap either can be utilized for double negative (DNG) ZOR antenna or be removed to engineer a simplified elision-negative ZOR (ENG) antenna. For verification, a DNG ZOR antenna sample is fabricated and measured. Numerical and experimental results agree well with each other, indicating that the omnidirectional radiations occur at two frequency bands which are accounted for by two shunt branches in the circuit model. The size of the antenna is 49% more compact than its previous counterpart. The superiority of W-ECSSRRP over CSSRRP lies in the lower fundamental resonance of the antenna by 38.2% and the introduction of a higher zeroth-order resonance. (fundamental areas of phenomenology(including applications))

In vivo magnetic resonance and fluorescence dual imaging of tumor sites by using dye-doped silica-coated iron oxide nanoparticles

International Nuclear Information System (INIS)

Jang, Haeyun; Lee, Chaedong; Nam, Gi-Eun; Quan, Bo; Choi, Hyuck Jae; Yoo, Jung Sun; Piao, Yuanzhe

2016-01-01

The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex ® with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.

In vivo magnetic resonance and fluorescence dual imaging of tumor sites by using dye-doped silica-coated iron oxide nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Jang, Haeyun; Lee, Chaedong [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Nam, Gi-Eun [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Quan, Bo [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Choi, Hyuck Jae [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Yoo, Jung Sun [Seoul National University, Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Smart Humanity Convergence Center (Korea, Republic of); Piao, Yuanzhe, E-mail: parkat9@snu.ac.kr [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of)

2016-02-15

The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex{sup ®} with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.

Computation within the auxiliary field approach

International Nuclear Information System (INIS)

Baeurle, S.A.

2003-01-01

Recently, the classical auxiliary field methodology has been developed as a new simulation technique for performing calculations within the framework of classical statistical mechanics. Since the approach suffers from a sign problem, a judicious choice of the sampling algorithm, allowing a fast statistical convergence and an efficient generation of field configurations, is of fundamental importance for a successful simulation. In this paper we focus on the computational aspects of this simulation methodology. We introduce two different types of algorithms, the single-move auxiliary field Metropolis Monte Carlo algorithm and two new classes of force-based algorithms, which enable multiple-move propagation. In addition, to further optimize the sampling, we describe a preconditioning scheme, which permits to treat each field degree of freedom individually with regard to the evolution through the auxiliary field configuration space. Finally, we demonstrate the validity and assess the competitiveness of these algorithms on a representative practical example. We believe that they may also provide an interesting possibility for enhancing the computational efficiency of other auxiliary field methodologies

Bayesian Analysis of Geostatistical Models With an Auxiliary Lattice

KAUST Repository

Park, Jincheol; Liang, Faming

2012-01-01

of observations is large. In this article, we propose an auxiliary lattice-based approach for tackling this difficulty. By introducing an auxiliary lattice to the space of observations and defining a Gaussian Markov random field on the auxiliary lattice, our model

47 CFR 73.1675 - Auxiliary antennas.

Science.gov (United States)

2010-10-01

... Class A TV licensees may request a decrease from the authorized facility's ERP in the license application. An FM, TV or Class A TV licensee may also increase the ERP of the auxiliary facility in a license... licensed main facility as an auxiliary facility with an ERP less than or equal to the ERP specified on the...

Dual Contrast - Magnetic Resonance Fingerprinting (DC-MRF): A Platform for Simultaneous Quantification of Multiple MRI Contrast Agents.

Science.gov (United States)

Anderson, Christian E; Donnola, Shannon B; Jiang, Yun; Batesole, Joshua; Darrah, Rebecca; Drumm, Mitchell L; Brady-Kalnay, Susann M; Steinmetz, Nicole F; Yu, Xin; Griswold, Mark A; Flask, Chris A

2017-08-16

Injectable Magnetic Resonance Imaging (MRI) contrast agents have been widely used to provide critical assessments of disease for both clinical and basic science imaging research studies. The scope of available MRI contrast agents has expanded over the years with the emergence of molecular imaging contrast agents specifically targeted to biological markers. Unfortunately, synergistic application of more than a single molecular contrast agent has been limited by MRI's ability to only dynamically measure a single agent at a time. In this study, a new Dual Contrast - Magnetic Resonance Fingerprinting (DC - MRF) methodology is described that can detect and independently quantify the local concentration of multiple MRI contrast agents following simultaneous administration. This "multi-color" MRI methodology provides the opportunity to monitor multiple molecular species simultaneously and provides a practical, quantitative imaging framework for the eventual clinical translation of molecular imaging contrast agents.

Dual-Mode Gas Sensor Composed of a Silicon Nanoribbon Field Effect Transistor and a Bulk Acoustic Wave Resonator: A Case Study in Freons

Directory of Open Access Journals (Sweden)

Ye Chang

2018-01-01

Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.

46 CFR 58.25-10 - Main and auxiliary steering gear.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Main and auxiliary steering gear. 58.25-10 Section 58.25... AUXILIARY MACHINERY AND RELATED SYSTEMS Steering Gear § 58.25-10 Main and auxiliary steering gear. (a) Power-operated main and auxiliary steering gear must be separate systems that are independent throughout their...

Sea water take-up facility for cooling reactor auxiliary

International Nuclear Information System (INIS)

Numata, Noriko; Mizutani, Akira; Hirako, Shizuka; Uchiyama, Yuichi; Oda, Atsushi.

1997-01-01

The present invention provides an improvement of a cooling sea water take-up facility for cooling auxiliary equipments of nuclear power plant. Namely, an existent sea water take-up facility for cooling reactor auxiliary equipments has at least two circulation water systems and three independent sea water systems for cooling reactor auxiliary equipments. In this case, a communication water channel is disposed, which connects the three independent sea water systems for cooling reactor auxiliary equipments mutually by an opening/closing operation of a flow channel partitioning device. With such a constitution, even when any combination of two systems among the three circulation water systems is in inspection at the same time, one system for cooling the reactor auxiliary equipments can be kept operated, and one system is kept in a stand-by state by the communication water channel upon periodical inspection of water take-up facility for cooling the auxiliary equipments. As a result, the sea water take-up facility for cooling auxiliary equipments of the present invention have operation efficiency higher than that of a conventional case while keeping the function and safety at the same level as in the conventional case. (I.S.)

14 CFR 29.757 - Hull and auxiliary float strength.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and auxiliary float strength. 29.757... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Floats and Hulls § 29.757 Hull and auxiliary float strength. The hull, and auxiliary floats if used, must withstand the...

78 FR 27321 - Revision of Auxiliary Regulations

Science.gov (United States)

2013-05-10

... Auxiliary organizational structure, extending civil liability protection to Auxiliary units and members, and... entities. C. Assistance for Small Entities If you think that your business, organization, or governmental..., explain why you think your business or organization qualifies, how and to what degree this rule would...

Hybrid method to predict the resonant frequencies and to characterise dual band proximity coupled microstrip antennas

Science.gov (United States)

Varma, Ruchi; Ghosh, Jayanta

2018-06-01

A new hybrid technique, which is a combination of neural network (NN) and support vector machine, is proposed for designing of different slotted dual band proximity coupled microstrip antennas. Slots on the patch are employed to produce the second resonance along with size reduction. The proposed hybrid model provides flexibility to design the dual band antennas in the frequency range from 1 to 6 GHz. This includes DCS (1.71-1.88 GHz), PCS (1.88-1.99 GHz), UMTS (1.92-2.17 GHz), LTE2300 (2.3-2.4 GHz), Bluetooth (2.4-2.485 GHz), WiMAX (3.3-3.7 GHz), and WLAN (5.15-5.35 GHz, 5.725-5.825 GHz) bands applications. Also, the comparative study of this proposed technique is done with the existing methods like knowledge based NN and support vector machine. The proposed method is found to be more accurate in terms of % error and root mean square % error and the results are in good accord with the measured values.

Speed-up of ab initio hybrid Monte Carlo and ab initio path integral hybrid Monte Carlo simulations by using an auxiliary potential energy surface

International Nuclear Information System (INIS)

Nakayama, Akira; Taketsugu, Tetsuya; Shiga, Motoyuki

2009-01-01

Efficiency of the ab initio hybrid Monte Carlo and ab initio path integral hybrid Monte Carlo methods is enhanced by employing an auxiliary potential energy surface that is used to update the system configuration via molecular dynamics scheme. As a simple illustration of this method, a dual-level approach is introduced where potential energy gradients are evaluated by computationally less expensive ab initio electronic structure methods. (author)

Resolution of concerns in auxiliary feedwater piping

International Nuclear Information System (INIS)

Bain, R.A.; Testa, M.F.

1994-01-01

Auxiliary feedwater piping systems at pressurized water reactor (PWR) nuclear power plants have experienced unanticipated operating conditions during plant operation. These unanticipated conditions have included plant events involving backleakage through check valves, temperatures in portions of the auxiliary feedwater piping system that exceed design conditions, and the occurrence of unanticipated severe fluid transients. The impact of these events has had an adverse effect at some nuclear stations on plant operation, installed plant components and hardware, and design basis calculations. Beaver Valley Unit 2, a three loop pressurized water reactor nuclear plant, has observed anomalies with the auxiliary feedwater system since the unit went operational in 1987. The consequences of these anomalies and plant events have been addressed and resolved for Beaver Valley Unit 2 by performing engineering and construction activities. These activities included pipe stress, pipe support and pipe rupture analysis, the monitoring of auxiliary feedwater system temperature and pressure, and the modification to plant piping, supports, valves, structures and operating procedures

Vacuum switchgear for power station auxiliary switchboards

International Nuclear Information System (INIS)

Coombs, P.E.

1992-01-01

Sizewell B is the first UK power station in which vacuum switchgear is used for the auxiliary switchboards. Previously the 3.3kV, 6.6kV or 11kV switchgear has used air-break circuit breakers and fused air-break contactors, known as motor starting devices or fused switching devices (FSD). The use of vacuum interrupters is therefore a new technology in this application, although it has been established in the UK distribution network and in industrial installations from the mid 1970s. Vacuum switchgear was already in use in the USA for power station auxiliary switchgear at the time that it was proposed for Sizewell B. The Sizewell B high voltage auxiliary switchgear comprises eight Unit and Station Auxiliary Switchboards at 3.3kV and 11kV, and four 3.3kV Essential Switchboards for the essential safety related circuits, making a total of 65 circuit breakers plus FSD panels. (Author)

30 CFR 57.22209 - Auxiliary fans (I-C mines).

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-C mines). 57.22209 Section 57... Standards for Methane in Metal and Nonmetal Mines Ventilation § 57.22209 Auxiliary fans (I-C mines). Electric auxiliary fans shall be approved by MSHA under the applicable requirements of 30 CFR part 18...

Improving Energy Efficiency of Auxiliaries

International Nuclear Information System (INIS)

Carl T. Vuk

2001-01-01

The summaries of this report are: Economics Ultimately Dictates Direction; Electric Auxiliaries Provide Solid Benefits. The Impact on Vehicle Architecture Will be Important; Integrated Generators With Combined With Turbo Generators Can Meet the Electrical Demands of Electric Auxiliaries; Implementation Will Follow Automotive 42V Transition; Availability of Low Cost Hardware Will Slow Implementation; Industry Leadership and Cooperation Needed; Standards and Safety Protocols Will be Important. Government Can Play an Important Role in Expediting: Funding Technical Development; Incentives for Improving Fuel Economy; Developing Standards, Allowing Economy of Scale; and Providing Safety Guidelines

The impact of dual-source parallel radiofrequency transmission with patient-adaptive shimming on the cardiac magnetic resonance in children at 3.0 T.

Science.gov (United States)

Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin

2017-06-01

The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.

Optimized auxiliary representation of non-Markovian impurity problems by a Lindblad equation

International Nuclear Information System (INIS)

Dorda, A; Sorantin, M; Linden, W von der; Arrigoni, E

2017-01-01

We present a general scheme to address correlated nonequilibrium quantum impurity problems based on a mapping onto an auxiliary open quantum system of small size. The infinite fermionic reservoirs of the original system are thereby replaced by a small number N B of noninteracting auxiliary bath sites whose dynamics are described by a Lindblad equation, which can then be exactly solved by numerical methods such as Lanczos or matrix-product states. The mapping becomes exponentially exact with increasing N B , and is already quite accurate for small N B . Due to the presence of the intermediate bath sites, the overall dynamics acting on the impurity site is non-Markovian. While in previous work we put the focus on the manybody solution of the associated Lindblad problem, here we discuss the mapping scheme itself, which is an essential part of the overall approach. On the one hand, we provide technical details together with an in-depth discussion of the employed algorithms, and on the other hand, we present a detailed convergence study. The latter clearly demonstrates the above-mentioned exponential convergence of the procedure with increasing N B . Furthermore, the influence of temperature and an external bias voltage on the reservoirs is investigated. The knowledge of the particular convergence behavior is of great value to assess the applicability of the scheme to certain physical situations. Moreover, we study different geometries for the auxiliary system. On the one hand, this is of importance for advanced manybody solution techniques such as matrix product states which work well for short-ranged couplings, and on the other hand, it allows us to gain more insights into the underlying mechanisms when mapping non-Markovian reservoirs onto Lindblad-type impurity problems. Finally, we present results for the spectral function of the Anderson impurity model in and out of equilibrium and discuss the accuracy obtained with the different geometries of the auxiliary system

The installation of helium auxiliary systems in HTGR

International Nuclear Information System (INIS)

Qin Zhenya; Fu Xiaodong

1993-01-01

The inert gas Helium was chosen as reactor coolant in high temperature gas coolant reactor, therefore a set of Special and uncomplex helium auxiliary systems will be installed, the safe operation of HTR-10 can be safeguarded. It does not effect the inherent safety of HTR-10 MW if any one of all those systems were damaged during operation condition. This article introduces the design function and the system principle of all helium auxiliary systems to be installed in HTR-10. Those systems include: helium purification and its regeneration system, helium supply and storage system, pressure control and release system of primary system, dump system for helium auxiliary system and fuel handling, gaseous waste storage system, water extraction system for helium auxiliary systems and evacuation system for primary system

Two-point active microrheology in a viscous medium exploiting a motional resonance excited in dual-trap optical tweezers

Science.gov (United States)

Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan

2018-04-01

Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.

Development of a universal dual-bolus injection scheme for the quantitative assessment of myocardial perfusion cardiovascular magnetic resonance

Directory of Open Access Journals (Sweden)

Alfakih Khaled

2011-05-01

Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined

Dual-Mode Dual-Band Microstrip Bandpass Filter Based on Fourth Iteration T-Square Fractal and Shorting Pin

Directory of Open Access Journals (Sweden)

E. S. Ahmed

2012-06-01

Full Text Available A new class of dual mode microstrip fractal resonator is proposed and developed for miniaturization of the dual band bandpass filter. The perimeter of the proposed resonator is increased by employing fourth iteration T-square fractal shape. Consequently the lower resonant frequency of the filter is decreased without increasing the usable space. The self similarity of the usable structure enables it to produce the two degenerate modes which are coupled using the proper perturbation technique. The shorting pin is placed at the null in the surface current distribution at the center of the resonator. This shorting pin is coactively coupled to the resonant circuit of the resonator, effectively coupled to the lower degenerate mode and reduces the lower edge band resonant frequency. By adjusting the resonator dimensions and the size of the shorting pin, the resonant frequency and the out-of-band rejection around the transmission bands can be controlled to meet the design requirements. The simulated response of the designed filter has two transmission bands, the first band is from 2.34-3.65 GHz with resonant frequencies at 2.47GHz and 3.55GHz, the second band is from 4.37-5.324GHz with resonant frequencies at 4.5GHz and 5.13GHz. In the pass bands, the group delay is less than 0.65 ns. The proposed filter can be applied to WLAN (2.4 GHz and 5.2 GHz and WiMAX (3.5 GHz and Bluetooth and ZigBee (4.9 GHz.

Intrinsically radiolabelled [59Fe]-SPIONs for dual MRI/radionuclide detection

OpenAIRE

Hoffman, David; Sun, Minghao; Yang, Likun; McDonagh, Philip R; Corwin, Frank; Sundaresan, Gobalakrishnan; Wang, Li; Vijayaragavan, Vimalan; Thadigiri, Celina; Lamichhane, Narottam; Zweit, Jamal

2014-01-01

Towards the development of iron oxide nanoparticles with intrinsically incorporated radionuclides for dual Positron Emission Tomography/Magnetic Resonance Imaging (PET/MRI) and more recently of Single Photon Emission Computed Tomography/Magnetic Resonance Imaging (SPECT/MRI), we have developed intrinsically radiolabeled [59Fe]-superparamagnetic iron oxide nanoparticles ([59Fe]-SPIONs) as a proof of concept for an intrinsic dual probe strategy. 59Fe was incorporated into Fe3O4 nanoparticle cry...

Development of 8 MW Power Supply Based on Pulse Step Modulation Technique for Auxiliary Heating System on HL-2A

International Nuclear Information System (INIS)

Xu Weidong; Xuan Weimin; Yao Lieying; Wang Yingqiao

2012-01-01

The high voltage power supply (HVPS) based on pulse step modulation (PSM) has already been developed for the auxiliary heating system on HL-2A. This power supply consists of many switch power supplies, and its output voltage can be obtained by modulating their delay time and pulse widths. The PSM topology and control principle are presented in this paper. The simple algorithms for the control system are explained clearly. The switch power supply (SPS) module has been built and the test results show it can meet the requirements of the auxiliary heating system. Now, 112 SPS modules and the whole system have already been developed. Its maximum output is about 72 kV/93 A. The protection time is less than 5 μs. The different outputs of this power supply are used for the electron cyclotron resonant heating (ECRH) system with different duty ratios. The experimental results of the entire system are presented. The results indicate that the whole system can meet the requirements of the auxiliary heating system on HL-2A.

47 CFR 74.601 - Classes of TV broadcast auxiliary stations.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 4 2010-10-01 2010-10-01 false Classes of TV broadcast auxiliary stations. 74... Television Broadcast Auxiliary Stations § 74.601 Classes of TV broadcast auxiliary stations. (a) TV pickup stations. A land mobile station used for the transmission of TV program material and related communications...

Integrated nanohole array surface plasmon resonance sensing device using a dual-wavelength source

International Nuclear Information System (INIS)

Escobedo, C; Vincent, S; Choudhury, A I K; Campbell, J; Gordon, R; Brolo, A G; Sinton, D

2011-01-01

In this paper, we demonstrate a compact integrated nanohole array-based surface plasmon resonance sensing device. The unit includes a LED light source, driving circuitry, CCD detector, microfluidic network and computer interface, all assembled from readily available commercial components. A dual-wavelength LED scheme was implemented to increase spectral diversity and isolate intensity variations to be expected in the field. The prototype shows bulk sensitivity of 266 pixel intensity units/RIU and a limit of detection of 6 × 10 −4 RIU. Surface binding tests were performed, demonstrating functionality as a surface-based sensing system. This work is particularly relevant for low-cost point-of-care applications, especially those involving multiple tests and field studies. While nanohole arrays have been applied to many sensing applications, and their suitability to device integration is well established, this is the first demonstration of a fully integrated nanohole array-based sensing device.

Effects of Auxiliary-Source Connection in Multichip Power Module

DEFF Research Database (Denmark)

Li, Helong; Munk-Nielsen, Stig; Wang, Xiongfei

2017-01-01

the power loop and the gate loop like how the Kelvin-source connection does, owing to their involvement in the loop of the power source current. Three effects of the auxiliary-source connections are then analyzed, which are 1) the common source stray inductance reduction, 2) the transient drain......Auxiliary-source bond wires and connections are widely used in power modules with paralleled MOSFETs or IGBTs. This paper investigates the operation mechanism of the auxiliary-source connections in multichip power modules. It reveals that the auxiliary-source connections cannot fully decouple......-source current imbalance mitigation, and 3) the influence on the steady-state current distribution. Lastly, simulations and experimental results validate the theoretical analysis....

30 CFR 57.8534 - Shutdown or failure of auxiliary fans.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Shutdown or failure of auxiliary fans. 57.8534... Ventilation Underground Only § 57.8534 Shutdown or failure of auxiliary fans. (a) Auxiliary fans installed and... fan maintenance or fan adjustments where air quality is maintained in compliance with the applicable...

White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 1: Technology and Terminology.

Science.gov (United States)

Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.

Auxiliary System Load Schemes in Large Thermal and Nuclear Power Plants

International Nuclear Information System (INIS)

Kuzle, I.; Bosnjak, D.; Pandzic, H.

2010-01-01

Uninterrupted auxiliary system power supply in large power plants is a key factor for normal operation, transient states, start-ups and shutdowns and particularly during fault conditions. Therefore, there are many challenges in designing the main electrical system as well as the auxiliary systems power supply. Depending upon the type of fuel used and the environmental control system required, a thermal power plant may consume as much as 10% of its total generation for auxiliary power, while a nuclear power plant may require only 4 - 6% auxiliaries. In general, the larger the power generating plant, the higher the voltage selected for the AC auxiliary electric system. Most stations in the 75 to 500 MW range utilize 4,2 kV as the base auxiliary system voltage. Large generating stations 500 - 1000 MW and more use voltage levels of 6,9 kV and more. Some single dedicated loads such as electric driven boiler feed pumps are supplied ba a 13,8 kV bus. While designing the auxiliary electric system, the following areas must be considered: motor starting requirements, voltage regulation requirements, short-circuit duty requirements, economic considerations, reliability and alternate sources. Auxiliary power supply can't be completely generalized and each situation should be studied on its own merits to determine the optimal solution. Naturally, nuclear power plants have more reliability requirements and safety design criteria. Main coolant-pump power supply and continuity of service to other vital loads deserve special attention. This paper presents an overview of some up-to-date power plant auxiliary load system concepts. The main types of auxiliary loads are described and the electric diagrams of the modern auxiliary system supply concepts are given. Various alternative sources of auxiliary electrical supply are considered, the advantages and disadvantages of these are compared and proposals are made for high voltage distribution systems around the thermal and nuclear plant

Nuclear reactor auxiliary heat removal system

International Nuclear Information System (INIS)

Thompson, R.E.; Pierce, B.L.

1977-01-01

An auxiliary heat removal system to remove residual heat from gas-cooled nuclear reactors is described. The reactor coolant is expanded through a turbine, cooled in a heat exchanger and compressed by a compressor before reentering the reactor coolant. The turbine powers both the compressor and the pump which pumps a second fluid through the heat exchanger to cool the reactor coolant. A pneumatic starter is utilized to start the turbine, thereby making the auxiliary heat removal system independent of external power sources

Builtin vs. auxiliary detection of extrapolation risk.

Energy Technology Data Exchange (ETDEWEB)

Munson, Miles Arthur; Kegelmeyer, W. Philip,

2013-02-01

A key assumption in supervised machine learning is that future data will be similar to historical data. This assumption is often false in real world applications, and as a result, prediction models often return predictions that are extrapolations. We compare four approaches to estimating extrapolation risk for machine learning predictions. Two builtin methods use information available from the classification model to decide if the model would be extrapolating for an input data point. The other two build auxiliary models to supplement the classification model and explicitly model extrapolation risk. Experiments with synthetic and real data sets show that the auxiliary models are more reliable risk detectors. To best safeguard against extrapolating predictions, however, we recommend combining builtin and auxiliary diagnostics.

14 CFR 25.1142 - Auxiliary power unit controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 25.1142... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Powerplant Powerplant Controls and Accessories § 25.1142 Auxiliary power unit controls. Means must be provided on the flight deck for starting...

14 CFR 23.1142 - Auxiliary power unit controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 23.1142... Powerplant Controls and Accessories § 23.1142 Auxiliary power unit controls. Means must be provided on the... power unit. [Doc. No. 26344, 58 FR 18974, Apr. 9, 1993] ...

14 CFR 29.1142 - Auxiliary power unit controls.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 29.1142... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Powerplant Powerplant Controls and Accessories § 29.1142 Auxiliary power unit controls. Means must be provided on the flight deck for starting...

Dedicated auxiliary power units for Hybrid Electric Vehicles

NARCIS (Netherlands)

Mourad, S.; Weijer, C.J.T. van de

1998-01-01

The use of a dedicated auxiliary power unit is essential to utilize the potential that hybrid vehicles offer for efficient and ultra-clean transportation. An example of a hybrid project at the TNO Road-Vehicles Research Institute shows the development and the results of a dedicated auxiliary power

Real-time biodetection using a smartphone-based dual-color surface plasmon resonance sensor

Science.gov (United States)

Liu, Qiang; Yuan, Huizhen; Liu, Yun; Wang, Jiabin; Jing, Zhenguo; Peng, Wei

2018-04-01

We proposed a compact and cost-effective red-green dual-color fiber optic surface plasmon resonance (SPR) sensor based on the smartphone. Inherent color selectivity of phone cameras was utilized for real-time monitoring of red and green color channels simultaneously, which can reduce the chance of false detection and improve the sensitivity. Because there are no external prisms, complex optical lenses, or diffraction grating, simple optical configuration is realized. It has a linear response in a refractive index range of 1.326 to 1.351 (R2 = 0.991) with a resolution of 2.3 × 10 - 4 RIU. We apply it for immunoglobulin G (IgG) concentration measurement. Experimental results demonstrate that a linear SPR response was achieved for IgG concentrations varying from 0.02 to 0.30 mg / ml with good repeatability. It may find promising applications in the fields of public health and environment monitoring owing to its simple optics design and applicability in real-time, label-free biodetection.

Nuclear reactors with auxiliary boiler circuit

International Nuclear Information System (INIS)

George, B.V.; Cook, R.K.

1976-01-01

A gas-cooled nuclear reactor has a main circulatory system for the gaseous coolant incorporating one or more main energy converting units, such as gas turbines, and an auxiliary circulatory system for the gaseous coolant incorporating at least one steam generating boiler arranged to be heated by the coolant after its passage through the reactor core to provide steam for driving an auxiliary steam turbine, such an arrangement providing a simplified start-up procedure also providing emergency duties associated with long term heat removal on reactor shut down

Transport in Auxiliary Heated NSTX Discharges

International Nuclear Information System (INIS)

LeBlanc, B.P.; Bell, M.G.; Bell, R.E.; Bitte, M.L.; Bourdelle, C.; Gates, D.A.; Kaye, S.M.; Maingi, R.; Menard, J.E.; Mueller, D.; Ono, M.; Paul, S.F.; Redi, M.H.; Roquemore, A.L.; Rosenberg, A.; Sabbagh, S.A.; Stutman, D.; Synakowski, E.J.; Soukhanovskii, V.A.; Wilson, J.R.

2003-01-01

The NSTX spherical torus (ST) provides a unique platform to investigate magnetic confinement in auxiliary-heated plasmas at low aspect ratio. Auxiliary power is routinely coupled to ohmically heated plasmas by deuterium neutral-beam injection (NBI) and by high-harmonic fast waves (HHFW) launch. While theory predicts both techniques to preferentially heat electrons, experiment reveals the electron temperature is greater than the ion temperature during HHFW, but the electron temperature is less than the ion temperature during NBI. In the following we present the experimental data and the results of transport analyses

PS auxiliary magnet

CERN Multimedia

CERN PhotoLab

1974-01-01

Units of the PS auxiliary magnet system. The picture shows how the new dipoles, used for vertical and horizontal high-energy beam manipulation, are split for installation and removal so that it is not necessary to break the accelerator vacuum. On the right, adjacent to the sector valve and the windings of the main magnet, is an octupole of the set.

The English Primary Auxiliary Verbs: A Linguistic Theoretical Exercise

African Journals Online (AJOL)

Nekky Umera

Abstract. Obviously, the fact remains that English Language is a sensitive Language ... Even though the English auxiliary verbs are of two kinds: Primary and Modal auxiliary ..... Therefore we are of the opinion that most speakers lack adequate.

Major factors in critical equipment reliability - Auxiliary systems; The development of an auxiliary system

International Nuclear Information System (INIS)

Forsthoffer, W.E.

1992-01-01

In this article, the author details the development of an actual auxiliary system in order to fully understand the function of each major component and how it contributes to the total operation and reliability of the system. Only after the function of an auxiliary system is thoroughly understood, can one proceed to discuss specifications, design audits, testing, operation and preventive maintenance. The application selected will be to develop a pressurized lubrication and steam turbine control oil system for the critical equipment unit. This example was selected since many readers will be familiar with this type and because it provides a good foundation towards understanding fluid sealing systems. In the exercise that follow, he will define the system requirements and determine the system parameters. This information will then be used for component sizing

Dual formulation of covariant nonlinear duality-symmetric action of kappa-symmetric D3-brane

Science.gov (United States)

Vanichchapongjaroen, Pichet

2018-02-01

We study the construction of covariant nonlinear duality-symmetric actions in dual formulation. Essentially, the construction is the PST-covariantisation and nonlinearisation of Zwanziger action. The covariantisation made use of three auxiliary scalar fields. Apart from these, the construction proceed in a similar way to that of the standard formulation. For example, the theories can be extended to include interactions with external fields, and that the theories possess two local PST symmetries. We then explicitly demonstrate the construction of covariant nonlinear duality-symmetric actions in dual formulation of DBI theory, and D3-brane. For each of these theories, the twisted selfduality condition obtained from duality-symmetric actions are explicitly shown to match with the duality relation between field strength and its dual from the one-potential actions. Their on-shell actions between the duality-symmetric and the one-potential versions are also shown to match. We also explicitly prove kappa-symmetry of the covariant nonlinear duality-symmetric D3-brane action in dual formulation.

Auxiliary bearing design considerations for gas cooled reactors

International Nuclear Information System (INIS)

Penfield, S.R. Jr.; Rodwell, E.

2001-01-01

The need to avoid contamination of the primary system, along with other perceived advantages, has led to the selection of electromagnetic bearings (EMBs) in most ongoing commercial-scale gas cooled reactor (GCR) designs. However, one implication of magnetic bearings is the requirement to provide backup support to mitigate the effects of failures or overload conditions. The demands on these auxiliary or 'catcher' bearings have been substantially escalated by the recent development of direct Brayton cycle GCR concepts. Conversely, there has been only limited directed research in the area of auxiliary bearings, particularly for vertically oriented turbomachines. This paper explores the current state-of-the-art for auxiliary bearings and the implications for current GCR designs. (author)

Energy consumption of auxiliary systems of electric cars

Directory of Open Access Journals (Sweden)

Evtimov Ivan

2017-01-01

Full Text Available The paper analyzes the power demand of the auxiliary systems of electric cars. On the basis of existing electric cars an analysis of energy consumption of different auxiliary systems is done. As a result possibilities for rational use of these systems have been proposed, which can increase the mileage per one charge of the battery.

Optimization of feed water control for auxiliary boiler

International Nuclear Information System (INIS)

Li Lingmao

2004-01-01

This paper described the feed water control system of the auxiliary boiler steam drum in Qinshan Phase III Nuclear Power Plant, analyzed the deficiency of the original configuration, and proposed the optimized configuration. The optimized feed water control system can ensure the stable and safe operation of the auxiliary boiler, and the normal operation of the users. (author)

Study on 3D printer production of auxiliary device for upper limb for medical imaging test

Energy Technology Data Exchange (ETDEWEB)

Kim, Hyeong Gyun [Dept. of Radiological Science, Far East University, Eumsung (Korea, Republic of); Yoon, Jae Ho [Jukwang Precision Co., Ltd., Gumi (Korea, Republic of); Choi, Seong Dae [Dept. of Mechanical system engineering, Kumoh Institute of Technology, Gumi (Korea, Republic of)

2015-12-15

There is a progressive development in the medical imaging technology, especially of descriptive capability for anatomical structure of human body thanks to advancement of information technology and medical devices. But however maintenance of correct posture is essential for the medical imaging checkup on the shoulder joint requiring rotation of the upper limb due to the complexity of human body. In the cases of MRI examination, long duration and fixed posture are critical, as failure to comply with them leads to minimal possibility of reproducibility only with the efforts of the examiner and will of the patient. Thus, this study aimed to develop an auxiliary device that enables rotation of the upper limb as well as fixing it at quantitative angles for medical imaging examination capable of providing diagnostic values. An auxiliary device has been developed based on the results of precedent studies, by designing a 3D model with the CATIA software, an engineering application, and producing it with the 3D printer. The printer is Objet350 Connex from Stratasys, and acrylonitrile- butadiene-styrene(ABS) is used as the material of the device. Dimensions are 120 X 150 X 190 mm, with the inner diameter of the handle being 125.9 mm. The auxiliary device has 4 components including the body (outside), handle (inside), fixture terminal and the connection part. The body and handle have the gap of 2.1 mm for smooth rotation, while the 360 degree of scales have been etched on the handle so that the angle required for observation may be recorded per patient for traceability and dual examination.

Study on 3D printer production of auxiliary device for upper limb for medical imaging test

International Nuclear Information System (INIS)

Kim, Hyeong Gyun; Yoon, Jae Ho; Choi, Seong Dae

2015-01-01

There is a progressive development in the medical imaging technology, especially of descriptive capability for anatomical structure of human body thanks to advancement of information technology and medical devices. But however maintenance of correct posture is essential for the medical imaging checkup on the shoulder joint requiring rotation of the upper limb due to the complexity of human body. In the cases of MRI examination, long duration and fixed posture are critical, as failure to comply with them leads to minimal possibility of reproducibility only with the efforts of the examiner and will of the patient. Thus, this study aimed to develop an auxiliary device that enables rotation of the upper limb as well as fixing it at quantitative angles for medical imaging examination capable of providing diagnostic values. An auxiliary device has been developed based on the results of precedent studies, by designing a 3D model with the CATIA software, an engineering application, and producing it with the 3D printer. The printer is Objet350 Connex from Stratasys, and acrylonitrile- butadiene-styrene(ABS) is used as the material of the device. Dimensions are 120 X 150 X 190 mm, with the inner diameter of the handle being 125.9 mm. The auxiliary device has 4 components including the body (outside), handle (inside), fixture terminal and the connection part. The body and handle have the gap of 2.1 mm for smooth rotation, while the 360 degree of scales have been etched on the handle so that the angle required for observation may be recorded per patient for traceability and dual examination

Dynamic Breast Magnetic Resonance Imaging without Complications in a Patient with Dual-Chamber Demand Pacemaker

International Nuclear Information System (INIS)

Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M.

2006-01-01

Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma

Dynamic Breast Magnetic Resonance Imaging without Complications in a Patient with Dual-Chamber Demand Pacemaker

Energy Technology Data Exchange (ETDEWEB)

Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M. [Policlinico San Donato, San Donato Milanese, Milan (Italy). Depts. of Radiology, Arrhythmia and Electrophysiology Center

2006-02-15

Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma.

Parallel Auxiliary Space AMG Solver for $H(div)$ Problems

Energy Technology Data Exchange (ETDEWEB)

Kolev, Tzanio V. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vassilevski, Panayot S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

2012-12-18

We present a family of scalable preconditioners for matrices arising in the discretization of $H(div)$ problems using the lowest order Raviart--Thomas finite elements. Our approach belongs to the class of “auxiliary space''--based methods and requires only the finite element stiffness matrix plus some minimal additional discretization information about the topology and orientation of mesh entities. Also, we provide a detailed algebraic description of the theory, parallel implementation, and different variants of this parallel auxiliary space divergence solver (ADS) and discuss its relations to the Hiptmair--Xu (HX) auxiliary space decomposition of $H(div)$ [SIAM J. Numer. Anal., 45 (2007), pp. 2483--2509] and to the auxiliary space Maxwell solver AMS [J. Comput. Math., 27 (2009), pp. 604--623]. Finally, an extensive set of numerical experiments demonstrates the robustness and scalability of our implementation on large-scale $H(div)$ problems with large jumps in the material coefficients.

Auxiliary partial liver transplantation

NARCIS (Netherlands)

C.B. Reuvers (Cornelis Bastiaan)

1986-01-01

textabstractIn this thesis studies on auxiliary partial liver transplantation in the dog and the pig are reported. The motive to perform this study was the fact that patients with acute hepatic failure or end-stage chronic liver disease are often considered to form too great a risk for successful

Highly sensitive digital optical sensor with large measurement range based on the dual-microring resonator with waveguide-coupled feedback

International Nuclear Information System (INIS)

Xiang Xing-Ye; Wang Kui-Ru; Yuan Jin-Hui; Jin Bo-Yuan; Sang Xin-Zhu; Yu Chong-Xiu

2014-01-01

We propose a novel high-performance digital optical sensor based on the Mach—Zehnder interferential effect and the dual-microring resonators with the waveguide-coupled feedback. The simulation results show that the sensitivity of the sensor can be orders of magnitude higher than that of a conventional sensor, and high quality factor is not critical in it. Moreover, by optimizing the length of the feedback waveguide to be equal to the perimeter of the ring, the measurement range of the proposed sensor is twice as much as that of the conventional sensor in the weak coupling case

Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency

Directory of Open Access Journals (Sweden)

C. Baccouch

2016-11-01

Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally   it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.

Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors

Science.gov (United States)

Deen, David A.; Osinsky, Andrei; Miller, Ross

2014-03-01

A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection.

Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors

International Nuclear Information System (INIS)

Deen, David A.; Osinsky, Andrei; Miller, Ross

2014-01-01

A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection

Bimodal wireless sensing with dual-channel wide bandgap heterostructure varactors

Energy Technology Data Exchange (ETDEWEB)

Deen, David A.; Osinsky, Andrei; Miller, Ross [Agnitron Technology Incorporated, Eden Prairie, Minnesota 55346 (United States)

2014-03-03

A capacitive wireless sensing scheme is developed that utilizes an AlN/GaN-based dual-channel varactor. The dual-channel heterostructure affords two capacitance plateaus within the capacitance-voltage (CV) characteristic, owing to the two parallel two-dimensional electron gases (2DEGs) located at respective AlN/GaN interfaces. The capacitance plateaus are leveraged for the definition of two resonant states of the sensor when implemented in an inductively-coupled resonant LRC network for wireless readout. The physics-based CV model is compared with published experimental results, which serve as a basis for the sensor embodiment. The bimodal resonant sensor is befitting for a broad application space ranging from gas, electrostatic, and piezoelectric sensors to biological and chemical detection.

Design and scope of impact of auxiliary lanes : technical report.

Science.gov (United States)

2014-06-01

For decades, Texas Department of Transportation districts have constructed auxiliary lanes to support interchange : ramp operations and to resolve congestion proximate to freeway entrance and exit ramps. While auxiliary lanes are : built throughout T...

In Vivo Dual-Modality Fluorescence and Magnetic Resonance Imaging-Guided Lymph Node Mapping with Good Biocompatibility Manganese Oxide Nanoparticles

Directory of Open Access Journals (Sweden)

Yonghua Zhan

2017-12-01

Full Text Available Multifunctional manganese oxide nanoparticles (NPs with impressive enhanced T1 contrast ability show great promise in biomedical diagnosis. Herein, we developed a dual-modality imaging agent system based on polyethylene glycol (PEG-coated manganese oxide NPs conjugated with organic dye (Cy7.5, which functions as a fluorescence imaging (FI agent as well as a magnetic resonance imaging (MRI imaging agent. The formed Mn3O4@PEG-Cy7.5 NPs with the size of ~10 nm exhibit good colloidal stability in different physiological media. Serial FI and MRI studies that non-invasively assessed the bio-distribution pattern and the feasibility for in vivo dual-modality imaging-guided lymph node mapping have been investigated. In addition, histological and biochemical analyses exhibited low toxicity even at a dose of 20 mg/kg in vivo. Since Mn3O4@PEG-Cy7.5 NPs exhibited desirable properties as imaging agents and good biocompatibility, this work offers a robust, safe, and accurate diagnostic platform based on manganese oxide NPs for tumor metastasis diagnosis.

Probabilistic cloning with supplementary information contained in the quantum states of two auxiliary systems

International Nuclear Information System (INIS)

Li, Lvjun; Qiu, Daowen

2007-01-01

In probabilistic cloning with two auxiliary systems, we consider and compare three different protocols for the success probabilities of cloning. We show that, in certain circumstances, it may increase the success probability to add an auxiliary system to the probabilistic cloning machine having one auxiliary system, but we always can find another cloning machine with one auxiliary system having the same success probability as that with two auxiliary systems

On-chip dual comb source for spectroscopy

OpenAIRE

Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L.; Lipson, Michal

2016-01-01

Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high-quality-factor microcavities has hindered the development of an on-chip dual comb source. Here, we report the first simultaneous generation of two microresonator comb...

Eigenstates with the auxiliary field method

Energy Technology Data Exchange (ETDEWEB)

Semay, Claude [Service de Physique Nucleaire et Subnucleaire, Universite de Mons-UMONS, 20 Place du Parc, 7000 Mons (Belgium); Silvestre-Brac, Bernard, E-mail: claude.semay@umons.ac.b, E-mail: silvestre@lpsc.in2p3.f [LPSC Universite Joseph Fourier, Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, Avenue des Martyrs 53, F-38026 Grenoble-Cedex (France)

2010-07-02

The auxiliary field method is a powerful technique to obtain approximate closed-form energy formulas for eigenequations in quantum mechanics. Very good results can be obtained for Schroedinger and semirelativistic Hamiltonians with various potentials, even in the case of many-body problems. This method can also provide approximate eigenstates in terms of well-known wavefunctions, for instance harmonic oscillator or hydrogen-like states, but with a characteristic size which depends on quantum numbers. In this paper, we consider two-body Schroedinger equations with linear, logarithmic and exponential potentials and show that analytical approximations of the corresponding eigenstates can be obtained with the auxiliary field method, with very good accuracy in some cases.

Eigenstates with the auxiliary field method

International Nuclear Information System (INIS)

Semay, Claude; Silvestre-Brac, Bernard

2010-01-01

The auxiliary field method is a powerful technique to obtain approximate closed-form energy formulas for eigenequations in quantum mechanics. Very good results can be obtained for Schroedinger and semirelativistic Hamiltonians with various potentials, even in the case of many-body problems. This method can also provide approximate eigenstates in terms of well-known wavefunctions, for instance harmonic oscillator or hydrogen-like states, but with a characteristic size which depends on quantum numbers. In this paper, we consider two-body Schroedinger equations with linear, logarithmic and exponential potentials and show that analytical approximations of the corresponding eigenstates can be obtained with the auxiliary field method, with very good accuracy in some cases.

S-matrix for the theories that admit closure of the algebra with the aid of auxiliary fields. Auxiliary fields in supergravity. [Word identities

Energy Technology Data Exchange (ETDEWEB)

Fradkin, E S; Vasiliev, M A [AN SSSR, Moscow. Fizicheskij Inst.

1978-08-19

A minimal set of auxiliary fields (scalarpseudoscalar and pseudovector) providing the closed algebra in supergravity is constructed. A compact scheme for the generating functional with closed gauge algebra is proposed. The S-matrix and the Ward identities for arbitrary theory that admits the closing of the algebra by introducing auxiliary fields is obtained.

Operation auxiliary system (SAO)

International Nuclear Information System (INIS)

Lolich, J.; Santome, D.; Drexler, J.

1990-01-01

This work presents an auxiliary system for nuclear power plants operation (SAO). The development purpose consisted in a computing supervision system to be installed at different sites of a reactor, mainly in the control room. The inclusion of this system to a nuclear power plant minimizes the possibility of human error for the facility operation. (Author) [es

Auxiliary bearing design and rotor dynamics analysis of blower fan for HTR-10

International Nuclear Information System (INIS)

Gao Mingshan; Yang Guojun; Xu Yang; Zhao Lei; Yu Suyuan

2005-01-01

The electromagnetic bearing instead of ordinary mechanical bearing was chosen to support the rotor in the blower fan system with helium of 10 MW high temperature gas-cooled test reactor (HTR-10), and the auxiliary bearing was applied in the HTR-10 as the backup protector. When the electromagnetic bearing doesn't work suddenly for the power broken, the auxiliary bearing is used to support the falling rotor with high rotating speed. The rotor system will be protected by the auxiliary bearing. The design of auxiliary bearing is the ultimate safeguard for the system. This rotor is vertically mounted to hold the blower fan. The rotor's length is about 1.5 m, its weight is about 240 kg and the rotating speed is about 5400 r/min. Auxiliary bearing design and rotor dynamics analysis are very important for the design of blower fan to make success. The research status of the auxiliary bearing was summarized in the paper. A sort of auxiliary bearing scheme was proposed. MSC.Marc was selected to analyze the vibration mode and the natural frequency of the rotor. The scheme design of auxiliary bearing and analysis result of rotor dynamics offer the important theoretical base for the protector design and control system of electromagnetic bearing of the blower fan. (authors)

The Range of Gapping and the Status of Auxiliaries.

Science.gov (United States)

Warner, A. R.

Full verbs and auxiliaries are subject to gapping. In the simplest cases, this construction type involves apparent ellipsis within one or more clausal conjuncts under identity with the finite verb or auxiliary of a preceding conjunct. It has often been suggested that the apparent ellipsis must involve at least a verb. Some researchers see in the…

Auxiliary office chair

OpenAIRE

Pascual Osés, Maite

2007-01-01

The aim of this project is to develop an auxiliary office chair, which favorably will compete with the existing chairs on the market. Evolutions of ergonomical survey in the work environment and on the configuration of offices require new products which fulfill the requirements properly. In order to achieve it a survey about office chairs has been carried out: types, characteristics, ways of usage and products on the market besides a large antropometrical study and ergonomics related to work ...

Induced dual EIT and EIA resonances with optical trapping phenomenon in near/far fields in the N-type four-level system

Science.gov (United States)

Osman, Kariman I.; Joshi, Amitabh

2017-01-01

The optical trapping phenomenon is investigated in the probe absorptive susceptibility spectra, during the interaction of four-level N-type atomic system with three transverse Gaussian fields, in a Doppler broadened medium. The system was studied under different temperature settings of 87Rb atomic vapor as well as different non-radiative decay rate. The system exhibits a combination of dual electromagnetically induced transparency with electromagnetically induced absorption (EIA) or transparency (EIT) resonances simultaneously in near/far field. Also, the optical trapping phenomenon is considerably affected by the non-radiative decay rate.

The relationship among the solutions of two auxiliary ordinary differential equations

International Nuclear Information System (INIS)

Liu Xiaoping; Liu Chunping

2009-01-01

In a recent article [Phys. Lett. A 356 (2006) 124], Sirendaoreji extended their auxiliary equation method by introducing a new auxiliary ordinary differential equation (NAODE) and its 14 solutions. Then the author studied some nonlinear evolution equations (NLEEs) and got more exact travelling wave solutions. In this paper, we will show that the 14 solutions of the NAODE are actually the same as the solutions obtained by original auxiliary equation method, and they are only different in the form.

Simplified technique for auxiliary orthotopic liver transplantation using a whole graft

Science.gov (United States)

ROCHA-SANTOS, Vinicius; NACIF, Lucas Souto; PINHEIRO, Rafael Soares; DUCATTI, Liliana; ANDRAUS, Wellington; D'ALBURQUERQUE, Luiz Carneiro

2015-01-01

Background Acute liver failure is associated with a high mortality rate and the main purposes of treatment are to prevent cerebral edema and infections, which often are responsible for patient death. The orthotopic liver transplantation is the gold standard treatment and improves the 1-year survival. Aim To describe an alternative technique to auxiliary liver transplant on acute liver failure. Method Was performed whole auxiliary liver transplantation as an alternative technique for a partial auxiliary liver transplantation using a whole liver graft from a child removing the native right liver performed a right hepatectomy. The patient met the O´Grady´s criteria and the rational to indicate an auxiliary orthotopic liver transplantation was the acute classification without hemodynamic instability or renal failure in a patient with deterioration in consciousness. Results The procedure improved liver function and decreased intracranial hypertension in the postoperative period. Conclusion This technique can overcome some postoperative complications that are associated with partial grafts. As far as is known, this is the first case of auxiliary orthotopic liver transplantation in Brazil. PMID:26176253

Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

Directory of Open Access Journals (Sweden)

Devender Singh

2016-12-01

Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

Window-mounted auxiliary solar heater

Science.gov (United States)

Anthony, K. G.; Herndon, E. P.

1977-01-01

System uses hot-air collectors, no thermal storage, and fan with thermostat switches. At cost of heating efficiency, unit could be manufactured and sold at price allowing immediate entry to market as auxiliary heating system. Its simplicity allows homeowner installation, and maintenance is minimal.

Auxiliary basis expansions for large-scale electronic structure calculations.

Science.gov (United States)

Jung, Yousung; Sodt, Alex; Gill, Peter M W; Head-Gordon, Martin

2005-05-10

One way to reduce the computational cost of electronic structure calculations is to use auxiliary basis expansions to approximate four-center integrals in terms of two- and three-center integrals, usually by using the variationally optimum Coulomb metric to determine the expansion coefficients. However, the long-range decay behavior of the auxiliary basis expansion coefficients has not been characterized. We find that this decay can be surprisingly slow. Numerical experiments on linear alkanes and a toy model both show that the decay can be as slow as 1/r in the distance between the auxiliary function and the fitted charge distribution. The Coulomb metric fitting equations also involve divergent matrix elements for extended systems treated with periodic boundary conditions. An attenuated Coulomb metric that is short-range can eliminate these oddities without substantially degrading calculated relative energies. The sparsity of the fit coefficients is assessed on simple hydrocarbon molecules and shows quite early onset of linear growth in the number of significant coefficients with system size using the attenuated Coulomb metric. Hence it is possible to design linear scaling auxiliary basis methods without additional approximations to treat large systems.

Cy5.5 conjugated MnO nanoparticles for magnetic resonance/near-infrared fluorescence dual-modal imaging of brain gliomas.

Science.gov (United States)

Chen, Ning; Shao, Chen; Li, Shuai; Wang, Zihao; Qu, Yanming; Gu, Wei; Yu, Chunjiang; Ye, Ling

2015-11-01

The fusion of molecular and anatomical modalities facilitates more reliable and accurate detection of tumors. Herein, we prepared the PEG-Cy5.5 conjugated MnO nanoparticles (MnO-PEG-Cy5.5 NPs) with magnetic resonance (MR) and near-infrared fluorescence (NIRF) imaging modalities. The applicability of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe for the detection of brain gliomas was investigated. In vivo MR contrast enhancement of the MnO-PEG-Cy5.5 nanoprobe in the tumor region was demonstrated. Meanwhile, whole-body NIRF imaging of glioma bearing nude mouse exhibited distinct tumor localization upon injection of MnO-PEG-Cy5.5 NPs. Moreover, ex vivo CLSM imaging of the brain slice hosting glioma indicated the preferential accumulation of MnO-PEG-Cy5.5 NPs in the glioma region. Our results therefore demonstrated the potential of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe in improving the diagnostic efficacy by simultaneously providing anatomical information from deep inside the body and more sensitive information at the cellular level. Copyright © 2015 Elsevier Inc. All rights reserved.

Reactor auxiliary cooling facility and coolant supplying method therefor

International Nuclear Information System (INIS)

Ando, Koji; Kinoshita, Shoichiro.

1996-01-01

A reactor auxiliary cooling facility of the present invention comprises a coolant recycling line for recycling coolants by way of a reactor auxiliary coolant pump and a cooling load, a gravitational surge tank for supplying coolants to the coolant recycling line and a supplemental water supplying line for supplying a supply the supplemental water to the tank. Then, a pressurization-type supply water surge tank is disposed for operating the coolant recycling line upon performing an initial system performance test in parallel with the gravitational surge tank. With such a constitution, the period of time required from the start of the installation of reactor auxiliary cooling facilities to the completion of the system performance test can be shortened at a reduced cost without enlarging the scale of the facility. (T.M.)

Reactor auxiliary cooling facility and coolant supplying method therefor

Energy Technology Data Exchange (ETDEWEB)

Ando, Koji; Kinoshita, Shoichiro

1996-06-07

A reactor auxiliary cooling facility of the present invention comprises a coolant recycling line for recycling coolants by way of a reactor auxiliary coolant pump and a cooling load, a gravitational surge tank for supplying coolants to the coolant recycling line and a supplemental water supplying line for supplying a supply the supplemental water to the tank. Then, a pressurization-type supply water surge tank is disposed for operating the coolant recycling line upon performing an initial system performance test in parallel with the gravitational surge tank. With such a constitution, the period of time required from the start of the installation of reactor auxiliary cooling facilities to the completion of the system performance test can be shortened at a reduced cost without enlarging the scale of the facility. (T.M.)

Goal programming for cyclical auxiliary police scheduling at UiTM Cawangan Perlis

Science.gov (United States)

Mustapar, Wasilatul Effah; Nasir, Diana Sirmayunie Mohd; Nor, Nor Azriani Mohamad; Abas, Sharifah Fhahriyah Syed

2017-11-01

Constructing a good and fair schedule for shift workers poses a great challenge as it requires a lot of time and effort. In this study, goal programming has been applied on scheduling to achieve the hard and soft constraints for a cyclical schedule that would ease the head of auxiliary police at building new schedules. To accomplish this goal, shift types were assigned in order to provide a fair schedule that takes into account the auxiliary police's policies and preferences. The model was run using Lingo software. Three out of four goals set for the study were achieved. In addition, the results considered an equal allocation for every auxiliary police, namely 70% for total duty and 30% for the day. Furthermore, the schedule was able to cyclically generate another 10 sets schedule. More importantly, the model has provided unbiased scheduling of auxiliary policies which led to high satisfaction in auxiliary police management.

Minimal set of auxiliary fields and S-matrix for extended supergravity

Energy Technology Data Exchange (ETDEWEB)

Fradkin, E S; Vasiliev, M A [Physical Lebedev Institute - Moscow

1979-05-19

Minimal set of auxiliary fields for linearized SO(2) supergravity and one-parameter extension of the minimal auxiliary fields in the SO(1) supergravity are constructed. The expression for the S-matrix in SO(2) supergravity are given.

Design of high power solid-state pulsed laser resonators

International Nuclear Information System (INIS)

Narro, R.; Ponce, L.; Arronte, M.

2009-01-01

Methods and configurations for the design of high power solid-state pulsed laser resonators, operating in free running, are presented. For fundamental mode high power resonators, a method is proposed for the design of a resonator with joined stability zones. In the case of multimode resonators, two configurations are introduced for maximizing the laser overall efficiency due to the compensation of the astigmatism induced by the excitation. The first configuration consists in a triangular ring resonator. The results for this configuration are discussed theoretically, showing that it is possible to compensate the astigmatism of the thermal lens virtually in a 100%; however this is only possible for a specific pumping power. The second configuration proposes a dual-active medium resonator, rotated 90 degree one from the other around the optical axis, where each active medium acts as an astigmatic lens of the same dioptric power. The reliability of this configuration is corroborated experimentally using a Nd:YAG dual-active medium resonator. It is found that in the pumping power range where the astigmatism compensation is possible, the overall efficiency is constant, even when increasing the excitation power with the consequent increase of the thermal lens dioptric power. (Author)

BE, DO, and Modal Auxiliaries of 3-Year-Old African American English Speakers

Science.gov (United States)

Newkirk-Turner, Brandi L.; Oetting, Janna B.; Stockman, Ida J.

2014-01-01

Purpose: This study examined African American English--speaking children's use of BE, DO, and modal auxiliaries. Method: The data were based on language samples obtained from 48 three-year-olds. Analyses examined rates of marking by auxiliary type, auxiliary surface form, succeeding element, and syntactic construction and by a number of child…

A ZVT–ZCT PWM synchronous buck converter with a simple passive auxiliary circuit for reduction of losses and efficiency enhancement

Directory of Open Access Journals (Sweden)

S. Shiva Kumar

2015-06-01

Full Text Available In this paper, a Zero-Voltage-Transition (ZVT–Zero-Current Transition (ZCT Pulse-width Modulated (PWM synchronous buck converter (SBC, with a simple passive auxiliary circuit is proposed, which reduces the stresses and improves the efficiency by pacifying the conduction losses compared to a traditional PWM converter, typically suitable for photovoltaic applications. The important design feature of ZVT–ZCT PWM SBC converters is placement of resonant components that mollifies the conduction losses. Due to the ZVT–ZCT, the resonant components with low values are used, thereby resulting in the increase of switching frequency. The ZVT–ZCT operation of the proposed converter is presented through theoretical analysis. The characteristics of the proposed converter are verified with the simulation in the PSIM co-simulated with MATLAB/SIMULINK environment and implemented experimentally.

Operating experiences and degradation detection for auxiliary feedwater systems

International Nuclear Information System (INIS)

Casada, D.; Farmer, W.S.

1992-01-01

A study of Pressurized Water Reactor Auxiliary Feedwater (AFW) Systems has been conducted by Oak Ridge National Laboratory (ORNL) under the auspices of the Nuclear Regulatory Commission's Nuclear Plant Aging Research Program. The results of the study are documented in NUREG/CR-5404, Vol. 1, Auxiliary Feedwater System Aging Study. The study reviewed historical failure experience and current monitoring practices for the AFW System. This paper provides an overview of the study approach and results

Modified Darboux transformations with foreign auxiliary equations

International Nuclear Information System (INIS)

Schulze-Halberg, Axel

2011-01-01

We construct a new type of first-order Darboux transformations for the stationary Schroedinger equation. In contrast to the conventional case, our Darboux transformations support arbitrary (foreign) auxiliary equations. We show that among other applications, our formalism can be used to systematically construct Darboux transformations for Schroedinger equations with energy-dependent potentials, including a recent result (Lin et al., 2007) as a special case. -- Highlights: → We generalize the Darboux transformation for the Schroedinger equation. → By admitting arbitrary auxiliary functions, we provide a new tool for generating solutions. → As a special case we recover a recent result on energy-dependent potentials. → We extend the latter result to very general energy-dependence.

Moment approach to neoclassical flows, currents and transport in auxiliary heated tokamaks

International Nuclear Information System (INIS)

Kim, Yil Bong.

1988-02-01

The moment approach is utilized to derive the full complement of neoclassical transport processes in auxiliary heated tokamaks. The effects of auxiliary heating [neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH)] considered arise from the collisional interaction between the background plasma species and the fast-ion-tail species. From a known fast ion distribution function we evaluate the parallel (to the magnetic field) momentum and heat flow inputs to the background plasma. Then, through the momentum and heat flow balance equations, we can determine the induced parallel flows (and current) and radial transpot fluxes in ''equilibrium'' (on the time scale much longer than the collisional relaxation time, i.e., t >> 1ν/sub ii/). In addition to the fast-ion-induced current, the total neoclassical current includes the boostap current, which is driven by the pressure and temperature gradients, the Pfirsch-Schlueter current which is required for charge neutrality, and the neoclassical (including trapped particle effects) Spitzer current due to the parallel electric field. The radial transport fluxes also include off-diagonal compnents in the transport matrix which correspond to the Ware (neoclassical) pinch due to the inductive applied electric field an the fast-ion-induced radial fluxes, in addition to the usual pressure- and temperature-gradient-driven fluxes (particle diffusion and heat conduction). Once the tranport coefficient are completely determined, the radial fluxes and the heat fluxes can be substituted into the density and energy evolution equations to provide a complete description of ''equilibrium'' (δδt << ν/sub ii/) neoclassical transport processes in a plasma. 47 refs., 14 figs

Dummy auxiliaries in child and adult second language acquisition of Dutch

NARCIS (Netherlands)

Blom, W.B.T.; de Korte, S.

2011-01-01

In previous research it has been observed that second language (L2) learners of Dutch and German use analytic verbs in contexts where the target language requires synthetic verbs. These analytic verbs consist of a semantically empty auxiliary (dummy auxiliary) that selects a lexical infinitive. In

Extensions of the auxiliary field method to solve Schroedinger equations

International Nuclear Information System (INIS)

Silvestre-Brac, Bernard; Semay, Claude; Buisseret, Fabien

2008-01-01

It has recently been shown that the auxiliary field method is an interesting tool to compute approximate analytical solutions of the Schroedinger equation. This technique can generate the spectrum associated with an arbitrary potential V(r) starting from the analytically known spectrum of a particular potential P(r). In the present work, general important properties of the auxiliary field method are proved, such as scaling laws and independence of the results on the choice of P(r). The method is extended in order to find accurate analytical energy formulae for radial potentials of the form aP(r) + V(r), and several explicit examples are studied. Connections existing between the perturbation theory and the auxiliary field method are also discussed

Extensions of the auxiliary field method to solve Schroedinger equations

Energy Technology Data Exchange (ETDEWEB)

Silvestre-Brac, Bernard [LPSC Universite Joseph Fourier, Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, Avenue des Martyrs 53, F-38026 Grenoble-Cedex (France); Semay, Claude; Buisseret, Fabien [Groupe de Physique Nucleaire Theorique, Universite de Mons-Hainaut, Academie universitaire Wallonie-Bruxelles, Place du Parc 20, B-7000 Mons (Belgium)], E-mail: silvestre@lpsc.in2p3.fr, E-mail: claude.semay@umh.ac.be, E-mail: fabien.buisseret@umh.ac.be

2008-10-24

It has recently been shown that the auxiliary field method is an interesting tool to compute approximate analytical solutions of the Schroedinger equation. This technique can generate the spectrum associated with an arbitrary potential V(r) starting from the analytically known spectrum of a particular potential P(r). In the present work, general important properties of the auxiliary field method are proved, such as scaling laws and independence of the results on the choice of P(r). The method is extended in order to find accurate analytical energy formulae for radial potentials of the form aP(r) + V(r), and several explicit examples are studied. Connections existing between the perturbation theory and the auxiliary field method are also discussed.

Experimental fast reactor JOYO MK-III functional test. Primary auxiliary cooling system test

International Nuclear Information System (INIS)

Karube, Koji; Akagi, Shinji; Terano, Toshihiro; Onuki, Osamu; Ito, Hideaki; Aoki, Hiroshi; Odo, Toshihiro

2004-03-01

This paper describes the results of primary auxiliary cooling system, which were done as a part of JOYO MK-III function test. The aim of the tests was to confirm the operational performance of primary auxiliary EMP and the protection system including siphon breaker of primary auxiliary cooling system. The items of the tests were: (Test No.): (Test item). 1) SKS-117: EMP start up test. 2) SKS-118-1: EMP start up test when pony motor running. 3) SKS-121: Function test of siphon breaker. The results of the tests satisfied the required performance, and demonstrated successful operation of primary auxiliary cooling system. (author)

Development of Intelligent Auxiliary System for Customized Physical Fitness and Healthcare

Directory of Open Access Journals (Sweden)

Huang Chung-Chi

2016-01-01

Full Text Available With the advent of global high-tech industry and commerce era, the sedentary reduces opportunities of physical activity. And physical fitness and health of people is getting worse and worse. At present, the shortage of physical fitness instructors greatly affected the effectiveness of health promotion. Therefore, it is necessary to develop an auxiliary system which can reduce the workload of instructors and enhance physical fitness and health for people. But current general physical fitness and healthcare system is hard to meet individualized needs. The main purpose of this research is to develop an intelligent auxiliary system for customized physical fitness and healthcare. It records all processes of physical fitness and healthcare system by wireless sensors network. The results of intelligent auxiliary systems for customized physical fitness and healthcare will be generated by fuzzy logic Inference. It will improve individualized physical fitness and healthcare. Finally, we will demonstrate the advantages of the intelligent auxiliary system for customized physical fitness and healthcare.

Aspectual auxiliary verbs in Xitsonga

African Journals Online (AJOL)

Kate H

Let him always come' e. á vá hátl-é vá yá étlélà. OPT 3PL quickly-OPT 3PL go sleep. 'Let them quickly go to bed'. 3.4 Negative markers. Negation is marked on AA verbs. The auxiliary verb hatla 'quickly' is negated in three tenses.

A Polyethylene Moderator Design for Auxiliary Ex-core Neutron Detector

International Nuclear Information System (INIS)

Lee, Hwan Soo; Shin, Ho Cheol; Bae, Seong Man

2012-01-01

The moderator of detector assembly in ENFMS (Excore Neutron Flux Monitoring System) plays a key role for slowing down from fast neutron to thermal neutron at outside of reactor vessel. Since neutron monitoring detector such as BF3, fission chamber detectors mostly responds to thermal neutron, moderator should be included to neutron detector assembly to detect more efficiently. Generally, resin has been used for moderator of detector in ENFMS of OPR1000 and APR1400, because resin has stable thermal resistance, availability and high neutron moderation characteristics due to the light atomic materials. In case of an auxiliary ex-core neutron detector, the polyethylene is suggested that polyethylene has a better moderator rather than resin, then, the amounts of moderator are reduced. This is important thing for auxiliary ex-core detector equipment at reactor, because the auxiliary equipment should affect minimally to another system. In this study, polyethylene moderator is designed for auxiliary ex-core neutron detector. To find out the optimal thickness of polyethylene moderator, preliminary simulation and experiments are performed. And sensitivity simulation for detector moderator at actual reactor is performed by DORT code

Orthodontic springs and auxiliary appliances: assessment of magnetic field interactions associated with 1.5 T and 3 T magnetic resonance systems

International Nuclear Information System (INIS)

Kemper, J.; Priest, A.N.; Adam, G.; Schulze, D.; Kahl-Nieke, B.; Klocke, A.

2007-01-01

The objective of this paper is to evaluate magnetic field interactions at 1.5 and 3 T for 20 orthodontic devices used for fixed orthodontic therapy. Twenty springs and auxiliary parts made from varying ferromagnetic alloys were tested for magnetic field interactions in the static magnetic field at 1.5 and 3 T. Magnetic translational force F z (in millinewtons) was evaluated by determining the deflection angle β [American Society for Testing and Materials (ASTM standard test method)]. Magnetic-field-induced rotational force F rot was qualitatively determined using a five-point scale. β was found to be >45 in 13(15) devices at 1.5(3) T and translational force F z exceeded gravitational force F g on the particular object [F z 10.17-261.4 mN (10.72-566.4 mN) at 1.5(3) T]. F z was found to be up to 24.1(47.5)-fold higher than F g at 1.5(3) T. Corresponding to this, F rot on the objects was shown to be high at both field strengths (≥ +3). Three objects (at 1.5 T) and one object (at 3 T) showed deflection angles rot was found to be ≥ +3 at both field strengths. For the remaining objects, β was below 45 and torque measurements ranged from 0 to +2. Of 20 objects investigated for magnetic field interactions at 1.5(3) T, 13(15) were unsafe in magnetic resonance (MR), based on the ASTM criteria of F z . The implications of these results for orthodontic patients undergoing MRI are discussed. (orig.)

Orthodontic springs and auxiliary appliances: assessment of magnetic field interactions associated with 1.5 T and 3 T magnetic resonance systems

Energy Technology Data Exchange (ETDEWEB)

Kemper, J.; Priest, A.N.; Adam, G. [University Medical Center of Hamburg-Eppendorf, Clinic of Diagnostic and Interventional Radiology, Hamburg (Germany); Schulze, D. [University Hospital of Freiburg, Department of Oral and Maxillofacial Surgery, Freiburg (Germany); Kahl-Nieke, B.; Klocke, A. [University Medical Center of Hamburg-Eppendorf, Department of Orthodontics, Hamburg (Germany)

2007-02-15

The objective of this paper is to evaluate magnetic field interactions at 1.5 and 3 T for 20 orthodontic devices used for fixed orthodontic therapy. Twenty springs and auxiliary parts made from varying ferromagnetic alloys were tested for magnetic field interactions in the static magnetic field at 1.5 and 3 T. Magnetic translational force F{sub z} (in millinewtons) was evaluated by determining the deflection angle {beta} [American Society for Testing and Materials (ASTM standard test method)]. Magnetic-field-induced rotational force F{sub rot} was qualitatively determined using a five-point scale. {beta} was found to be >45 in 13(15) devices at 1.5(3) T and translational force F{sub z} exceeded gravitational force F{sub g} on the particular object [F{sub z} 10.17-261.4 mN (10.72-566.4 mN) at 1.5(3) T]. F{sub z} was found to be up to 24.1(47.5)-fold higher than F{sub g} at 1.5(3) T. Corresponding to this, F{sub rot} on the objects was shown to be high at both field strengths ({>=} +3). Three objects (at 1.5 T) and one object (at 3 T) showed deflection angles <45 , but F{sub rot} was found to be {>=} +3 at both field strengths. For the remaining objects, {beta} was below 45 and torque measurements ranged from 0 to +2. Of 20 objects investigated for magnetic field interactions at 1.5(3) T, 13(15) were unsafe in magnetic resonance (MR), based on the ASTM criteria of F{sub z}. The implications of these results for orthodontic patients undergoing MRI are discussed. (orig.)

Proportional-Resonant Control of Doubly-Fed Induction Generator Wind Turbines for Low-Voltage Ride-Through Enhancement

Directory of Open Access Journals (Sweden)

Zhan-Feng Song

2012-11-01

Full Text Available A novel control strategy is proposed in this paper for the rotor side converter (RSC of doubly-fed induction generator (DFIG-based wind power generation systems. It is supposed to enhance the low-voltage ride-through (LVRT capability of DFIGs during great-level grid voltage dips. The strategy consists of a proportional-resonant (PR controller and auxiliary PR controllers. The auxiliary controllers compensate the output voltage of the RSC in case of grid faults, thus limiting the rotor inrush current of DFIG and meeting the requirements of LVRT. Sequential-component decompositions of current are not required in the control system to improve the response of system. Since the resonant compensator is a double-side integrator, the auxiliary controllers can be simplified through coordinate transformation. The feasibility of the control strategy is validated by simulation on a 1.5 MW wind-turbine driven DFIG system. The impact of the RSC converter voltage rating on the LVRT capability of DFIG is investigated. Meanwhile, the influence of angular frequency detection and control parameters are also discussed. Compared with traditional vector control schemes based on PI current controllers, the presented control strategy effectively suppress rotor current and reduce oscillations of DFIG power and torque under grid faults.

Theoretical and numerical analysis of auxiliary heating for cryogenic target fabrication

International Nuclear Information System (INIS)

Yang Xiaohu; Tian Chenglin; Yin Yan; Xu Han; Zhuo Hongbin

2008-01-01

In order to compensate for the nonspherical-symmetric heat flux in the hohlraum, auxiliary heating is usually applied to the outside wall of the hohlraum during the cooling process. A one-dimensional heat exchange theoretical model has been proposed in the indirect-drive target, to analyze the required auxiliary heat flux. With a two dimensional axisymmetric model, the auxiliary heating mechanism has been simulated by FLUENT code. The optimum heat flux which is 635 W/m 2 has been obtained as the heaters around the outside of the hohlraum about 1.3 mm above and below the mid-plane. The result is in good agreement with the theoretical model. (authors)

Entanglement Capacity of Two-Qubit Unitary Operator with the Help of Auxiliary System

International Nuclear Information System (INIS)

Hu Baolin; Di Yaomin

2007-01-01

The entanglement capacity of general two-qubit unitary operators is studied when auxiliary systems are allowed, and the analytical results based on linear entropy when input states are disentangled are given. From the results the condition for perfect entangler, α 1 = α 2 = π/4, is obtained. Contrary to the case without auxiliary system, the parameter α 3 may play active role to the entanglement capacity when auxiliary systems are allowed.

The Future Mission Tasking and Resourcing of the U.S. Coast Guard Auxiliary

Science.gov (United States)

2012-09-01

the years. Therefore, this study cannot present what the demographic makeup of the Auxiliary was at any past point, and cannot identify if there were...Auxiliary, and the Nation’s projected demographic composition. The demographic makeup of the country, the country’s future volunteers, is changing...command in the spring of 2010.104 This one-page document broad- brushes three prioritized overarching Auxiliary missions: 1) to promote and improve

A generalized strategy for designing (19)F/(1)H dual-frequency MRI coil for small animal imaging at 4.7 Tesla.

Science.gov (United States)

Hu, Lingzhi; Hockett, Frank D; Chen, Junjie; Zhang, Lei; Caruthers, Shelton D; Lanza, Gregory M; Wickline, Samuel A

2011-07-01

To propose and test a universal strategy for building (19) F/(1) H dual-frequency RF coil that permits multiple coil geometries. The feasibility to design (19) F/(1) H dual-frequency RF coil based on coupled resonator model was investigated. A series capacitive matching network enables robust impedance matching for both harmonic oscillating modes of the coupled resonator. Two typical designs of (19) F/(1) H volume coils (birdcage and saddle) at 4.7T were implemented and evaluated with electrical bench test and in vivo (19) F/(1) H dual-nuclei imaging. For various combinations of internal resistances of the sample coil and secondary resonator, numerical solutions for the tunable capacitors to optimize impedance matching were obtained using a root-seeking program. Identical and homogeneous B1 field distribution at (19) F and (1) H frequencies were observed in bench test and phantom image. Finally, in vivo mouse imaging confirmed the sensitivity and homogeneity of the (19) F/(1) H dual-frequency coil design. A generalized strategy for designing (19) F/(1) H dual-frequency coils based on the coupled resonator approach was developed and validated. A unique feature of this design is that it preserves the B1 field homogeneity of the RF coil at both resonant frequencies. Thus it minimizes the susceptibility effect on image co-registration. Copyright © 2011 Wiley-Liss, Inc.

Environmental practices of the auxiliary companies to the Spanish automobile industry

Science.gov (United States)

González-Torre, Pilar L.; González, Beatriz A.; Gupta, Surendra M.

2005-11-01

The automobile manufacturing industry plays a very important role in a country's economy. The importance of automobile manufacturing industry lies in its sheer size and complexity in terms of the direct and indirect influence it commands across many other industries. While millions of people are employed in the automobile manufacturing industry, it is estimated that more than two and half times that number are employed in the auxiliary companies that supply parts to the automobile manufacturing companies. The auxiliary companies represent a group of businesses of various sizes, types, and geographical locations, producing a vast variety of products ranging from the very simple to the extremely intricate. In this study, the current environmental practices of management in the core Spanish auxiliary companies that do business with the automobile manufacturing industry (and thus form a large part of the automobile manufacturing industry's supply chain) are investigated. We show that while automobile manufacturing companies are under scrutiny to become more and more environmentally friendly, not only at their manufacturing stage but also at their products' useful and EOL stages, there appears to be no such burden on the auxiliary companies. Our conclusion is based on an elaborate survey conducted during the fall of 2004 of Spanish auxiliary companies with questions about the characteristics, environmental practices and reverse logistics related activities carried out by the companies.

Curricular Guidelines for Dental Auxiliary Radiology.

Science.gov (United States)

Journal of Dental Education, 1981

1981-01-01

AADS curricular guidelines suggest objectives for these areas of dental auxiliary radiology: physical principles of X-radiation in dentistry, related radiobiological concepts, principles of radiologic health, radiographic technique, x-ray films and intensifying screens, factors contributing to film quality, darkroom, and normal variations in…

Linearized curvatures for auxiliary fields in the de Sitter space

Energy Technology Data Exchange (ETDEWEB)

Vasiliev, M A

1988-09-19

New consistent linearized curvatures in the de Sitter space are constructed. The sequence of actions, describing bosonic and fermionic gauge auxiliary fields, is found based on these curvatures. The proposed actions are parametrized by two integer parameters, n greater than or equal to 0 and m greater than or equal to 0. The simplest case n=m=0 corresponds in the flat limit to the auxiliary fields of 'new minimal' supergravity. The hamiltonian formulation is developed for the auxiliary fields suggested; hamiltonians and first- and second-class constraints are constructed. Using these results, it is shown that the systems of fields proposed possess no dynamical degrees of freedom in de Sitter and flat spaces. In addition the hamiltonian formalism is analysed for some free dynamical systems based on linearized higher-spin curvatures introduced previously.

Improvement of stability of sinusoidally driven atmospheric pressure plasma jet using auxiliary bias voltage

Directory of Open Access Journals (Sweden)

Hyun-Jin Kim

2015-12-01

Full Text Available In this study, we have proposed the auxiliary bias pulse scheme to improve the stability of atmospheric pressure plasma jets driven by an AC sinusoidal waveform excitation source. The stability of discharges can be significantly improved by the compensation of irregular variation in memory voltage due to the effect of auxiliary bias pulse. From the parametric study, such as the width, voltage, and onset time of auxiliary bias pulse, it has been demonstrated that the auxiliary bias pulse plays a significant role in suppressing the irregular discharges caused by the irregular variation in memory voltage and stable discharge can be initiated with the termination of the auxiliary bias pulse. As a result of further investigating the effects of the auxiliary pulse scheme on the jet stability under various process conditions such as the distance between the jet head and the counter electrode, and carrier gas flow, the jet stability can be improved by adjusting the amplitude and number of the bias pulse depending on the variations in the process conditions.

Studies on a Hybrid Full-Bridge/Half-Bridge Bidirectional CLTC Multi-Resonant DC-DC Converter with a Digital Synchronous Rectification Strategy

Directory of Open Access Journals (Sweden)

Shu-huai Zhang

2018-01-01

Full Text Available This study presents a new bidirectional multi-resonant DC-DC converter, which is named CLTC. The converter adds an auxiliary transformer and an extra resonant capacitor based on a LLC resonant DC-DC converter, achieving zero-voltage switching (ZVS for the input inverting switches and zero-current switching (ZCS for the output rectifiers in all load range. The converter also has a wide gain range in two directions. When the load is light, a half-bridge configuration is adopted instead of a full-bridge configuration to solve the problem of voltage regulation. By this method, the voltage gain becomes monotonous and controllable. Besides, the digital synchronous rectification strategy is proposed in forward mode without adding any auxiliary circuit. The conduction time of synchronous rectifiers equals the estimation value of body diodes’ conduction time with the lightest load. Power loss analysis is also conducted in different situations. Finally, the theoretical analysis is validated by a 5 kW prototype.

Auxiliary/Master microprocessor CAMAC Crate Controller applications

International Nuclear Information System (INIS)

Barsotti, E.

1975-01-01

The need for further sophistication of an already complex serial CAMAC control system at Fermilab led to the development of an Auxilary/Master CAMAC Crate Controller. The controller contains a Motorola 6800 microprocessor, 2K bytes of RAM, and 8K bytes of PROM memory. Bussed dataway lines are time shared with CAMAC signals to provide memory expansion and direct addressing of peripheral devices without the need of external cabling. The Auxiliary/Master Crate Controller (A/MCC) can function as either a Master, i.e., stand alone, crate controller or as an Auxiliary controller to Fermilab's Serial Crate Controller (SCC). Two modules, one single- and one double-width, make up an A/MCC. The microprocessor has one nonmaskable and one maskable vectored interrupt. Time sharing the dataway between SCC programmed and block transfer generated dataway cycles and A/MCC operations still allows a 99 percent microprocessor CPU busy time. Since the conception of the A/MCC, there has been an increasing number of control system-related projects proposed which would not have been possible or would have been very difficult to implement without such a device. The first such application now in use at Fermilab is a stand-alone control system for a mass spectrometer experiment in the Main Ring Internal Target Area. This application in addition to other proposed A/MCC applications, both stand-alone and auxiliary, is discussed

Improving Semi-Supervised Learning with Auxiliary Deep Generative Models

DEFF Research Database (Denmark)

Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

Deep generative models based upon continuous variational distributions parameterized by deep networks give state-of-the-art performance. In this paper we propose a framework for extending the latent representation with extra auxiliary variables in order to make the variational distribution more...... expressive for semi-supervised learning. By utilizing the stochasticity of the auxiliary variable we demonstrate how to train discriminative classifiers resulting in state-of-the-art performance within semi-supervised learning exemplified by an 0.96% error on MNIST using 100 labeled data points. Furthermore...

Modal Auxiliaries and Their Semantic Functions Used by Advanced EFL Learners

Science.gov (United States)

Torabiardakani, Najmeh; Khojasteh, Laleh; Shokrpour, Nasrin

2015-01-01

Since modal auxiliary verbs have been proved to be one of the most troublesome grammatical structures in English, the researchers of this study decided to do an analysis on the ways in which advanced EFL Iranian students use modal auxiliaries focusing specially on nine modals' semantic functions. Consequently, was conducted based on the following…

Development of KALIMER auxiliary sodium and cover gas management system

International Nuclear Information System (INIS)

Kwon, Sang Woon; Hwang, Sung Tae

1996-11-01

The objectives of this report are to develop and to describe the auxiliary liquid metal and cover gas management systems of KALIMER. the system includes following system: (1) Auxiliary liquid metal system (2) Inert gas receiving and processing system (3) Impurity monitoring and analysis system. Auxiliary liquid metal and cover gas management system of KALIMER was developed. Functions of each systems and design basis were describes. The auxiliary liquid metal system receives, transfers, and purifies all sodium used in the plant. The system furnishes the required sodium quantity at the pressure, temperature, flow rate, and purity specified by the interfacing system. The intermediated sodium processing subsystem (ISPS) provides continuous purification of IHTS sodium, as well as performs the initial fill operation for both the IHTS and reactor vessel. The primary sodium processing subsystem provides purification (cold trapping) for sodium used in the reactor vessel. The inert gas receiving and processing (IGRP) system provides liquefied and ambient gas storage, delivers inert gases of specified composition and purity at regulated flow rates and pressures to points of usage throughout the KALIMER, and accepts the contaminated gases through its vacuum facilities for storage and transfer to the gas radwaste system. Three gases are used in the KALIMER: helium, argon, and nitrogen. 11 tabs., 12 figs. (Author)

Development of KALIMER auxiliary sodium and cover gas management system

Energy Technology Data Exchange (ETDEWEB)

Kwon, Sang Woon; Hwang, Sung Tae [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

1996-11-01

The objectives of this report are to develop and to describe the auxiliary liquid metal and cover gas management systems of KALIMER. the system includes following system: (1) Auxiliary liquid metal system (2) Inert gas receiving and processing system (3) Impurity monitoring and analysis system. Auxiliary liquid metal and cover gas management system of KALIMER was developed. Functions of each systems and design basis were describes. The auxiliary liquid metal system receives, transfers, and purifies all sodium used in the plant. The system furnishes the required sodium quantity at the pressure, temperature, flow rate, and purity specified by the interfacing system. The intermediated sodium processing subsystem (ISPS) provides continuous purification of IHTS sodium, as well as performs the initial fill operation for both the IHTS and reactor vessel. The primary sodium processing subsystem provides purification (cold trapping) for sodium used in the reactor vessel. The inert gas receiving and processing (IGRP) system provides liquefied and ambient gas storage, delivers inert gases of specified composition and purity at regulated flow rates and pressures to points of usage throughout the KALIMER, and accepts the contaminated gases through its vacuum facilities for storage and transfer to the gas radwaste system. Three gases are used in the KALIMER: helium, argon, and nitrogen. 11 tabs., 12 figs. (Author).

Hydraulic turbines and auxiliary equipment

Energy Technology Data Exchange (ETDEWEB)

Luo Gaorong [Organization of the United Nations, Beijing (China). International Centre of Small Hydroelectric Power Plants

1995-07-01

This document presents a general overview on hydraulic turbines and auxiliary equipment, emphasizing the turbine classification, in accordance with the different types of turbines, standard turbine series in China, turbine selection based on the basic data required for the preliminary design, general hill model curves, chart of turbine series and the arrangement of application for hydraulic turbines, hydraulic turbine testing, and speed regulating device.

Design and experimental verification of a dual-band metamaterial filter

Science.gov (United States)

Zhu, Hong-Yang; Yao, Ai-Qin; Zhong, Min

2016-10-01

In this paper, we present the design, simulation, and experimental verification of a dual-band free-standing metamaterial filter operating in a frequency range of 1 THz-30 THz. The proposed structure consists of periodically arranged composite air holes, and exhibits two broad and flat transmission bands. To clarify the effects of the structural parameters on both resonant transmission bands, three sets of experiments are performed. The first resonant transmission band shows a shift towards higher frequency when the side width w 1 of the main air hole is increased. In contrast, the second resonant transmission band displays a shift towards lower frequency when the side width w 2 of the sub-holes is increased, while the first resonant transmission band is unchanged. The measured results indicate that these resonant bands can be modulated individually by simply optimizing the relevant structural parameters (w 1 or w 2) for the required band. In addition, these resonant bands merge into a single resonant band with a bandwidth of 7.7 THz when w 1 and w 2 are optimized simultaneously. The structure proposed in this paper adopts different resonant mechanisms for transmission at different frequencies and thus offers a method to achieve a dual-band and low-loss filter. Project supported by the Doctorate Scientific Research Foundation of Hezhou University, China (Grant No. HZUBS201503), the Promotion of the Basic Ability of Young and Middle-aged Teachers in Universities Project of Guangxi Zhuang Autonomous Region, China (Grant No. KY2016YB453), the Guangxi Colleges and Universities Key Laboratory Symbolic Computation, China, Engineering Data Processing and Mathematical Support Autonomous Discipline Project of Hezhou University, China (Grant No. 2016HZXYSX01).

Progress on radio frequency auxiliary heating system designs in ITER

International Nuclear Information System (INIS)

Makowski, M.; Bosia, G.; Elio, F.

1996-09-01

ITER will require over 100 MW of auxiliary power for heating, on- and off-axis current drive, accessing the H-mode, and plasma shut-down. The Electron Cyclotron Range of Frequencies (ECRF) and Ion Cyclotron Range of Frequencies (ICRF) are two forms of Radio Frequency (RF) auxiliary power being developed for these applications. Design concepts for both the ECRF and ICRF systems are presented, key features and critical design issues are discussed, and projected performances outlined

An auxiliary differential equation FDTD method for anisotropic magnetized plasmas

International Nuclear Information System (INIS)

Liu Shaobin; Mo Jinjun; Yuan Naichang

2004-01-01

An auxiliary differential equation finite-difference time-domain (ADE-FDTD) methodology for anisotropic magnetized plasmas is derived. The method is based on a difference approximation of the auxiliary differential equation. A comparison with the JEC method is included. The CPU time saving by several times and accuracy of the method are confirmed by computing the reflection and transmission through a magnetized plasma layer with the direction of propagation parallel to the direction of the biasing field

Electrospinning of aligned fibers with adjustable orientation using auxiliary electrodes

International Nuclear Information System (INIS)

Arras, Matthias M L; Grasl, Christian; Schima, Heinrich; Bergmeister, Helga

2012-01-01

A conventional electrospinning setup was upgraded by two turnable plate-like auxiliary high-voltage electrodes that allowed aligned fiber deposition in adjustable directions. Fiber morphology was analyzed by scanning electron microscopy and attenuated total reflection Fourier transform infrared spectroscopy (FTIR-ATR). The auxiliary electric field constrained the jet bending instability and the fiber deposition became controllable. At target speeds of 0.9 m s −1 90% of the fibers had aligned within 2°, whereas the angular spread was 70° without the use of auxiliary electrodes. It was even possible to orient fibers perpendicular to the rotational direction of the target. The fiber diameter became smaller and its distribution narrower, while according to the FTIR-ATR measurement the molecular orientation of the polymer was unaltered. This study comprehensively documents the feasibility of directed fiber deposition and offers an easy upgrade to existing electrospinning setups. (paper)

Aiming of Kirkpatrick-Baez microscope based on auxiliary optical system

International Nuclear Information System (INIS)

Huang Shengling; Mu Baozhong; Yi Shengzhen; Wang Xin; Wang Zhanshan; Ding Yongkun; Miao Wenyong; Dong Jianjun

2009-01-01

An auxiliary optical system has been designed, which can provide precise positioning for aiming Kirkpatrick-Baez (KB) microscope object location. An 8 keV X-ray imaging system by KB microscope with periodic multilayer films has been designed. The field of view and depth of field in the resolution of 5 μm are got, and then the corresponding point and depth of field in diagnostic experiments are calculated. Based on the object-image relations and precision of the KB microscope, an auxiliary visible light imaging system is designed and X-ray imaging experiments are performed, which can achieve equivalent aiming between the visible imaging system and the KB microscope. The results show that ±20 μm vertical axis plane and ±300 μm axial accuracy are achieved through the auxiliary optical path, which can meet the object point positioning requirements of the KB microscope. (authors)

Three-dimensional balanced steady state free precession myocardial perfusion cardiovascular magnetic resonance at 3T using dual-source parallel RF transmission: initial experience.

Science.gov (United States)

Jogiya, Roy; Schuster, Andreas; Zaman, Arshad; Motwani, Manish; Kouwenhoven, Marc; Nagel, Eike; Kozerke, Sebastian; Plein, Sven

2014-11-28

The purpose of this study was to establish the feasibility of three-dimensional (3D) balanced steady-state-free-precession (bSSFP) myocardial perfusion cardiovascular magnetic resonance (CMR) at 3T using local RF shimming with dual-source RF transmission, and to compare it with spoiled gradient echo (TGRE) acquisition. Dynamic contrast-enhanced 3D bSSFP perfusion imaging was performed on a 3T MRI scanner equipped with dual-source RF transmission technology. Images were reconstructed using k-space and time broad-use linear acquisition speed-up technique (k-t BLAST) and compartment based principle component analysis (k-t PCA). In phantoms and volunteers, local RF shimming with dual source RF transmission significantly improved B1 field homogeneity compared with single source transmission (P=0.01). 3D bSSFP showed improved signal-to-noise, contrast-to-noise and signal homogeneity compared with 3D TGRE (29.8 vs 26.9, P=0.045; 23.2 vs 21.6, P=0.049; 14.9% vs 12.4%, p=0.002, respectively). Image quality was similar between bSSFP and TGRE but there were more dark rim artefacts with bSSFP. k-t PCA reconstruction reduced artefacts for both sequences compared with k-t BLAST. In a subset of five patients, both methods correctly identified those with coronary artery disease. Three-dimensional bSSFP myocardial perfusion CMR using local RF shimming with dual source parallel RF transmission at 3T is feasible and improves signal characteristics compared with TGRE. Image artefact remains an important limitation of bSSFP imaging at 3T but can be reduced with k-t PCA.

14 CFR 33.96 - Engine tests in auxiliary power unit (APU) mode.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Engine tests in auxiliary power unit (APU... TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: AIRCRAFT ENGINES Block Tests; Turbine Aircraft Engines § 33.96 Engine tests in auxiliary power unit (APU) mode. If the engine is designed with a propeller brake which...

A photo-excited broadband to dual-band tunable terahertz prefect metamaterial polarization converter

Science.gov (United States)

Zhu, Jianfeng; Yang, Yang; Li, Shufang

2018-04-01

A new and simple design of photo-excited broadband to dual-band tunable terahertz (THz) metamaterial cross polarization converter is proposed in this paper. The tunable converter is a sandwich structure with the center-cut cross-shaped metallic patterned structure as a resonator, the middle dielectric layer as a spacer and the bottom metallic film as the ground. The conductivity of the photoconductive semiconductor (Silicon) filled in the gap of the cross-shaped metallic resonator can be tuned by the incident pump power, leading to an easy modulation of the electromagnetic response of the proposed converter. The results show that the proposed cross-polarization converter can be tuned from a broadband with polarization conversion ratio (PCR) beyond 95% (1.86-2.94 THz) to dual frequency bands (fl = 1 . 46 THz &fh = 2 . 9 THz). The conversion peaks can reach 99.9% for the broadband and, 99.5% (fl) and 99.7% (fh) for the dual-band, respectively. Most importantly, numerical simulations demonstrate that the broadband/dual-band polarization conversion mechanism of the converter originates from the localized surface plasmon modes, which make the design simple and different from previous designs. With these good features, the proposed broadband to dual-band tunable polarization converter is expected to be used in widespread applications.

Dual curved photonic crystal ring resonator based channel drop filter using two-dimensional photonic crystal structure

Energy Technology Data Exchange (ETDEWEB)

Chhipa, Mayur Kumar, E-mail: mayurchhipa1@gmail.com [Deptt. of Electronics and Communication Engineering, Government Engineering College Ajmer Rajasthan INDIA (India); Dusad, Lalit Kumar [Rajasthan Technical University Kota, Rajasthan (India)

2016-05-06

In this paper channel drop filter (CDF) is designed using dual curved photonic crystal ring resonator (PCRR). The photonic band gap (PBG) is calculated by plane wave expansion (PWE) method and the photonic crystal (PhC) based on two dimensional (2D) square lattice periodic arrays of silicon (Si) rods in air structure have been investigated using finite difference time domain (FDTD) method. The number of rods in Z and X directions is 21 and 20 respectively with lattice constant 0.540 nm and rod radius r = 0.1 µm. The channel drop filter has been optimized for telecommunication wavelengths λ = 1.591 µm with refractive indices 3.533. In the designed structure further analysis is also done by changing whole rods refractive index and it has been observed that this filter may be used for filtering several other channels also. The designed structure is useful for CWDM systems. This device may serve as a key component in photonic integrated circuits. The device is ultra compact with the overall size around 123 µm{sup 2}.

Accelerating the reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning using CUDA.

Science.gov (United States)

Jiansen Li; Jianqi Sun; Ying Song; Yanran Xu; Jun Zhao

2014-01-01

An effective way to improve the data acquisition speed of magnetic resonance imaging (MRI) is using under-sampled k-space data, and dictionary learning method can be used to maintain the reconstruction quality. Three-dimensional dictionary trains the atoms in dictionary in the form of blocks, which can utilize the spatial correlation among slices. Dual-dictionary learning method includes a low-resolution dictionary and a high-resolution dictionary, for sparse coding and image updating respectively. However, the amount of data is huge for three-dimensional reconstruction, especially when the number of slices is large. Thus, the procedure is time-consuming. In this paper, we first utilize the NVIDIA Corporation's compute unified device architecture (CUDA) programming model to design the parallel algorithms on graphics processing unit (GPU) to accelerate the reconstruction procedure. The main optimizations operate in the dictionary learning algorithm and the image updating part, such as the orthogonal matching pursuit (OMP) algorithm and the k-singular value decomposition (K-SVD) algorithm. Then we develop another version of CUDA code with algorithmic optimization. Experimental results show that more than 324 times of speedup is achieved compared with the CPU-only codes when the number of MRI slices is 24.

30 CFR 57.22208 - Auxiliary fans (I-A, II-A, III, and V-A mines).

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-A, II-A, III, and V-A mines... fans (I-A, II-A, III, and V-A mines). (a) Auxiliary fans, except fans used in shops and other areas... applicable requirements of 30 CFR part 18, and be operated so that recirculation is minimized. Auxiliary fans...

Heralded quantum controlled-phase gates with dissipative dynamics in macroscopically distant resonators

Science.gov (United States)

Qin, Wei; Wang, Xin; Miranowicz, Adam; Zhong, Zhirong; Nori, Franco

2017-07-01

Heralded near-deterministic multiqubit controlled-phase gates with integrated error detection have recently been proposed by Borregaard et al. [Phys. Rev. Lett. 114, 110502 (2015), 10.1103/PhysRevLett.114.110502]. This protocol is based on a single four-level atom (a heralding quartit) and N three-level atoms (operational qutrits) coupled to a single-resonator mode acting as a cavity bus. Here we generalize this method for two distant resonators without the cavity bus between the heralding and operational atoms. Specifically, we analyze the two-qubit controlled-Z gate and its multiqubit-controlled generalization (i.e., a Toffoli-like gate) acting on the two-lowest levels of N qutrits inside one resonator, with their successful actions being heralded by an auxiliary microwave-driven quartit inside the other resonator. Moreover, we propose a circuit-quantum-electrodynamics realization of the protocol with flux and phase qudits in linearly coupled transmission-line resonators with dissipation. These methods offer a quadratic fidelity improvement compared to cavity-assisted deterministic gates.

Bayesian Analysis of Geostatistical Models With an Auxiliary Lattice

KAUST Repository

Park, Jincheol

2012-04-01

The Gaussian geostatistical model has been widely used for modeling spatial data. However, this model suffers from a severe difficulty in computation: it requires users to invert a large covariance matrix. This is infeasible when the number of observations is large. In this article, we propose an auxiliary lattice-based approach for tackling this difficulty. By introducing an auxiliary lattice to the space of observations and defining a Gaussian Markov random field on the auxiliary lattice, our model completely avoids the requirement of matrix inversion. It is remarkable that the computational complexity of our method is only O(n), where n is the number of observations. Hence, our method can be applied to very large datasets with reasonable computational (CPU) times. The numerical results indicate that our model can approximate Gaussian random fields very well in terms of predictions, even for those with long correlation lengths. For real data examples, our model can generally outperform conventional Gaussian random field models in both prediction errors and CPU times. Supplemental materials for the article are available online. © 2012 American Statistical Association, Institute of Mathematical Statistics, and Interface Foundation of North America.

46 CFR 182.620 - Auxiliary means of steering.

Science.gov (United States)

2010-10-01

... TONS) MACHINERY INSTALLATION Steering Systems § 182.620 Auxiliary means of steering. (a) Except as... personnel hazards during normal or heavy weather operation. (b) A suitable hand tiller may be acceptable as...

Auxiliary Armed Forces and Innovations in Security Governance in Mozambique’s Civil War

NARCIS (Netherlands)

Jentzsch, C.

2017-01-01

Who rules during the civil war? This article argues that the concept of armed group governance must be expanded to include auxiliary armed forces linked to rebels or the government. Comparing the organization of rebel and government auxiliaries, the article demonstrates that security governance

Stereoselective conjugate radical additions: application of a fluorous oxazolidinone chiral auxiliary for efficient tin removal.

Science.gov (United States)

Hein, Jason E; Zimmerman, Jake; Sibi, Mukund P; Hultin, Philip G

2005-06-23

[reaction: see text] A series of asymmetric free-radical-mediated intermolecular conjugate additions using a fluorous oxazolidinone chiral auxiliary has been completed. The fluorous auxiliary facilitated product isolation using fluorous solid phase extractions (FSPE), effectively removing excess organic and organometallic reagents. Parallel reactions carried out with a similar but nonfluorous norephedrine-derived oxazolidinone demonstrated the superior stereoselectivity and purification obtainable with the fluorous chiral auxiliary.

Auxiliary power unit for moving a vehicle

Science.gov (United States)

Akasam, Sivaprasad [Peoria, IL; Johnson, Kris W [Peoria, IL; Johnson, Matthew D [Peoria, IL; Slone, Larry M [Washington, IL; Welter, James Milton [Chillicothe, IL

2009-02-03

A power system is provided having at least one traction device and a primary power source configured to power the at least one traction device. In addition, the power system includes an auxiliary power source also configured to power the at least one traction device.

Fast response double series resonant high-voltage DC-DC converter

International Nuclear Information System (INIS)

Lee, S S; Iqbal, S; Kamarol, M

2012-01-01

In this paper, a novel double series resonant high-voltage dc-dc converter with dual-mode pulse frequency modulation (PFM) control scheme is proposed. The proposed topology consists of two series resonant tanks and hence two resonant currents flow in each switching period. Moreover, it consists of two high-voltage transformer with the leakage inductances are absorbed as resonant inductor in the series resonant tanks. The secondary output of both transformers are rectified and mixed before supplying to load. In the resonant mode operation, the series resonant tanks are energized alternately by controlling two Insulated Gate Bipolar Transistor (IGBT) switches with pulse frequency modulation (PFM). This topology operates in discontinuous conduction mode (DCM) with all IGBT switches operating in zero current switching (ZCS) condition and hence no switching loss occurs. To achieve fast rise in output voltage, a dual-mode PFM control during start-up of the converter is proposed. In this operation, the inverter is started at a high switching frequency and as the output voltage reaches 90% of the target value, the switching frequency is reduced to a value which corresponds to the target output voltage. This can effectively reduce the rise time of the output voltage and prevent overshoot. Experimental results collected from a 100-W laboratory prototype are presented to verify the effectiveness of the proposed system.

An Auxiliary Equation for the Bellman Equation in a One-Dimensional Ergodic Control

International Nuclear Information System (INIS)

Fujita, Y.

2001-01-01

In this paper we consider the Bellman equation in a one-dimensional ergodic control. Our aim is to show the existence and the uniqueness of its solution under general assumptions. For this purpose we introduce an auxiliary equation whose solution gives the invariant measure of the diffusion corresponding to an optimal control. Using this solution, we construct a solution to the Bellman equation. Our method of using this auxiliary equation has two advantages in the one-dimensional case. First, we can solve the Bellman equation under general assumptions. Second, this auxiliary equation gives an optimal Markov control explicitly in many examples

TMI-2 auxiliary building elevator shaft and pit decontamination

Energy Technology Data Exchange (ETDEWEB)

Bengel, T.G.

1986-01-01

Decontamination of the elevator pit and shaft in the auxiliary building at Three Mile Island Unit 2 (TMI-2) was performed to remove high radiation and contamination levels which prevented personnel from utilizing the elevator. The radiation and contamination levels in the TMI-2 auxiliary building elevator shaft have been reduced to the point where plant personnel are again permitted to ride in the elevator without a radiation work permit, with the exception of access to the 281-ft (basement) level. Based on the declassification and expanded use of the elevator, the task goal has been met. The tax expended 16.16 man-rem and 621 man-hours.

Treatment for chronic daily headache by using auxiliary and alternative methods

Directory of Open Access Journals (Sweden)

V. A. Golovacheva

2015-01-01

Full Text Available Chronic daily headache (CDH is one of the top 10 causes of adult disability and one of the 5 most common causes of female disability. To treat patients with CDH is one of the most difficult tasks in neurological practice. Difficulties in managing patients with CHD are associated with the high prevalence of comorbid mental disorders, analgesic abuse, pain syndromes at another site, and misconceptions of a patient about his/her disease. A combination of drug and non-drug therapies is the mainstay of the current approach to treating patients with CDH. Standard, alternative, and auxiliary therapies are identified. The paper describes different types of current auxiliary and alternative therapy used in the world’s leading headache centers and clinics. It describes experience with cerebrolysin used as auxiliary and alternative pharmacotherapies for CDH.

Miniaturized dual-band antenna array with double-negative (DNG) metamaterial for wireless applications

Science.gov (United States)

Alqadami, Abdulrahman Shueai Mohsen; Jamlos, Mohd Faizal; Soh, Ping Jack; Rahim, Sharul Kamal Abdul; Vandenbosch, Guy A. E.; Narbudowicz, Adam

2017-01-01

A miniaturized dual-band antenna array using a negative index metamaterial is presented for WiMAX, LTE, and WLAN applications. This left-handed metamaterial plane is located behind the antenna array, and its unit cell is a combination of split-ring resonator, square electric ring resonator, and rectangular electrical coupled resonator. This enables the achievement of a metamaterial structure exhibiting both negative permittivity and permeability, which results in antenna size miniaturization, efficiency, and gain enhancement. Moreover, the proposed metamaterial antenna has realized dual-band operating frequencies compared to a single frequency for normal antenna. The measured reflection coefficient (S11) shows a 50.25% bandwidth in the lower band (from 2.119 to 3.058 GHz) and 4.27% in the upper band (from 5.058 to 5.276 GHz). Radiation efficiency obtained in the lower and upper band are >95 and 80%, respectively.

Design and Experiment of Auxiliary Bearing for Helium Blower of HTR-PM

International Nuclear Information System (INIS)

Yang Guojun; Shi Zhengang; Liu Xingnan; Zhao Jingjing

2014-01-01

The helium blower is the important equipment for HTR-PM. Active magnetic bearing (AMB) instead of mechanical bearing is selected to support the rotor of the helium blower. However, one implication of AMB is the requirement to provide the auxiliary bearing to mitigate the effects of failures or overload conditions. The auxiliary bearing is used to support the rotor when the AMB fails to work. It must support the dropping rotor and bear the great impact force and friction heat. The design of the auxiliary bearing is one of the challenging problems in the whole system. It is very important for the helium blower with AMB of HTR-PM to make success. The rotor’s length of helium blower of HTR-PM is about 3.3 m, its weight is about 4000 kg and the rotating speed is 4000 r/min. The axial load is 4500kg, and the radial load is 1950kg. The angular contact ball bearing was selected as the auxiliary bearing. The test rig has been finished. It is difficult to analyze the falling course of the rotor. The preliminary analysis of the dropping rotor was done in the special condition. The impact force of auxiliary bearing was computed for the axial and radial load. And the dropping test of the blower rotor for HTR-10 will be introduced also in this paper. Results offer the important theoretical base for the protector design of the helium blower with AMB for HTR-PM. (author)

Smart Drug Delivery System-Inspired Enzyme-Linked Immunosorbent Assay Based on Fluorescence Resonance Energy Transfer and Allochroic Effect Induced Dual-Modal Colorimetric and Fluorescent Detection.

Science.gov (United States)

Miao, Luyang; Zhu, Chengzhou; Jiao, Lei; Li, He; Du, Dan; Lin, Yuehe; Wei, Qin

2018-02-06

Numerous analytical techniques have been undertaken for the detection of protein biomarkers because of their extensive and significant applications in clinical diagnosis, whereas there are few strategies to develop dual-readout immunosensors to achieve more accurate results. To the best of our knowledge, inspired by smart drug delivery system (DDS), a novel pH-responsive modified enzyme-linked immunosorbent assay (ELISA) was innovatively developed for the first time, realizing dual-modal colorimetric and fluorescent detection of cardiac troponin I (cTnI). Curcumin (CUR) was elaborately selected as a reporter molecule, which played the same role of drugs in DDS based on the following considerations: (1) CUR can be used as a kind of pH indicator by the inherited allochroic effect induced by basic pH value; (2) the fluorescence of CUR can be quenched by certain nanocarriers as the acceptor because of the occurrence of fluorescence resonance energy transfer (FRET), while recovered by the stimuli of basic pH value, which can produce "signal-on" fluorescence detection. Three-dimensional MoS 2 nanoflowers (3D-MoS 2 NFs) were employed in immobilizing CUR to constitute a nanoprobe for the determination of cTnI by virtue of good biocompatibility, high absorption capacity, and fluorescence quench efficiency toward CUR. The proposed DDS-inspired ELISA offered dual-modal colorimetric and fluorescent detection of cTnI, thereby meeting the reliable and precise analysis requirements. We believe that the developed dual-readout ELISA will create a new avenue and bring innovative inspirations for biological detections.

Compact Microstrip Triple-Mode Bandpass Filters Using Dual-Stub-Loaded Spiral Resonators

Directory of Open Access Journals (Sweden)

K. D. Xu

2017-04-01

Full Text Available Two new microstrip triple-mode resonators loaded with T-shaped open stubs using axially and centrally symmetric spiral structures, respectively, are presented. Spiraled for circuit size reduction, these two half-wavelength resonators can both generate three resonant modes over a wide frequency band by loading two T-stubs with different lengths. Due to the structural symmetry, they can be analyzed by odd- and even-mode method. To validate the design concept, two compact bandpass filters (BPFs using these two novel resonators with center frequencies of 1.76 GHz and 2.44 GHz for the GSM1800 and WLAN/Zigbee applications, respectively, have been designed, fabricated and tested. The center frequencies and bandwidths can be tunable through the analysis of resonant frequency responses, fractional bandwidths and external quality factor versus the resonator parameters. The final measured results have achieved good consistence with the simulations of these two BPFs.

New set of auxiliary fields for supergravity theories

International Nuclear Information System (INIS)

Oliveira Rivelles, V. de.

1983-02-01

A brief introduction on supersymmetry is given. The problems with the obtainment of the auxiliary fields in supergravity theories are discussed, after a short presentation of the supersymmetry algebra representations. (L.C.) [pt

Terahertz plasmon-induced transparency based on asymmetric dual-disk resonators coupled to a semiconductor InSb waveguide and its biosensor application

Science.gov (United States)

Shahamat, Yadollah; Vahedi, Mohammad

2017-06-01

An ultracompact double eight-shaped plasmonic structure for the realization of plasmon-induced transparency (PIT) in the terahertz (THz) region has been studied. The device consists of a semiconductor-insulator-semiconductor bus waveguide coupled to the dual-disk resonators. Indium antimonide is employed to excite SPP in the THz region. The transmission characteristics of the proposed device are simulated numerically by the finite-difference time-domain method. In addition, a theoretical analysis based on the coupled-mode theory for transmission features is presented and compared with the numerical results. Results are in good agreement. Also, the dependence of PIT frequency characteristics on the radius of the outer disk is discussed in detail. In addition, by removing one of the outer disk resonators, double-PIT peaks can be observed in the transmission spectrum, and the physical mechanism of the appeared peaks is investigated. Finally, an application of the proposed structure for distinguishing different states of DNA molecules is discussed. Results show that the maximum sensitivity with 654 GHz/RIU-1 could be obtained for a single PIT structure. The frequency shifts equal to 37 and 99 GHz could be observed for the denatured and the hybridized DNA states, respectively.

Dual-axis resonance testing of wind turbine blades

Science.gov (United States)

Hughes, Scott; Musial, Walter; White, Darris

2014-01-07

An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.

Folding of the natural hammerhead ribozyme is enhanced by interaction of auxiliary elements

Science.gov (United States)

PENEDO, J. CARLOS; WILSON, TIMOTHY J.; JAYASENA, SUMEDHA D.; KHVOROVA, ANASTASIA; LILLEY, DAVID M.J.

2004-01-01

It has been shown that the activity of the hammerhead ribozyme at μM magnesium ion concentrations is markedly increased by the inclusion of loops in helices I and II. We have studied the effect of such loops on the magnesium ion-induced folding of the ribozyme, using fluorescence resonance energy transfer. We find that with the loops in place, folding into the active conformation occurs in a single step, in the μM range of magnesium ion concentration. Disruption of the loop–loop interaction leads to a reversion to two-step folding, with the second stage requiring mM concentrations of magnesium ion. Sodium ions also promote the folding of the natural form of the ribozyme at high concentrations, but the folding occurs as a two-stage process. The loops clearly act as important auxiliary elements in the function of the ribozyme, permitting folding to occur efficiently under physiological conditions. PMID:15100442

76 FR 28795 - Privacy Act of 1974; Department of Homeland Security United States Coast Guard-024 Auxiliary...

Science.gov (United States)

2011-05-18

... 1974; Department of Homeland Security United States Coast Guard-024 Auxiliary Database System of... Security/United States Coast Guard-024 Auxiliary Database (AUXDATA) System of Records.'' This system of...: United States Coast Guard Auxiliary Database (AUXDATA). Security classification: Unclassified. System...

Direction of Impurity Pinch and Auxiliary Heating in Tokamak Plasmas

International Nuclear Information System (INIS)

Angioni, C.; Peeters, A.G.

2006-01-01

A mechanism of particle pinch for trace impurities in tokamak plasmas, arising from the effect of parallel velocity fluctuations in the presence of a turbulent electrostatic potential, is identified analytically by means of a reduced fluid model and verified numerically with a gyrokinetic code for the first time. The direction of such a pinch reverses as a function of the direction of rotation of the turbulence in agreement with the impurity pinch reversal observed in some experiments when moving from dominant auxiliary ion heating to dominant auxiliary electron heating

Aging assessment of auxiliary feedwater systems

International Nuclear Information System (INIS)

Casada, D.A.

1989-01-01

A study of Pressurized Water Reactor Auxiliary Feedwater (AFW) Systems has been conducted by Oak Ridge National Laboratory (ORNL) under the auspices of the Nuclear Regulatory Commission's Nuclear Plant Aging Research Program. The study has reviewed historical failure experience and current monitoring practices for the AFW System. This paper provides an overview of the study approach and results. 7 figs

Renormalization of supersymmetric models without using auxiliary fields

International Nuclear Information System (INIS)

Urbanek, P.

1986-01-01

Previously a linear representation of supersymmetry (Ss) was used in investigations of renormalizability. There auxiliary fields have been introduced in order that the Ss-algebra closes 'off-shell'. When the auxiliary fields are eliminated by their equations of motion, the Ss representation becomes nonlinear and Ss closes only 'on-shell'. Following O.Piguet and K.Sibold 1984 Ss is expressed through Ward identities which are formulated as functional variations of the generating functional of the Green functions. These functional operators form a closed algebra, a fact essential for the proof of renormalizability, which is given. It is not necessary to use a specific subtraction scheme in the Green functions. The procedure is applied to the Wess-Zumino model and the supersymmetric extension of the quantum electrodynamics. 15 refs. (qui)

Auxiliary equipment cooling circuit in nuclear reactors

International Nuclear Information System (INIS)

Yanagisawa, Ko.

1986-01-01

Purpose: To prevent the propagation of bacterias that transform NO 2 into NO 3 in auxiliary equipment coolants using corrosion inhibitors of nitrite type in BWR type reactors. Method: In auxiliary equipments coolant systems, water quality is controlled by using purified water as supplement water and nitrite such as Na 2 NO 2 as the corrosion inhibitors. However, in the circumstance where dissolved oxygen is present, bacteria propagate to oxidize NO 2 into NO 3 . Thus, NO 2 at 200 ppm is reduced to 20 ppm. In view of the above, a surge tank supplied from water supplement line is connected in series and a deaeration device is disposed thereto. Since the presence of dissolved oxygen causes the bacteria to propagate it is desired that the dissolved oxygen density in the supplement water is less than 5 ppm. Deaeration and pressure reduction in the surge tank can remove the dissolved oxygen, prevent NO 3 increase and also prevent stress corrosion cracks in the system pipeways. (Horiuchi, T.)

A dual-wavelength overlapping resonance Rayleigh scattering method for the determination of chondroitin sulfate with nile blue sulfate

Science.gov (United States)

Cui, Zhiping; Hu, Xiaoli; Liu, Shaopu; Liu, Zhongfang

2011-12-01

A dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) method was developed to detect chondroitin sulfate (CS) with nile blue sulfate (NBS). At pH 3.0-4.0 Britton-Robinson (BR) buffer medium, CS interacted with NBS to form an ion-association complex. As a result, the new spectra of resonance Rayleigh scattering (RRS), second order scattering (SOS) and frequence doubling scattering (FDS) appeared and their intensities were enhanced greatly. Their maximum wavelengths were located at 303 nm (RRS), 362 nm (RRS), 588 nm (SOS) and 350 nm (FDS), respectively. The scattering intensities of the three methods were proportional to the concentration of CS in certain ranges. The methods had high sensitivity and the detection limits were between 1.5 and 7.1 ng mL -1. The DWO-RRS method had the highest sensitivity with the detection limit being 1.5 ng mL -1. The characteristics of the spectra and optimal reaction conditions of RRS method were investigated. The effects of coexistent substances on the determination of CS were evaluated. Owing to the high sensitivity, RRS method had been applied to the determination of CS in eye drops with satisfactory results. The recovery range was between 99.4% and 104.6% and the relative standard deviation (RSD) was between 0.4% and 0.8%. In addition, the reasons for RRS enhancement were discussed and the shape of ion-association complex was characterized by atomic force microscopy (AFM).

Loss Model and Efficiency Analysis of Tram Auxiliary Converter Based on a SiC Device

Directory of Open Access Journals (Sweden)

Hao Liu

2017-12-01

Full Text Available Currently, the auxiliary converter in the auxiliary power supply system of a modern tram adopts Si IGBT as its switching device and with the 1700 V/225 A SiC MOSFET module commercially available from Cree, an auxiliary converter using all SiC devices is now possible. A SiC auxiliary converter prototype is developed during this study. The author(s derive the loss calculation formula of the SiC auxiliary converter according to the system topology and principle and each part loss in this system can be calculated based on the device datasheet. Then, the static and dynamic characteristics of the SiC MOSFET module used in the system are tested, which aids in fully understanding the performance of the SiC devices and provides data support for the establishment of the PLECS loss simulation model. Additionally, according to the actual circuit parameters, the PLECS loss simulation model is set up. This simulation model can simulate the actual operating conditions of the auxiliary converter system and calculate the loss of each switching device. Finally, the loss of the SiC auxiliary converter prototype is measured and through comparison it is found that the loss calculation theory and PLECS loss simulation model is valuable. Furthermore, the thermal images of the system can prove the conclusion about loss distribution to some extent. Moreover, these two methods have the advantages of less variables and fast calculation for high power applications. The loss models may aid in optimizing the switching frequency and improving the efficiency of the system.

An Analytical Method of Auxiliary Sources Solution for Plane Wave Scattering by Impedance Cylinders

DEFF Research Database (Denmark)

Larsen, Niels Vesterdal; Breinbjerg, Olav

2004-01-01

Analytical Method of Auxiliary Sources solutions for plane wave scattering by circular impedance cylinders are derived by transformation of the exact eigenfunction series solutions employing the Hankel function wave transformation. The analytical Method of Auxiliary Sources solution thus obtained...

DUAL TIMELIKE NORMAL AND DUAL TIMELIKE SPHERICAL CURVES IN DUAL MINKOWSKI SPACE

OpenAIRE

ÖNDER, Mehmet

2009-01-01

Abstract: In this paper, we give characterizations of dual timelike normal and dual timelike spherical curves in the dual Minkowski 3-space and we show that every dual timelike normal curve is also a dual timelike spherical curve. Keywords: Normal curves, Dual Minkowski 3-Space, Dual Timelike curves. Mathematics Subject Classifications (2000): 53C50, 53C40. DUAL MINKOWSKI UZAYINDA DUAL TIMELIKE NORMAL VE DUAL TIMELIKE KÜRESEL EĞRİLER Özet: Bu çalışmada, dual Minkowski 3-...

On-chip dual-comb source for spectroscopy.

Science.gov (United States)

Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L; Lipson, Michal

2018-03-01

Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra, which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high quality-factor microcavities has hindered the development of on-chip dual combs. We report the simultaneous generation of two microresonator combs on the same chip from a single laser, drastically reducing experimental complexity. We demonstrate broadband optical spectra spanning 51 THz and low-noise operation of both combs by deterministically tuning into soliton mode-locked states using integrated microheaters, resulting in narrow (lasers or microwave oscillators. We demonstrate high signal-to-noise ratio absorption spectroscopy spanning 170 nm using the dual-comb source over a 20-μs acquisition time. Our device paves the way for compact and robust spectrometers at nanosecond time scales enabled by large beat-note spacings (>1 GHz).

Inundation Mapping for Heterogeneous Land Covers with Synthetic Aperture Radar and Auxiliary Data

Science.gov (United States)

Aristizabal, F.; Judge, J.

2017-12-01

Synthetic Aperture Radar (SAR) has been widely used to detect surface water inundation and provides an advantage over multi-spectral instruments due to cloud penetration and higher spatial resolutions. However, detecting inundation for densely vegetated and urban areas with SAR remains a challenge due to corner reflection and diffuse scattering. Additionally, flat urban surfaces such as roads exhibit similar backscatter coefficients as urban surface water. Differences between inundated and non-inundated backscatter over vegetated land covers of static spatial domains have been demonstrated in previous studies. However, these backscatter differences are sensitive to changes in water depth, soil moisture, SAR sensor parameters, terrain, and vegetation properties. These factors tend to make accurate inundation mapping of heterogeneous regions across varying spatial and temporal extents difficult with exclusive use of SAR. This study investigates the utility of auxiliary data specifically high-resolution (10m) terrain information in conjunction with SAR (10m) for detecting inundated areas. Digital elevation models provide an absolute elevation which could enhance inundation mapping given a limited study extent with similar topography. To counter this limitation, a hydrologically relevant terrain index is proposed known as the Height Above Nearest Drainage (HAND) which normalizes topography to the local relative elevation of the nearest point along the relevant drainage line. HAND has been used for assisting remote sensing inundation mapping in the pre-processing stage as a terrain correction tool and as a post-processing mask that eliminates areas of low inundation risk. While the latter technique is useful for reduction of commission errors, it does not employ HAND for reducing omission errors that can occur from dense vegetation, spectral noise, and urban features. Sentinel-1 dual-pol SAR as well as auxiliary HAND will be used as predictors by various supervised and

Dual-temperature acoustic levitation and sample transport apparatus

Science.gov (United States)

Trinh, E.; Robey, J.; Jacobi, N.; Wang, T.

1986-01-01

The properties of a dual-temperature resonant chamber to be used for acoustical levitation and positioning have been theoretically and experimentally studied. The predictions of a first-order dissipationless treatment of the generalized wave equation for an inhomogeneous medium are in close agreement with experimental results for the temperature dependence of the resonant mode spectrum and the acoustic pressure distribution, although the measured magnitude of the pressure variations does not correlate well with the calculated one. Ground-based levitation of low-density samples has been demonstrated at 800 C, where steady-state forces up to 700 dyn were generated.

Dual-wavelength erbium-doped fiber laser with asymmetric fiber Bragg grating Fabry-Perot cavity

Science.gov (United States)

Chen, Cong; Xu, Zhi-wei; Wang, Meng; Chen, Hai-yan

2014-11-01

A novel dual-wavelength fiber laser with asymmetric fiber Bragg grating (FBG) Fabry-Perot (FP) cavity is proposed and experimentally demonstrated. A couple of uniform FBGs are used as the cavity mirrors, and the third FBG is used as intracavity wavelength selector by changing its operation temperature. Experimental results show that by adjusting the operation temperature of the intracavity wavelength selector, a tunable dual-wavelength laser emission can be achieved. The results demonstrate the new concept of dual-wavelength lasing with asymmetric FBG FP resonator and its technical feasibility.

Determination of effective resonance energies for the (n,γ) reactions of 152Sm and 165Ho by using dual monitors

International Nuclear Information System (INIS)

Budak, M.G.; Karadag, M.; Yuecel, H.

2010-01-01

The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r

Awareness of biomedical waste management among dental professionals and auxiliary staff in Amritsar, India.

Science.gov (United States)

Narang, Ramandeep S; Manchanda, Adesh; Singh, Simarpreet; Verma, Nitin; Padda, Sarfaraz

2012-12-01

The aim of this study was to determine awareness of biomedical waste (BMW) management policies and practices among dental professionals and auxiliary staff in a dental hospital/clinics in Amritsar, India, to inform the development of future policies for effective implementation of BMW rules. The study involved 160 staff members at the Amritsar hospital/clinics (80 dentists and 80 auxiliary staff) to whom a questionnaire was distributed regarding policies, practices and awareness relating to BMW. The questionnaire was first piloted. Completed questionnaires were returned anonymously. The resulting data were statistically tested using the chi-square test for differences between the dentists and auxiliary staff. In respect of BMW management policies, there was a highly significant difference in the responses of the dentists, whose answers suggested far greater knowledge than that of the auxiliaries (Pmanagement practices, the dentists were significantly more aware (Pwaste collection in the hospital and the disposal of various items into different colour-coded bags. As for employee education/awareness, there was a significant difference (Pmanagement among dental auxiliary staff in the dental hospital/clinics in Amritsar and a lack of awareness of some aspects among dentists who work in the hospital/clinics. The results provide the hospital authorities with data upon which they can develop a strategy for improving BMW management.

Auxiliary facilities on nuclear ship 'MUTSU'

International Nuclear Information System (INIS)

Tsujimura, Shotaro; Takigami, Yoshio.

1989-01-01

The nuclear ship 'MUTSU' has been moored at SEKINEHAMA, MUTU City in AOMORI Prefecture and several tests and works are being carried out on the ship. The construction of the auxiliary facilities for these works on the ship was completed in safety in August 1988. After that the facilities have fulfilled their function. The outlines of design, fabrication and construction of the facilities are described in this paper. (author)

Categorical Data Fusion Using Auxiliary Information

OpenAIRE

Fosdick, Bailey K.; DeYoreo, Maria; Reiter, Jerome P.

2015-01-01

In data fusion, analysts seek to combine information from two databases comprised of disjoint sets of individuals, in which some variables appear in both databases and other variables appear in only one database. Most data fusion techniques rely on variants of conditional independence assumptions. When inappropriate, these assumptions can result in unreliable inferences. We propose a data fusion technique that allows analysts to easily incorporate auxiliary information on the dependence struc...

Progress in the integration of the ITER plant systems in auxiliary buildings

International Nuclear Information System (INIS)

Kotamäki, M.; Cordier, J.-J.; Kuehn, I.; Perrin, J.-L.; Sweeney, S.; Villedary, B.

2016-01-01

Highlights: • Usage of 3D CAD model in ITER configuration management presented. • 3D CAD models efficient in configuration and interface management. • Costly and schedule delaying changes avoided with proper interface management. • ITER buildings construction progressing. - Abstract: The ITER Tokamak machine is located in the center of Tokamak complex buildings consisting of Tokamak, Diagnostic, and Tritium buildings. Around the Tokamak complex there are over 30 auxiliary buildings housing various plant systems serving the Tokamak machine either directly or indirectly. The layout and space allocation of each auxiliary building and plant systems housed by the building are represented in the so-called Configuration Management Models (CMM). These are light 3D CAD models that define the required space envelope and the physical interfaces between the systems and the buildings and in-between the systems. The paper describes the CMM and interface management processes of the ITER auxiliary buildings and plant systems, and discusses the preparations for the plant installation phase. In addition, the current baseline configuration of the ITER plant systems in auxiliary buildings is described together with the recent developments in the configuration of different systems, as well as the current status of the construction of the buildings.

Progress in the integration of the ITER plant systems in auxiliary buildings

Energy Technology Data Exchange (ETDEWEB)

Kotamäki, M., E-mail: miikka.kotamaki@iter.org; Cordier, J.-J.; Kuehn, I.; Perrin, J.-L.; Sweeney, S.; Villedary, B.

2016-11-01

Highlights: • Usage of 3D CAD model in ITER configuration management presented. • 3D CAD models efficient in configuration and interface management. • Costly and schedule delaying changes avoided with proper interface management. • ITER buildings construction progressing. - Abstract: The ITER Tokamak machine is located in the center of Tokamak complex buildings consisting of Tokamak, Diagnostic, and Tritium buildings. Around the Tokamak complex there are over 30 auxiliary buildings housing various plant systems serving the Tokamak machine either directly or indirectly. The layout and space allocation of each auxiliary building and plant systems housed by the building are represented in the so-called Configuration Management Models (CMM). These are light 3D CAD models that define the required space envelope and the physical interfaces between the systems and the buildings and in-between the systems. The paper describes the CMM and interface management processes of the ITER auxiliary buildings and plant systems, and discusses the preparations for the plant installation phase. In addition, the current baseline configuration of the ITER plant systems in auxiliary buildings is described together with the recent developments in the configuration of different systems, as well as the current status of the construction of the buildings.

Energy confinement scaling in tokamaks: some implications of recent experiments with ohmic and strong auxiliary heating

International Nuclear Information System (INIS)

Goldston, R.J.

1984-02-01

Recent results from confinement scaling experiments on tokamaks with ohmic and strong auxiliary heating are reviewed. An attempt is made to draw these results together into a low-density ohmic confinement scaling law, and a scaling law for confinement with auxiliary heating. The auxiliary heating confinement law may also serve to explain the saturation in tau/sub E/ vs anti n/sub e/ observed in some ohmic heating density scaling experiments

46 CFR 52.01-35 - Auxiliary, donkey, fired thermal fluid heater, and heating boilers.

Science.gov (United States)

2010-10-01

... 46 Shipping 2 2010-10-01 2010-10-01 false Auxiliary, donkey, fired thermal fluid heater, and... (CONTINUED) MARINE ENGINEERING POWER BOILERS General Requirements § 52.01-35 Auxiliary, donkey, fired thermal... requirements for miscellaneous boiler types, such as donkey, fired thermal fluid heater, heating boiler, etc...

A probabilistic evaluation of the Shearon Harris Nuclear Power Plant auxiliary feedwater isolation system

International Nuclear Information System (INIS)

Anoba, R.C.

1989-01-01

This paper reports on a fault tree approach that was used to evaluate the safety significance of modifying the Shearon Harris Auxiliary Feedwater Isolation System. The design modification was a result of on-site reviews which identified a single failure in the Auxiliary Feedwater Isolation circuitry

Common window resonance features in K and heavier alkaline atoms Rb and Cs

International Nuclear Information System (INIS)

Koide, Michi; Koike, Fumihiro; Nagata, Tetsuo

2002-01-01

A previous study of subvalence s-shell photoionization of potassium [Koide et al.: J. Phys. Soc. Jpn. 71 (2002) 1676] has been extended to the cases of heavier alkaline atoms Rb and Cs. We have measured the photoion time-of-flight spectra using monochromatized synchrotron radiation. Dual windows resonance structure previously observed in K was also found in Rb and Cs, suggesting that those structure are general features in alkaline atoms. We have observed also the Rydberg series of resonances that appear in dual windows. Our data analysis shows that the resonance widths are broad when compared with its rare gas neighbors. Based on multiconfiguration Dirac-Fock calculations, the Rydberg series of resonances were assigned to the 4s 1 4p 6 5s5p excitations embedded in the 4p 5 5s continua for Rb and to the 5s 1 5p 6 6s6p excitations embedded in the 5p 5 6s continua for Cs. (author)

Auxiliary feedwater system aging study

International Nuclear Information System (INIS)

Kueck, J.D.

1992-01-01

The Phase 1 Auxiliary Feedwater (AFW) System Aging Study, NUREG/CR-5404 V1, focused on how and to what extent the various AFW system component types fail, how the failures have been and can be detected, and on the value of current testing requirements and practices. This follow-on study, which will be provided in full in NUREG/CR-5404 V2, provides a closure to the Phase 1 Study. For each of the component types and for the various sources of component failure identified in the Phase 1 Study, the methods of failure detection were designated and tabulated and the following findings became evident: Instrumentation and Control (I and C) related failures dominated the group of failures that were detected during demand conditions; many of the potential failure sources not detectable by the current monitoring practices were related to the I and C portion of the system; some component failure modes are actually aggravated by conventional test methods; and several important system functions did not undergo any function verification test. The goal of this follow-on study was to categorize and evaluate the deficiencies in testing identified by Phase 1 and to make specific recommendations for corrective action. In addition, this study presents discussions of alternate, state-of-the-art test methods, and provides a proposed Auxiliary Feedwater Pump test at normal operating pressure which should do much to verify system operability while eliminating degradation

A Low-Profile Dual-Layer Patch Antenna with a Circular Polarizer Consisting of Dual Semicircular Resonators

Directory of Open Access Journals (Sweden)

Li Guo

2018-06-01

Full Text Available In this paper, a circular polarizer comprising dual semicircular split-rings (DSSRs is presented. By placing it above an elliptical radiator that radiates linearly polarized (LP waves, dual-layer patch antennas capable of radiating right-hand (RH or left-hand (LH circularly polarized (CP waves are achieved in terms of the different offset direction of the bottom splits of the DSSRs. Because of both the capacitive coupling to the radiator and the degenerate modes existing in the excited DSSRs, the DSSRs collaboratively result in a circularly polarized radiation, successfully converting incident LP waves into CP ones. Simulated results show that the impedance, axial ratio (AR, and gain frequency response of both proposed CP antennas are identical, with a simulated 3-dB AR bandwidth of 72 MHz covering 2.402–2.474 GHz and a gain enhanced by 3.9 dB. The proposed antennas were fabricated and measured, revealing an operational bandwidth of 65 MHz (2.345–2.41 GHz and a peak gain up to 9 dBi. Moreover, a low profile of 0.063λ0 is maintained. The proposed CP antennas could be as a candidate for wireless target detection applications in terms of their identical frequency response property.

Dual-mode plasmonic nanorod type antenna based on the concept of a trapped dipole.

Science.gov (United States)

Panaretos, Anastasios H; Werner, Douglas H

2015-04-06

In this paper we theoretically investigate the feasibility of creating a dual-mode plasmonic nanorod antenna. The proposed design methodology relies on adapting to optical wavelengths the principles of operation of trapped dipole antennas, which have been widely used in the low MHz frequency range. This type of antenna typically employs parallel LC circuits, also referred to as "traps", which are connected along the two arms of the dipole. By judiciously choosing the resonant frequency of these traps, as well as their position along the arms of the dipole, it is feasible to excite the λ/2 resonance of both the original dipole as well as the shorter section defined by the length of wire between the two traps. This effectively enables the dipole antenna to have a dual-mode of operation. Our analysis reveals that the implementation of this concept at the nanoscale requires that two cylindrical pockets (i.e. loading volumes) be introduced along the length of the nanoantenna, inside which plasmonic core-shell particles are embedded. By properly selecting the geometry and constitution of the core-shell particle as well as the constitution of the host material of the two loading volumes and their position along the nanorod, the equivalent effect of a resonant parallel LC circuit can be realized. This effectively enables a dual-mode operation of the nanorod antenna. The proposed methodology introduces a compact approach for the realization of dual-mode optical sensors while at the same time it clearly illustrates the inherent tuning capabilities that core-shell particles can offer in a practical framework.

Intrinsically safe electrical installations, auxiliary circuits and electric communication equipment

Energy Technology Data Exchange (ETDEWEB)

Herms, C D

1981-11-19

Technical progress has not stopped short of electrical systems in mining, so that three new chapters are new included in the VDE regulations leaflet No. 0118 on 'Installation of electrical systems in underground coal mining'. The regulations on intrinsically safe electric systems, auxiliary circuits and communication systems are briefly described, and grounds for the regulations are presented. The regulations already take account of European regulations on intrinsic safety which will soon be published in a European Regulation on Mine Explosions. In the chapters on auxiliary circuits and communication systems, protection against direct contact, fires, and explosions is discussed as well as the further goal of reliable signal transmission.

Analysis and Measurement of NOx Emissions in Port Auxiliary Vessels

Directory of Open Access Journals (Sweden)

German de Melo Rodriguez

2013-09-01

Full Text Available This paper is made NOx pollution emitted by port auxiliary vessels, specifically by harbour tugs, due to its unique operating characteristics of operation, require a large propulsion power changes discontinuously, also possess some peculiar technical characteristics, large tonnage and high propulsive power, that differentiate them from other auxiliary vessels of the port. Taking into account all the above features, there are no studies of the NOx emission engines caused by different working regimes of power because engine manufacturers have not measured these emissions across the range of operating power, but usually we only report the pollution produced by its engines to a maximum continuous power.

29 CFR Appendix II to Part 1918 - Tables for Selected Miscellaneous Auxiliary Gear (Mandatory)

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Tables for Selected Miscellaneous Auxiliary Gear (Mandatory) II Appendix II to Part 1918 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND.... 1918, App. II Appendix II to Part 1918—Tables for Selected Miscellaneous Auxiliary Gear (Mandatory...

Heat removal performance of auxiliary cooling system for the high temperature engineering test reactor during scrams

International Nuclear Information System (INIS)

Takeda, Takeshi; Tachibana, Yukio; Iyoku, Tatsuo; Takenaka, Satsuki

2003-01-01

The auxiliary cooling system of the high temperature engineering test reactor (HTTR) is employed for heat removal as an engineered safety feature when the reactor scrams in an accident when forced circulation can cool the core. The HTTR is the first high temperature gas-cooled reactor in Japan with reactor outlet gas temperature of 950 degree sign C and thermal power of 30 MW. The auxiliary cooling system should cool the core continuously avoiding excessive cold shock to core graphite components and water boiling of itself. Simulation tests on manual trip from 9 MW operation and on loss of off-site electric power from 15 MW operation were carried out in the rise-to-power test up to 20 MW of the HTTR. Heat removal characteristics of the auxiliary cooling system were examined by the tests. Empirical correlations of overall heat transfer coefficients were acquired for a helium/water heat exchanger and air cooler for the auxiliary cooling system. Temperatures of fluids in the auxiliary cooling system were predicted on a scram event from 30 MW operation at 950 degree sign C of the reactor outlet coolant temperature. Under the predicted helium condition of the auxiliary cooling system, integrity of fuel blocks among the core graphite components was investigated by stress analysis. Evaluation results showed that overcooling to the core graphite components and boiling of water in the auxiliary cooling system should be prevented where open area condition of louvers in the air cooler is the full open

Dual-mode T_1 and T_2 magnetic resonance imaging contrast agent based on ultrasmall mixed gadolinium-dysprosium oxide nanoparticles: synthesis, characterization, and in vivo application

International Nuclear Information System (INIS)

Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong

2015-01-01

A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)

Dual-Recognition Förster Resonance Energy Transfer Based Platform for One-Step Sensitive Detection of Pathogenic Bacteria Using Fluorescent Vancomycin-Gold Nanoclusters and Aptamer-Gold Nanoparticles.

Science.gov (United States)

Yu, Mengqun; Wang, Hong; Fu, Fei; Li, Linyao; Li, Jing; Li, Gan; Song, Yang; Swihart, Mark T; Song, Erqun

2017-04-04

The effective monitoring, identification, and quantification of pathogenic bacteria is essential for addressing serious public health issues. In this study, we present a universal and facile one-step strategy for sensitive and selective detection of pathogenic bacteria using a dual-molecular affinity-based Förster (fluorescence) resonance energy transfer (FRET) platform based on the recognition of bacterial cell walls by antibiotic and aptamer molecules, respectively. As a proof of concept, Vancomycin (Van) and a nucleic acid aptamer were employed in a model dual-recognition scheme for detecting Staphylococcus aureus (Staph. aureus). Within 30 min, by using Van-functionalized gold nanoclusters and aptamer-modified gold nanoparticles as the energy donor and acceptor, respectively, the FRET signal shows a linear variation with the concentration of Staph. aureus in the range from 20 to 10 8 cfu/mL with a detection limit of 10 cfu/mL. Other nontarget bacteria showed negative results, demonstrating the good specificity of the approach. When employed to assay Staph. aureus in real samples, the dual-recognition FRET strategy showed recoveries from 99.00% to the 109.75% with relative standard derivations (RSDs) less than 4%. This establishes a universal detection platform for sensitive, specific, and simple pathogenic bacteria detection, which could have great impact in the fields of food/public safety monitoring and infectious disease diagnosis.

Large gap plasma display cell with auxiliary electrodes: macro-cell experiments and two-dimensional modelling

International Nuclear Information System (INIS)

Ouyang, J T; Callegari, Th; Caillier, B; Boeuf, J-P

2003-01-01

In this paper we use a two-dimensional fluid model and a 'macroscopic' PDP cell to investigate the possibility of using large gap configurations with auxiliary electrodes to improve the efficiency of PDP discharge cells. The large gap allows operation in a transient positive column regime where energy is more efficiently deposited into xenon excitation, while the auxiliary electrodes are used to keep reasonable values of the operating voltage. Two types of auxiliary electrode configurations (floating and powered) are considered. The discharge characteristics and the discharge efficiency in exciting xenon are studied with simulations and by measuring the intensity of infrared emission from xenon and visible emission from neon in a macroscopic PDP cell. The results show that an efficient positive column regime can be achieved at reasonably low operating voltages when the auxiliary electrode configuration is carefully designed

Verb and auxiliary movement in agrammatic Broca's aphasia

NARCIS (Netherlands)

Bastiaanse, Y.R.M.; Thompson, C.K.

Verb production in agrammatic Broca's aphasia has repeatedly been shown to be impaired by a number of investigators. Not only is the number of verbs produced often significantly reduced, but verb inflections and auxiliaries are often omitted as well (e.g., Bastiaanse, Jonkers, & Moltmaker-Osinga,

The Explicit Determinations Of Dual Plane Curves And Dual Helices In Terms Of Its Dual Curvature And Dual Torsion

OpenAIRE

Lee Jae Won; Choi Jin Ho; Jin Dae Ho

2014-01-01

In this paper, we give the explicit determinations of dual plane curves, general dual helices and dual slant helices in terms of its dual curvature and dual torsion as a fundamental theory of dual curves in a dual 3-space

Auxiliary Heat Exchanger Flow Distribution Test

International Nuclear Information System (INIS)

Kaufman, J.S.; Bressler, M.M.

1983-01-01

The Auxiliary Heat Exchanger Flow Distribution Test was the first part of a test program to develop a water-cooled (tube-side), compact heat exchanger for removing heat from the circulating gas in a high-temperature gas-cooled reactor (HTGR). Measurements of velocity and pressure were made with various shell side inlet and outlet configurations. A flow configuration was developed which provides acceptable velocity distribution throughout the heat exchanger without adding excessive pressure drop

Natural convection in an asymmetrically heated vertical channel with an adiabatic auxiliary plate

International Nuclear Information System (INIS)

Taieb, Soumaya; Hatem, Laatar Ali; Balti, Jalloul

2013-01-01

The effect of an auxiliary plate on natural convection in an asymmetrically heated channel is studied numerically in laminar regime. The computational procedure is made by solving the unsteady two dimensional Navier-Stokes and energy equations. This nonlinear system is integrated by a finite volume approach and then solved in time using the projection method, allowing the decoupling pressure from velocity. More than hundred simulations are performed to determine the best positions of the auxiliary plate that enhance the induced mass flow and the heat transfer rate for modified Rayleigh numbers ranging from Ra m = 10 2 to Ra m = 10 5 . Contour maps are plotted and then used to precise the enhancement rates of the mass flow and the heat transfer for any position of the auxiliary plate in the channel. The numerical results (velocity, pressure and temperature fields) provide detailed information about the evolution of the flow structure according to the geometry considered in this study. In addition, they permit to explain why the mass flow rate and Nusselt number are enhanced for certain positions of the auxiliary plate and are on the contrary deteriorated for others. (authors)

Total synthesis of cytochrome b562 by native chemical ligation using a removable auxiliary

Science.gov (United States)

Low, Donald W.; Hill, Michael G.; Carrasco, Michael R.; Kent, Stephen B. H.; Botti, Paolo

2001-01-01

We have completed the total chemical synthesis of cytochrome b562 and an axial ligand analogue, [SeMet7]cyt b562, by thioester-mediated chemical ligation of unprotected peptide segments. A novel auxiliary-mediated native chemical ligation that enables peptide ligation to be applied to protein sequences lacking cysteine was used. A cleavable thiol-containing auxiliary group, 1-phenyl-2-mercaptoethyl, was added to the α-amino group of one peptide segment to facilitate amide bond-forming ligation. The amine-linked 1-phenyl-2-mercaptoethyl auxiliary was stable to anhydrous hydrogen fluoride used to cleave and deprotect peptides after solid-phase peptide synthesis. Following native chemical ligation with a thioester-containing segment, the auxiliary group was cleanly removed from the newly formed amide bond by treatment with anhydrous hydrogen fluoride, yielding a full-length unmodified polypeptide product. The resulting polypeptide was reconstituted with heme and folded to form the functional protein molecule. Synthetic wild-type cyt b562 exhibited spectroscopic and electrochemical properties identical to the recombinant protein, whereas the engineered [SeMet7]cyt b562 analogue protein was spectroscopically and functionally distinct, with a reduction potential shifted by ≈45 mV. The use of the 1-phenyl-2-mercaptoethyl removable auxiliary reported here will greatly expand the applicability of total protein synthesis by native chemical ligation of unprotected peptide segments. PMID:11390992

Numerical analysis of magnetically suspended rotor in HTR-10 helium circulator being dropped into auxiliary bearings

International Nuclear Information System (INIS)

Zhao Jingxiong; Yang Guojun; Li Yue; Yu Suyuan

2012-01-01

Active magnetic bearings (AMB) have been selected to support the rotor of primary helium circulator in commercial 10 Mega-Walt High Temperature Gas-cooled Reactor (HTR-10). In an AMB system, the auxiliary bearings are necessary to protect the AMB components in case of losing power. This paper performs the impact simulation of Magnetically Suspended Rotor in HTR-10 Helium Circulator being dropped into the auxiliary bearings using the finite element program ABAQUS. The dynamic response and the strain field of auxiliary bearings are analyzed. The results achieved by the numerical analysis are in agreement with the experiment results. Therefore, the feasibility of the design of auxiliary bearing and the possibility of using the AMB system in the HTR are proved. (authors)

ASCERTAINMENT OF ELECTRIC-SUPPLY SCHEMES RELIABILITY FOR THE ATOMIC POWER PLANT AUXILIARIES

Directory of Open Access Journals (Sweden)

A. L. Starzhinskij

2015-01-01

Full Text Available The paper completes ascertainment of electrical-supply scheme reliability for the auxiliaries of a nuclear power plant. Thereat the author considers the system behavior during the block normal operation, carrying out current maintenance, and capital repairs in combination with initiating events. The initiating events for reactors include complete blackout, i.e. the loss of outside power supply (normal and reserve; emergency switching one of the working turbogenerators; momentary dumping the normal rating to the level of auxiliaries with seating the cutout valve of one turbo-generator. The combination of any initiating event with the repairing mode in case of one of the system elements failure should not lead to blackout occurrence of more than one system of the reliable power supply. This requirement rests content with the help of the reliable power supply system self-dependence (electrical and functional and the emergency power-supply operational autonomy (diesel generator and accumulator batteries.The reliability indicators of the power supply system for the nuclear power plant auxiliaries are the conditional probabilities of conjoined blackout of one, two, and three sections of the reliable power supply conditional upon an initiating event emerging and the blackout of one, two, and three reliable power-supply sections under the normal operational mode. Furthermore, they also are the blackout periodicity of one and conjointly two, three, and four sections of normal operation under the block normal operational mode. It is established that the blackout of one bus section of normal operation and one section of reliable power-supply system of the auxiliaries that does not lead to complete blackout of the plant auxiliaries may occur once in three years. The probability of simultaneous power failure of two or three normal-operation sections and of two reliable power-supply sections during the power plant service life is unlikely.

Component Data Base for Space Station Resistojet Auxiliary Propulsion

Science.gov (United States)

Bader, Clayton H.

1988-01-01

The resistojet was baselined for Space Station auxiliary propulsion because of its operational versatility, efficiency, and durability. This report was conceived as a guide to designers and planners of the Space Station auxiliary propulsion system. It is directed to the low thrust resistojet concept, though it should have application to other station concepts or systems such as the Environmental Control and Life Support System (ECLSS), Manufacturing and Technology Laboratory (MTL), and the Waste Fluid Management System (WFMS). The information will likely be quite useful in the same capacity for other non-Space Station systems including satellite, freeflyers, explorers, and maneuvering vehicles. The report is a catalog of the most useful information for the most significant feed system components and is organized for the greatest convenience of the user.

Automated positioning dual-axis solar tracking system with precision elevation and azimuth angle control

International Nuclear Information System (INIS)

Sidek, M.H.M.; Azis, N.; Hasan, W.Z.W.; Ab Kadir, M.Z.A.; Shafie, S.; Radzi, M.A.M.

2017-01-01

This paper presents a study on an automated positioning open-loop dual-axis solar tracking system. The solar tracker was designed and fabricated using standard cylindrical aluminium hollow and Polyuthrene (PE). The control system of the solar tracker was governed by Micro Controller Unit (MCU) with auxiliary devices which includes encoder and Global Positioning System (GPS). The sun path trajectory algorithm utilizing the astronomical equation and GPS information was also embedded in the system. The power generation performance of the dual-axis solar tracking system was compared with the fixed-tilted Photovoltaic (PV) system. It is found that the solar tracker is able to position itself automatically based on sun path trajectory algorithm with an accuracy of ±0.5°. The embedded Proportional Integral Derivative (PID) positioning system improves the tracking of elevation and azimuth angles with minimum energy consumption. It is reveals that the proposed solar tracker is able generate 26.9% and 12.8% higher power than fixed-tilted PV system on a clear and heavy overcast conditions respectively. Overall, the open-loop dual-axis solar tracker can be deployed automatically at any location on the earth with minimal configurations and is suitable for mobile solar tracking system. - Highlights: • Self-positioning dual-axis solar tracking system. • Precise control of elevation and azimuth angle. • Sun path trajectory based on astronomical equation and GPS. • Can achieve up to 26.9% higher power than fixed-tilted PV system under clear weather condition.

A Superconducting Dual-Channel Photonic Switch.

Science.gov (United States)

Srivastava, Yogesh Kumar; Manjappa, Manukumara; Cong, Longqing; Krishnamoorthy, Harish N S; Savinov, Vassili; Pitchappa, Prakash; Singh, Ranjan

2018-06-05

The mechanism of Cooper pair formation and its underlying physics has long occupied the investigation into high temperature (high-T c ) cuprate superconductors. One of the ways to unravel this is to observe the ultrafast response present in the charge carrier dynamics of a photoexcited specimen. This results in an interesting approach to exploit the dissipation-less dynamic features of superconductors to be utilized for designing high-performance active subwavelength photonic devices with extremely low-loss operation. Here, dual-channel, ultrafast, all-optical switching and modulation between the resistive and the superconducting quantum mechanical phase is experimentally demonstrated. The ultrafast phase switching is demonstrated via modulation of sharp Fano resonance of a high-T c yttrium barium copper oxide (YBCO) superconducting metamaterial device. Upon photoexcitation by femtosecond light pulses, the ultrasensitive cuprate superconductor undergoes dual dissociation-relaxation dynamics, with restoration of superconductivity within a cycle, and thereby establishes the existence of dual switching windows within a timescale of 80 ps. Pathways are explored to engineer the secondary dissociation channel which provides unprecedented control over the switching speed. Most importantly, the results envision new ways to accomplish low-loss, ultrafast, and ultrasensitive dual-channel switching applications that are inaccessible through conventional metallic and dielectric based metamaterials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

The CFS-PML for 2D Auxiliary Differential Equation FDTD Method Using Associated Hermite Orthogonal Functions

Directory of Open Access Journals (Sweden)

Feng Jiang

2017-01-01

Full Text Available The complex frequency shifted (CFS perfectly matched layer (PML is proposed for the two-dimensional auxiliary differential equation (ADE finite-difference time-domain (FDTD method combined with Associated Hermite (AH orthogonal functions. According to the property of constitutive parameters of CFS-PML (CPML absorbing boundary conditions (ABCs, the auxiliary differential variables are introduced. And one relationship between field components and auxiliary differential variables is derived. Substituting auxiliary differential variables into CPML ABCs, the other relationship between field components and auxiliary differential variables is derived. Then the matrix equations are obtained, which can be unified with Berenger’s PML (BPML and free space. The electric field expansion coefficients can thus be obtained, respectively. In order to validate the efficiency of the proposed method, one example of wave propagation in two-dimensional free space is calculated using BPML, UPML, and CPML. Moreover, the absorbing effectiveness of the BPML, UPML, and CPML is discussed in a two-dimensional (2D case, and the numerical simulations verify the accuracy and efficiency of the proposed method.

Generic description of facilities at the shaft head (auxiliary entrance installations) of deep geological repositories

International Nuclear Information System (INIS)

2016-10-01

In a deep geological repository, the access structures function as the link between the surface and the installations and structures at the disposal level. In the planned implementation scenarios, at least two access structures will be in operation up to the time of closure of the repository. The radioactive waste will be transported via the main access from the surface to the disposal level during emplacement operations. For the construction and operation of a deep geological repository, additional access structures are required. These auxiliary accesses and the associated surface infrastructure (e.g. shaft head installations) form the subject of this report. To provide as broad and comprehensive a description as possible, seven types of auxiliary access facilities are defined; these are characterised in line with the current status of planning and their functions and impacts are described. During construction, operation and dismantling of auxiliary access facilities, the usual conventional safety measures (inter alia) have to be observed (e.g. groundwater protection, fire prevention, facility security, accident prevention). Regarding the 'Ordinance on Protection against Major Accidents' no large quantities of hazardous materials, i.e. above the corresponding threshold quantities, are to be expected in the auxiliary access facilities. Proper handling and compliance with applicable regulations in all phases will ensure no hazard to humans and the environment. As no handling of radioactive materials is foreseen in the auxiliary access facilities, and because exhaust air and waste water from the controlled zones of a repository will, in principle, be removed via the main access and not the auxiliary accesses, a safety-relevant emission of radioactive substances and transport of contaminated material can be ruled out for the auxiliary access facilities during both normal operation and also in the case of an accident. Based on the information presented in

Capacitance of circular patch resonator

International Nuclear Information System (INIS)

Miano, G.; Verolino, L.; Naples Univ.; Panariello, G.; Vaccaro, V.G.; Naples Univ.

1995-11-01

In this paper the capacitance of the circular microstrip patch resonator is computed. It is shown that the electrostatic problem can be formulated as a system of dual integral equations, and the most interesting techniques of solutions of these systems are reviewed. Some useful approximated formulas for the capacitance are derived and plots of the capacitance are finally given in a wide range of dielectric constants

High Selectivity Dual-Band Bandpass Filter with Tunable Lower Passband

Directory of Open Access Journals (Sweden)

Wei-Qiang Pan

2015-01-01

Full Text Available This paper presents a novel method to design dual-band bandpass filters with tunable lower passband and fixed upper passband. It utilizes a trimode resonator with three controllable resonant modes. Discriminating coupling is used to suppress the unwanted mode to avoid the interference. Varactors are utilized to realize tunable responses. The bandwidth of the two bands can be controlled individually. Transmission zeros are generated near the passband edges, resulting in high selectivity. For demonstration, a tunable bandpass filter is implemented. Good agreement between the prediction and measurement validates the proposed method.

Vanishing auxiliary variables in PPS sampling - with applications in microscopy

DEFF Research Database (Denmark)

Andersen, Ina Trolle; Hahn, Ute; Jensen, Eva B. Vedel

Recently, non-uniform sampling has been suggested in microscopy to increase efficiency. More precisely, sampling proportional to size (PPS) has been introduced where the probability of sampling a unit in the population is proportional to the value of an auxiliary variable. Unfortunately, vanishing...... auxiliary variables are a common phenomenon in microscopy and, accordingly, part of the population is not accessible, using PPS sampling. We propose a modification of the design, for which an optimal solution can be found, using a model assisted approach. The optimal design has independent interest...... in sampling theory. We verify robustness of the new approach by numerical results, and we use real data to illustrate the applicability....

[The surgical nurse: his/her leadership of auxiliary nursing personnel].

Science.gov (United States)

Galvão, C M; Trevizan, M A; Sawada, N O; Mendes, I A

1997-01-01

This investigation as carried out in order to promote follow-up in the studies concerning nurse's leadership in the hospital context. Emphasys is given to the nurses that works in surgical ward unities. As a theoretical framework, authors utilized the model of leadership proposed by Hersey and Blanchard, named Situational Leadership. The objective was to analyze the correspondence of opinion between nurses and nursing auxiliary personnel about the leadership style of nurse should adopt in accordance with the maturity level of an element of the auxiliary personnel based on six categories of activities that were studied. Authors found out that nurses should adopt the styles of participant leadership, such as E3 (participating) and/or E4 (delegating).

A new auxiliary equation and exact travelling wave solutions of nonlinear equations

International Nuclear Information System (INIS)

Sirendaoreji

2006-01-01

A new auxiliary ordinary differential equation and its solutions are used for constructing exact travelling wave solutions of nonlinear partial differential equations in a unified way. The main idea of this method is to take full advantage of the auxiliary equation which has more new exact solutions. More new exact travelling wave solutions are obtained for the quadratic nonlinear Klein-Gordon equation, the combined KdV and mKdV equation, the sine-Gordon equation and the Whitham-Broer-Kaup equations

1,3-Bis(2-chloroethyl)-1-nitrosourea-loaded bovine serum albumin nanoparticles with dual magnetic resonance-fluorescence imaging for tracking of chemotherapeutic agents.

Science.gov (United States)

Wei, Kuo-Chen; Lin, Feng-Wei; Huang, Chiung-Yin; Ma, Chen-Chi M; Chen, Ju-Yu; Feng, Li-Ying; Yang, Hung-Wei

To date, knowing how to identify the location of chemotherapeutic agents in the human body after injection is still a challenge. Therefore, it is urgent to develop a drug delivery system with molecular imaging tracking ability to accurately understand the distribution, location, and concentration of a drug in living organisms. In this study, we developed bovine serum albumin (BSA)-based nanoparticles (NPs) with dual magnetic resonance (MR) and fluorescence imaging modalities (fluorescein isothiocyanate [FITC]-BSA-Gd/1,3-bis(2-chloroethyl)-1-nitrosourea [BCNU] NPs) to deliver BCNU for inhibition of brain tumor cells (MBR 261-2). These BSA-based NPs are water dispersible, stable, and biocompatible as confirmed by XTT cell viability assay. In vitro phantoms and in vivo MR and fluorescence imaging experiments show that the developed FITC-BSA-Gd/BCNU NPs enable dual MR and fluorescence imaging for monitoring cellular uptake and distribution in tumors. The T1 relaxivity (R1) of FITC-BSA-Gd/BCNU NPs was 3.25 mM(-1) s(-1), which was similar to that of the commercial T1 contrast agent (R1 =3.36 mM(-1) s(-1)). The results indicate that this multifunctional drug delivery system has potential bioimaging tracking of chemotherapeutic agents ability in vitro and in vivo for cancer therapy.

Vacuum transitions in dual models

International Nuclear Information System (INIS)

Pashnev, A.I.; Volkov, D.V.; Zheltukhin, A.A.

1976-01-01

The investigation is continued of the spontaneous vacuum transition problem in the Neview-Schwartz dual model (NSDM). It is shown that vacuum transitions allow disclosing of supplementary degeneration in the resonance state spectrum. The dual amplitudes possess an internal structure corresponding to the presence of an infinite number of quarks with increasing masses and retained charges. The Adler principle holds. Analytic continuation on the constant of induced vacuum transitions makes it possible to establish the existence of spontaneous vacuum transitions in the NSDM. The consequence of this fact is the exact SU(2) symmetry of π, rho meson trajectories and the Higgs mechanism in the model. In this case the ratios of masses of particles leading trajectories are analogous to those obtained in the current algebra. It is shown that in the NSDM there arises chiral SU(2) x SU(2) x U(1) x U(1) x ... symmetry resulting from spontaneous vacuum transitions

Performance assessment of auxiliary bearing in HTR-10 AMB helium circulator on the event of rotor drop

International Nuclear Information System (INIS)

Xiao Zhen; Yang Guojun; Li Yue; Shi Zhengang; Yu Suyuan

2014-01-01

In this paper, a model for analyzing internal contact stress arid external load of ball bearing from rotor displacement was developed based on the Hertz contact theory and applied to the analysis of the rotor drop test in HTR-10 helium circulator equipped with AMB (Active Magnetic Bearing) to gain a better understanding of auxiliary bearing performance at different stages after the rotor drop. It was shown that the auxiliary bearing can well resist axial impact produced by rotor drop, avoiding of internal severe plastic deformation and damage to the performance of the auxiliary bearing. Rotor's rotary motion and the heat accumulation of the inner ring resulted from the initial acute acceleration are the main contributor of radial load during the rotor idling and may cause the failure of auxiliary bearing. This paper analyzed the influence of this load and confirmed that the auxiliary bearing can still work in its loading limits. (authors)

Auxiliary fields for super Yang-Mills from division algebras

CERN Document Server

Evans, Jonathan M.

1994-01-01

Division algebras are used to explain the existence and symmetries of various sets of auxiliary fields for super Yang-Mills in dimensions d=3,4,6,10. (Contribution to G\\"ursey Memorial Conference I: Strings and Symmetries)

In vivo tomographic imaging with fluorescence and MRI using tumor-targeted dual-labeled nanoparticles

Directory of Open Access Journals (Sweden)

Zhang Y

2013-12-01

Full Text Available Yue Zhang,1 Bin Zhang,1 Fei Liu,1,2 Jianwen Luo,1,3 Jing Bai1 1Department of Biomedical Engineering, School of Medicine, 2Tsinghua-Peking Center for Life Sciences, 3Center for Biomedical Imaging Research, Tsinghua University, Beijing, People's Republic of China Abstract: Dual-modality imaging combines the complementary advantages of different modalities, and offers the prospect of improved preclinical research. The combination of fluorescence imaging and magnetic resonance imaging (MRI provides cross-validated information and direct comparison between these modalities. Here, we report on the application of a novel tumor-targeted, dual-labeled nanoparticle (NP, utilizing iron oxide as the MRI contrast agent and near infrared (NIR dye Cy5.5 as the fluorescent agent. Results of in vitro experiments verified the specificity of the NP to tumor cells. In vivo tumor targeting and uptake of the NPs in a mouse model were visualized by fluorescence and MR imaging collected at different time points. Quantitative analysis was carried out to evaluate the efficacy of MRI contrast enhancement. Furthermore, tomographic images were also acquired using both imaging modalities and cross-validated information of tumor location and size between these two modalities was revealed. The results demonstrate that the use of dual-labeled NPs can facilitate the dual-modal detection of tumors, information cross-validation, and direct comparison by combing fluorescence molecular tomography (FMT and MRI. Keywords: dual-modality, fluorescence molecular tomography (FMT, magnetic resonance imaging (MRI, nanoparticle

ADAPTIVE SELECTION OF AUXILIARY OBJECTIVES IN MULTIOBJECTIVE EVOLUTIONARY ALGORITHMS

Directory of Open Access Journals (Sweden)

I. A. Petrova

2016-05-01

Full Text Available Subject of Research.We propose to modify the EA+RL method, which increases efficiency of evolutionary algorithms by means of auxiliary objectives. The proposed modification is compared to the existing objective selection methods on the example of travelling salesman problem. Method. In the EA+RL method a reinforcement learning algorithm is used to select an objective – the target objective or one of the auxiliary objectives – at each iteration of the single-objective evolutionary algorithm.The proposed modification of the EA+RL method adopts this approach for the usage with a multiobjective evolutionary algorithm. As opposed to theEA+RL method, in this modification one of the auxiliary objectives is selected by reinforcement learning and optimized together with the target objective at each step of the multiobjective evolutionary algorithm. Main Results.The proposed modification of the EA+RL method was compared to the existing objective selection methods on the example of travelling salesman problem. In the EA+RL method and its proposed modification reinforcement learning algorithms for stationary and non-stationary environment were used. The proposed modification of the EA+RL method applied with reinforcement learning for non-stationary environment outperformed the considered objective selection algorithms on the most problem instances. Practical Significance. The proposed approach increases efficiency of evolutionary algorithms, which may be used for solving discrete NP-hard optimization problems. They are, in particular, combinatorial path search problems and scheduling problems.

Multireference Density Functional Theory with Generalized Auxiliary Systems for Ground and Excited States.

Science.gov (United States)

Chen, Zehua; Zhang, Du; Jin, Ye; Yang, Yang; Su, Neil Qiang; Yang, Weitao

2017-09-21

To describe static correlation, we develop a new approach to density functional theory (DFT), which uses a generalized auxiliary system that is of a different symmetry, such as particle number or spin, from that of the physical system. The total energy of the physical system consists of two parts: the energy of the auxiliary system, which is determined with a chosen density functional approximation (DFA), and the excitation energy from an approximate linear response theory that restores the symmetry to that of the physical system, thus rigorously leading to a multideterminant description of the physical system. The electron density of the physical system is different from that of the auxiliary system and is uniquely determined from the functional derivative of the total energy with respect to the external potential. Our energy functional is thus an implicit functional of the physical system density, but an explicit functional of the auxiliary system density. We show that the total energy minimum and stationary states, describing the ground and excited states of the physical system, can be obtained by a self-consistent optimization with respect to the explicit variable, the generalized Kohn-Sham noninteracting density matrix. We have developed the generalized optimized effective potential method for the self-consistent optimization. Among options of the auxiliary system and the associated linear response theory, reformulated versions of the particle-particle random phase approximation (pp-RPA) and the spin-flip time-dependent density functional theory (SF-TDDFT) are selected for illustration of principle. Numerical results show that our multireference DFT successfully describes static correlation in bond dissociation and double bond rotation.

Model predictions for auxiliary heating in spheromaks

International Nuclear Information System (INIS)

Fauler, T.K.; Khua, D.D.

1997-01-01

Calculations are presented of the plasma temperature waited for under auxiliary heating in spheromaks. A model, ensuring good agreement of earlier experiments with joule heating results, is used. The model includes heat losses due to magnetic fluctuations and shows that the plasma temperatures of the kilo-electron-volt order may be achieved in a small device with the radius of 0.3 m only

A Corpus-Based Study on the Use of Past Tense Auxiliary "Be" in Argumentative Essays of Malaysian ESL Learners

Science.gov (United States)

Manokaran, Janaki; Ramalingam, Chithra; Adriana, Karen

2013-01-01

This research is a corpus-based study of secondary and college ESL Malaysian learner's written work by identifying and classifying the types of errors in the Past Tense Auxiliary "Be". This research studied the past tense auxiliary "be", types of past tense auxiliary "be" errors and frequency of past tense auxiliary…

Versatile Auxiliary Orthodontic Spring for Orthodontic Correction of Impacted Teeth

Directory of Open Access Journals (Sweden)

Pavankumar Janardan Vibhute

2011-01-01

Full Text Available Malocclusion such as impacted tooth is not uncommon. Many approaches with various auxiliary springs have been reported in literature till date for correction of such malocclusions. They had biomechanical, retentive and stability drawbacks inherent in their designs. This article presents the innovative approach for orthodontic correction of impacted tooth, especially with light force appliance, i.e. Begg′s appliance, where round wires in round molar tubes are used throughout treatment. A versatile auxiliary orthodontic spring (VAOS is fabricated in the 0.018 inch Australian stainless steel round wire, which may be anchored on round molar buccal tube, and desirable force vector may be applied in any of the three dimensions. Fabrication and its clinical application are discussed.

Multicolor Upconversion Nanoprobes Based on a Dual Luminescence Resonance Energy Transfer Assay for Simultaneous Detection and Bioimaging of [Ca2+ ]i and pHi in Living Cells.

Science.gov (United States)

Song, Xinyue; Yue, Zihong; Zhang, Jiayu; Jiang, Yanxialei; Wang, Zonghua; Zhang, Shusheng

2018-04-25

Intracellular [Ca 2+ ] i and pH i have a close relationship, and their abnormal levels can result in cell dysfunction and accompanying diseases. Thus, simultaneous determination of [Ca 2+ ] i and pH i can more accurately investigate complex biological processes in an integrated platform. Herein, multicolor upconversion nanoparticles (UCNPs) were prepared with the advantages of no spectral overlapping, single NIR excitation wavelengths, and greater tissue penetration depth. The upconversion nanoprobes were easily prepared by the attachment of two fluorescent dyes, Fluo-4 and SNARF-4F. Based on the dual luminescence resonance energy transfer (LRET) process, the blue and green fluorescence of the UCNPs were specially quenched and selectively recovered after the detachment and/or absorbance change of the attached fluorescent dyes, enabling dual detection. Importantly, the developed nanoprobe could successfully be applied for the detection of [Ca 2+ ] i and pH i change in adenosine triphosphate (ATP) and ethylene glycol tetraacetic acid (EGTA) stimulation in living cells. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

Dual Band Parasitic Element Patch Antenna for LTE/WLAN Applications

Directory of Open Access Journals (Sweden)

BAG Biplab

2017-05-01

Full Text Available In this paper, a single layer coaxial fed dual band slotted microstrip antenna is proposed. The proposed antenna consists of two direct couple parasitic elements and L-shape slots on the main resonating element. Two resonant modes are excited and it covers 4G LTE and WLAN middle band. The -10dB impedance bandwidth for resonant frequency of 2.35GHz and 5.28GHz are 140MHz (2.25-2.39GHz and 570MHz (5.18-5.75GHz, respectively. The measured VSWR at 2.35GHz is 1.27 and at 5.28GHz is 1.41. The proposed antenna is simple in design and compact in size. The simulated and measured results are in good agreement.

Reduction of residual gas in a sputtering system by auxiliary sputter of rare-earth metal

International Nuclear Information System (INIS)

Li Dejie

2002-01-01

In film deposition by sputtering, the oxidation and nitrification of the sputtered material lead to degradation of film quality, particularly with respect to metal sulfide films. We propose to use auxiliary sputtering as a method to produce a fresh film of rare-earth metal, usually dysprosium (Dy), that absorbs the active gases in a sputtering system, greatly reducing the background pressure and protecting the film from oxidation and nitrification effectively. The influence of the auxiliary sputtering power consumption, sputtering time, and medium gas pressure on the background pressure in the vacuum chamber is investigated in detail. If the auxiliary sputtering power exceeds 120 W and the sputtering time is more than 4 min, the background pressure is only one fourth of the ultimate pressure pumped by an oil diffusion pump. The absorption activity of the sputtered Dy film continues at least an hour after completion of the auxiliary sputter. Applied to film deposition of Ti and ZnS, this technique has been proven to be effective. For the Ti film, the total content of N and O is reduced from 45% to 20% when the auxiliary sputtering power of Dy is 120 W, and the sputtering time is 20 min. In the case of ZnS, the content of O is reduced from 8% to 2%

Meaningful questions: The acquisition of auxiliary inversion in a connectionist model of sentence production.

Science.gov (United States)

Fitz, Hartmut; Chang, Franklin

2017-09-01

Nativist theories have argued that language involves syntactic principles which are unlearnable from the input children receive. A paradigm case of these innate principles is the structure dependence of auxiliary inversion in complex polar questions (Chomsky, 1968, 1975, 1980). Computational approaches have focused on the properties of the input in explaining how children acquire these questions. In contrast, we argue that messages are structured in a way that supports structure dependence in syntax. We demonstrate this approach within a connectionist model of sentence production (Chang, 2009) which learned to generate a range of complex polar questions from a structured message without positive exemplars in the input. The model also generated different types of error in development that were similar in magnitude to those in children (e.g., auxiliary doubling, Ambridge, Rowland, & Pine, 2008; Crain & Nakayama, 1987). Through model comparisons we trace how meaning constraints and linguistic experience interact during the acquisition of auxiliary inversion. Our results suggest that auxiliary inversion rules in English can be acquired without innate syntactic principles, as long as it is assumed that speakers who ask complex questions express messages that are structured into multiple propositions. Copyright © 2017 Elsevier B.V. All rights reserved.

Reliability of supply of switchgear for auxiliary low voltage in substations extra high voltage to high voltage

Directory of Open Access Journals (Sweden)

Perić Dragoslav M.

2015-01-01

Full Text Available Switchgear for auxiliary low voltage in substations (SS of extra high voltages (EHV to high voltage (HV - SS EHV/HV kV/kV is of special interest for the functioning of these important SS, as it provides a supply for system of protection and other vital functions of SS. The article addresses several characteristic examples involving MV lines with varying degrees of independence of their supply, and the possible application of direct transformation EHV/LV through special voltage transformers. Auxiliary sources such as inverters and diesel generators, which have limited power and expensive energy, are also used for the supply of switchgear for auxiliary low voltage. Corresponding reliability indices are calculated for all examples including mean expected annual engagement of diesel generators. The applicability of certain solutions of switchgear for auxiliary low voltage SS EHV/HV, taking into account their reliability, feasibility and cost-effectiveness is analyzed too. In particular, the analysis of applications of direct transformation EHV/LV for supply of switchgear for auxiliary low voltage, for both new and existing SS EHV/HV.

Resonance – Journal of Science Education | Indian Academy of ...

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 10. What Can the Answer be? Reciprocal Basis and Dual Vectors. V Balakrishnan. Series Article Volume 1 Issue 10 October 1996 pp 6-13. Fulltext. Click here to view fulltext PDF. Permanent link:

System Study: Auxiliary Feedwater 1998-2014

Energy Technology Data Exchange (ETDEWEB)

Schroeder, John Alton [Idaho National Lab. (INL), Idaho Falls, ID (United States). Risk Assessment and Management Services Dept.

2015-12-01

This report presents an unreliability evaluation of the auxiliary feedwater (AFW) system at 69 U.S. commercial nuclear power plants. Demand, run hours, and failure data from fiscal year 1998 through 2014 for selected components were obtained from the Institute of Nuclear Power Operations (INPO) Consolidated Events Database (ICES). The unreliability results are trended for the most recent 10 year period, while yearly estimates for system unreliability are provided for the entire active period. No statistically significant increasing or decreasing trends were identified in the AFW results.

Generating Selected Color using RGB, Auxiliary Lights, and Simplex Search

Directory of Open Access Journals (Sweden)

Kim HyungTae

2015-01-01

Full Text Available A mixed light source generates various colors, with the potential to adjust intensities of multiple LEDs, which makes it possible to generate arbitrary colors. Currently, PCs and OSs provide color selection windows that can obtain the RGB or HSL color coordinates of a user’s selection. Mixed light sources are usually composed of LEDs in the primary colors, with LEDs in auxiliary colors such as white and yellow used in a few cases. When using auxiliary color LEDs, the number of LED inputs, the dimming levels, is larger than the number of elements in the color coordinate, which causes an under-determined problem. This study proposed how to determine the dimming levels of LEDs based on the selected color. Commercial LEDs have di_erent optical power values and impure color coordinates, even if they are RGB. Hence, the characteristics of the LEDs were described using a linear model derived from the tri-stimulus values (an XYZ color coordinate model and dimming levels. Color mixing models were derived for the arbitrary number of auxiliary color LEDs. The under-determined problem was solved using a simplex search method without an inverse matrix operation. The proposed method can be applied to a machine vision system and an RGBW light mixer for semiconductor inspection. The dimming levels, obtained using the proposed method were better than derived using other methods.

NRSC, Neutron Resonance Spectrum Calculation System

International Nuclear Information System (INIS)

Leszczynski, Francisco

2004-01-01

1 - Description of program or function: The NRSC system is a package of four programs for calculating detailed neutron spectra and related quantities, for homogeneous mixtures of isotopes and cylindrical reactor pin cells, in the energy resonance region, using ENDF/B evaluated nuclear data pre-processed with NJOY or Cullen's codes up to the Doppler Broadening and unresolved resonance level. 2 - Methods: NRSC consists of four programs: GEXSCO, RMET21, ALAMBDA and WLUTIL. GEXSCO prepares the nuclear data from ENDF/B evaluated nuclear data pre-processed with NJOY or Cullen's codes up to the Doppler Broadening or unresolved resonance level for RMET21 input. RMET21 calculates spectra and related quantities for homogeneous mixtures of isotopes and cylindrical reactor pin cells, in the energy resonance region, using slowing-down algorithms and, in the case of pin cells, the collision probability method. ALAMBDA obtains lambda factors (Goldstein-Cohen intermediate resonance factors in the formalism of WIMSD code) of different isotopes for including on WIMSD-type multigroup libraries for WIMSD or other cell-codes, from output of RMET21 program. WLUTIL is an auxiliary program for extracting tabulated parameters related with RMET21 program calculations from WIMSD libraries for comparisons, and for producing new WIMSD libraries with parameters calculated with RMET21 and ALAMBDA programs. 3 - Restrictions on the complexity of the problem: GEXSCO program has fixed array dimensions that are suitable for processing all reasonable outputs from nuclear data pre-processing programs. RMET21 program uses variable dimension method from a fixed general array. ALAMBDA and WLUTIL programs have fixed arrays that are adapted to standard WIMSD libraries. All programs can be easily modified to adapt to special requirements

Dual-energy contrast-enhanced spectral mammography (CESM).

Science.gov (United States)

Daniaux, Martin; De Zordo, Tobias; Santner, Wolfram; Amort, Birgit; Koppelstätter, Florian; Jaschke, Werner; Dromain, Clarisse; Oberaigner, Willi; Hubalek, Michael; Marth, Christian

2015-10-01

Dual-energy contrast-enhanced mammography is one of the latest developments in breast care. Imaging with contrast agents in breast cancer was already known from previous magnetic resonance imaging and computed tomography studies. However, high costs, limited availability-or high radiation dose-led to the development of contrast-enhanced spectral mammography (CESM). We reviewed the current literature, present our experience, discuss the advantages and drawbacks of CESM and look at the future of this innovative technique.

Pressurizer /Auxiliary Spray Piping Stress Analysis For Determination Of Lead Shielding Maximum Allow Able Load

International Nuclear Information System (INIS)

Setjo, Renaningsih

2000-01-01

Piping stress analysis for PZR/Auxiliary Spray Lines Nuclear Power Plant AV Unit I(PWR Type) has been carried out. The purpose of this analysis is to establish a maximum allowable load that is permitted at the time of need by placing lead shielding on the piping system on class 1 pipe, Pressurizer/Auxiliary Spray Lines (PZR/Aux.) Reactor Coolant Loop 1 and 4 for NPP AV Unit one in the mode 5 and 6 during outage. This analysis is intended to reduce the maximum amount of radiation dose for the operator during ISI ( In service Inspection) period.The result shown that the maximum allowable loads for 4 inches lines for PZR/Auxiliary Spray Lines is 123 lbs/feet

Magnetic resonance imaging and dual energy X-ray absorptiometry of the lumbar spine in professional wrestlers and untrained men.

Science.gov (United States)

Hu, M; Sheng, J; Kang, Z; Zou, L; Guo, J; Sun, P

2014-08-01

The aim of this study was to examine the relation between bone marrow adipose tissue (BMAT) and bone mineral density (BMD) of lumbar spine in male professional wrestlers and healthy untrained men. A total of 14 wrestlers (22.9±3.4 years) and 11 controls (24.4±1.6 years) were studied cross-sectionally. Body composition and BMD were measured by dual-energy X-ray absorptiometry. Magnetic resonance imaging of the lumbar spine was examined in a sagittal T1-weighted (T1-w) spin-echo (SE) sequence. The averaged bone marrow signal intensity (SI) of L2-L4 was related to the signal of an adjacent nondegenerative disk. Mean SI of T1-w SE in wrestlers was lower than controls (P=0.001), indicating L2-L4 BMAT in wrestlers was lower compared to controls. L2-L4 BMD in wrestlers was higher than controls (PBMAT and BMD was confirmed in this relatively small subject sample with narrow age range, which implies that exercise training is an important determinant of this association.

Dual-anticipating, dual and dual-lag synchronization in modulated time-delayed systems

International Nuclear Information System (INIS)

Ghosh, Dibakar; Chowdhury, A. Roy

2010-01-01

In this Letter, dual synchronization in modulated time delay system using delay feedback controller is proposed. Based on Lyapunov stability theory, we suggest a general method to achieve the dual-anticipating, dual, dual-lag synchronization of time-delayed chaotic systems and we find both its existing and sufficient stability conditions. Numerically it is shown that the dual synchronization is also possible when driving system contain two completely different systems. Effect of parameter mismatch on dual synchronization is also discussed. As an example, numerical simulations for the Mackey-Glass and Ikeda systems are conducted, which is in good agreement with the theoretical analysis.

Cooling system for auxiliary systems of a nuclear power plant

International Nuclear Information System (INIS)

Maerker, W.; Mueller, K.; Roller, W.

1981-01-01

From the reactor auxiliary and ancillary systems of a nuclear facility heat has to be removed without the hazard arising that radioactive liquids or gases may escape from the safe area of the nuclear facility. A cooling system is described allowing at every moment to make available cooling fluid at a temperature sufficiently low for heat exchangers to be able to remove the heat from such auxiliary systems without needing fresh water supply or water reservoirs. For this purpose a dry cooling tower is connected in series with a heat exchanger that is cooled on the secondary side by means of a refrigerating machine. The cooling pipes are filled with a nonfreezable fluid. By means of a bypass a minimum temperature is guaranteed at cold weather. (orig.) [de

[Evaluating work intensity in major and auxiliary occupations of by-product coke industry].

Science.gov (United States)

Smagulov, N K; Alpysbayeva, Zh T

2015-01-01

The article covers evaluation of work strain in major and auxiliary occupations of by-product coke industry. The study results conclude that occupational activity of by-product coke industry workers, under exposure to occupational hazards, affects the workers' performance. Major occupations workers demonstrate higher level of functional strain of CNS, poor concentration of attention and lower ability to switch over, decreased general performance, vs. the auxiliary occupations workers who demonstrated increased cardiovascular and neuro-muscular strain due to occupational activity.

Pure spinors as auxiliary fields in the ten-dimensional supersymmetric Yang-Mills theory

International Nuclear Information System (INIS)

Nilsson, B.E.W.

1986-01-01

A new way of introducing auxiliary fields into the ten-dimensional supersymmetric Yang-Mills theory is proposed. The auxiliary fields are commuting 'pure spinors' and constitute a non-linear realisation of the Lorentz group. This invalidates previous no-go theorems concerning the possibility of going off-shell in this theory. There seems to be a close relation between pure spinors and the concepts usually used in twistor theory. The non-Abelian theory can be constructed for all groups having pseudo-real representations. (author)

Review of the Shearon Harris Unit 1 auxiliary feedwater system reliability analysis

International Nuclear Information System (INIS)

Fresco, A.; Youngblood, R.; Papazoglou, I.A.

1986-02-01

This report presents the results of a review of the Auxiliary Feedwater System Reliability Analysis for the Shearon Harris Nuclear Power Plant (SHNPP) Unit 1. The objective of this report is to estimate the probability that the Auxiliary Feedwater System will fail to perform its mission for each of three different initiators: (1) loss of main feedwater with offsite power available, (2) loss of offsite power, (3) loss of all ac power except vital instrumentation and control 125-V dc/120-V ac power. The scope, methodology, and failure data are prescribed by NUREG-0611 for other Westinghouse plants

Aging and low-flow degradation of auxiliary feedwater pumps

International Nuclear Information System (INIS)

Adams, M.L.

1991-01-01

This paper documents the results of research done under the auspices of the Nuclear Regulatory Commission Nuclear Plant Aging Research Program. It examines the degradation imparted to safety Auxiliary Feedwater System pumps at nuclear plants due to the low flow operation. The Auxiliary Feedwater (AFW) System is normally a stand-by system. As such it is operated most often in the test mode. Since few plants are equipped with full flow test loops, most testing is accomplished at minimum flow conditions in pump by-pass lines. It is the vibration and hydraulic forces generated at low flow conditions that have been shown to be the major causes of AFW pump aging and degradation. The wear can be manifested in a number of ways, such as impeller or diffuser breakage, thrust bearing and/or balance device failure due to excessive loading, cavitation damage on such stage impellers, increase seal leakage or failure, sear injection piping failure, shaft or coupling breakage, and rotating element seizure

Femtosecond optical parametric oscillators toward real-time dual-comb spectroscopy

Science.gov (United States)

Jin, Yuwei; Cristescu, Simona M.; Harren, Frans J. M.; Mandon, Julien

2015-04-01

We demonstrate mid-infrared dual-comb spectroscopy with an optical parametric oscillator (OPO) toward real-time field measurement. A singly resonant OPO based on a MgO-doped periodically poled lithium niobate (PPLN) crystal is demonstrated. Chirped mirrors are used to compensate the dispersion caused by the optical cavity and the crystal. A low threshold of 17 mW has been achieved. The OPO source generates a tunable idler frequency comb between 2.7 and 4.7 μm. Dual-comb spectroscopy is achieved by coupling two identical Yb-fiber mode-locked lasers to this OPO with slightly different repetition frequencies. A measured absorption spectrum of methane is presented with a spectral bandwidth of , giving an instrumental resolution of . In addition, a second OPO containing two MgO-doped PPLN crystals in a singly resonant ring cavity is demonstrated. As such, this OPO generates two idler combs (average power up to 220 mW), covering a wavelength range between 2.7 and 4.2 μm, from which a mid-infrared dual-comb Fourier transform spectrometer is constructed. By detecting the heterodyned signal between the two idler combs, broadband spectra of molecular gases can be observed over a spectral bandwidth of more than . This special cavity design allows the spectral resolution to be improved to without locking the OPO cavity, indicating that this OPO represents an ideal high-power broadband mid-infrared source for real-time gas sensing.

Auxiliary services for petrochemistry. Cogeneration, thermocompression, steam distribution networks

International Nuclear Information System (INIS)

Vergerio, G.; Bruzzi, V.

1999-01-01

The article gives some guidelines for the choice of the most suitable energy vectors distributed in petrochemical plants and refineries for auxiliary services and for processes (mainly distillation). Conclusions are summed up in a diagram showing the most suitable heat sources and sinks for the various temperature ranges [it

Dual contrast enhanced magnetic resonance imaging of the liver with superparamagnetic iron oxide followed by gadolinium for lesion detection and characterization

International Nuclear Information System (INIS)

Kubaska, Samantha; Sahani, Dushyant V.; Saini, Sanjay; Hahn, Peter F.; Halpern, Elkan

2001-01-01

AIM: Iron oxide contrast agents are useful for lesion detection, and extracellular gadolinium chelates are advocated for lesion characterization. We undertook a study to determine if dual contrast enhanced liver imaging with sequential use of ferumoxides particles and gadolinium (Gd)-DTPA can be performed in the same imaging protocol. MATERIALS AND METHODS: Sixteen patients underwent dual contrast magnetic resonance imaging (MRI) of the liver for evaluation of known/suspected focal lesions which included, metastases (n = 5), hepatocellular carcinoma (HCC;n = 3), cholangiocharcinoma(n = 1) and focal nodular hyperplasia (FNH;n = 3). Pre- and post-iron oxide T1-weighted gradient recalled echo (GRE) and T2-weighted fast spin echo (FSE) sequences were obtained, followed by post-Gd-DTPA (0.1 mmol/kg) multi-phase dynamic T1-weighted out-of-phase GRE imaging. Images were analysed in a blinded fashion by three experts using a three-point scoring system for lesion conspicuity on pre- and post-iron oxide T1 images as well as for reader's confidence in characterizing liver lesions on post Gd-DTPA T1 images. RESULTS: No statistically significant difference in lesion conspicuity was observed on pre- and post-iron oxide T1-GRE images in this small study cohort. The presence of iron oxide did not appreciably diminish image quality of post-gadolinium sequences and did not prevent characterization of liver lesions. CONCLUSION: Our results suggest that characterization of focal liver lesion with Gd-enhanced liver MRI is still possible following iron oxide enhanced imaging. Kubaska, S. et al. (2001)

THE REDUCTION OF VIBRATIONS IN A CAR – THE PRINCIPLE OF PNEUMATIC DUAL MASS FLYWHEEL

Directory of Open Access Journals (Sweden)

Robert GREGA

2014-09-01

Full Text Available The dual-mass flywheel replaces the classic flywheel in such way that it is divided into two masses (the primary mass and the secondary mass, which are jointed together by means of a flexible interconnection. This kind of the flywheel solution enables to change resonance areas of the engine with regard to the engine dynamic behaviour what leads to a reduction of vibrations consequently. However, there is also a disadvantage of the dualmass flywheels. The disadvantage is its short-time durability. There was projected a new type of the dual-mass flywheel in the framework of our workplace in order to eliminate disadvantages of the present dual-mass flywheels, i.e. we projected the pneumatic dual-mass flywheel, taking into consideration our experiences obtained during investigation of vibrations.

Auxiliary variables in multiple imputation in regression with missing X: a warning against including too many in small sample research

Directory of Open Access Journals (Sweden)

Hardt Jochen

2012-12-01

Full Text Available Abstract Background Multiple imputation is becoming increasingly popular. Theoretical considerations as well as simulation studies have shown that the inclusion of auxiliary variables is generally of benefit. Methods A simulation study of a linear regression with a response Y and two predictors X1 and X2 was performed on data with n = 50, 100 and 200 using complete cases or multiple imputation with 0, 10, 20, 40 and 80 auxiliary variables. Mechanisms of missingness were either 100% MCAR or 50% MAR + 50% MCAR. Auxiliary variables had low (r=.10 vs. moderate correlations (r=.50 with X’s and Y. Results The inclusion of auxiliary variables can improve a multiple imputation model. However, inclusion of too many variables leads to downward bias of regression coefficients and decreases precision. When the correlations are low, inclusion of auxiliary variables is not useful. Conclusion More research on auxiliary variables in multiple imputation should be performed. A preliminary rule of thumb could be that the ratio of variables to cases with complete data should not go below 1 : 3.

Prediction of appendicular skeletal and fat mass in children: excellent concordance of dual-energy X-ray absorptiometry and magnetic resonance imaging.

Science.gov (United States)

Bridge, Pascale; Pocock, Nicholas A; Nguyen, Tuan; Munns, Craig; Cowell, Christopher T; Thompson, Martin W

2009-09-01

Body composition studies in children have great potential to help understand the aetiology and evolution of acute and chronic. diseases. To validate appendicular lean soft tissue mass (LSTM) and fat mass (FM) measured using dual energy X-ray absorptiometry (DXA), with magnetic resonance imaging (MRI) as the reference standard, in healthy peri-pubertal adolescents. Peri-pubertal Caucasian children (n = 74) aged 11-14 years were evaluated. DXA LSTM and FM of the mid third femur were measured and skeletal muscle mass (SM) and FM of the same region were measured on the same day by MRI. There was a strong correlation between MRI SM and DXA LSTM (r2 = 0.98, index of concordance [C] = 0.91). DXA estimation of LSTM exceeded MRI SM by a mean of 189 g, from 6-371 g (p LSTM measurement in children, confirming its potential in clinical and research roles in paediatric diseases affecting and related to body composition.

Auxiliary feedwater system aging study

International Nuclear Information System (INIS)

Kueck, J.D.

1993-07-01

This report documents the results of a Phase I follow-on study of the Auxiliary Feedwater (AFW) System that has been conducted for the US Regulatory Commission's Nuclear Plant Aging research Program. The Phase I study found a number of significant AFW System functions that are not being adequately tested by conventional test methods and some that are actually being degraded by conventional testing. Thus, it was decided that this follow-on study would focus on these testing omissions nd equipment degradation. The deficiencies in current monitoring and operating practice are categorized and evaluated. Areas of component degradation caused by current practice are discussed. Recommendations are made for improved diagnostic methods and test procedures

Dual Entwining Structures and Dual Entwined Modules

OpenAIRE

Abuhlail, Jawad Y.

2003-01-01

In this note we introduce and investigate the concepts of dual entwining structures and dual entwined modules. This generalizes the concepts of dual Doi-Koppinen structures and dual Doi-Koppinen modules introduced (in the infinite case over rings) by the author is his dissertation.

Aging assessment of PWR [Pressurized Water Reactor] Auxiliary Feedwater Systems

International Nuclear Information System (INIS)

Casada, D.A.

1988-01-01

In support of the Nuclear Regulatory Commission's Nuclear Plant Aging Research (NPAR) Program, Oak Ridge National Laboratory is conducting a review of Pressurized Water Reactor Auxiliary Feedwater Systems. Two of the objectives of the NPAR Program are to identify failure modes and causes and identify methods to detect and track degradation. In Phase I of the Auxiliary Feedwater System study, a detailed review of system design and operating and surveillance practices at a reference plant is being conducted to determine failure modes and to provide an indication of the ability of current monitoring methods to detect system degradation. The extent to which current practices are contributing to aging and service wear related degradation is also being assessed. This paper provides a description of the study approach, examples of results, and some interim observations and conclusions. 1 fig., 1 tab

Rapidly reconfigurable slow-light system based on off-resonant Raman absorption

International Nuclear Information System (INIS)

Vudyasetu, Praveen K.; Howell, John C.; Camacho, Ryan M.

2010-01-01

We present a slow-light system based on dual Raman absorption resonances in warm rubidium vapor. Each Raman absorption resonance is produced by a control beam in an off-resonant Λ system. This system combines all optical control of the Raman absorption and the low-dispersion broadening properties of the double Lorentzian absorption slow light. The bandwidth, group delay, and central frequency of the slow-light system can all be tuned dynamically by changing the properties of the control beam. We demonstrate multiple pulse delays with low distortion and show that such a system has fast switching dynamics and thus fast reconfiguration rates.

A dual-band reconfigurable Yagi-Uda antenna with diverse radiation patterns

Science.gov (United States)

Saurav, Kushmanda; Sarkar, Debdeep; Srivastava, Kumar Vaibhav

2017-07-01

In this paper, a dual-band pattern reconfigurable antenna is proposed. The antenna comprises of a dual-band complementary split ring resonators (CSRRs) loaded dipole as the driven element and two copper strips with varying lengths as parasitic segments on both sides of the driven dipole. PIN diodes are used with the parasitic elements to control their electrical length. The CSRRs loading provide a lower order mode in addition to the reference dipole mode, while the parasitic elements along with the PIN diodes are capable of switching the omni-directional radiation of the dual-band driven element to nine different configurations of radiation patterns which include bi-directional end-fire, broadside, and uni-directional end-fire in both the operating bands. A prototype of the designed antenna together with the PIN diodes and DC bias lines is fabricated to validate the concept of dual-band radiation pattern diversity. The simulation and measurement results are in good agreement. The proposed antenna can be used in wireless access points for PCS and WLAN applications.

Effect of subject types on the production of auxiliary is in young English-speaking children.

Science.gov (United States)

Guo, Ling-Yu; Owen, Amanda J; Tomblin, J Bruce

2010-12-01

In this study, the authors tested the unique checking constraint (UCC) hypothesis and the usage-based approach concerning why young children variably use tense and agreement morphemes in obligatory contexts by examining the effect of subject types on the production of auxiliary is. Twenty typically developing 3-year-olds were included in this study. The children's production of auxiliary is was elicited in sentences with pronominal subjects, high-frequency lexical noun phrase (NP) subjects (e.g., the dog), and low-frequency lexical NP subjects (e.g., the deer). As a group, children did not use auxiliary is more accurately with pronominal subjects than with lexical NP subjects. Furthermore, individual data revealed that although some children used auxiliary is more accurately with pronominal subjects than with lexical NP subjects, the majority of children did not show this trend. The symmetry observed between lexical and pronominal subjects supports the predictions of the UCC hypothesis, although additional mechanisms may be needed to account for the asymmetry between subject types in some individual children. Discrepant results between the present study and previous studies were attributed to differences in task formats and children's developmental levels.

Understanding Counterfactuality: A Review of Experimental Evidence for the Dual Meaning of Counterfactuals

Science.gov (United States)

Nieuwland, Mante S.

2016-01-01

Abstract Cognitive and linguistic theories of counterfactual language comprehension assume that counterfactuals convey a dual meaning. Subjunctive‐counterfactual conditionals (e.g., ‘If Tom had studied hard, he would have passed the test’) express a supposition while implying the factual state of affairs (Tom has not studied hard and failed). The question of how counterfactual dual meaning plays out during language processing is currently gaining interest in psycholinguistics. Whereas numerous studies using offline measures of language processing consistently support counterfactual dual meaning, evidence coming from online studies is less conclusive. Here, we review the available studies that examine online counterfactual language comprehension through behavioural measurement (self‐paced reading times, eye‐tracking) and neuroimaging (electroencephalography, functional magnetic resonance imaging). While we argue that these studies do not offer direct evidence for the online computation of counterfactual dual meaning, they provide valuable information about the way counterfactual meaning unfolds in time and influences successive information processing. Further advances in research on counterfactual comprehension require more specific predictions about how counterfactual dual meaning impacts incremental sentence processing. PMID:27512408

PSA effect analysis of a design modification of the auxiliary feedwater system for a Westinghouse type plant

International Nuclear Information System (INIS)

Bae, Yeon Kyoung; Lee, Eun Chan

2012-01-01

The auxiliary feedwater system is an important system used to mitigate most accidents considered in probabilistic safety assessment (PSA). The reference plant has produced electric power for about thirty years. Due to age related deterioration and lack of parts, a turbine driven auxiliary feedwater pump (TD AFWP), some valves, and piping of the auxiliary feedwater system should be replaced. This change includes relocation of some valves, installation of valves for maintenance of the steam generator, and a new cross tie line. According to the design change, the Final Safety Analysis Report (FSAR) has been revised. Therefore, this design modification affects the PSA. It is thus necessary to assess the improvement of plant safety. In this paper, the impact of the design change of the auxiliary feedwater system on the PSA is assessed. The results demonstrate that this modification considering the plant safety decreased the total CDF

The application of 99Tcm-phytate scintigraphy in pig auxiliary liver transplantation

International Nuclear Information System (INIS)

Lin Jianhua; Li Xiaoping; Li Chaolong; He Xu; Lin Zhiqi; Zhu Weibing

2001-01-01

Objective: To affirm the application value of 99 Tc m -phytate scintigraphy in pig auxiliary liver transplantation. Methods: The graft was transplanted in the right subhepatic space of recipient to establish pig auxiliary liver transplantation model. The artery blood supplies were the very same in all grafts and the portal vein (PV) blood flows were differently controlled by trussing the host PV at the site neared host liver. According to the constriction degree, PV blood supplies were divided into three groups including A (constricted by 1/3), B (constricted by 1/2) and C(not constricted). The blood flows of the graft liver and the host liver were measured by 99 Tc m -phytate scintigraphy and livers functions were estimated after auxiliary liver transplantation. Contrasted with its histological findings the reflection of graft survival with 99 Tc m -phytate scintigraphy was investigated. Results: It was detected by 99 Tc m -phytate scintigraphy that the blood flows were almost equilibrated and abundant in grafts and host liver' in group A, and were abundant in grafts of group B and host livers of group C and were significantly decreased in host livers of group B and grafts of group C. Histological work-up demonstrated that the liver was not atrophic while the blood flow was abundant and the liver was atrophic while the blood flow was decreased. Conclusion: 99 Tc m -phytate scintigraphy could accurately reflect the survival and function of grafts and host livers after auxiliary liver transplantation and it is a reliable technique which can be used to estimate the survival and function of the grafts and host livers

Auxiliary controller for time-to-digital converter module readout

International Nuclear Information System (INIS)

Ermolin, Yu.V.

1992-01-01

The KD-225 auxiliary controller for time-to-digital converter module readout in the SUMMA crate is described. After readout and preliminary processing the data are written in the P-140 buffer memory module. The controller is used in the FODS-2 experimental setup data acquisition system. 12 refs.; 1 fig

How Does Dissociation between Written and Oral Forms Affect Reading: Evidence from Auxiliary Verbs in Arabic

Science.gov (United States)

Ibrahim, Raphiq

2011-01-01

In Arabic, auxiliary verbs are necessary in the written language, but absent from the oral language. This is contrary to languages such as English and French in which auxiliary verbs are mandatory in both written and oral languages. This fact was exploited to examine if dissociation between written and oral forms affects reading measures like…

On adjustment for auxiliary covariates in additive hazard models for the analysis of randomized experiments

DEFF Research Database (Denmark)

Vansteelandt, S.; Martinussen, Torben; Tchetgen, E. J Tchetgen

2014-01-01

We consider additive hazard models (Aalen, 1989) for the effect of a randomized treatment on a survival outcome, adjusting for auxiliary baseline covariates. We demonstrate that the Aalen least-squares estimator of the treatment effect parameter is asymptotically unbiased, even when the hazard...... that, in view of its robustness against model misspecification, Aalen least-squares estimation is attractive for evaluating treatment effects on a survival outcome in randomized experiments, and the primary reasons to consider baseline covariate adjustment in such settings could be interest in subgroup......'s dependence on time or on the auxiliary covariates is misspecified, and even away from the null hypothesis of no treatment effect. We furthermore show that adjustment for auxiliary baseline covariates does not change the asymptotic variance of the estimator of the effect of a randomized treatment. We conclude...

Multi-resonant wideband energy harvester based on a folded asymmetric M-shaped cantilever

Energy Technology Data Exchange (ETDEWEB)

Wu, Meng; Mao, Haiyang; Li, Zhigang; Liu, Ruiwen; Ming, Anjie [Key laboratory of Microelectronics Devices & Integrated Technology, Institute of Microelectronics, Chinese Academic of Sciences, Beijing 100029 (China); Ou, Yi; Ou, Wen [Key laboratory of Microelectronics Devices & Integrated Technology, Institute of Microelectronics, Chinese Academic of Sciences, Beijing 100029 (China); Smart Sensor Engineering Center, Jiangsu R& D Center for Internet of Things, Wuxi 214315 (China)

2015-07-15

This article reports a compact wideband piezoelectric vibration energy harvester consisting of three proof masses and an asymmetric M-shaped cantilever. The M-shaped beam comprises a main beam and two folded and dimension varied auxiliary beams interconnected through the proof mass at the end of the main cantilever. Such an arrangement constitutes a three degree-of-freedom vibrating body, which can tune the resonant frequencies of its first three orders close enough to obtain a utility wide bandwidth. The finite element simulation results and the experimental results are well matched. The operation bandwidth comprises three adjacent voltage peaks on account of the frequency interval shortening mechanism. The result shows that the proposed piezoelectric energy harvester could be efficient and adaptive in practical vibration circumstance based on multiple resonant modes.

Multi-resonant wideband energy harvester based on a folded asymmetric M-shaped cantilever

International Nuclear Information System (INIS)

Wu, Meng; Mao, Haiyang; Li, Zhigang; Liu, Ruiwen; Ming, Anjie; Ou, Yi; Ou, Wen

2015-01-01

This article reports a compact wideband piezoelectric vibration energy harvester consisting of three proof masses and an asymmetric M-shaped cantilever. The M-shaped beam comprises a main beam and two folded and dimension varied auxiliary beams interconnected through the proof mass at the end of the main cantilever. Such an arrangement constitutes a three degree-of-freedom vibrating body, which can tune the resonant frequencies of its first three orders close enough to obtain a utility wide bandwidth. The finite element simulation results and the experimental results are well matched. The operation bandwidth comprises three adjacent voltage peaks on account of the frequency interval shortening mechanism. The result shows that the proposed piezoelectric energy harvester could be efficient and adaptive in practical vibration circumstance based on multiple resonant modes

Plasma immersion ion implantation of the interior surface of a large cylindrical bore using an auxiliary electrode

International Nuclear Information System (INIS)

Zeng, X.C.; Kwok, T.K.; Liu, A.G.; Chu, P.K.; Tang, B.Y.

1998-01-01

A model utilizing cold, unmagnetized, and collisionless fluid ions as well as Boltzmann electrons is used to comprehensively investigate the sheath expansion into a translationally invariant large bore in the presence of an auxiliary electrode during plasma immersion ion implantation (PIII) of a cylindrical bore sample. The governing equation of ion continuity, ion motion, and Poisson close-quote s equation are solved by using a numerical finite difference method for different cylindrical bore radii, auxiliary electrode radii, and voltage rise times. The ion density and ion impact energy at the cylindrical inner surface, as well as the ion energy distribution, maximum ion impact energy, and average ion impact energy for the various cases are obtained. Our results show a dramatic improvement in the impact energy when an auxiliary electrode is used and the recommended normalized auxiliary electrode radius is in the range of 0.1 endash 0.3. copyright 1998 American Institute of Physics

Speckle Interferometry with the McMath-Pierce East Auxiliary Telescope

Science.gov (United States)

Harshaw, Richard; Ray, Jimmy; Douglass, David; Prause, Lori; Genet, Russell

2015-09-01

Engineering runs and tests on the McMath-Pierce 0.8 meter East Auxiliary telescope successfully configured the telescope for speckle interferometry observations of close visual double stars. This paper reports the procedure and results of the speckle analysis of four double stars.

Simulative technology for auxiliary fuel tank separation in a wind tunnel

Directory of Open Access Journals (Sweden)

Ma Xin

2016-06-01

Full Text Available In this paper, we propose a simulative experimental system in wind tunnel conditions for the separation of auxiliary fuel tanks from an aircraft. The experimental system consists of a simulative release mechanism, a scaled model and a pose measuring system. A new release mechanism was designed to ensure stability of the separation. Scaled models of the auxiliary fuel tank were designed and their moment of inertia was adjusted by installing counterweights inside the model. Pose parameters of the scaled model were measured and calculated by a binocular vision system. Additionally, in order to achieve high brightness and high signal-to-noise ratio of the images in the dark enclosed wind tunnel, a new high-speed image acquisition method based on miniature self-emitting units was presented. Accuracy of the pose measurement system and repeatability of the separation mechanism were verified in the laboratory. Results show that the position precision of the pose measurement system can reach 0.1 mm, the precision of the pitch and yaw angles is less than 0.1° and that of the roll angle can be up to 0.3°. Besides, repeatability errors of models’ velocity and angular velocity controlled by the release mechanism remain small, satisfying the measurement requirements. Finally, experiments for the separation of auxiliary fuel tanks were conducted in the laboratory.

Dual-Tasking Alleviated Sleep Deprivation Disruption in Visuomotor Tracking: An fMRI Study

Science.gov (United States)

Gazes, Yunglin; Rakitin, Brian C.; Steffener, Jason; Habeck, Christian; Butterfield, Brady; Basner, Robert C.; Ghez, Claude; Stern, Yaakov

2012-01-01

Effects of dual-responding on tracking performance after 49-h of sleep deprivation (SD) were evaluated behaviorally and with functional magnetic resonance imaging (fMRI). Continuous visuomotor tracking was performed simultaneously with an intermittent color-matching visual detection task in which a pair of color-matched stimuli constituted a…

Neoclassical offset toroidal velocity and auxiliary ion heating in tokamaks

Energy Technology Data Exchange (ETDEWEB)

Lazzaro, E., E-mail: lazzaro@ifp.cnr.it [Istituto di Fisica del Plasma CNR (Italy)

2016-05-15

In conditions of ideal axisymmetry, for a magnetized plasma in a generic bounded domain, necessarily toroidal, the uniform absorption of external energy (e.g., RF or any isotropic auxiliary heating) cannot give rise to net forces or torques. Experimental evidence on contemporary tokamaks shows that the near central absorption of RF heating power (ICH and ECH) and current drive in presence of MHD activity drives a bulk plasma rotation in the co-I{sub p} direction, opposite to the initial one. Also the appearance of classical or neoclassical tearing modes provides a nonlinear magnetic braking that tends to clamp the rotation profile at the q-rational surfaces. The physical origin of the torque associated with P{sub RF} absorption could be due the effects of asymmetry in the equilibrium configuration or in power deposition, but here we point out also an effect of the response of the so-called neoclassical offset velocity to the power dependent heat flow increment. The neoclassical toroidal viscosity due to internal magnetic kink or tearing modes tends to relax the plasma rotation to this asymptotic speed, which in absence of auxiliary heating is of the order of the ion diamagnetic velocity. It can be shown by kinetic and fluid calculations, that the absorption of auxiliary power by ions modifies this offset proportionally to the injected power thereby forcing the plasma rotation in a direction opposite to the initial, to large values. The problem is discussed in the frame of the theoretical models of neoclassical toroidal viscosity.

Advanced LIGO: length sensing and control in a dual recycled interferometric gravitational wave antenna

International Nuclear Information System (INIS)

Izumi, Kiwamu; Sigg, Daniel

2017-01-01

Length sensing and control is vital for Advanced LIGO and its goal of performing astrophysical searches. The current kilometer scale gravitational wave antennae are dual recycled Michelson interferometers enhanced with Fabry–Perot resonators in the arms. Observation requires the lengths of all optical cavities to be precisely servoed in the vicinity of a resonance using feedback controls. Simultaneously achieving robustness and low-noise is challenging due to cross-couplings between the multiple coupled optical resonators. We analytically derive the Advanced LIGO sensing and control scheme, calculate the effects of radiation pressure forces and review the current strategies of minimizing the coupling of noise into the gravitational wave readout. (paper)

Stabilization of self-mode-locked quantum dash lasers by symmetric dual-loop optical feedback

Science.gov (United States)

Asghar, Haroon; Wei, Wei; Kumar, Pramod; Sooudi, Ehsan; McInerney, John. G.

2018-02-01

We report experimental studies of the influence of symmetric dual-loop optical feedback on the RF linewidth and timing jitter of self-mode-locked two-section quantum dash lasers emitting at 1550 nm. Various feedback schemes were investigated and optimum levels determined for narrowest RF linewidth and low timing jitter, for single-loop and symmetric dual-loop feedback. Two symmetric dual-loop configurations, with balanced and unbalanced feedback ratios, were studied. We demonstrate that unbalanced symmetric dual loop feedback, with the inner cavity resonant and fine delay tuning of the outer loop, gives narrowest RF linewidth and reduced timing jitter over a wide range of delay, unlike single and balanced symmetric dual-loop configurations. This configuration with feedback lengths 80 and 140 m narrows the RF linewidth by 4-67x and 10-100x, respectively, across the widest delay range, compared to free-running. For symmetric dual-loop feedback, the influence of different power split ratios through the feedback loops was determined. Our results show that symmetric dual-loop feedback is markedly more effective than single-loop feedback in reducing RF linewidth and timing jitter, and is much less sensitive to delay phase, making this technique ideal for applications where robustness and alignment tolerance are essential.

Brain activations during bimodal dual tasks depend on the nature and combination of component tasks

Directory of Open Access Journals (Sweden)

Emma eSalo

2015-02-01

Full Text Available We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or simple (speaker-gender or font-shade discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley’s model modality atypical, that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.

Fat suppression with short inversion time inversion-recovery and chemical-shift selective saturation: a dual STIR-CHESS combination prepulse for turbo spin echo pulse sequences.

Science.gov (United States)

Tanabe, Koji; Nishikawa, Keiichi; Sano, Tsukasa; Sakai, Osamu; Jara, Hernán

2010-05-01

To test a newly developed fat suppression magnetic resonance imaging (MRI) prepulse that synergistically uses the principles of fat suppression via inversion recovery (STIR) and spectral fat saturation (CHESS), relative to pure CHESS and STIR. This new technique is termed dual fat suppression (Dual-FS). To determine if Dual-FS could be chemically specific for fat, the phantom consisted of the fat-mimicking NiCl(2) aqueous solution, porcine fat, porcine muscle, and water was imaged with the three fat-suppression techniques. For Dual-FS and STIR, several inversion times were used. Signal intensities of each image obtained with each technique were compared. To determine if Dual-FS could be robust to magnetic field inhomogeneities, the phantom consisting of different NiCl(2) aqueous solutions, porcine fat, porcine muscle, and water was imaged with Dual-FS and CHESS at the several off-resonance frequencies. To compare fat suppression efficiency in vivo, 10 volunteer subjects were also imaged with the three fat-suppression techniques. Dual-FS could suppress fat sufficiently within the inversion time of 110-140 msec, thus enabling differentiation between fat and fat-mimicking aqueous structures. Dual-FS was as robust to magnetic field inhomogeneities as STIR and less vulnerable than CHESS. The same results for fat suppression were obtained in volunteers. The Dual-FS-STIR-CHESS is an alternative and promising fat suppression technique for turbo spin echo MRI. Copyright 2010 Wiley-Liss, Inc.

Biased divertor performance under auxiliary heating conditions on the TdeV tokamak

International Nuclear Information System (INIS)

Decoste, R.; Lachambre, J.L.; Demers, Y.

1994-01-01

Plasma biasing has been shown on TdeV in the ohmic regime to be very promising for divertor applications. Negative biasing, with shortened SOL density gradients, improves the divertor performance, whereas positive biasing, with longer gradients, does not do much for the divertor. The next objectives were to extrapolate those results to auxiliary heated plasmas and optimize/simplify the biasing geometry for future upgrades. New results are now available with an improved divertor geometry and auxiliary heating/current drive provided by a new lower hybrid (LH) system. The new geometry, optimized for positive biasing with predictably acceptable negative biasing performances, allows for a fair comparison between the two polarities. (author) 4 refs., 5 figs

Auxiliary equation method for solving nonlinear partial differential equations

International Nuclear Information System (INIS)

Sirendaoreji,; Jiong, Sun

2003-01-01

By using the solutions of an auxiliary ordinary differential equation, a direct algebraic method is described to construct several kinds of exact travelling wave solutions for some nonlinear partial differential equations. By this method some physically important nonlinear equations are investigated and new exact travelling wave solutions are explicitly obtained with the aid of symbolic computation

Specific features of auxiliary water supply at underground NPPs

International Nuclear Information System (INIS)

Pergamenshchik, B.K.; Pavlov, A.S.

1991-01-01

Specific features of auxiliary water supply systems for underground NPPs related to peculiarities of NPP basis equipment arrangement, are considered. Circulation water supply scheme, in which water cooling storage basin (cooling towers) with operational area corresponding to NPP power is on the surface and has traditional design, is proposed. Sufficiently high efficiency of the arrangement proposed is proved

A Method of Auxiliary Sources Approach for Modelling the Impact of Ground Planes on Antenna

DEFF Research Database (Denmark)

Larsen, Niels Vesterdal; Breinbjerg, Olav

2006-01-01

The Method of Auxiliary Sources (MAS) is employed to model the impact of finite ground planes on the radiation from antennas. Two different antenna test cases are shown and the calculated results agree well with reference measurements......The Method of Auxiliary Sources (MAS) is employed to model the impact of finite ground planes on the radiation from antennas. Two different antenna test cases are shown and the calculated results agree well with reference measurements...

Dual-band left-handed metamaterials fabricated by using tree-shaped fractal

International Nuclear Information System (INIS)

Xu He-Xiu; Wang Guang-Ming; Yang Zi-Mu; Wang Jia-Fu

2012-01-01

A method of fabricating dual-band left-handed metematerials (LHMs) is investigated numerically and experimentally by single-sided tree-like fractals. The resulting structure features multiband magnetic resonances and two electric resonances. By appropriately adjusting the dimensions, two left-handed (LH) bands with simultaneous negative permittivity and permeability are engineered and are validated by full-wave eigenmode analysis and measurement as well in the microwave frequency range. To study the multi-resonant mechanism in depth, the LHM is analysed from three different perspectives of field distribution analysis, circuit model analysis, and geometrical parameters evaluation. The derived formulae are consistent with all simulated results and resulting electromagnetic phenomena, indicating the effectiveness of the established theory. The method provides an alternative to the design of multi-band LHM and has the advantage of not requiring two individual resonant particles and electrically continuous wires, which in turn facilitates planar design and considerably simplifies the fabrication. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

Dual-energy CT can detect malignant lymph nodes in rectal cancer.

Science.gov (United States)

Al-Najami, I; Lahaye, M J; Beets-Tan, R G H; Baatrup, G

2017-05-01

There is a need for an accurate and operator independent method to assess the lymph node status to provide the most optimal personalized treatment for rectal cancer patients. This study evaluates whether Dual Energy Computed Tomography (DECT) could contribute to the preoperative lymph node assessment, and compared it to Magnetic Resonance Imaging (MRI). The objective of this prospective observational feasibility study was to determine the clinical value of the DECT for the detection of metastases in the pelvic lymph nodes of rectal cancer patients and compare the findings to MRI and histopathology. The patients were referred to total mesorectal excision (TME) without any neoadjuvant oncological treatment. After surgery the rectum specimen was scanned, and lymph nodes were matched to the pathology report. Fifty-four histology proven rectal cancer patients received a pelvic DECT scan and a standard MRI. The Dual Energy CT quantitative parameters were analyzed: Water and Iodine concentration, Dual-Energy Ratio, Dual Energy Index, and Effective Z value, for the benign and malignant lymph node differentiation. DECT scanning showed statistical difference between malignant and benign lymph nodes in the measurements of iodine concentration, Dual-Energy Ratio, Dual Energy Index, and Effective Z value. Dual energy CT classified 42% of the cases correctly according to N-stage compared to 40% for MRI. This study showed statistical difference in several quantitative parameters between benign and malignant lymph nodes. There were no difference in the accuracy of lymph node staging between DECT and MRI. Copyright © 2017 Elsevier B.V. All rights reserved.

Disturbance observer-based control of a dual-output LLC converter for solid-state lighting applications

NARCIS (Netherlands)

Roes, M.G.L.; Duarte, J.L.; Hendrix, M.A.M.

2011-01-01

Feedback sensor isolation is often an expensive necessity in power converters, for reasons of safety and electromagnetic compatibility. A disturbance observer-based control strategy for a dual-output resonant converter is proposed to overcome this problem. Current control of two LED loads is

Disturbance observer-based control of a dual output LLC converter for solid state lighting applications

NARCIS (Netherlands)

Roes, M.G.L.; Duarte, J.L.; Hendrix, M.A.M.

2010-01-01

Feedback sensor isolation is often an expensive necessity in power converters, for reasons of safety and electromagnetic compatibility. A disturbance observer-based control strategy for a dual-output resonant converter is proposed to overcome this problem. Current control of two LED loads is

Verb Placement in Second Language Acquisition: Experimental Evidence for the Different Behavior of Auxiliary and Lexical Verbs

Science.gov (United States)

Verhagen, Josje

2011-01-01

This study investigates the acquisition of verb placement by Moroccan and Turkish second language (L2) learners of Dutch. Elicited production data corroborate earlier findings from L2 German that learners who do not produce auxiliaries do not raise lexical verbs over negation, whereas learners who produce auxiliaries do. Data from elicited…

Study on Brilliant Blue-chitosan System by Dual-wavelength Overlapping Resonance Rayleigh Scattering Method and its Analytical Applications

Science.gov (United States)

Ma, Caijuan; Sun, Zijun; Liu, Guihua; Su, Zhengquan; Bai, Yan

2018-02-01

The method was presented for the sensitive and selective determination of chitosan (CTS) in health products with Brilliant Blue (BB) as a probe, based on dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS). In weakly acidic buffer solution, the binding of CTS and BB could result in the RRS intensities getting enhanced significantly at RRS peaks of 344 nm and 452 nm, and the scattering intensities of the two peaks were proportional to the concentration of CTS within a certain range. When the RRS intensities of the two wavelengths were superposed, the results showed higher sensitivity. Under the optimum experimental conditions, the total of the two increased RRS intensities was linear to the CTS concentration in the range of 0.02-1.80 μg/mL and the limit of detection (LOD) was 7.45 ng/mL. In this work, the optimum conditions and the effects of some foreign substances were studied. Accordingly, the new method based on DWO-RRS for the determination of CTS was developed. In addition, the effect of the molecular weight and the deacetylation degree between different chitosan molecules was discussed. Finally, this assay was applied to determine the concentration of CTS in health products with satisfactory results.

Incorporation of flow injection analysis with dual-wavelength overlapping resonance Rayleigh scattering for rapid determination of malachite green and its metabolite in fish.

Science.gov (United States)

Zhu, Jinghui; Qin, Mingyou; Liu, Shaopu; Liu, Zhongfang; Yang, Jidong; Hu, Xiaoli

2014-09-15

A flow injection analysis (FIA) system combined with dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) has been established and validated for rapid determination of malachite green (MG) and its metabolite in fish samples. Under experimental condition, MG would react with Erythrosin (Ery) to form ion-association complexes, resulting in the occurrence of two RRS peaks and a dramatic enhancement of RRS intensity. The maximum RRS peaks were located at 286 nm and 337 nm. It is noted that the increments of both of these two peaks were proportional to the concentration of MG. The detection limit of DWO-RRS was 1.5 ng/mL, which was comparable to several reported methods. Moreover, the results of real sample analysis exhibited an acceptable recovery between 97.5% and 103.6%, indicating that the method had good reproducibility. Copyright © 2014 Elsevier B.V. All rights reserved.

Auxiliary matrices for the six-vertex model at qN = 1 and a geometric interpretation of its symmetries

International Nuclear Information System (INIS)

Korff, Christian

2003-01-01

The construction of auxiliary matrices for the six-vertex model at a root of unity is investigated from a quantum group theoretic point of view. Employing the concept of intertwiners associated with the quantum loop algebra U q (s-tilde l-tilde 2 ) at q N = 1, a three-parameter family of auxiliary matrices is constructed. The elements of this family satisfy a functional relation with the transfer matrix allowing one to solve the eigenvalue problem of the model and to derive the Bethe ansatz equations. This functional relation is obtained from the decomposition of a tensor product of evaluation representations and involves auxiliary matrices with different parameters. Because of this dependence on additional parameters, the auxiliary matrices break in general the finite symmetries of the six-vertex model, such as spin-reversal or spin-conservation. More importantly, they also lift the extra degeneracies of the transfer matrix due to the loop symmetry present at rational coupling values. The extra parameters in the auxiliary matrices are shown to be directly related to the elements in the enlarged centre Z of the algebra U q (s-tilde l-tilde 2 ) at q N = 1. This connection provides a geometric interpretation of the enhanced symmetry of the six-vertex model at rational coupling. The parameters labelling the auxiliary matrices can be interpreted as coordinates on a hypersurface Spec Z subset of C 4 which remains invariant under the action of an infinite-dimensional group G of analytic transformations, called the quantum coadjoint action

Dual Resonant Frequencies Effects on an Induction-Based Oil Palm Fruit Sensor

Directory of Open Access Journals (Sweden)

Noor Hasmiza Harun

2014-11-01

Full Text Available As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB. Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB. A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA. To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

Dual resonant frequencies effects on an induction-based oil palm fruit sensor.

Science.gov (United States)

Harun, Noor Hasmiza; Misron, Norhisam; Mohd Sidek, Roslina; Aris, Ishak; Wakiwaka, Hiroyuki; Tashiro, Kunihisa

2014-11-19

As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB). Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB). A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA). To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

The Impact Of Dental Auxiliaries In Oral Health Delivery In Cameroon

African Journals Online (AJOL)

treat 6-10 patients per day while 13 (29.5%) of respondents work without any direct supervision. Out of ... the training and job description of dental auxiliaries in Cameroon. Introduction .... A Textbook for Preventive and. Community Dentistry.

Restarting Automata with Auxiliary Symbols and Small Lookahead

DEFF Research Database (Denmark)

Schluter, Natalie Elaine

2012-01-01

We present a study on lookahead hierarchies for restarting automata with auxiliary symbols and small lookahead. In particular, we show that there are just two different classes of languages recognised by RRWW automata, through the restriction of lookahead size. We also show that the respective...... (left-) monotone restarting automaton models characterise the context-free languages and that the respective right-left-monotone restarting automata characterise the linear languages both with just lookahead length 2....

76 FR 22295 - National Poultry Improvement Plan and Auxiliary Provisions

Science.gov (United States)

2011-04-21

... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection 9 CFR Part 145 [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions Correction In rule document 2011-6539 appearing on pages 15791-15798 in the issue of Tuesday, March 22, 2011, make the...

A Source Term Calculation for the APR1400 NSSS Auxiliary System Components Using the Modified SHIELD Code

International Nuclear Information System (INIS)

Park, Hong Sik; Kim, Min; Park, Seong Chan; Seo, Jong Tae; Kim, Eun Kee

2005-01-01

The SHIELD code has been used to calculate the source terms of NSSS Auxiliary System (comprising CVCS, SIS, and SCS) components of the OPR1000. Because the code had been developed based upon the SYSTEM80 design and the APR1400 NSSS Auxiliary System design is considerably changed from that of SYSTEM80 or OPR1000, the SHIELD code cannot be used directly for APR1400 radiation design. Thus the hand-calculation is needed for the portion of design changes using the results of the SHIELD code calculation. In this study, the SHIELD code is modified to incorporate the APR1400 design changes and the source term calculation is performed for the APR1400 NSSS Auxiliary System components

Note on Nahm's partition function of the dual spectrum II

CERN Document Server

Minimi, M

1977-01-01

For pt.I see CERN publication TH2240. In part I, in considering the Nahm dual resonance mass spectra theory, it was noticed that there is another modular form; a generating function that transforms automorphically under T:w to -1/w and would realize the Veneziano dualism. The group structure associated with this form is studied since it appears, to the authors, to be more natural than Nahm's original. (6 refs).

Manufacture and installation of reactor auxiliary facilities for advanced thermal prototype reactor 'Fugen'

International Nuclear Information System (INIS)

Kawahara, Toshio; Matsushita, Tadashi

1977-01-01

The facilities of reactor auxiliary systems for the advanced thermal prtotype reactor ''Fugen'' were manufactured in factories since 1972, and the installation at the site began in November, 1974. It was almost completed in March, 1977, except a part of the tests and inspections, therefore the outline of the works is reported. The ATR ''Fugen'' is a heavy water-moderated, boiling light water reactor, and its reactor auxiliary systems comprise mainly the facilities for handling heavy water, such as heavy water cooling system, heavy water cleaning system, poison supplying system, helium circulating system, helium cleaning system, and carbon dioxide system. The poison supplying system supplies liquid poison to the heavy water cooling system to absorb excess reactivity in the initial reactor core. The helium circulating system covers heavy water surface with helium to prevent the deterioration of heavy water and maintains heavy water level by pressure difference. The carbon dioxide system flows highly pure CO 2 gas in the space of pressure tubes and carandria tubes, and provides thermal shielding. The design, manufacture and installation of the facilities of reactor auxiliary systems, and the helium leak test, synthetic pressure test and total cleaning are explained. (Kako, I.)

Auxiliary-field quantum Monte Carlo calculations of molecular systems with a Gaussian basis

International Nuclear Information System (INIS)

Al-Saidi, W.A.; Zhang Shiwei; Krakauer, Henry

2006-01-01

We extend the recently introduced phaseless auxiliary-field quantum Monte Carlo (QMC) approach to any single-particle basis and apply it to molecular systems with Gaussian basis sets. QMC methods in general scale favorably with the system size as a low power. A QMC approach with auxiliary fields, in principle, allows an exact solution of the Schroedinger equation in the chosen basis. However, the well-known sign/phase problem causes the statistical noise to increase exponentially. The phaseless method controls this problem by constraining the paths in the auxiliary-field path integrals with an approximate phase condition that depends on a trial wave function. In the present calculations, the trial wave function is a single Slater determinant from a Hartree-Fock calculation. The calculated all-electron total energies show typical systematic errors of no more than a few millihartrees compared to exact results. At equilibrium geometries in the molecules we studied, this accuracy is roughly comparable to that of coupled cluster with single and double excitations and with noniterative triples [CCSD(T)]. For stretched bonds in H 2 O, our method exhibits a better overall accuracy and a more uniform behavior than CCSD(T)

Analysis of design of auxiliary system of Booshehr Nuclear Power Plant

International Nuclear Information System (INIS)

Naseh Hasanzadeh, M.

1999-01-01

Power plant's internal auxiliary system has an important role in its safety operation. Because of the decay heat and safety aspects in the nuclear power plants, this role is more important. In this thesis, operation of the nuclear power plant with PWR reactor is studied and deferent nuclear systems described. In the next section all electrical loads in the Booshehr Nuclear Power Plant identified and feeding methods of each load is determined. by use of the single line diagram of the internal auxiliary system, the nominal rating of all electrical devices as transformers, inverters, Ups, diesel generators and etc. is determined. In the following, short circuit calculations performed and by above conclusion, rating values of circuit breakers is determined. At last the starting problems of electrical motors is studied and the results of motor's behavior at starting moment is discussed

Terminal Sliding Mode Control with Unidirectional Auxiliary Surfaces for Hypersonic Vehicles Based on Adaptive Disturbance Observer

Directory of Open Access Journals (Sweden)

Naibao He

2015-01-01

Full Text Available A novel flight control scheme is proposed using the terminal sliding mode technique, unidirectional auxiliary surfaces and the disturbance observer model. These proposed dynamic attitude control systems can improve control performance of hypersonic vehicles despite uncertainties and external disturbances. The terminal attractor is employed to improve the convergence rate associated with the critical damping characteristics problem noted in short-period motions of hypersonic vehicles. The proposed robust attitude control scheme uses a dynamic terminal sliding mode with unidirectional auxiliary surfaces. The nonlinear disturbance observer is designed to estimate system uncertainties and external disturbances. The output of the disturbance observer aids the robust adaptive control scheme and improves robust attitude control performance. Finally, simulation results are presented to illustrate the effectiveness of the proposed terminal sliding mode with unidirectional auxiliary surfaces.

A randomized, controlled study of an educational intervention to improve recall of auxiliary medication labeling and adherence to antibiotics

Directory of Open Access Journals (Sweden)

Jade A Pham

2013-06-01

Full Text Available Purpose: To evaluate whether medication counseling with emphasis on auxiliary labels improves recall of auxiliary label information and adherence to medication schedules. Methods: A prospective, randomized study of an educational intervention in community pharmacies near Baltimore, Maryland. Fifty literate, English-speaking adults receiving one of the 18 commonly dispensed antibiotics were randomized to receive a counseling session or no counseling. Five to seven days after medication pickup, a structured phone interview was conducted to capture data on recall of auxiliary labels and adherence. Results: A total of 39 subjects completed the phone interview (78%. The rate of correct recall was high: 77% correct recall for all three labels. Among those with incorrect recall, 7 out of 9 subjects received no counseling (p = 0.11. The auxiliary labels incorrectly recalled were all related to dietary restrictions. Conclusion: The findings from this study suggest that medication counseling emphasizing auxiliary label information may lead to improved recall and adherence to antibiotics. Additional studies are required to confirm the preliminary findings and determine whether they correspond to improved adherence. Information most commonly misunderstood were related to dietary restrictions. Additional research focusing on counseling related to dietary restrictions is recommended.

Rates of auxiliary is and are in African American English speaking children with specific language impairment following language treatment.

Science.gov (United States)

Smith, Shana; Bellon-Harn, Monica L

2015-02-01

The purpose of this exploratory study is to examine rates of auxiliary is and are across dialect patterns produced by African American English with specific language impairment (AAE-SLI) children following language treatment. The following research question is asked: Do AAE-SLI children exhibit rates of auxiliary is and are across dialect patterns consistent with previous reports of typically developing children and adult AAE speakers? A pre-/post-test design was used to identify patterns in which auxiliary is and are were produced at significant levels. Individual performance was included to examine variable rates of use across patterns. Group and individual results suggest children used auxiliary is and are in dialect patterns at rates consistent with typically developing child and adult AAE speakers. We conclude that rates of use may contribute to evidence-based guidelines for morphological intervention with AAE-SLI children.

Analysis of Gradient Waveform in Magnetic Resonance Imaging

Directory of Open Access Journals (Sweden)

OU-YANG Shan-mei

2017-12-01

Full Text Available The accuracy of gradient pulse waveform affects image quality significantly in magnetic resonance imaging (MRI. Recording and analyzing the waveform of gradient pulse helps to make rapid and accurate diagnosis of spectrometer gradient hardware and/or pulse sequence. Using the virtual instrument software LabVIEW to control the high speed data acquisition card DAQ-2005, a multi-channel acquisition scheme was designed to collect the gradient outputs from a custom-made spectrometer. The collected waveforms were post-processed (i.e., histogram statistical analysis, data filtering and difference calculation to obtain feature points containing time and amplitude information. Experiments were carried out to validate the method, which is an auxiliary test method for the development of spectrometer and pulses sequence.

The Influence of Magnetic Resonance Imaging Findings of Degenerative Disease on Dual-Energy X-ray Absorptiometry Measurements in Middle-Aged Men

International Nuclear Information System (INIS)

Donescu, O.S.; Battie, M.C.; Videman, T.

2007-01-01

Purpose: To examine degenerative features based on magnetic resonance imaging (MRI) measurements at the lumbar spine in relation to dual-energy X-ray absorptiometry (DXA), and to investigate whether bone mineral density (BMD) is reflected in the substitution of bone trabecular structure by fat at the vertebral body level indicated by MRI T1 relaxation time, endplate concavity, and hypertrophic (osteophytes and endplate sclerosis) MRI findings. Material and Methods: The sample for this cross-sectional study was composed of 102 subjects, 35-70 years old, from a population-based cohort. Data collection included DXA in the anterior-posterior projection at the L1-L4 vertebrae and right femoral neck, and MRI of the lumbar spine in the midsagittal plane. Results: Age, vertebral signal intensity, osteophytes, and endplate concavity collectively explained 20% of the variance in spine BMD. Conclusion: The study findings suggest that degenerative findings based on MRI measurements at the lumbar spine have an influence on bone assessment using DXA. Therefore, an overall bone assessment such as DXA might not offer an accurate measure of BMD

Some properties of dual and approximate dual of fusion frames

OpenAIRE

Arefijamaal, Ali Akbar; Neyshaburi, Fahimeh Arabyani

2016-01-01

In this paper we extend the notion of approximate dual to fusion frames and present some approaches to obtain dual and approximate alternate dual fusion frames. Also, we study the stability of dual and approximate alternate dual fusion frames.

The auxiliary elliptic-like equation and the exp-function method

Indian Academy of Sciences (India)

exact solutions of the nonlinear evolution equations are derived with the aid of auxiliary elliptic-like equation. ... (NEE) have been paid attention by many researchers, especially the investigations of exact solutions for ... elliptic-like equation with the aid of the travelling wave reduction are introduced. The exact solutions of ...

The effect of an auxiliary discharge on anode sheath potentials in a transverse discharge

International Nuclear Information System (INIS)

Foster, J.E.; Gallimore, A.D.

1997-01-01

A novel scheme that employs the use of an auxiliary discharge has been shown to reduce markedly anode sheath potentials in a transverse discharge. An 8.8 A low-pressure argon discharge in the presence of a transverse magnetic field was used as the plasma source in this study. In such discharges, the transverse flux that is collected by the anode is severely limited due to marked reductions in the transverse diffusion coefficient. Findings of this study indicate that the local electron number density and the transverse flux increase when the auxiliary discharge is operated. Changes in these parameters are reflected in the measured anode sheath voltage. Anode sheath potentials, estimated by using Langmuir probes, were shown to be reduced by over 33% when the auxiliary discharge is operated. These reductions in anode sheath potentials translated into significant reductions in anode power flux as measured using water calorimeter techniques. The reductions in anode power flux also correlate well with changes in the electron transverse flux. Finally, techniques implementing these positive effects in real plasma accelerators are discussed. copyright 1997 American Institute of Physics

Temporal lobe epilepsy: analysis of patients with dual pathology.

Science.gov (United States)

Salanova, V; Markand, O; Worth, R

2004-02-01

To determine the frequency and types of dual pathology in patients with temporal lobe epilepsy (TLE) and to analyze the clinical manifestations and surgical outcome. A total of 240 patients with TLE underwent temporal resections following a comprehensive pre-surgical evaluation. Thirty-seven (15.4%) of these had hippocampal sclerosis (HS) or temporal lobe gliosis in association with another lesion (dual pathology). Eighteen of 37 patients with dual pathology had heterotopia of the temporal lobe, nine had cortical dysplasia, four had cavernous angiomas or arteriovenous malformations, one had a dysembryoplastic neuroepithelial tumor, one had a contusion and four patients had cerebral infarctions in childhood. 68.5% had abnormal head magnetic resonance imagings, 91.3% had abnormal positron emission tomography scans, and 96% had abnormal ictal SPECT. The intracarotid amobarbital procedure (IAP) showed impaired memory of the epileptogenic side in 72% of the patients. Twenty patients had left and 17 had right-sided en bloc temporal resections, including the lesion and mesial temporal structures. Twenty-six (70.2%) became seizure-free, eight (21.6%) had rare seizures, two (5.4%) had worthwhile seizure reduction and one (2.7%) had no improvement (range of follow-up 1-16 years, mean = 7.4 years). 15.4% had dual pathology. The dual pathology was almost exclusively seen in patients whose lesions were congenital, or occurred early in life, suggesting that the hippocampus is more vulnerable and more readily develops HS in early childhood. Resections, including the lateral and mesial temporal structures led to a favorable outcome with no mortality and little morbidity.

Formation of multifunctional Fe3O4/Au composite nanoparticles for dual-mode MR/CT imaging applications

International Nuclear Information System (INIS)

Hu Yong; Li Jing-Chao; Shen Ming-Wu; Shi Xiang-Yang

2014-01-01

Recent advances with iron oxide/gold (Fe 3 O 4 /Au) composite nanoparticles (CNPs) in dual-modality magnetic resonance (MR) and computed tomography (CT) imaging applications are reviewed. The synthesis and assembly of “dumbbelllike” and “core/shell” Fe 3 O 4 /Au CNPs is introduced. Potential applications of some developed Fe 3 O 4 /Au CNPs as contrast agents for dual-mode MR/CT imaging applications are described in detail. (topical review - magnetism, magnetic materials, and interdisciplinary research)

On the Auxiliary Status of Dare in Old English

Directory of Open Access Journals (Sweden)

Tomaszewska Magdalena

2014-12-01

Full Text Available OE *durran ‘dare’ belongs to a group of the so-called preterite-present verbs which developed weak past tense forms replacing the originally strong forms throughout the paradigm. The present study hypothesizes that the potential sources of this development are related to the decay of the subjunctive mood in Old English. Further, this corpus-based study analyses the status of DARE in Old English, with the findings showing that the verb displayed both lexical and auxiliary verb characteristics. These results are juxtaposed and compared with the verb's developments in Middle English. The databases examined are the corpus of The Dictionary of Old English in Electronic Form (A-G and the Innsbruck Computer Archive of Machine-Readable English Texts. In both cases, a search of potential forms was performed on all the files of the corpora, the raw results were then analysed in order to eliminate irrelevant instances (adjectives, nouns, foreign words, etc.. The relevant forms were examined with the aim to check the properties of DARE as a lexical and an auxiliary verb, and compare the findings with Molencki’s (2002, 2005 observations.

Dynamic analysis of auxiliary buildings in nuclear power plants

International Nuclear Information System (INIS)

Subramanian, K.V.; Madhava Rao, A.S.; Warudkar, A.S.

1989-01-01

All nuclear power plants have a large number of auxiliary buildings housing various services and control systems required for the operation of the plant. Illustrative examples are turbine building, control building, service building etc. These buildings are seismically qualified as Class I or Class II structures. Usually, these auxiliary buildings are of low rise type with two or three floors and floor heights varying from five to eight meters and of framed construction in steel or concrete or a combination of both the materials. The floors are usually staggered with large cutouts and may not extend over the full area in plan. Some of the bays are often of double story height with the columns continuous over a story in order to accommodate cranes and other equipment. The structural elements supporting the roof may consist of steel roof trusses instead of beams. The seismic analysis of these structures involves the formulation of the analytical model that can simulate the physical behavior of the structure as close as possible taking into consideration the practical aspects. The criteria adopted to formulate the mathematical model has an important bearing on the evaluated dynamic characteristics and seismic response

The SOL-2/Neto auxiliary protein modulates the function of AMPA-subtype ionotropic glutamate receptors.

Science.gov (United States)

Wang, Rui; Mellem, Jerry E; Jensen, Michael; Brockie, Penelope J; Walker, Craig S; Hoerndli, Frédéric J; Hauth, Linda; Madsen, David M; Maricq, Andres V

2012-09-06

The neurotransmitter glutamate mediates excitatory synaptic transmission by gating ionotropic glutamate receptors (iGluRs). AMPA receptors (AMPARs), a subtype of iGluR, are strongly implicated in synaptic plasticity, learning, and memory. We previously discovered two classes of AMPAR auxiliary proteins in C. elegans that modify receptor kinetics and thus change synaptic transmission. Here, we have identified another auxiliary protein, SOL-2, a CUB-domain protein that associates with both the related auxiliary subunit SOL-1 and with the GLR-1 AMPAR. In sol-2 mutants, behaviors dependent on glutamatergic transmission are disrupted, GLR-1-mediated currents are diminished, and GLR-1 desensitization and pharmacology are modified. Remarkably, a secreted variant of SOL-1 delivered in trans can rescue sol-1 mutants, and this rescue depends on in cis expression of SOL-2. Finally, we demonstrate that SOL-1 and SOL-2 have an ongoing role in the adult nervous system to control AMPAR-mediated currents. Copyright © 2012 Elsevier Inc. All rights reserved.

Assessment of myocardial perfusion with MRI using a modified dual bolus method

International Nuclear Information System (INIS)

Husso, M; Sipola, P; Manninen, H; Vainio, P; Kuittinen, T; Hartikainen, J; Saarakkala, S; Töyräs, J; Kuikka, J

2014-01-01

Quantification of regional myocardial blood flow (rMBF) with first-pass magnetic resonance imaging (FP-MRI) requires two contrast agent injections (dual bolus technique), inducing error in the determined rMBF if the injections differ. We hypothesize that using input and residue curves of the same injection would be more reliable. We aim to introduce and evaluate a novel method to correct the high concentration arterial input function (AIF) for determination of rMBF. Sixteen patients with non-Hodgkin's lymphoma were examined before and after chemotherapy. The input function was solved by correcting initial high concentration AIF using the ratio of low and high contrast AIF areas, normalized by corresponding heart rates (modified dual bolus method). For comparison, the scaled low contrast AIF was used as an input function (dual bolus method). Unidirectional transfer coefficient K trans  was calculated using both methods. K trans -values determined with the dual bolus (0.81 ± 0.32 ml g −1  min −1 ) and modified dual bolus (0.77 ± 0.42 ml g −1  min −1 ) methods were in agreement (p = 0.21). Mean K trans -values increased from 0.76 ± 0.43 to 0.89 ± 0.55 ml g −1  min −1  after chemotherapy (p = 0.17). The modified dual bolus technique agrees with the dual bolus technique (R2 = 0.899) when the low and high contrast injections are similar. However, when this is not the case, the modified dual bolus technique may be more reliable. (paper)

INFLUENCE OF FEEDING ELECTRIC ENERGY QUALITY ON HEATING OF THE AUXILIARY MA-CHINES OF AC ELECTRIC ROLLING STOCK

Directory of Open Access Journals (Sweden)

O. YU. Baliichuk

2014-04-01

Full Text Available Purpose. The article aims to study the problem of increase the reliability of auxiliary machines for AC electric trains during operation in real conditions. Methodology. The peculiarity of system construction of auxiliary machines for AC electric rolling stock is the use of asynchronous motors for general industrial purpose. An engineering method of influence determination on the feeding voltage asymmetry and its deviation from the nominal value on heating of auxiliary machines insulation was proposed. Findings. It is found out that in case when the auxiliary machines of AC electric trains work under asymmetry factor of the voltage 10% or more and feeding voltage deviation from the nominal order 0.6 relative unit then it is possible the overheat of their isolation, even if it has class H. Originality. For the first time the issue of the total insulation heating under such boundary parameters combinations of energy quality, when each of them contributes to the heating insulation increase as compared to the nominal regime of the "rotating phase splitter−auxiliary machinery" system was illuminated. Practical value. Conducted research allow us to establish the boundary parameter values of feeding energy quality (asymmetry factor, feeding voltage deviations from the nominal value, at which additional isolation overheating of this class under the effect of specified factors will not exceed the agreed value.

The Neurocognitive Basis for Impaired Dual-Task Performance in Senior Fallers.

Science.gov (United States)

Nagamatsu, Lindsay S; Hsu, C Liang; Voss, Michelle W; Chan, Alison; Bolandzadeh, Niousha; Handy, Todd C; Graf, Peter; Beattie, B Lynn; Liu-Ambrose, Teresa

2016-01-01

Falls are a major health-care concern, and while dual-task performance is widely recognized as being impaired in those at-risk for falls, the underlying neurocognitive mechanisms remain unknown. A better understanding of the underlying mechanisms could lead to the refinement and development of behavioral, cognitive, or neuropharmacological interventions for falls prevention. Therefore, we conducted a cross-sectional study with community-dwelling older adults aged 70-80 years with a history of falls (i.e., two or more falls in the past 12 months) or no history of falls (i.e., zero falls in the past 12 months); n = 28 per group. We compared functional activation during cognitive-based dual-task performance between fallers and non-fallers using functional magnetic resonance imaging (fMRI). Executive cognitive functioning was assessed via Stroop, Trail Making, and Digit Span. Mobility was assessed via the Timed Up and Go test (TUG). We found that non-fallers exhibited significantly greater functional activation compared with fallers during dual-task performance in key regions responsible for resolving dual-task interference, including precentral, postcentral, and lingual gyri. Further, we report slower reaction times during dual-task performance in fallers and significant correlations between level of functional activation and independent measures of executive cognitive functioning and mobility. Our study is the first neuroimaging study to examine dual-task performance in fallers, and supports the notion that fallers have reduced functional brain activation compared with non-fallers. Given that dual-task performance-and the underlying neural concomitants-appears to be malleable with relevant training, our study serves as a launching point for promising strategies to reduce falls in the future.

Auxiliary representations of Lie algebras and the BRST constructions

International Nuclear Information System (INIS)

Burdik, C.; Pashnev, A.I.; Tsulaya, M.M.

2000-01-01

The method of construction of auxiliary representations for a given Lie algebra is discussed in the framework of the BRST approach. The corresponding BRST charge turns out to be nonhermitian. This problem is solved by the introduction of the additional kernel operator in the definition of the scalar product in the Fock space. The existence of the kernel operator is proved for any Lie algebra

Auxiliary Electrodes for Chromium Vapor Sensors

Energy Technology Data Exchange (ETDEWEB)

Fergus, Jeffrey; Shahzad, Moaiz; Britt, Tommy

2018-05-15

Measurement of chromia-containing vapors in solid oxide fuel cell systems is useful for monitoring and addressing cell degradation caused by oxidation of the chomia scale formed on alloys for interconnects and balance-of-plant components. One approach to measuring chromium is to use a solid electrolyte with an auxiliary electrode that relates the partial pressure of the chromium containing species to the mobile species in the electrolyte. One example is YCrO3 which can equilibrate with the chromium containing vapor and yttrium in yttria stabilized zirconia to establish an oxygen activity. Another is Na2CrO4 which can equilibrate with the chromium-containing vapor to establish a sodium activity.

Auxiliary accelerating system for TRIUMF cyclotron

International Nuclear Information System (INIS)

Zach, M.; Fong, K.; Laxdal, R.; Mackenzie, G.H.; Pacak, V.; Pearson, J.; Richardson, J.R.; Stanford, G.; Worsham, R.

1990-06-01

A 92 MHz auxiliary accelerating cavity has been designed and manufactured for installation in the TRIUMF cyclotron. Operating at the fourth harmonic of the RF with a peak voltage of 150 kV, it almost doubles the present energy gain per turn in the 400-500 MeV range, and reduces by ∼50% the stripping loss of the H - beam. This significant improvement will allow a substantial increase in the extracted current above the present routine level of 150μA while maintaining the same levels of residual radioactivity. The system is completed and being commissioned. A description of the design and commissioning procedures is presented, and results of beam tests given. (Author) 7 refs., 5 figs

On Estimating Quantiles Using Auxiliary Information

Directory of Open Access Journals (Sweden)

Berger Yves G.

2015-03-01

Full Text Available We propose a transformation-based approach for estimating quantiles using auxiliary information. The proposed estimators can be easily implemented using a regression estimator. We show that the proposed estimators are consistent and asymptotically unbiased. The main advantage of the proposed estimators is their simplicity. Despite the fact the proposed estimators are not necessarily more efficient than their competitors, they offer a good compromise between accuracy and simplicity. They can be used under single and multistage sampling designs with unequal selection probabilities. A simulation study supports our finding and shows that the proposed estimators are robust and of an acceptable accuracy compared to alternative estimators, which can be more computationally intensive.

Acylation, Diastereoselective Alkylation, and Cleavage of an Oxazolidinone Chiral Auxiliary: A Multistep Asymmetric Synthesis Experiment for Advanced Undergraduates

Science.gov (United States)

Smith, Thomas E.; Richardson, David P.; Truran, George A.; Belecki, Katherine; Onishi, Megumi

2008-01-01

An introduction to the concepts and experimental techniques of diastereoselective synthesis using a chiral auxiliary is described. The 4-benzyl-2-oxazolidinone chiral auxiliary developed by Evans is acylated with propionic anhydride under mild conditions using DMAP as an acyl transfer catalyst. Deprotonation with NaN(TMS)[subscript 2] at -78…

VLTI auxiliary telescopes: a full object-oriented approach

Science.gov (United States)

Chiozzi, Gianluca; Duhoux, Philippe; Karban, Robert

2000-06-01

The Very Large Telescope (VLT) Telescope Control Software (TCS) is a portable system. It is now in use or will be used in a whole family of ESO telescopes VLT Unit Telescopes, VLTI Auxiliary Telescopes, NTT, La Silla 3.6, VLT Survey Telescope and Astronomical Site Monitors in Paranal and La Silla). Although it has been developed making extensive usage of Object Oriented (OO) methodologies, the overall development process chosen at the beginning of the project used traditional methods. In order to warranty a longer lifetime to the system (improving documentation and maintainability) and to prepare for future projects, we have introduced a full OO process. We have taken as a basis the United Software Development Process with the Unified Modeling Language (UML) and we have adapted the process to our specific needs. This paper describes how the process has been applied to the VLTI Auxiliary Telescopes Control Software (ATCS). The ATCS is based on the portable VLT TCS, but some subsystems are new or have specific characteristics. The complete process has been applied to the new subsystems, while reused code has been integrated in the UML models. We have used the ATCS on one side to tune the process and train the team members and on the other side to provide a UML and WWW based documentation for the portable VLT TCS.

Ocean Surface Topography Mission (OSTM) /Jason-2: Auxiliary Files (NODC Accession 0044983)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the data descriptions for the OSTM/Jason-2 Auxiliary data files, which is served through the NOAA/NESDIS Comprehensive Large Array-data...

47 CFR 74.690 - Transition of the 1990-2025 MHz band from the Broadcast Auxiliary Service to emerging technologies.

Science.gov (United States)

2010-10-01

... Broadcast Auxiliary Service to emerging technologies. 74.690 Section 74.690 Telecommunication FEDERAL... of the 1990-2025 MHz band from the Broadcast Auxiliary Service to emerging technologies. (a) New... licensed emerging technology services will maintain primary status in the band until the Existing Licensee...

High voltage series resonant inverter ion engine screen supply. [SCR series resonant inverter for space applications

Science.gov (United States)

Biess, J. J.; Inouye, L. Y.; Shank, J. H.

1974-01-01

A high-voltage, high-power LC series resonant inverter using SCRs has been developed for an Ion Engine Power Processor. The inverter operates within 200-400Vdc with a maximum output power of 2.5kW. The inverter control logic, the screen supply electrical and mechanical characteristics, the efficiency and losses in power components, regulation on the dual feedback principle, the SCR waveforms and the component weight are analyzed. Efficiency of 90.5% and weight density of 4.1kg/kW are obtained.

Nanodiamond-Manganese dual mode MRI contrast agents for enhanced liver tumor detection.

Science.gov (United States)

Hou, Weixin; Toh, Tan Boon; Abdullah, Lissa Nurrul; Yvonne, Tay Wei Zheng; Lee, Kuan J; Guenther, Ilonka; Chow, Edward Kai-Hua

2017-04-01

Contrast agent-enhanced magnetic resonance (MR) imaging is critical for the diagnosis and monitoring of a number of diseases, including cancer. Certain clinical applications, including the detection of liver tumors, rely on both T1 and T2-weighted images even though contrast agent-enhanced MR imaging is not always reliable. Thus, there is a need for improved dual mode contrast agents with enhanced sensitivity. We report the development of a nanodiamond-manganese dual mode contrast agent that enhanced both T1 and T2-weighted MR imaging. Conjugation of manganese to nanodiamonds resulted in improved longitudinal and transverse relaxivity efficacy over unmodified MnCl 2 as well as clinical contrast agents. Following intravenous administration, nanodiamond-manganese complexes outperformed current clinical contrast agents in an orthotopic liver cancer mouse model while also reducing blood serum concentration of toxic free Mn 2+ ions. Thus, nanodiamond-manganese complexes may serve as more effective dual mode MRI contrast agent, particularly in cancer. Copyright © 2016 Elsevier Inc. All rights reserved.

Seismic Qualification of Auxiliary Feed Water Control Valve

International Nuclear Information System (INIS)

Hwang, K. M.; Jang, J. B.; Kim, J. K.; Suh, Y. P.

2006-01-01

Although domestic nuclear power industry has almost accomplished technical independence, Auxiliary Feed Water Control Valve (AFWCV) is still depending on import. In order to jump to advanced nation in nuclear power industry, it is very important to achieve technical independence in designing and manufacturing AFWCV. At last, AFWCV is self-manufactured using the domestic technology under the financial support of the government. Therefore, the seismic qualification is carried out to verify the safety and operability of AFWCV against the earthquake in this study

Chemistry and radiochemistry strategies supported by FA3-EPRTM and UK-EPRTM auxiliary systems: performances and control

International Nuclear Information System (INIS)

Tigeras, Arancha; Fourment, Pierre; Elgallaf; Anas; Chupin, Antoine; Fauvel, Nicola

2012-09-01

The design and the operation of auxiliary systems play an essential role in: - the preservation of the primary circuit integrity, - the prevention of hydrogen risk, - the control of the boron concentration and radioactivity, - the application of pH and zinc programmes. While the source term generation mainly depends on the primary circuit material and primary coolant chemistry conditioning, the source term spreading is directly linked to the auxiliary systems treatment and performances. Indeed, the auxiliary systems regulate the boron, hydrogen, lithium and zinc injection as well as the countermeasures to ensure the reactivity control and the hazardous H 2 /O 2 mixture prevention. The main principles governing the chemistry and radiochemistry in the auxiliary systems are based on the application of: - Design features for hydrogen and boron management. - Criteria for selecting the appropriate material of each system considering the functional requirements and the source term build up reduction. - Measures for minimizing the activity deposition on the surfaces of components and pipings. - Adequate and reliable systems of purification for reducing the accumulation of liquid/gas radioactivity and impurities in the circuits and for optimizing the waste production. - Chemistry program for limiting the material corrosion of auxiliary systems and preventing the source term transfer to the core. - Appropriate sampling locations and equipment to monitor the chemistry and radiochemistry parameters. This paper describes the operation of the main auxiliary systems of FLAMANVILLE3-EPR TM and UK-EPR- TM participating in the chemistry/radiochemistry management such as Chemical and Volume Control System (CVCS), Reactor Borated Water Make-up System (RBWMS), Coolant Treatment System (CTS), Gaseous Waste Processing System (GWPS), Fuel Pool Purification System (PTR [FPPS/FPCS]) also. The performances requested to these systems and the chemistry programs applied to them are discussed

Auxiliary matrices for the six-vertex model at q sup N = 1 and a geometric interpretation of its symmetries

CERN Document Server

Korff, C

2003-01-01

The construction of auxiliary matrices for the six-vertex model at a root of unity is investigated from a quantum group theoretic point of view. Employing the concept of intertwiners associated with the quantum loop algebra U sub q (s-tilde l-tilde sub 2) at q sup N = 1, a three-parameter family of auxiliary matrices is constructed. The elements of this family satisfy a functional relation with the transfer matrix allowing one to solve the eigenvalue problem of the model and to derive the Bethe ansatz equations. This functional relation is obtained from the decomposition of a tensor product of evaluation representations and involves auxiliary matrices with different parameters. Because of this dependence on additional parameters, the auxiliary matrices break in general the finite symmetries of the six-vertex model, such as spin-reversal or spin-conservation. More importantly, they also lift the extra degeneracies of the transfer matrix due to the loop symmetry present at rational coupling values. The extra pa...

Dual-probe spectroscopic fingerprints of defects in graphene

DEFF Research Database (Denmark)

Settnes, Mikkel; Power, Stephen; Petersen, Dirch Hjorth

2014-01-01

(e.g., an extended graphene sheet). Applying this method, we study the transport anisotropies in pristine graphene sheets, and analyze the spectroscopic fingerprints arising from quantum interference around single-site defects, such as vacancies and adatoms. Furthermore, we demonstrate that the dual......-probe setup is a useful tool for characterizing the electronic transport properties of extended defects or designed nanostructures. In particular, we show that nanoscale perforations, or antidots, in a graphene sheet display Fano-type resonances with a strong dependence on the edge geometry of the perforation....

PZT crack detection in suspension-based dual stage actuator [for HDDs

CERN Document Server

Yung Ping Yeh; Ku, C

2000-01-01

An impedance method is proposed to detect cracks of PZT bars in suspension based dual stage-actuators. The frequency response amplitude of impedance at the resonance of 1.95 MHz, the PZT bar width extension mode, was very sensitive to the cracks in PZT material. As cracks in the PZT bars propagated from invisible micro cracks to visible macro cracks, the impedance gain at 1.95 MHz dropped suddenly. (3 refs).

Design and operation of the LAMPF Auxiliary Controller. High-speed remote processing on the CAMAC dataway

International Nuclear Information System (INIS)

Machen, D.R.

1979-02-01

A CAMAC Auxiliary Controller has been developed to further the concepts of distributed processing in both process control and experiment data-acquisition systems. The Auxiliary Controller is built around a commercially available 16-bit microcomputer and a high-speed bit-sliced microprocessor capable of instruction execution times of 140 ns. The modular nature of the controller allows the user to tailor the controller capabilities to the system problem, while maintaining the interface techniques of the CAMAC Standard

On the prohibition of automatic redundant power supply of 6 and 0.4 kV auxiliary sections at Leningrad NPP

International Nuclear Information System (INIS)

Mokeev, S.F.

1987-01-01

At Leningrad NPP the automatic switching on of the auxiliary power supply sources of 6 and 0.4 kV is prohibited to provide personnel safety and preserve destruction of electroequipment. With excess of current maximum value in the 6 kV section immediate detachment of all electric motors occurs. At that moment by the switchers detechment emergency signal it occurs immediate swithing on of auxiliary systems or emergency switching on of auxiliary supply of the main circulating pumps, that insreases abruptly operation reliability of plant technological department

Dual Credit/Dual Enrollment and Data Driven Policy Implementation

Science.gov (United States)

Lichtenberger, Eric; Witt, M. Allison; Blankenberger, Bob; Franklin, Doug

2014-01-01

The use of dual credit has been expanding rapidly. Dual credit is a college course taken by a high school student for which both college and high school credit is given. Previous studies provided limited quantitative evidence that dual credit/dual enrollment is directly connected to positive student outcomes. In this study, predictive statistics…

Hepatic fat quantification: a prospective comparison of magnetic resonance spectroscopy and analysis methods for chemical-shift gradient echo magnetic resonance imaging with histologic assessment as the reference standard.

Science.gov (United States)

Kang, Bo-Kyeong; Yu, Eun Sil; Lee, Seung Soo; Lee, Youngjoo; Kim, Namkug; Sirlin, Claude B; Cho, Eun Yoon; Yeom, Suk Keu; Byun, Jae Ho; Park, Seong Ho; Lee, Moon-Gyu

2012-06-01

The aims of this study were to assess the confounding effects of hepatic iron deposition, inflammation, and fibrosis on hepatic steatosis (HS) evaluation by magnetic resonance imaging (MRI) and magnetic resonance spectroscopy (MRS) and to assess the accuracies of MRI and MRS for HS evaluation, using histology as the reference standard. In this institutional review board-approved prospective study, 56 patients gave informed consents and underwent chemical-shift MRI and MRS of the liver on a 1.5-T magnetic resonance scanner. To estimate MRI fat fraction (FF), 4 analysis methods were used (dual-echo, triple-echo, multiecho, and multi-interference), and MRS FF was calculated with T2 correction. Degrees of HS, iron deposition, inflammation, and fibrosis were analyzed in liver resection (n = 37) and biopsy (n = 19) specimens. The confounding effects of histology on fat quantification were assessed by multiple linear regression analysis. Using the histologic degree of HS as the reference standard, the accuracies of each method in estimating HS and diagnosing an HS of 5% or greater were determined by linear regression and receiver operating characteristic analyses. Iron deposition significantly confounded estimations of FF by the dual-echo (P hepatic fat, with coexisting histologic abnormalities having no confounding effects.

PWR auxiliary systems, safety and emergency systems, accident analysis, operation

International Nuclear Information System (INIS)

Meyer, P.J.

1976-01-01

The author presents a description of PWR auxiliary systems like volume control, boric acid control, coolant purification, -degassing, -storage and -treatment system and waste processing systems. Residual heat removal systems, emergency systems and containment designs are discussed. As an accident analysis the author gives a survey over malfunctions and disturbances in the field of reactor operations. (TK) [de

Energy Recovery for the Main and Auxiliary Sources of Electric Vehicles

Directory of Open Access Journals (Sweden)

Binggang Cao

2010-10-01

Full Text Available Based on the traditional regenerative braking electrical circuit, a novel energy recovery system for the main and auxiliary sources of electric vehicles (EVs has been developed to improve their energy efficiency. The electrical circuit topology is presented in detail. During regenerative braking, the recovered mechanical energy is stored in both the main source and the auxiliary source at the same time. The mathematical model of the proposed system is derived step by step. Combining the merits and defects of H2 optimal control and H∞ robust control, a H2/H∞ controller is designed to guarantee both the system performance and robust stability. The perfect match between the simulated and experimental results validates the notion that the proposed novel energy recovery system is both feasible and effective, as more energy is recovered than that with the traditional energy recovery systems, in which recovered energy is stored only in the main source.

Energy Recovery for the Main and Auxiliary Sources of Electric Vehicles

Energy Technology Data Exchange (ETDEWEB)

Min Ye [Key Laboratory for Highway Construction Technology and Equipment of Ministry of Education, Chang’an University, Xi’an (China); Sengjie Jiao [Key Laboratory for Highway Construction Technology and Equipment of Ministry of Education, Chang’an University, Xi’an (China); Binggang Cao [School of Mechanical Engineering, Xi’an Jiaotong University, Xi’an (China)

2010-09-15

Based on the traditional regenerative braking electrical circuit, a novel energy recovery system for the main and auxiliary sources of electric vehicles (EVs) has been developed to improve their energy efficiency. The electrical circuit topology is presented in detail. During regenerative braking, the recovered mechanical energy is stored in both the main source and the auxiliary source at the same time. The mathematical model of the proposed system is derived step by step. Combining the merits and defects of H2 optimal control and H-infinity robust control, a H2/H-infinity controller is designed to guarantee both the system performance and robust stability. The perfect match between the simulated and experimental results validates the notion that the proposed novel energy recovery system is both feasible and effective, as more energy is recovered than that with the traditional energy recovery systems, in which recovered energy is stored only in the main source.

Energy Recovery for the Main and Auxiliary Sources of Electric Vehicles

Energy Technology Data Exchange (ETDEWEB)

Ye, M.; Jiao, S. [Key Laboratory for Highway Construction Technology and Equipment of Ministry of Education, Chang' an University, Xi' an 710064 (China); Cao, B. [School of Mechanical Engineering, Xi' an Jiaotong University, Xi' an 710049 (China)

2010-10-15

Based on the traditional regenerative braking electrical circuit, a novel energy recovery system for the main and auxiliary sources of electric vehicles (EVs) has been developed to improve their energy efficiency. The electrical circuit topology is presented in detail. During regenerative braking, the recovered mechanical energy is stored in both the main source and the auxiliary source at the same time. The mathematical model of the proposed system is derived step by step. Combining the merits and defects of H{sub 2} optimal control and H{sub {infinity}} robust control, a H{sub 2}/H{sub {infinity}} controller is designed to guarantee both the system performance and robust stability. The perfect match between the simulated and experimental results validates the notion that the proposed novel energy recovery system is both feasible and effective, as more energy is recovered than that with the traditional energy recovery systems, in which recovered energy is stored only in the main source. (authors)

A SLAM based on auxiliary marginalised particle filter and differential evolution

Science.gov (United States)

Havangi, R.; Nekoui, M. A.; Teshnehlab, M.; Taghirad, H. D.

2014-09-01

FastSLAM is a framework for simultaneous localisation and mapping (SLAM) using a Rao-Blackwellised particle filter. In FastSLAM, particle filter is used for the robot pose (position and orientation) estimation, and parametric filter (i.e. EKF and UKF) is used for the feature location's estimation. However, in the long term, FastSLAM is an inconsistent algorithm. In this paper, a new approach to SLAM based on hybrid auxiliary marginalised particle filter and differential evolution (DE) is proposed. In the proposed algorithm, the robot pose is estimated based on auxiliary marginal particle filter that operates directly on the marginal distribution, and hence avoids performing importance sampling on a space of growing dimension. In addition, static map is considered as a set of parameters that are learned using DE. Compared to other algorithms, the proposed algorithm can improve consistency for longer time periods and also, improve the estimation accuracy. Simulations and experimental results indicate that the proposed algorithm is effective.

Quantum damped oscillator I: Dissipation and resonances

International Nuclear Information System (INIS)

Chruscinski, Dariusz; Jurkowski, Jacek

2006-01-01

Quantization of a damped harmonic oscillator leads to so called Bateman's dual system. The corresponding Bateman's Hamiltonian, being a self-adjoint operator, displays the discrete family of complex eigenvalues. We show that they correspond to the poles of energy eigenvectors and the corresponding resolvent operator when continued to the complex energy plane. Therefore, the corresponding generalized eigenvectors may be interpreted as resonant states which are responsible for the irreversible quantum dynamics of a damped harmonic oscillator

Modification of anisotropic plasma diffusion via auxiliary electrons emitted by a carbon nanotubes-based electron gun in an electron cyclotron resonance ion source.

Science.gov (United States)

Malferrari, L; Odorici, F; Veronese, G P; Rizzoli, R; Mascali, D; Celona, L; Gammino, S; Castro, G; Miracoli, R; Serafino, T

2012-02-01

The diffusion mechanism in magnetized plasmas is a largely debated issue. A short circuit model was proposed by Simon, assuming fluxes of lost particles along the axial (electrons) and radial (ions) directions which can be compensated, to preserve the quasi-neutrality, by currents flowing throughout the conducting plasma chamber walls. We hereby propose a new method to modify Simon's currents via electrons injected by a carbon nanotubes-based electron gun. We found this improves the source performances, increasing the output current for several charge states. The method is especially sensitive to the pumping frequency. Output currents for given charge states, at different auxiliary electron currents, will be reported in the paper and the influence of the frequency tuning on the compensation mechanism will be discussed.

Evaluation of regeneration of liver function in pig model of auxiliary partial liver transplantation

International Nuclear Information System (INIS)

Li Jiaxin; Chen Xiaopeng; Rui Ging; Shong Qun; Chen Fangman; Lu Meijing; Chen Yongquan

2010-01-01

Objective: To establish a pig model of auxiliary partial liver transplantation and observe the liver function regeneration of host liver and graft. Methods: The portal vein providing for the host liver were gradually contracted; the donor hepatic veins were eng-to-side anastomosed to inferior vena cava in host caudal; graft was transplanted into the space under the host liver, part of receivers relieved portal vein angiography and color Doppler flow imaging was performed 3 days after surgery. Liver function of double livers in relievers was checked up, 3 days and 1 week after surgery respectively. Results: After surgery 10 relievers survived over 1 week, blood enzymology from hepatic vein of grafts 1 week after surgery were not ameliorative significantly compared with those 3 days after surgery (P > 0.05). Blood enzymology indexes from hepatic veins of grafts 1 week after surgery were were improved significantly compared with 3 days after surgery (P < 0.05). The graft did not reveal atrophic and gained favorable function. Conclusion: Favorable regeneration in the auxiliary partial liver transplantation model has achieved. Ideal foundation has been established for simulating and investigating human auxiliary liver transplantation. (authors)

Prevention of postpartum haemorrhage by community-based auxiliary midwives in hard-to-reach areas of Myanmar: a qualitative inquiry into acceptability and feasibility of task shifting.

Science.gov (United States)

Than, Kyu Kyu; Mohamed, Yasmin; Oliver, Victoria; Myint, Theingi; La, Thazin; Beeson, James G; Luchters, Stanley

2017-05-17

In Myanmar, postpartum haemorrhage is the leading cause of maternal mortality and contributes to around 30% of all maternal deaths. The World Health Organization recommends training and supporting auxiliary midwives to administer oral misoprostol for prevention of postpartum haemorrhage in resource-limited settings. However, use of misoprostol by auxiliary midwives has not formally been approved in Myanmar. Our study aimed to explore community and provider perspectives on the roles of auxiliary midwives and community-level provision of oral misoprostol by auxiliary midwives. A qualitative inquiry was conducted in Ngape Township, Myanmar. A total of 15 focus group discussions with midwives, auxiliary midwives, community members and mothers with children under the age of three were conducted. Ten key informant interviews were performed with national, district and township level health planners and implementers of maternal and child health services. All audio recordings were transcribed verbatim in Myanmar language. Transcripts of focus group discussions were fully translated into English before coding, while key informants' data were coded in Myanmar language. Thematic analysis was done using ATLAS.ti software. Home births are common and auxiliary midwives were perceived as an essential care provider during childbirth in hard-to-reach areas. Main reasons provided were that auxiliary midwives are more accessible than midwives, live in the hard-to-reach areas, and are integrated in the community and well connected with midwives. Auxiliary midwives generally reported that their training involved instruction on active management of the third stage of labour, including use of misoprostol, but not all auxiliary midwives reported using misoprostol in practice. Supportive reasons for task-shifting administration of oral misoprostol to auxiliary midwives included discussions around the good relationship and trust between auxiliary midwives and midwives, whereby midwives felt

Response-only method for damage detection of beam-like structures using high accuracy frequencies with auxiliary mass spatial probing

Science.gov (United States)

Zhong, Shuncong; Oyadiji, S. Olutunde; Ding, Kang

2008-04-01

This paper proposes a new approach based on auxiliary mass spatial probing using spectral centre correction method (SCCM), to provide a simple solution for damage detection by just using the response time history of beam-like structures. The natural frequencies of a damaged beam with a traversing auxiliary mass change due to change in the inertia of the beam as the auxiliary mass is traversed along the beam, as well as the point-to-point variations in the flexibility of the beam. Therefore the auxiliary mass can enhance the effects of the crack on the dynamics of the beam and, therefore, facilitate the identification and location of damage in the beam. That is, the auxiliary mass can be used to probe the dynamic characteristic of the beam by traversing the mass from one end of the beam to the other. However, it is impossible to obtain accurate modal frequencies by the direct operation of the fast Fourier transform (FFT) of the response data of the structure because the frequency spectrum can be only calculated from limited sampled time data which results in the well-known leakage effect. SCCM is identical to the energy centrobaric correction method (ECCM) which is a practical and effective method used in rotating mechanical fault diagnosis and which resolves the shortcoming of FFT and can provide high accuracy estimate of frequency, amplitude and phase. In the present work, the modal responses of damaged simply supported beams with auxiliary mass are computed using the finite element method (FEM). The graphical plots of the natural frequencies calculated by SCCM versus axial location of auxiliary mass are obtained. However, it is difficult to locate the crack directly from the curve of natural frequencies. A simple and fast method, the derivatives of natural frequency curve, is proposed in the paper which can provide crack information for damage detection of beam-like structures. The efficiency and practicability of the proposed method is illustrated via numerical

Terahertz-wave differential detection based on simultaneous dual-wavelength up-conversion

Directory of Open Access Journals (Sweden)

Yuma Takida

2017-03-01

Full Text Available We report a terahertz (THz-wave differential detection based on simultaneous dual-wavelength up-conversion in a nonlinear optical MgO:LiNbO3 crystal with optical and electronic THz-wave sources. The broadband parametric gain and noncollinear phase-matching of MgO:LiNbO3 provide efficient conversion from superposed THz waves to spatially distributed near-infrared (NIR beams to function as a dispersive THz-wave spectrometer without any additional dispersive element. We show that the μW-level THz waves from two independent sources, a 0.78-THz injection-seeded THz-wave parametric generator (is-TPG and a 1.14-THz resonant tunneling diode (RTD, are simultaneously up-converted to two NIR waves and then detected with two NIR photodetectors. By applying a balanced detection scheme to this dual-frequency detection, we demonstrate THz-wave differential imaging of maltose and polyethylene pellets in the transmission geometry. This dual-wavelength detection is applicable to more than three frequencies and broadband THz-wave radiation for real-time THz-wave spectroscopic detection and imaging.

Sampling general N-body interactions with auxiliary fields

Science.gov (United States)

Körber, C.; Berkowitz, E.; Luu, T.

2017-09-01

We present a general auxiliary field transformation which generates effective interactions containing all possible N-body contact terms. The strength of the induced terms can analytically be described in terms of general coefficients associated with the transformation and thus are controllable. This transformation provides a novel way for sampling 3- and 4-body (and higher) contact interactions non-perturbatively in lattice quantum Monte Carlo simulations. As a proof of principle, we show that our method reproduces the exact solution for a two-site quantum mechanical problem.

75 FR 3639 - Revisions to Rules Authorizing the Operation of Low Power Auxiliary Stations in the 698-806 MHz...

Science.gov (United States)

2010-01-22

.... 10-24; DA 10-92] Revisions to Rules Authorizing the Operation of Low Power Auxiliary Stations in the... Auxiliary Stations, Including Wireless Microphones, and the Digital Television Transition AGENCY: Federal... language that must be used in the consumer disclosure that is required by Section 15.216 of Appendix B in...

Design of an increase in the CNAAA unit I South auxiliary building

International Nuclear Information System (INIS)

Lorentz, R.G.; Loyola Benedicto Ottoni, I. de; Roech, J.L.

1990-01-01

In this work it is presented the description of the model adopted in the structural calculations for a modification in the CNAAA Unit I South Auxiliary Building. This modification intended to increase the facilities destinated to keeping and changing of special clothing for access to the controlled area. The design basically constitutes of a slab at the Elevation 5,15m, for which a tridimensional frame model was adopted, in reinforced adopted concrete, fixed in the South Auxiliary Building foundation slab and structurally independent on the building, at the slab level. It was demonstrated in this study that the introduction, in the existing structure, of the masses of this enlarged area does not considerably change the dynamic behaviour of the building, which allowed proceeding the analysis of the new structure independently of the existing one. (author)

Circuit QED: generation of two-transmon-qutrit entangled states via resonant interaction

Science.gov (United States)

Ye, Xi-Mei; Zheng, Zhen-Fei; Lu, Dao-Ming; Yang, Chui-Ping

2018-04-01

We present a way to create entangled states of two superconducting transmon qutrits based on circuit QED. Here, a qutrit refers to a three-level quantum system. Since only resonant interaction is employed, the entanglement creation can be completed within a short time. The degree of entanglement for the prepared entangled state can be controlled by varying the weight factors of the initial state of one qutrit, which allows the prepared entangled state to change from a partially entangled state to a maximally entangled state. Because a single cavity is used, only resonant interaction is employed, and none of identical qutrit-cavity coupling constant, measurement, and auxiliary qutrit is needed, this proposal is easy to implement in experiments. The proposal is quite general and can be applied to prepare a two-qutrit partially or maximally entangled state with two natural or artificial atoms of a ladder-type level structure, coupled to an optical or microwave cavity.

Increasing the mode-locking efficiency of a cw solid-state laser with an auxiliary cavity

International Nuclear Information System (INIS)

Kalashnikov, V.L.; Kalosha, V.P.; Mikhailov, V.P.; Demchuk, M.I.

1992-01-01

It is predicted theoretically that the efficiency of self-mode locking can be raised by means of a bleachable shutter in the main cavity or an auxiliary cavity. The laser emits a stable train of ultrashort pulses under these conditions. The theory is based on a fluctuation model of the operation of a cw solid-state laser with a linear auxiliary cavity. The increase in efficiency involves a broadening of the region of parameter values of the system in which self-mode locking occurs, a significant decrease in the threshold pump intensity, and a reduced sensitivity of the operation to the phase mismatch of the lengths of the cavities. It is shown, for the first time, that a stable train of double ultrashort pulses can be generated by a system with a shutter in the auxiliary cavity. It is also shown that a self-mode locking is possible in the case in which there is a phase mismatch of the cavity lengths and there is no phase self-modulation in the main cavity. 15 refs., 8 figs

Magnetic Resonance Imaging of Alimentary Tract Development in Manduca sexta.

Directory of Open Access Journals (Sweden)

Ian J Rowland

Full Text Available Non-invasive 3D magnetic resonance imaging techniques were used to investigate metamorphosis of the alimentary tract of Manduca sexta from the larval to the adult stage. The larval midgut contracts in volume immediately following cessation of feeding and then greatly enlarges during the late pharate pupal period. Magnetic resonance imaging revealed that the foregut and hindgut of the pharate pupa undergo ecdysis considerably earlier than the external exoskeleton. Expansion of air sacs in the early pupa and development of flight muscles several days later appear to orient the midgut into its adult position in the abdomen. The crop, an adult auxiliary storage organ, begins development as a dorsal outgrowth of the foregut. This coincides with a reported increase in pupal ecdysteroid titers. An outgrowth of the hindgut, the rectal sac, appears several days later and continues to expand until it nearly fills the dorsal half of the abdominal cavity. This development correlates with a second rise in pupal ecdysteroid titers. In the pharate pupa, the presence of paramagnetic species renders the silk glands hyperintense.

An analytic method for S-expansion involving resonance and reduction

Energy Technology Data Exchange (ETDEWEB)

Ipinza, M.C.; Penafiel, D.M. [Departamento de Fisica, Universidad de Concepcion (Chile); DISAT, Politecnico di Torino (Italy); Istituto Nazionale di Fisica Nucleare (INFN), Sezione di Torino (Italy); Lingua, F. [DISAT, Politecnico di Torino (Italy); Ravera, L. [DISAT, Politecnico di Torino (Italy); Istituto Nazionale di Fisica Nucleare (INFN), Sezione di Torino (Italy)

2016-11-15

In this paper we describe an analytic method able to give the multiplication table(s) of the set(s) involved in an S-expansion process (with either resonance or 0{sub S}-resonant-reduction) for reaching a target Lie (super)algebra from a starting one, after having properly chosen the partitions over subspaces of the considered (super)algebras. This analytic method gives us a simple set of expressions to find the subset decomposition of the set(s) involved in the process. Then, we use the information coming from both the initial (super)algebra and the target one for reaching the multiplication table(s) of the mentioned set(s). Finally, we check associativity with an auxiliary computational algorithm, in order to understand whether the obtained set(s) can describe semigroup(s) or just abelian set(s) connecting two (super)algebras. We also give some interesting examples of application, which check and corroborate our analytic procedure and also generalize some result already presented in the literature. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

The Quantum N-Body Problem and the Auxiliary Field Method

International Nuclear Information System (INIS)

Semay, C.; Buisseret, F.; Silvestre-Brac, B.

2011-01-01

Approximate analytical energy formulas for N-body semirelativistic Hamiltonians with one- and two-body interactions are obtained within the framework of the auxiliary field method. We first review the method in the case of nonrelativistic two-body problems. A general procedure is then given for N-body systems and applied to the case of baryons in the large-N c limit. (author)

Characterization of liver lesions with mangafodipir trisodium-enhanced MR imaging: multicenter study comparing MR and dual-phase spiral CT

NARCIS (Netherlands)

M. Oudkerk (Matthijs); C.G. Torres; B. Song; M. Konig; J. Grimm; J. Fernandez-Cuadrado; B. op de Beeck; M. Marquardt; P. van Dijk (Pieter); J.C. de Groot (Jan Cees)

2002-01-01

textabstractPURPOSE: To evaluate whether mangafodipir trisodium (Mn-DPDP)-enhanced magnetic resonance (MR) imaging surpasses dual-phase spiral computed tomography (CT) in differentiating focal liver lesions. MATERIALS AND METHODS: One hundred forty-five patients who had or were

Investigation of New Microstrip Bandpass Filter Based on Patch Resonator with Geometrical Fractal Slot.

Directory of Open Access Journals (Sweden)

Yaqeen S Mezaal

Full Text Available A compact dual-mode microstrip bandpass filter using geometrical slot is presented in this paper. The adopted geometrical slot is based on first iteration of Cantor square fractal curve. This filter has the benefits of possessing narrower and sharper frequency responses as compared to microstrip filters that use single mode resonators and traditional dual-mode square patch resonators. The filter has been modeled and demonstrated by Microwave Office EM simulator designed at a resonant frequency of 2 GHz using a substrate of εr = 10.8 and thickness of h = 1.27 mm. The output simulated results of the proposed filter exhibit 22 dB return loss, 0.1678 dB insertion loss and 12 MHz bandwidth in the passband region. In addition to the narrow band gained, miniaturization properties as well as weakened spurious frequency responses and blocked second harmonic frequency in out of band regions have been acquired. Filter parameters including insertion loss, return loss, bandwidth, coupling coefficient and external quality factor have been compared with different values of perturbation dimension (d. Also, a full comparative study of this filter as compared with traditional square patch filter has been considered.

Computer determination of event maps with application to auxiliary supply systems

International Nuclear Information System (INIS)

Wredenberg, L.; Billinton, R.

1975-01-01

A method of evaluating the reliability of sequential operations in systems containing standby and alternate supply facilities is presented. The method is based upon the use of a digital computer for automatic development of event maps. The technique is illustrated by application to a nuclear power plant auxiliary supply system. (author)

Dual-band and high-efficiency polarization converter based on metasurfaces at microwave frequencies

Science.gov (United States)

Liu, Yajun; Xia, Song; Shi, Hongyu; Zhang, Anxue; Xu, Zhuo

2016-06-01

We present a dual-band and high-efficiency polarization converter in microwave regime. The proposed converter can convert a linearly polarized wave to its cross-polarized wave for two distinct bands: Ku (11.5-20.0 GHz) and Ka (28.8-34.0 GHz). It can also convert the linearly polarized wave to a circularly polarized wave at four other frequencies. The experimental results are in good agreement with simulation results for both frequency bands. The polarization conversion ratio is above 0.94 for the Ku-band and 0.90 for the Ka-band. Furthermore, the converter can achieve dual-band and high-efficiency polarization conversion over angles of incidence up to 45°. The converter is also polarization-selective in that only the x- and y-polarized waves can be converted. The physical mechanism of the dual-band polarization conversion effect is interpreted via decomposed electric field components that couple with different plasmon resonance modes of the structure.

The auxiliary field method and approximate analytical solutions of the Schroedinger equation with exponential potentials

Energy Technology Data Exchange (ETDEWEB)

Silvestre-Brac, Bernard [LPSC Universite Joseph Fourier, Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, Avenue des Martyrs 53, F-38026 Grenoble-Cedex (France); Semay, Claude; Buisseret, Fabien [Groupe de Physique Nucleaire Theorique, Universite de Mons-Hainaut, Academie universitaire Wallonie-Bruxelles, Place du Parc 20, B-7000 Mons (Belgium)], E-mail: silvestre@lpsc.in2p3.fr, E-mail: claude.semay@umh.ac.be, E-mail: fabien.buisseret@umh.ac.be

2009-06-19

The auxiliary field method is a new and efficient way to compute approximate analytical eigenenergies of the Schroedinger equation. This method has already been successfully applied to the case of central potentials of power-law and logarithmic forms. In the present work, we show that the Schroedinger equation with exponential potentials of the form -{alpha}r{sup {lambda}}exp(-{beta}r) can also be analytically solved by using the auxiliary field method. Closed formulae giving the critical heights and the energy levels of these potentials are presented. Special attention is drawn to the Yukawa potential and the pure exponential potential.

The auxiliary field method and approximate analytical solutions of the Schroedinger equation with exponential potentials

International Nuclear Information System (INIS)

Silvestre-Brac, Bernard; Semay, Claude; Buisseret, Fabien

2009-01-01

The auxiliary field method is a new and efficient way to compute approximate analytical eigenenergies of the Schroedinger equation. This method has already been successfully applied to the case of central potentials of power-law and logarithmic forms. In the present work, we show that the Schroedinger equation with exponential potentials of the form -αr λ exp(-βr) can also be analytically solved by using the auxiliary field method. Closed formulae giving the critical heights and the energy levels of these potentials are presented. Special attention is drawn to the Yukawa potential and the pure exponential potential

Non-Toxic Dual Thrust Reaction Control Engine Development for On-Orbit APS Applications

Science.gov (United States)

Robinson, Philip J.; Veith, Eric M.

2003-01-01

A non-toxic dual thrust proof-of-concept demonstration engine was successfully tested at the Aerojet Sacramento facility under a technology contract sponsored by the National Aeronautics and Space Administration's (NASA) Marshall Space Flight Center (MSFC). The goals of the NASA MSFC contract (NAS8-01109) were to develop and expand the technical maturity of a non-toxic, on-orbit auxiliary propulsion system (APS) thruster under the Next Generation Launch Technology (NGLT) program. The demonstration engine utilized the existing Kistler K-1 870 lbf LOX/Ethanol orbital maneuvering engine ( O m ) coupled with some special test equipment (STE) that enabled engine operation at 870 lbf in the primary mode and 25 lbf in the vernier mode. Ambient testing in primary mode varied mixture ratio (MR) from 1.28 to 1.71 and chamber pressure (P(c) from 110 to 181 psia, and evaluated electrical pulse widths (EPW) of 0.080, 0.100 and 0.250 seconds. Altitude testing in vernier mode explored igniter and thruster pulsing characteristics, long duration steady state operation (greater than 420 sec) and the impact of varying the percent fuel film cooling on vernier performance and chamber thermal response at low PC (4 psia). Data produced from the testing provided calibration of the performance and thermal models used in the design of the next version of the dual thrust Reaction Control Engine (RCE).

Simultaneous live cell imaging using dual FRET sensors with a single excitation light.

Directory of Open Access Journals (Sweden)

Yusuke Niino

Full Text Available Fluorescence resonance energy transfer (FRET between fluorescent proteins is a powerful tool for visualization of signal transduction in living cells, and recently, some strategies for imaging of dual FRET pairs in a single cell have been reported. However, these necessitate alteration of excitation light between two different wavelengths to avoid the spectral overlap, resulting in sequential detection with a lag time. Thus, to follow fast signal dynamics or signal changes in highly motile cells, a single-excitation dual-FRET method should be required. Here we reported this by using four-color imaging with a single excitation light and subsequent linear unmixing to distinguish fluorescent proteins. We constructed new FRET sensors with Sapphire/RFP to combine with CFP/YFP, and accomplished simultaneous imaging of cAMP and cGMP in single cells. We confirmed that signal amplitude of our dual FRET measurement is comparable to of conventional single FRET measurement. Finally, we demonstrated to monitor both intracellular Ca(2+ and cAMP in highly motile cardiac myocytes. To cancel out artifacts caused by the movement of the cell, this method expands the applicability of the combined use of dual FRET sensors for cell samples with high motility.

A plug’n’play WiFi surface-mount dual-loop antenna

Directory of Open Access Journals (Sweden)

Pedro Chamorro-Posada

2017-04-01

Full Text Available We present the design, modelling and characterization in the 2.4 GHz band of a B-shaped antenna consisting of a dual circular loop over a conductor plane. The proposed design is intrinsically unbalanced and features a very good match to a 50 Ω line at resonance, which makes our device essentially plug’n’play for a coaxial cable feed. Another interesting property of the proposed antenna is its simplicity of construction. The antenna has been modelled using the moment method. A prototype resonant at 2.4 GHz has been built and we have measured its impedance in this spectral region. The radiation pattern and the gain at resonance have also been characterized and the device has been shown to provide 6.31 dBi gain. The overall properties of the device make it an excellent option to provide WiFi connectivity when required in open hardware implementations.

A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

Science.gov (United States)

Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza

2008-01-01

AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.

A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

International Nuclear Information System (INIS)

Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza

2008-01-01

AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency

A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

Energy Technology Data Exchange (ETDEWEB)

Heydari, Hossein; Faghihi, Faramarz; Aligholizadeh, Reza [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)

2008-01-15

AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency.

Introduction to deaerator in auxiliary water supply system of nuclear power plant

International Nuclear Information System (INIS)

Dong Jianguo; Zhou Xia; Lei Yongxia

2015-01-01

The paper introduces the operation theory and thermal calculation and verification requirements for the deaerator in the auxiliary water supply system of nuclear power plant. In addition, it describes the key factors in terms of function, structure, design and fabrication of equipment. (authors)

Harbingers of Artin's Reciprocity Law. I. The Continuing Story of Auxiliary Primes

OpenAIRE

Lemmermeyer, Franz

2011-01-01

In this article we present the history of auxiliary primes used in proofs of reciprocity laws from the quadratic to Artin's reciprocity law. We also show that the gap in Legendre's proof can be closed with a simple application of Gauss's genus theory.

Polymer dual ring resonators for label-free optical biosensing using microfluidics.

Science.gov (United States)

Salleh, Muhammad H M; Glidle, Andrew; Sorel, Marc; Reboud, Julien; Cooper, Jonathan M

2013-04-18

We demonstrate a polymer resonator microfluidic biosensor that overcomes the complex manufacturing procedures required to fabricate traditional devices. In this new format, we show that a gapless light coupling photonic configuration, fabricated in SU8 polymer, can achieve high sensitivity, label-free chemical sensing in solution and high sensitivity biological sensing, at visible wavelengths.

National Ignition Facility subsystem design requirements target area auxiliary subsystem SSDR 1.8.6

International Nuclear Information System (INIS)

Reitz, T.

1996-01-01

This Subsystem Design Requirement (SSDR) establishes the performance, design, development, and test requirements for the Target Area Auxiliary Subsystems (WBS 1.8.6), which is part of the NIF Target Experimental System (WBS 1.8). This document responds directly to the requirements detailed in NIF Target Experimental System SDR 003 document. Key elements of the Target Area Auxiliary Subsystems include: WBS 1.8.6.1 Local Utility Services; WBS 1.8.6.2 Cable Trays; WBS 1.8.6.3 Personnel, Safety, and Occupational Access; WBS 1.8.6.4 Assembly, Installation, and Maintenance Equipment; WBS 1.8.6.4.1 Target Chamber Service System; WBS 1.8.6.4.2 Target Bay Service Systems

Research on vibration properties of auxiliary bearing cage used in HTR-10 GT project

International Nuclear Information System (INIS)

Qin Qingquan; Yang Guojun; Shi Zhengang; Yu Suyuan

2009-01-01

Auxiliary Bearings (ABs) is one of the most important parts in Active Magnetic Bearing (AMB) system, which was used in HTR-10 GT project. This paper uses finite element method to analyze the centrifugal stress and free vibration properties of the cage according to its work condition. And different geometric parameters of the cage that has effects on its vibration performance are discussed. The results show that the highest centrifugal stress is in the middle of the cage side sill. The low odder vibration modes of the cage can be induced when the auxiliary bearings are working. Proper geometric parameters and ball pocket number can enhance the performance of the cage. (authors)

Surgical nurse: his leadership style with nursing auxiliary personnel

OpenAIRE

Galvão, Cristina Maria; Trevizan, Maria Auxiliadora; Okino Sawada, Namie

2008-01-01

This investigation as carried out in order to promote follow-up in the studies concerning nurse`s leadership in the hospital context. Emphasys is given to the nurses that works in surgical ward unities. As a theoretical framework, authors utilized the model of leadership proposed by Hersey na Blanchard, named Situational Leadership. The objective was to analyze the correspondence of opinion between nurses and nursing auxiliary personnel about the leadership style of nurse should adopt in acco...

Solar combisystems with forecast control to increase the solar fraction and lower the auxiliary energy cost

DEFF Research Database (Denmark)

Perers, Bengt; Furbo, Simon; Fan, Jianhua

2011-01-01

Solar Combi systems still need quite a lot of auxiliary energy especially in small systems without seasonal storage possibilities. The control of the auxiliary energy input both in time and power is important to utilize as much as possible of the solar energy available from the collectors and also...... energy sources. It can be either direct electric heating elements or a heat pump upgrading ambient energy in the air, ground, solar collector or waste heat from the house. The paper describes system modeling and simulation results. Advanced laboratory experiments are also starting now with three...

Effect of the small-scale auxiliary laser spots on the 3ω0/2 harmonic emission

International Nuclear Information System (INIS)

Lin, Z.; Zhang, H.; He, X.; Lin, K.; Wang, X.; Zhuang, Y.; Wang, L.; Wei, X.; Lu, Q.; Shi, A.; Dai, M.; Tian, L.; Fan, G.; Li, J.

1992-01-01

Experiments have shown that a single 10-μm-radius laser spot is not able to produce the 90 degree side-emitted 3/2 harmonic efficiently in a preformed laser plasma. However, with the help of one or two auxiliary laser spots with a size similar to that of the main spot, the side-emitted 3/2 harmonic can frequently be detected when some positional and angular conditions for the auxiliary spots are met. The origin of these phenomena has been analyzed in terms of a proposed reflected laser photon-coupling model

Exact fluctuations of nonequilibrium steady states from approximate auxiliary dynamics

OpenAIRE

Ray, Ushnish; Chan, Garnet Kin-Lic; Limmer, David T.

2017-01-01

We describe a framework to significantly reduce the computational effort to evaluate large deviation functions of time integrated observables within nonequilibrium steady states. We do this by incorporating an auxiliary dynamics into trajectory based Monte Carlo calculations, through a transformation of the system's propagator using an approximate guiding function. This procedure importance samples the trajectories that most contribute to the large deviation function, mitigating the exponenti...

Development of an ESR/MR dual-imaging system as a tool to detect bioradicals

International Nuclear Information System (INIS)

Fujii, Hirotada; Aoki, Masaaki; Haishi, Tomoyuki; Itoh, Kouichi; Sakata, Motomichi

2006-01-01

A system combining electron spin resonance imaging (ESRI) with another imaging modality capable of enabling visualization of the distribution of bioradicals on an anatomical map of the specimens would be a superior biomedical imaging system. We describe the development of an electron spin resonance ESR/MR dual-imaging system with one permanent magnet and the biomedical applications of this system. The magnetic circuit developed for the ESR/MR dual-imaging system consisted of the permanent magnet made of Fe-Nd-B, pole pieces, and poke. The permanent magnet was installed on the MR side only, and the ESR side was made of pole pieces only. The magnetic field was adjusted to 0.5T at MR and to 0.042T at ESR. The overall dimensions of the magnet developed for the ESR/MR imaging system were 460 (W) x 440 (D) x 460 (H) mm, and it weighed 220 kg. The distance of each center for the magnet for ESR and MR imaging could be set as close as 200 mm. The entire ESR/MR imaging system can be installed in a common laboratory without magnetic shielding. MR images of plants (myoga) and small animals (mice and rats) were successfully acquired with or without ESR operation. ESR spectra of nitroxyl spin probes were also measured, even with MRI operation. ESR signals of triarylmethyl derivatives with narrow line-width (0.026 mT) were observed in living mice while MRI was operating. The ESR/MR imaging dual functions work properly with no electric or magnetic interference. The ESR/MR dual images demonstrate that this system enables visualization of the distribution of bioradicals on the anatomical map of the object. (author)

Scope and Limitations of Auxiliary-Assisted, Palladium-Catalyzed Arylation and Alkylation of sp2 and sp3 C-H Bonds

Science.gov (United States)

Nadres, Enrico T.; Santos, Gerson Ivan Franco; Shabashov, Dmitry; Daugulis, Olafs

2013-01-01

The scope of palladium-catalyzed, auxiliary-assisted direct arylation and alkylation of sp2 and sp3 C-H bonds of amine and carboxylic acid derivatives has been investigated. The method employs a palladium acetate catalyst, substrate, aryl, alkyl, benzyl, or allyl halide, and inorganic base in t-amyl alcohol or water solvent at 100-140 °C. Aryl and alkyl iodides as well as benzyl and allyl bromides are competent reagents in this transformation. Picolinic acid auxiliary is used for amine γ-functionalization and 8-aminoquinoline auxiliary is used for carboxylic acid β-functionalization. Some optimization of base, additives, and solvent is required for achieving best results. PMID:24090404

Steady state flow evaluations for passive auxiliary feedwater system of APR

International Nuclear Information System (INIS)

Park, Jongha; Kim, Jaeyul; Seong, Hoje; Kang, Kyoungho

2012-01-01

This paper briefly introduces a methodology to evaluate steady state flow of APR+ Passive Auxiliary Feedwater System (PAFS). The PAFS is being developed as a safety grade passive system to completely replace the existing active Auxiliary Feedwater System (AFWS). Natural circulation cooling can be generally classified into the single-phase, two-phase, and boiling-condensation modes. The PAF is designed to be operated in a boiling-condensation natural circulation mode. The steady-state flow rate should be equal to the steady-state boiling/condensation rate determined by the steady-state energy and momentum balances in the PAFS. The determined steady-state flow rate can be used in the design optimization for the natural circulation loop of the PAFS through the steady-state momentum balance. Since the retarding force, which is to be balanced by the driving force in the natural circulation system design depends on the reliable evaluation of the success of a natural circulation system design depends on the reliable evaluation of the pressure loss coefficients. In PAFS, the core decay heat is released by natural circulation flow between the S G secondary side and the Passive Condensation Heat Exchanger (PCHX) that is immersed in the Passive Condensation Cooling Tank (PCCT). The PCCT is located on the top of Auxiliary building The driving force is determined by the difference between the S/G (heat Source) secondary water level and condensation liquid (heat sink) level. It will overcome retarding force at flowrate in the system, which is determined by vaporization and condensation of the steam which is generated at the S/G by the latent heat in system. In this study, the theoretical method to estimate the steady state flow rate in boiling-condensation natural circulation system is developed and compared with test results

Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

Science.gov (United States)

Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

2014-01-01

While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

Engineering the CernVM-Filesystem as a High Bandwidth Distributed Filesystem for Auxiliary Physics Data

Energy Technology Data Exchange (ETDEWEB)

Dykstra, D. [Fermilab; Bockelman, B. [Nebraska U.; Blomer, J. [CERN; Herner, K. [Fermilab; Levshina, T. [Fermilab; Slyz, M. [Fermilab

2015-12-23

A common use pattern in the computing models of particle physics experiments is running many distributed applications that read from a shared set of data files. We refer to this data is auxiliary data, to distinguish it from (a) event data from the detector (which tends to be different for every job), and (b) conditions data about the detector (which tends to be the same for each job in a batch of jobs). Relatively speaking, conditions data also tends to be relatively small per job where both event data and auxiliary data are larger per job. Unlike event data, auxiliary data comes from a limited working set of shared files. Since there is spatial locality of the auxiliary data access, the use case appears to be identical to that of the CernVM- Filesystem (CVMFS). However, we show that distributing auxiliary data through CVMFS causes the existing CVMFS infrastructure to perform poorly. We utilize a CVMFS client feature called 'alien cache' to cache data on existing local high-bandwidth data servers that were engineered for storing event data. This cache is shared between the worker nodes at a site and replaces caching CVMFS files on both the worker node local disks and on the site's local squids. We have tested this alien cache with the dCache NFSv4.1 interface, Lustre, and the Hadoop Distributed File System (HDFS) FUSE interface, and measured performance. In addition, we use high-bandwidth data servers at central sites to perform the CVMFS Stratum 1 function instead of the low-bandwidth web servers deployed for the CVMFS software distribution function. We have tested this using the dCache HTTP interface. As a result, we have a design for an end-to-end high-bandwidth distributed caching read-only filesystem, using existing client software already widely deployed to grid worker nodes and existing file servers already widely installed at grid sites. Files are published in a central place and are soon available on demand throughout the grid and cached

Engineering the CernVM-Filesystem as a High Bandwidth Distributed Filesystem for Auxiliary Physics Data

Science.gov (United States)

Dykstra, D.; Bockelman, B.; Blomer, J.; Herner, K.; Levshina, T.; Slyz, M.

2015-12-01

A common use pattern in the computing models of particle physics experiments is running many distributed applications that read from a shared set of data files. We refer to this data is auxiliary data, to distinguish it from (a) event data from the detector (which tends to be different for every job), and (b) conditions data about the detector (which tends to be the same for each job in a batch of jobs). Relatively speaking, conditions data also tends to be relatively small per job where both event data and auxiliary data are larger per job. Unlike event data, auxiliary data comes from a limited working set of shared files. Since there is spatial locality of the auxiliary data access, the use case appears to be identical to that of the CernVM- Filesystem (CVMFS). However, we show that distributing auxiliary data through CVMFS causes the existing CVMFS infrastructure to perform poorly. We utilize a CVMFS client feature called "alien cache" to cache data on existing local high-bandwidth data servers that were engineered for storing event data. This cache is shared between the worker nodes at a site and replaces caching CVMFS files on both the worker node local disks and on the site's local squids. We have tested this alien cache with the dCache NFSv4.1 interface, Lustre, and the Hadoop Distributed File System (HDFS) FUSE interface, and measured performance. In addition, we use high-bandwidth data servers at central sites to perform the CVMFS Stratum 1 function instead of the low-bandwidth web servers deployed for the CVMFS software distribution function. We have tested this using the dCache HTTP interface. As a result, we have a design for an end-to-end high-bandwidth distributed caching read-only filesystem, using existing client software already widely deployed to grid worker nodes and existing file servers already widely installed at grid sites. Files are published in a central place and are soon available on demand throughout the grid and cached locally on the

STARTER-GENERATOR SYSTEM FOR AUXILIARY POWER UNIT

Directory of Open Access Journals (Sweden)

A. V. Levin

2017-01-01

Full Text Available The article presents a starter-generator system for an auxiliary power unit of an aircraft. A feature of the presented system is the use of a synchronous generator with excitation from permanent magnets and a semiconductor converter. The main problem of the system is the generation of electric energy of an aircraft on the basis of a synchronous generator with excitation from permanent magnets is the absence of the possibility of regulating the voltage and frequency of electrical energy, in this connection, a semiconductor converter that ensures the conversion of generated electric energy with significant mass-dimensions characteristics.The article proposes an approach to designing a starter-generator system with a parallel connection of a synchronous generator with excitation from permanent magnets and a semiconductor converter. This approach makes it possible to significantly reduce the part of the electrical energy that needs to be converted, as a consequence, the semiconductor converter has significantly smaller mass-and-batch characteristics.In the article the modes of generation of electric energy and the starter mode of operation of the starter-generator system are considered in detail, the circuit realization of the semiconductor converter is shown. A scheme for replacing one phase of the system for generating electric energy and calculating electric parameters is presented.The possibility of creating a highly efficient starter-generator system based on a synchronous generator with excitation from permanent magnets and a semiconductor converter for an auxiliary power plant of aircrafts is shown. Structural and basic schemes for constructing a system for generating electrical energy are proposed. The approach to the choice of rational circuit solutions is substantiated, basic estimates of the electrical parameters of the system are obtained. The possibility of achieving a specific mass of a semiconductor converter for synchronous

pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

Directory of Open Access Journals (Sweden)

Sidan Tian

2016-06-01

Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

Ignition and burn propagation with suprathermal electron auxiliary heating

International Nuclear Information System (INIS)

Han Shensheng; Wu Yanqing

2000-01-01

The rapid development in ultrahigh-intensity lasers has allowed the exploration of applying an auxiliary heating technique in inertial confinement fusion (ICF) research. It is hoped that, compared with the 'standard fast ignition' scheme, raising the temperature of a hot-spot over the ignition threshold based on the shock-heated temperature will greatly reduce the required output energy of an ignition ultrahigh-intensity pulse. One of the key issues in ICF auxiliary heating is: how can we transport the exogenous energy efficiently into the hot-spot of compressed DT fuel? A scheme is proposed with three phases. First, a partial-spherical-shell capsule, such as double-conical target, is imploded as in the conventional approach to inertial fusion to assemble a high-density fuel configuration with a hot-spot of temperature lower than the ignition threshold. Second, a hole is bored through the shell outside the hot-spot by suprathermal electron explosion boring. Finally, the fuel is ignited by suprathermal electrons produced in the high-intensity ignition laser-plasma interactions. Calculations with a simple hybrid model show that the new scheme can possibly lead to ignition and burn propagation with a total drive energy of a few tens of kilojoules and an output energy as low as hundreds of joules for a single ignition ultrahigh-intensity pulse. (author)

Enantioselective preparation of 1,3-dithiane 1-oxides by asymmetric oxidation of 1,3-dithianes bearing a chiral auxiliary

OpenAIRE

Yoshihiko, Watanabe; Yojiro, Ono; Shigefumi, Hayashi; Yoshio, Ueno; Takeshi, Toru

1996-01-01

Oxidation of 1,3-dithianes bearing a chiral auxiliary derived from (+) or (-)-camphor or diacetone D-(+)-glucose by the Sharpless reagent [Ti(OPi)4-diethyl L-(+)- or D-(-)-tartrate-ButOOH] affords, with high stereoselectivity, the monosulfoxides in good to excellent yields. Removal of the chiral auxiliary by base-catalysed hydrolysis yields (R)- and (S)-1,3-dithiane 1-oxides in high yields.

Coupling effect and control strategies of the maglev dual-stage inertially stabilization system based on frequency-domain analysis.

Science.gov (United States)

Lin, Zhuchong; Liu, Kun; Zhang, Li; Zeng, Delin

2016-09-01

Maglev dual-stage inertially stabilization (MDIS) system is a newly proposed system which combines a conventional two-axis gimbal assembly and a 5-DOF (degree of freedom) magnetic bearing with vernier tilting capacity to perform dual-stage stabilization for the LOS of the suspended optical instrument. Compared with traditional dual-stage system, maglev dual-stage system exhibits different characteristics due to the negative position stiffness of the magnetic forces, which introduces additional coupling in the dual stage control system. In this paper, the coupling effect on the system performance is addressed based on frequency-domain analysis, including disturbance rejection, fine stage saturation and coarse stage structural resonance suppression. The difference between various control strategies is also discussed, including pile-up(PU), stabilize-follow (SF) and stabilize-compensate (SC). A number of principles for the design of a maglev dual stage system are proposed. A general process is also suggested, which leads to a cost-effective design striking a balance between high performance and complexity. At last, a simulation example is presented to illustrate the arguments in the paper. Copyright © 2016 ISA. Published by Elsevier Ltd. All rights reserved.

The rise and fall of the passive auxiliary weorðan and strict Verb-Second in the history of English

NARCIS (Netherlands)

Postma, G.J.; Los, Bettelou; de Haan, Pieter

2015-01-01

The rise and fall of the passive auxiliary weorðan (WERDEN) in the history of English is investigated. We provide a new structural analysis of why and in what languages the passive diathesis can / cannot use the copula BE as auxiliary. We will do so in a comparative perspective within Germanic and

30 CFR 18.22 - Boring-type machines equipped for auxiliary face ventilation.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Boring-type machines equipped for auxiliary..., DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC MOTOR-DRIVEN MINE EQUIPMENT AND ACCESSORIES Construction and Design Requirements § 18.22 Boring-type machines equipped for...

When you have too many features: Auxiliaries, agreement and clitics in Italian varieties

Directory of Open Access Journals (Sweden)

Roberta D'Alessandro

2017-05-01

Full Text Available Syntactic variation can be ascribed to a range of factors. The Borer-Chomsky conjecture, as Mark Baker (2008 refers to it, states for instance that all parameters of variation are attributable to differences in the features of particular items (e.g. functional heads in the lexicon. In this paper, this hypothesis is carefully considered in relation to a group of Abruzzese dialects that exhibit three seemingly unrelated syntactic patterns: split auxiliary selection, split differential object marking, and omnivorous participial agreement in number/argumental agreement mismatch marking. It will be proposed that these three patterns are closely interrelated, and can be attributed to the presence of an unvalued bundle of φ-features (π. Depending on which XP this head is merged with, different agreement patterns will emerge. Furthermore, these dialects will be shown to differ from another macrogroup of northern Italian dialects purely in the locus of Merge of this extra functional head: it will also be shown that the almost perfect areal complementary distribution between languages with subject clitics and languages with person-driven auxiliary selection is not accidental, but is the result of the presence of an extra φ-probe doubling the features of the subject in different parts of the syntactic spine. A microtypology of 'v 'will be presented, unifying many phenomena that were previously considered unrelated, such as auxiliary selection, participial agreement, differential object marking and subject clitics.

Evaluation of the pressure loads generated by hydrogen explosion in auxiliary nuclear building

International Nuclear Information System (INIS)

Ahmed Bentaib; Alexandre Bleyer; Pierre Pailhories; Jean-Pierre L'heriteau; Bernard Chaumont; Jerome Dupas; Jerome Riviere

2005-01-01

Full text of publication follows: In the framework of nuclear safety, a hydrogen leaks in the auxiliary nuclear building would raise a explosion hazard. A local ignition of the combustible mixture would give birth initially to a slow flame, rapidly accelerated by obstacles. This flame acceleration is responsible for high pressure loads that can damage the auxiliary building and destroy safety equipments in it. In this paper, we evaluate the pressure loads generated by an hydrogen explosion for both bounding and realistic explosion scenarios. The bounding scenarios use stoichiometric hydrogen-air mixtures and the realistic scenarios correspond to hydrogen leaks with mass flow rate varying between 1 g/s and 9 g/s. For every scenario, the impact of the ignition location and ignition time are investigated. The hydrogen dispersion and explosion are computed using the TONUS code. The dispersion model used is based on a finite element solver and the explosion is simulated by a structured finite volumes EULER equation solver and the combustion model CREBCOM which simulates the hydrogen/air turbulent flame propagation, taking into account 3D complex geometry and reactants concentration gradients. The pressure loads computed are then used to investigate the occurrence of a mechanical failure of the tanks located in the auxiliary nuclear building and containing radioactive fluids. The EUROPLEXUS code is used to perform 3D mechanical calculations because the loads are non uniform and of rather short deviation. (authors)

Comparative LCA of methanol-fuelled SOFCs as auxiliary power systems on-board ships

International Nuclear Information System (INIS)

Strazza, C.; Del Borghi, A.; Costamagna, P.; Traverso, A.; Santin, M.

2010-01-01

Fuel cells own the potential for significant environmental improvements both in terms of air quality and climate protection. Through the use of renewable primary energies, local pollutant and greenhouse gas emissions can be significantly minimized over the full life cycle of the electricity generation process, so that marine industry accounts renewable energy as its future energy source. The aim of this paper is to evaluate the use of methanol in Solid Oxide Fuel Cells (SOFC), as auxiliary power systems for commercial vessels, through Life Cycle Assessment (LCA). The LCA methodology allows the assessment of the potential environmental impact along the whole life cycle of the process. The unit considered is a 20 kWel fuel cell system. In a first part of the study different fuel options have been compared (methanol, bio-methanol, natural gas, hydrogen from cracking, electrolysis and reforming), then the operation of the cell fed with methanol has been compared with the traditional auxiliary power system, i.e. a diesel engine. The environmental benefits of the use of fuel cells have been assessed considering different impact categories. The results of the analysis show that fuel production phase has a strong influence on the life cycle impacts and highlight that feeding with bio-methanol represents a highly attractive solution from a life cycle point of view. The comparison with the conventional auxiliary power system shows extremely lower impacts for SOFCs.

Auxiliary en-bloc liver-small bowel transplantation with partial pancreas preservation in pigs

Institute of Scientific and Technical Information of China (English)

Zhen-Yu Yin; Xiao-Dong Ni; Feng Jiang; Ning Li; You-Sheng Li; Xiao-Ming Wang; Jie-Shou Li

2004-01-01

AIM: The aim of this study was to describe an auxiliary combined liver-small bowel transplantation model with the preservation of duodenum, head of pancreas and hepatic biliary system in pigs. The technique, feasibility, security and immunosuppression were commented.METHODS: Forty outbred long-white pigs were randomized into two groups, and the auxiliary composite liver/small bowel allotransplantations were undertaken in 10 long-white pigs in each group with the recipient liver preserved.Group A was not treated with immunosuppressive drugs while group B was treated with cyclosporine A and methylprednisolone after operation. The hemodynamic changes and amylase of body fluid (including blood, urine and abdominal drain) were analyzed.RESULTS: The average survival time of the animals was 10±1.929 d (6 to 25 d) in group A while more than 30 d in group B. The pigs could tolerate the hemodynamic fluctuation during operation and the hemodynamic parameters recovered to normal 2 h after blood reperfusion. The transient high amylase level was decreased to normal one week after operation and autopsy showed no pancreatitis.CONCLUSION: Auxiliary en-bloc liver-small bowel transplantation with partial pancreas preservation is a feasible and safe model with simplified surgical techniques for composite liver/small bowel transplantation. This model may be used as a preclinical training model for clinical transplantation method, clinical liver-small bowel transplantation related complication research, basic research including immunosuppressive treatment, organ preservation, acute rejection, chronic rejection, immuno-tolerance and xenotransplantation.

Modeling and stability analysis for the upper atmosphere research satellite auxiliary array switch component

Science.gov (United States)

Wolfgang, R.; Natarajan, T.; Day, J.

1987-01-01

A feedback control system, called an auxiliary array switch, was designed to connect or disconnect auxiliary solar panel segments from a spacecraft electrical bus to meet fluctuating demand for power. A simulation of the control system was used to carry out a number of design and analysis tasks that could not economically be performed with a breadboard of the hardware. These tasks included: (1) the diagnosis of a stability problem, (2) identification of parameters to which the performance of the control system was particularly sensitive, (3) verification that the response of the control system to anticipated fluctuations in the electrical load of the spacecraft was satisfactory, and (4) specification of limitations on the frequency and amplitude of the load fluctuations.

Tube Model Predictive Control with an Auxiliary Sliding Mode Controller

Directory of Open Access Journals (Sweden)

Miodrag Spasic

2016-07-01

Full Text Available This paper studies Tube Model Predictive Control (MPC with a Sliding Mode Controller (SMC as an auxiliary controller. It is shown how to calculate the tube widths under SMC control, and thus how much the constraints of the nominal MPC have to be tightened in order to achieve robust stability and constraint fulfillment. The analysis avoids the assumption of infinitely fast switching in the SMC controller.

Teaching Grammar: The Use of The English Auxiliary "BE" Present Tense Verb among Malaysian Form 4 and Form 5 Students

Science.gov (United States)

Jishvithaa, Joanna M.; Tabitha, M.; Kalajahi, Seyed Ali Rezvani

2013-01-01

This research paper aims to explore the usage of the English Auxiliary "Be" Present Tense Verb, using corpus based method among Malaysian form 4 and form 5 students. This study is conducted by identifying and classifying the types of errors in the Auxiliary "Be" Present Tense verb in students' compositions from the MCSAW corpus…

Histochemical demonstration of creatine kinase activity using polyvinyl alcohol and auxiliary enzymes

NARCIS (Netherlands)

Frederiks, W. M.; Marx, F.; van Noorden, C. J.

1987-01-01

Creatine kinase activity (EC 2.7.3.2.) has been demonstrated in myocardium and skeletal muscle from rats by a method based on the incubation of cryostat sections with a polyvinyl alcohol-containing medium and the use of auxiliary enzymes. Hexokinase and glucose-6-phosphate dehydrogenase were spread

Dual structure in the charge excitation spectrum of electron-doped cuprates

Science.gov (United States)

Bejas, Matías; Yamase, Hiroyuki; Greco, Andrés

2017-12-01

Motivated by the recent resonant x-ray scattering (RXS) and resonant inelastic x-ray scattering (RIXS) experiments for electron-doped cuprates, we study the charge excitation spectrum in a layered t -J model with the long-range Coulomb interaction. We show that the spectrum is not dominated by a specific type of charge excitations, but by different kinds of charge fluctuations, and is characterized by a dual structure in the energy space. Low-energy charge excitations correspond to various types of bond-charge fluctuations driven by the exchange term (J term), whereas high-energy charge excitations are due to usual on-site charge fluctuations and correspond to plasmon excitations above the particle-hole continuum. The interlayer coupling, which is frequently neglected in many theoretical studies, is particularly important to the high-energy charge excitations.

Estimating the spatial distribution of soil moisture based on Bayesian maximum entropy method with auxiliary data from remote sensing

Science.gov (United States)

Gao, Shengguo; Zhu, Zhongli; Liu, Shaomin; Jin, Rui; Yang, Guangchao; Tan, Lei

2014-10-01

Soil moisture (SM) plays a fundamental role in the land-atmosphere exchange process. Spatial estimation based on multi in situ (network) data is a critical way to understand the spatial structure and variation of land surface soil moisture. Theoretically, integrating densely sampled auxiliary data spatially correlated with soil moisture into the procedure of spatial estimation can improve its accuracy. In this study, we present a novel approach to estimate the spatial pattern of soil moisture by using the BME method based on wireless sensor network data and auxiliary information from ASTER (Terra) land surface temperature measurements. For comparison, three traditional geostatistic methods were also applied: ordinary kriging (OK), which used the wireless sensor network data only, regression kriging (RK) and ordinary co-kriging (Co-OK) which both integrated the ASTER land surface temperature as a covariate. In Co-OK, LST was linearly contained in the estimator, in RK, estimator is expressed as the sum of the regression estimate and the kriged estimate of the spatially correlated residual, but in BME, the ASTER land surface temperature was first retrieved as soil moisture based on the linear regression, then, the t-distributed prediction interval (PI) of soil moisture was estimated and used as soft data in probability form. The results indicate that all three methods provide reasonable estimations. Co-OK, RK and BME can provide a more accurate spatial estimation by integrating the auxiliary information Compared to OK. RK and BME shows more obvious improvement compared to Co-OK, and even BME can perform slightly better than RK. The inherent issue of spatial estimation (overestimation in the range of low values and underestimation in the range of high values) can also be further improved in both RK and BME. We can conclude that integrating auxiliary data into spatial estimation can indeed improve the accuracy, BME and RK take better advantage of the auxiliary

Acute vertebral fracture after spinal fusion: a case report illustrating the added value of single-source dual-energy computed tomography to magnetic resonance imaging in a patient with spinal Instrumentation

International Nuclear Information System (INIS)

Fuchs, M.; Putzier, M.; Pumberger, M.; Hermann, K.G.; Diekhoff, T.

2016-01-01

Magnetic resonance imaging (MRI) is degraded by metal-implant-induced artifacts when used for the diagnostic assessment of vertebral compression fractures in patients with instrumented spinal fusion. Dual-energy computed tomography (DECT) offers a promising supplementary imaging tool in these patients. This case report describes an 85-year-old woman who presented with a suspected acute vertebral fracture after long posterior lumbar interbody fusion. This is the first report of a vertebral fracture that showed bone marrow edema on DECT; however, edema was missed by an MRI STIR sequence owing to metal artifacts. Bone marrow assessment using DECT is less susceptible to metal artifacts than MRI, resulting in improved visualization of vertebral edema in the vicinity of fused vertebral bodies. (orig.)

Derived Requirements for Double Shell Tank (DST) High Level Waste (HLW) Auxiliary Solids Mobilization

Energy Technology Data Exchange (ETDEWEB)

TEDESCHI, A.R.

2000-02-28

The potential need for auxiliary double-shell tank waste mixing and solids mobilization requires an evaluation of optional technologies. This document formalizes those operating and design requirements needed for further engineering evaluations.

Derived Requirements for Double-Shell Tank (DST) High Level Waste (HLW) Auxiliary Solids Mobilization

International Nuclear Information System (INIS)

TEDESCHI, A.R.

2000-01-01

The potential need for auxiliary double-shell tank waste mixing and solids mobilization requires an evaluation of optional technologies. This document formalizes those operating and design requirements needed for further engineering evaluations

Gastrin-releasing peptide receptor-targeted gadolinium oxide-based multifunctional nanoparticles for dual magnetic resonance/fluorescent molecular imaging of prostate cancer

Directory of Open Access Journals (Sweden)

Cui DT

2017-09-01

Full Text Available Danting Cui,1 Xiaodan Lu,1 Chenggong Yan,1 Xiang Liu,1 Meirong Hou,1 Qi Xia,2 Yikai Xu,1 Ruiyuan Liu2,3 1Department of Medical Imaging Center, Nanfang Hospital, Southern Medical University, Guangzhou, People’s Republic of China; 2School of Pharmaceutical Sciences, Southern Medical University, Guangzhou, People’s Republic of China; 3School of Biomedical Engineering, Southern Medical University, Guangzhou, People’s Republic of China Abstract: Bombesin (BBN, an analog of gastrin-releasing peptide (GRP, specifically binds to GRP receptors, which are overexpressed in human prostate cancer (PC. Here, we synthesized a BBN-modified gadolinium oxide (Gd2O3 nanoprobe containing fluorescein (Gd2O3-5(6-carboxyfluorescein [FI]-polyethylene glycol [PEG]-BBN for targeted magnetic resonance (MR/optical dual-modality imaging of PC. The Gd2O3-FI-PEG-BBN nanoparticles exhibited a relatively uniform particle size with an average diameter of 52.3 nm and spherical morphology as depicted by transmission electron microscopy. The longitudinal relaxivity (r1 of Gd2O3-FI-PEG-BBN (r1 =4.23 mM–1s–1 is comparable to that of clinically used Magnevist (Gd-DTPA. Fluorescence microscopy and in vitro cellular MRI demonstrated GRP receptor-specific and enhanced cellular uptake of the Gd2O3-FI-PEG-BBN in PC-3 tumor cells. Moreover, Gd2O3-FI-PEG-BBN showed more remarkable contrast enhancement than the corresponding nontargeted Gd2O3-FI-PEG according to in vivo MRI and fluorescent imaging. Tumor immunohistochemical analysis further demonstrated improved accumulation of the targeted nanoprobe in tumors. BBN-conjugated Gd2O3 may be a promising nanoplatform for simultaneous GRP receptor-targeted molecular cancer diagnosis and antitumor drug delivery in future clinical applications. Keywords: magnetic resonance imaging, gadolinium oxide, bombesin, gastrin-releasing peptide receptor, molecular imaging

Reliability analysis of the auxiliary feedwater system; Analiza zanesljivosti sistema pomozne napajalne vode

Energy Technology Data Exchange (ETDEWEB)

Susnik, J; Dusic, M [Institut Jozef Stefan, Ljubljana (Yugoslavia)

1984-07-01

The reliability of a NPP auxiliary feedwater system is evaluated using the fault tree analysis. The system is analyzed during the time interval 0 to 6 hours with the computer package program PREP/KITT which is described in more detail. (author)

Generic description of facilities at the shaft head (auxiliary entrance installations) of deep geological repositories; Generische Beschreibung von Schachtkopfanlagen (Nebenzugangsanlagen) geologischer Tiefenlager

Energy Technology Data Exchange (ETDEWEB)

NONE

2016-10-15

In a deep geological repository, the access structures function as the link between the surface and the installations and structures at the disposal level. In the planned implementation scenarios, at least two access structures will be in operation up to the time of closure of the repository. The radioactive waste will be transported via the main access from the surface to the disposal level during emplacement operations. For the construction and operation of a deep geological repository, additional access structures are required. These auxiliary accesses and the associated surface infrastructure (e.g. shaft head installations) form the subject of this report. To provide as broad and comprehensive a description as possible, seven types of auxiliary access facilities are defined; these are characterised in line with the current status of planning and their functions and impacts are described. During construction, operation and dismantling of auxiliary access facilities, the usual conventional safety measures (inter alia) have to be observed (e.g. groundwater protection, fire prevention, facility security, accident prevention). Regarding the 'Ordinance on Protection against Major Accidents' no large quantities of hazardous materials, i.e. above the corresponding threshold quantities, are to be expected in the auxiliary access facilities. Proper handling and compliance with applicable regulations in all phases will ensure no hazard to humans and the environment. As no handling of radioactive materials is foreseen in the auxiliary access facilities, and because exhaust air and waste water from the controlled zones of a repository will, in principle, be removed via the main access and not the auxiliary accesses, a safety-relevant emission of radioactive substances and transport of contaminated material can be ruled out for the auxiliary access facilities during both normal operation and also in the case of an accident. Based on the information presented in

Development of Novel Piezoelectric Biosensor Using PZT Ceramic Resonator for Detection of Cancer Markers.

Science.gov (United States)

Su, Li; Fong, Chi-Chun; Cheung, Pik-Yuan; Yang, Mengsu

2017-01-01

A novel biosensor based on piezoelectric ceramic resonator was developed for direct detection of cancer markers in the study. For the first time, a commercially available PZT ceramic resonator with high resonance frequency was utilized as transducer for a piezoelectric biosensor. A dual ceramic resonators scheme was designed wherein two ceramic resonators were connected in parallel: one resonator was used as the sensing unit and the other as the control unit. This arrangement minimizes environmental influences including temperature fluctuation, while achieving the required frequency stability for biosensing applications. The detection of the cancer markers Prostate Specific Antigen (PSA) and α-Fetoprotein (AFP) was carried out through frequency change measurement. The device showed high sensitivity (0.25 ng/ml) and fast detection (within 30 min) with small samples (1 μl), which is compatible with the requirements of clinical measurements. The results also showed that the ceramic resonator-based piezoelectric biosensor platform could be utilized with different chemical interfaces, and had the potential to be further developed into biosensor arrays with different specificities for simultaneous detection of multiple analytes.

Auxiliary Verbs, Dictionaries and the Late Evolution of the Italian Language

Science.gov (United States)

Kinder, John J.

2004-01-01

The use of BE as an auxiliary verb with intransitive verbs has declined in all the Romance languages over the past five centuries. Today, Spanish and Portuguese use only HAVE, in Catalan and Romanian BE occurs in marginal contexts, and in French, BE is used with approximately 40 verbs. Italian is a notable exception, since BE is still used as the…

[Research of dual-photoelastic-modulator-based beat frequency modulation and Fourier-Bessel transform imaging spectrometer].

Science.gov (United States)

Wang, Zhi-Bin; Zhang, Rui; Wang, Yao-Li; Huang, Yan-Fei; Chen, You-Hua; Wang, Li-Fu; Yang, Qiang

2014-02-01

As the existing photoelastic-modulator(PEM) modulating frequency in the tens of kHz to hundreds of kHz between, leading to frequency of modulated interference signal is higher, so ordinary array detector cannot effectively caprure interference signal..A new beat frequency modulation method based on dual-photoelastic-modulator (Dual-PEM) and Fourier-Bessel transform is proposed as an key component of dual-photoelastic-modulator-based imaging spectrometer (Dual-PEM-IS) combined with charge coupled device (CCD). The dual-PEM are operated as an electro-optic circular retardance modulator, Operating the PEMs at slightly different resonant frequencies w1 and w2 respectively, generates a differential signal at a much lower heterodyne frequency that modulates the incident light. This method not only retains the advantages of the existing PEM, but also the frequency of modulated photocurrent decreased by 2-3 orders of magnitude (10-500 Hz) and can be detected by common array detector, and the incident light spectra can be obtained by Fourier-Bessel transform of low frequency component in the modulated signal. The method makes the PEM has the dual capability of imaging and spectral measurement. The basic principle is introduced, the basic equations is derived, and the feasibility is verified through the corresponding numerical simulation and experiment. This method has' potential applications in imaging spectrometer technology, and analysis of the effect of deviation of the optical path difference. This work provides the necessary theoretical basis for remote sensing of new Dual-PEM-IS and for engineering implementation of spectra inversion.

Vehicle energy management for on/off controlled auxiliaries : fuel economy vs. switching frequency

NARCIS (Netherlands)

Chen, H.; Kessels, J.T.B.A.; Weiland, S.

2015-01-01

In this paper, an integrated approach for designing energy management strategies concerning vehicle auxiliaries with on/off control is proposed. This approach provides the possibility of making different trade-offs between fuel economy and switching frequency. In this paper, we demonstrate the

The Bantu-Romance-Greek connection revisited: Processing constraints in auxiliary and clitic placement from a cross-linguistic perspective

Directory of Open Access Journals (Sweden)

Stergios Chatzikyriakidis

2017-02-01

Full Text Available This paper explores a connection between Romance and Greek on the one hand, and Bantu on the other. More specifically, we look at auxiliary placement in Rangi and clitic placement in Tobler Mussafia languages, with a special emphasis on Cypriot Greek, and argue that a common explanation for their distribution can be found once a move into a dynamic framework is made. Rangi exhibits an unusual word order alternation in auxiliary constructions under which the position of the auxiliary appears to be sensitive to an element appearing at the left periphery of the clause. A similar sensitivity to a left-peripheral element can be seen to regulate clitic placement in Cypriot Greek (and generally in the so-called Tobler Mussafia clitic languages. The paper presents a parsing-oriented account of these two phenomena in the Dynamic Syntax framework, arguing that the similarities in syntactic distribution are the result of the encoding in the lexicon of processing strategies that were potentially pragmatic preferences in earlier stages of the respective languages. The account thus leans on the role played by the lexical entries for auxiliary and clitic forms, as well as the assumption that underspecification is inherent in the process of establishing meaning in context. The account is further supplemented by possible pathways of diachronic change that could have given rise to the systems found in present day varieties.

Nonlinear analysis for dual-frequency concurrent energy harvesting

Science.gov (United States)

Yan, Zhimiao; Lei, Hong; Tan, Ting; Sun, Weipeng; Huang, Wenhu

2018-05-01

The dual-frequency responses of the hybrid energy harvester undergoing the base excitation and galloping were analyzed numerically. In this work, an approximate dual-frequency analytical method is proposed for the nonlinear analysis of such a system. To obtain the approximate analytical solutions of the full coupled distributed-parameter model, the forcing interactions is first neglected. Then, the electromechanical decoupled governing equation is developed using the equivalent structure method. The hybrid mechanical response is finally separated to be the self-excited and forced responses for deriving the analytical solutions, which are confirmed by the numerical simulations of the full coupled model. The forced response has great impacts on the self-excited response. The boundary of Hopf bifurcation is analytically determined by the onset wind speed to galloping, which is linearly increased by the electrical damping. Quenching phenomenon appears when the increasing base excitation suppresses the galloping. The theoretical quenching boundary depends on the forced mode velocity. The quenching region increases with the base acceleration and electrical damping, but decreases with the wind speed. Superior to the base-excitation-alone case, the existence of the aerodynamic force protects the hybrid energy harvester at resonance from damages caused by the excessive large displacement. From the view of the harvested power, the hybrid system surpasses the base-excitation-alone system or the galloping-alone system. This study advances our knowledge on intrinsic nonlinear dynamics of the dual-frequency energy harvesting system by taking advantage of the analytical solutions.

Hybrid mesons with auxiliary fields

International Nuclear Information System (INIS)

Buisseret, F.; Mathieu, V.

2006-01-01

Hybrid mesons are exotic mesons in which the color field is not in the ground state. Their understanding deserves interest from a theoretical point of view, because it is intimately related to nonperturbative aspects of QCD. Moreover, it seems that some recently detected particles, such as the π 1 (1600) and the Y(4260), are serious hybrid candidates. In this work, we investigate the description of such exotic hadrons by applying the auxiliary fields technique (also known as the einbein field method) to the widely used spinless Salpeter Hamiltonian with appropriate linear confinement. Instead of the usual numerical resolution, this technique allows to find simplified analytical mass spectra and wave functions of the Hamiltonian, which still lead to reliable qualitative predictions. We analyse and compare two different descriptions of hybrid mesons, namely a two-body q system with an excited flux tube, or a three-body qg system. We also compute the masses of the 1 -+ hybrids. Our results are shown to be in satisfactory agreement with lattice QCD and other effective models. (orig.)

Modelling Seasonal GWR of Daily PM2.5 with Proper Auxiliary Variables for the Yangtze River Delta

Directory of Open Access Journals (Sweden)

Man Jiang

2017-04-01

Full Text Available Over the past decades, regional haze episodes have frequently occurred in eastern China, especially in the Yangtze River Delta (YRD. Satellite derived Aerosol Optical Depth (AOD has been used to retrieve the spatial coverage of PM2.5 concentrations. To improve the retrieval accuracy of the daily AOD-PM2.5 model, various auxiliary variables like meteorological or geographical factors have been adopted into the Geographically Weighted Regression (GWR model. However, these variables are always arbitrarily selected without deep consideration of their potentially varying temporal or spatial contributions in the model performance. In this manuscript, we put forward an automatic procedure to select proper auxiliary variables from meteorological and geographical factors and obtain their optimal combinations to construct four seasonal GWR models. We employ two different schemes to comprehensively test the performance of our proposed GWR models: (1 comparison with other regular GWR models by varying the number of auxiliary variables; and (2 comparison with observed ground-level PM2.5 concentrations. The result shows that our GWR models of “AOD + 3” with three common meteorological variables generally perform better than all the other GWR models involved. Our models also show powerful prediction capabilities in PM2.5 concentrations with only slight overfitting. The determination coefficients R2 of our seasonal models are 0.8259 in spring, 0.7818 in summer, 0.8407 in autumn, and 0.7689 in winter. Also, the seasonal models in summer and autumn behave better than those in spring and winter. The comparison between seasonal and yearly models further validates the specific seasonal pattern of auxiliary variables of the GWR model in the YRD. We also stress the importance of key variables and propose a selection process in the AOD-PM2.5 model. Our work validates the significance of proper auxiliary variables in modelling the AOD-PM2.5 relationships and

Mesoporous composite nanoparticles for dual-modality ultrasound/magnetic resonance imaging and synergistic chemo-/thermotherapy against deep tumors

Directory of Open Access Journals (Sweden)

Zhang N

2017-10-01

Full Text Available Nan Zhang,1 Ronghui Wang,2 Junnian Hao,1 Yang Yang,1 Hongmi Zou,3 Zhigang Wang1 1Chongqing Key Laboratory of Ultrasound Molecular Imaging, Second Affiliated Hospital of Chongqing Medical University, Chongqing Medical University, Chongqing, 2Department of Ultrasound, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, 3Department of Ophthalmology, Second Affiliated Hospital of Chongqing Medical University, Chongqing, People’s Republic of China Abstract: High-intensity focused ultrasound (HIFU is a promising and noninvasive treatment for solid tumors, which has been explored for potential clinical applications. However, the clinical applications of HIFU for large and deep tumors such as hepatocellular carcinoma (HCC are severely limited by unsatisfactory imaging guidance, long therapeutic times, and damage to normal tissue around the tumor due to the high power applied. In this study, we developed doxorubicin/perfluorohexane-encapsulated hollow mesoporous Prussian blue nanoparticles (HMPBs-DOX/PFH as theranostic agents, which can effectively guide HIFU therapy and enhance its therapeutic effects in combination with chemotherapy, by decreasing the cavitation threshold. We investigated the effects of this agent on ultrasound and magnetic resonance imaging in vitro and in vivo. In addition, we showed a highly efficient HIFU therapeutic effect against HCC tumors, as well as controlled drug release, owing to the phase-transitional performance of the PFH. We therefore conclude that HMPB-DOX/PFH is a safe and efficient nanoplatform, which holds significant promise for cancer theranostics against deep tumors in clinical settings. Keywords: high-intensity focused ultrasound, HIFU, hollow mesoporous Prussian blue nanoplatforms, hepatocellular carcinoma, dual-modality imaging, synergistic chemo-/thermotherapy, theranostics

Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

CERN Document Server

Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

2016-01-01

The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

Energy Technology Data Exchange (ETDEWEB)

Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN, CH-1211 Geneva 23 (Switzerland); School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Fedorov, D. [Petersburg Nuclear Physics Institute, 188350 Gatchina (Russian Federation); Fedosseev, V.N.; Forster, L.; Marsh, B.A. [CERN, CH-1211 Geneva 23 (Switzerland); Rossel, R.E. [CERN, CH-1211 Geneva 23 (Switzerland); Institut für Physik, Johannes Gutenberg Universität, D-55099 Mainz (Germany); Faculty of Design, Computer Science and Media, Hochschule RheinMain, Wiesbaden (Germany); Rothe, S.; Veinhard, M. [CERN, CH-1211 Geneva 23 (Switzerland)

2016-09-11

The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

The role of developmental levels in examining the effect of subject types on the production of auxiliary is in young english-speaking children.

Science.gov (United States)

Guo, Ling-Yu; Owen Van Horne, Amanda J; Tomblin, J Bruce

2011-12-01

Prior work (Guo, Owen, & Tomblin, 2010) has shown that at the group level, auxiliary is production by young English-speaking children was symmetrical across lexical noun and pronominal subjects. Individual data did not uniformly reflect these patterns. On the basis of the framework of the gradual morphosyntactic learning (GML) hypothesis, the authors tested whether the addition of a theoretically motivated developmental measure, tense productivity (TP), could assist in explaining these individual differences. Using archival data from 20 children between age 2;8 and 3;4 (years;months), the authors tested the ability of 3 developmental measures (TP; finite verb morphology composite, FVMC; mean length of utterance, MLU) to predict use of auxiliary is with different subject types. TP, but not MLU or FVMC, significantly improved model fit. Children with low TP scores produced auxiliary is more accurately with pronominal subjects than with lexical subjects. The facilitative effect of pronominal subjects on the production of auxiliary is, however, was not found in children with high TP scores. The finding that the effect of subject types on the production accuracy of auxiliary is changed with children's TP is consistent with the GML hypothesis.

Compact driver, notably for a light emitting diode, having an auxiliary output

NARCIS (Netherlands)

2015-01-01

The current invention relates to a driver(10,20) for driving at least one main load and one auxiliary load comprising: ä power converter(101) adapted to convert an input voltage(Vin) into at least one main output voltage provided through a main output(1011) for driving said main load, and at least

Microvascular obstruction on delayed enhancement cardiac magnetic resonance imaging after acute myocardial infarction, compared with myocardial {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings

Energy Technology Data Exchange (ETDEWEB)

Mori, Hiroaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Cardiology, Kainan Hospital, Yatomi (Japan); Isobe, Satoshi, E-mail: sisobe@med.nagoya-u.ac.jp [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Sakai, Shinichi [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Yamada, Takashi [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Watanabe, Naoki; Miura, Manabu [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Uchida, Yasuhiro; Kanashiro, Masaaki; Ichimiya, Satoshi [Department of Cardiology, Yokkaichi Municipal Hospital, Yokkaichi (Japan); Okumura, Takahiro; Murohara, Toyoaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan)

2015-08-15

Highlights: • The percentage infarct size (%IS) was significantly greater in the microvascular obstruction (MO) group than in the non-MO group. • The percentage mismatch score (%MMS) on dual scintigraphy significantly correlated with the %IS and the percentage MO. • The %MMS was significantly greater in the non-MO group than in the MO group, and was an independent predictor for MO. - Abstract: Background: The hypo-enhanced regions within the hyper-enhanced infarct areas detected by cardiac magnetic resonance (CMR) imaging reflect microvascular obstruction (MO) after acute myocardial infarction (AMI). The combined myocardial thallium-201 ({sup 201}Tl)/iodine-123-15-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ({sup 123}I-BMIPP) dual single-photon emission computed tomography (SPECT) is a useful tool for detecting myocardial reversibility after AMI. We evaluated whether MO could be an early predictor of irreversible myocardial damage in comparison with {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings in AMI patients. Methods: Sixty-two patients with initial AMI who successfully underwent coronary revascularization were enrolled. MO was defined by CMR imaging. Patients were divided into 2 groups as follows: MO group (n = 32) and non-MO group (n = 30). Scintigraphic defect scores were calculated using a 17-segment model with a 5-point scoring system. The mismatch score (MMS) was calculated as follows: the total sum of (Σ) {sup 123}I-BMIPP defect score minus Σ{sup 201}Tl defect score. The percentage mismatch score (%MMS) was calculated as follows: MMS/(Σ{sup 123}I-BMIPP score) × 100 (%). Results: The percentage infarct size (%IS) was significantly greater in the MO group than in the non-MO group (32.2 ± 13.8% vs. 18.3 ± 12.1%, p < 0.001). The %MMS significantly correlated with the %IS and the percentage MO (r = −0.26, p = 0.03; r = −0.45, p < 0.001, respectively). The %MMS was significantly greater in the non-MO group than in the MO group (45.4 �

Cooling system for auxiliary reactor component

International Nuclear Information System (INIS)

Fujihira, Tomoko.

1991-01-01

A cooling system for auxiliary reactor components comprises three systems, that is, two systems of reactor component cooling water systems (RCCW systems) and a high pressure component cooling water system (HPCCW system). Connecting pipelines having partition valves are intervened each in a cooling water supply pipeline to an emmergency component of each of the RCCW systems, a cooling water return pipeline from the emmergency component of each of the RCCW systems, a cooling water supply pipeline to each of the emmergency components of one of the RCCW system and the HPCCW system and a cooling water return pipeline from each of the emmergency components of one of the RCCW system and the HPCCW system. With such constitution, cooling water can be supplied also to the emmergency components in the stand-by system upon periodical inspection or ISI, thereby enabling to improve the backup performance of the emmergency cooling system. (I.N.)

Nuclear Reactor RA Safety Report, Vol. 8, Auxiliary system

International Nuclear Information System (INIS)

1986-11-01

This volume describes RA reactor auxiliary systems, as follows: special ventilation system, special drainage system, hot cells, systems for internal transport. Ventilation system is considered as part of the reactor safety and protection system. Its role is eliminate possible radioactive particles dispersion in the environment. Special drainage system includes pipes and reservoirs with the safety role, meaning absorption or storage of possible radioactive waste water from the reactor building. Hot cells existing in the RA reactor building are designed for production of sealed radioactive sources, including packaging and transport [sr

Biofouling Removal and Protein Detection Using a Hypersonic Resonator.

Science.gov (United States)

Pan, Shuting; Zhang, Hongxiang; Liu, Wenpeng; Wang, Yanyan; Pang, Wei; Duan, Xuexin

2017-08-25

Nonspecific binding (NSB) is a general issue for surface based biosensors. Various approaches have been developed to prevent or remove the NSBs. However, these approaches either increased the background signals of the sensors or limited to specific transducers interface. In this work, we developed a hydrodynamic approach to selectively remove the NSBs using a microfabricated hypersonic resonator with 2.5 gigahertz (GHz) resonant frequency. The high frequency device facilitates generation of multiple controlled microvortexes which then create cleaning forces at the solid-liquid interfaces. The competitive adhesive and cleaning forces have been investigated using the finite element method (FEM) simulation, identifying the feasibility of the vortex-induced NSB removal. NSB proteins have been selectively removed experimentally both on the surface of the resonator and on other substrates which contact the vortexes. Thus, the developed hydrodynamic approach is believed to be a simple and versatile tool for NSB removal and compatible to many sensor systems. The unique feature of the hypersonic resonator is that it can be used as a gravimetric sensor as well; thus a combined NSB removal and protein detection dual functional biosensor system is developed.

Dual-echo, chemical shift gradient-echo magnetic resonance imaging to quantify hepatic steatosis: Implications for living liver donation.

Science.gov (United States)

Rinella, Mary E; McCarthy, Richard; Thakrar, Kiran; Finn, John Paul; Rao, Sambasiva M; Koffron, Alan J; Abecassis, Michael; Blei, Andres T

2003-08-01

In living liver donation, a fatty liver poses risks for both recipient and donor. Currently, liver biopsy is the standard for assessing the presence and extent of steatosis. The goals of this study were to correlate a steatosis index derived from magnetic resonance imaging (MRI) to the histologic grade on biopsy as well as to determine the topographic distribution of steatosis within the liver. We examined the ability of dual-echo, chemical shift gradient-echo MRI to predict the degree of steatosis on liver biopsy. A total of 22 subjects received both a liver biopsy and detailed MRI evaluation. These individuals included 15 potential living donors and 7 patients with nonalcoholic fatty liver disease. MRI steatosis index was then compared with histologic grade on liver biopsy. The topographic distribution of hepatic steatosis was determined from those subjects in whom MRI detected hepatic steatosis. The steatosis index had a positive correlation with grade of steatosis on liver biopsy (correlation coefficient, 0.84). There was no significant variation in the degree of steatosis among segments. A steatosis index of >0.2 had good positive and negative predictive value for the presence of significant steatosis (>15%) on biopsy. Our quantitative MRI protocol can predict the degree of hepatic steatosis when it is minimal to moderate, and may obviate the need for liver biopsy for the purpose of quantification of steatosis in living donors. Fat saturation added to the MRI protocol may further improve diagnostic accuracy. This technique may be applicable to the larger population with hepatic steatosis.

Self-dual Hopf quivers

International Nuclear Information System (INIS)

Huang Hualin; Li Libin; Ye Yu

2004-07-01

We study pointed graded self-dual Hopf algebras with a help of the dual Gabriel theorem for pointed Hopf algebras. Quivers of such Hopf algebras are said to be self-dual. An explicit classification of self-dual Hopf quivers is obtained. We also prove that finite dimensional coradically graded pointed self-dual Hopf algebras are generated by group-like and skew-primitive elements as associative algebras. This partially justifies a conjecture of Andruskiewitsch and Schneider and may help to classify finite dimensional self-dual pointed Hopf algebras

Seismic qualification of the rotary relay for use in the Trojan and Diablo Canyon Auxiliary Safeguards Cabinets

International Nuclear Information System (INIS)

Riggio, M.D.; Jarecki, S.J.

1977-10-01

This report presents the results of the analysis performed for the seismic qualification of the rotary relay for use in the Trojan and Diablo Canyon Auxiliary Safeguards Cabinets. A finite element model of the cabinet was developed from seismic test results. This model was analytically subjected to a simulated 3D floor acceleration time history that enveloped, simultaneously, the Trojan and the June 1969 Diablo Canyon Safe Shutdown Earthquake requirements. The dynamic response of the cabinet at the mounting location of the rotary relays was determined. The calculated acceleration time histories were converted to response spectra and these response spectra were compared to the test response spectra successfully achieved during the rotary relay seismic qualification tests. It was found that the dynamic motion levels at the rotary relays, when mounted in the Trojan or Diablo Canyon Auxiliary Safeguards Cabinets, do not exceed the levels for which they were previously seismically qualified by tests. Consequently, the rotary relays are seismically qualified for use in the Trojan or Diablo Canyon Auxiliary Safeguards Cabinets

Accuracy of sentinel lymph node biopsy for the assessment of auxiliary status in patients with early (T1) breast carcinoma

International Nuclear Information System (INIS)

Gurleyik, G.; Sekmen, U.; Saglam, A.; Aker, F.

2005-01-01

Objective: To determine the accuracy of SLN biopsy for the assessment of auxiliary status, and prognostic markers leading to lymphatic metastasis in patients with early (T1) breast cancer. Design: Cross-sectional study. Place and Duration of Study: Department of Surgery, Teaching and Research Hospital. Between January 2000 and August 2004. Patients and Methods: SLN mapping by blue dye method was performed on 39 patients with T1 breast carcinoma. SLNs, level 1 and 2 auxiliary nodes were dissected and excised. The size, pathologic features of the primary tumor, SLNs and other auxiliary nodes, and hormone receptors were evaluated by histopathologic examination. The rate of SLNs and non SLNs involvement, and demographic, clinical and pathologic risk factors leading to nodal metastasis were established. The diagnostic accuracy of SLN for auxiliary status was calculated. Results: SLNs were identified in 37 (95%) patients. The axilla had metastasis in 11 (28%) patients. Malignant cells involved SLNs in 8 patients. Non-SLNs had metastasis in 3 patients without SLN involvement. The sensitivity, specificity and accuracy of SLN biopsy for predicting auxiliary status was calculated as 73%, 100% and 92% respectively. Four of 5 patients T1c tumors (p=0.14) and lymphovascular invasion (p=0.0004). Conclusion: SLN biopsy with high diagnostic accuracy may prevent unnecessary disection of the axilla in the majority of patients with early (T1) breast carcinoma. Some risk factors as pre-menopausal status, absence of hormone receptors, and presence of lymphovascular invasion must be taken into account as important determinant of non-SLNs metastasis. (author)

A Lateral Differential Resonant Pressure Microsensor Based on SOI-Glass Wafer-Level Vacuum Packaging

Directory of Open Access Journals (Sweden)

Bo Xie

2015-09-01

Full Text Available This paper presents the fabrication and characterization of a resonant pressure microsensor based on SOI-glass wafer-level vacuum packaging. The SOI-based pressure microsensor consists of a pressure-sensitive diaphragm at the handle layer and two lateral resonators (electrostatic excitation and capacitive detection on the device layer as a differential setup. The resonators were vacuum packaged with a glass cap using anodic bonding and the wire interconnection was realized using a mask-free electrochemical etching approach by selectively patterning an Au film on highly topographic surfaces. The fabricated resonant pressure microsensor with dual resonators was characterized in a systematic manner, producing a quality factor higher than 10,000 (~6 months, a sensitivity of about 166 Hz/kPa and a reduced nonlinear error of 0.033% F.S. Based on the differential output, the sensitivity was increased to two times and the temperature-caused frequency drift was decreased to 25%.

The improved photovoltaic performance of phenothiazine-dithienopyrrole based dyes with auxiliary acceptors

Science.gov (United States)

Han, Ming-Liang; Zhu, Yi-Zhou; Liu, Shuang; Liu, Qing-Long; Ye, Dan; Wang, Bing; Zheng, Jian-Yu

2018-05-01

Incorporating alkyl chain decorated dithienopyrrole π-spacer with phenothiazine donor has proven to be efficient strategy for constructing novel dyes, which can achieve both large short-circuit current (Jsc) and high open-circuit voltage (Voc) in dye-sensitized solar cells (DSSCs). To promote the light harvesting capability, auxiliary acceptors including benzotriazole (BTZ), benzothiadiazole (BTD), and quinoxaline (Qu) have been inserted into the skeleton of dyes, and much improved Jsc have been realized. Meantime, the rational design of alkyl chains endows dyes JY53 and JY55 a good shielding effect from the penetration of electrolyte, guaranteeing a high Voc (over 810 mV) through retarding unwanted interfacial charge recombination. As a result, with the assistance of introduced auxiliary acceptors and alkyl chains, the photovoltaic performance of devices have been significantly improved, and dye JY55 has achieved an excellent power conversion efficiency (PCE) of 10.06% with Jsc of 19.18 mA cm-2, Voc of 829 mV, and FF of 0.63 under AM 1.5 G irradiation.

CRADA Final Report for CRADA Number ORNL98-0521 : Development of an Electric Bus Inverter Based on ORNL Auxiliary Resonant Tank (ART) Soft-Switching Technology; TOPICAL

International Nuclear Information System (INIS)

Ayers, C.W.

2001-01-01

The Power Electronics and Electric Machinery Research Center (PEEMRC) of Oak Ridge National Laboratory (ORNL) has for many years been developing technologies for power converters for motor drives and many other applications. Some of the research goals are to improve efficiency and reduce audible and electromagnetic interference noise generation for inverters and the driven loads. The converters are being required to produce more power with reduced weight and volume, which requires improvements in heat removal from the electronics, as well as improved circuit designs that have fewer electrical losses. PEEMRC has recently developed and patented a soft-switching inverter topology called an Auxiliary Resonant Tank (ART), and this design has been tested and proven at ORNL using a 10-kW laboratory prototype. The objective of this project was to develop, test, and install the ART inverter technology in an electric transit bus with the final goal of evaluating performance of the ORNL inverter under field conditions in a vehicle. A scaled-up inverter with the capacity to drive a 22-e bus was built based on the 10-kW ORNL laboratory prototype ART soft-switching inverter. Most (if not all) commercially available inverters for traction drive and other applications use hard-switching inverters. A Cooperative Research and Development Agreement was established with the Chattanooga Area Regional Transit Authority (CARTA), the Electric Transit Vehicle Institute (ETVI), and Advanced Vehicle Systems (AVS), all of Chattanooga, along with ORNL. CARTA, which maintains and operates the public transit system in Chattanooga, provided an area for testing the vehicle alongside other similar vehicles in the normal operating environment. ETVI offers capabilities in standardized testing and reporting and also provides exposure in the electric transit vehicle arena for ORNL's technologies. The third Chattanooga partner, (AVS) manufactures all-electric and hybrid electric transit buses using

Dual Youla parameterization

DEFF Research Database (Denmark)

Niemann, Hans Henrik

2003-01-01

A different aspect of using the parameterisation of all systems stabilised by a given controller, i.e. the dual Youla parameterisation, is considered. The relation between system change and the dual Youla parameter is derived in explicit form. A number of standard uncertain model descriptions...... are considered and the relation with the dual Youla parameter given. Some applications of the dual Youla parameterisation are considered in connection with the design of controllers and model/performance validation....

Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

Energy Technology Data Exchange (ETDEWEB)

Amoudache, Samira [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria); Moiseyenko, Rayisa [Department of Physics, Technical University of Denmark, DTU Physics, Building 309, DK-2800 Kongens Lyngby (Denmark); Pennec, Yan, E-mail: yan.pennec@univ-lille1.fr; Rouhani, Bahram Djafari [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Khater, Antoine [Institut des Molécules et Matériaux du Mans (IMMM), UMR CNRS 6283, l' UNAM, Université du Maine, 72085 Le Mans (France); Lucklum, Ralf [Institute of Micro and Sensor Systems (IMOS), Otto-von-Guericke-University, P.O. Box 4120, D-39016 Magdeburg (Germany); Tigrine, Rachid [Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria)

2016-03-21

We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.

Preliminary report on the development of rf auxiliary heating systems for TEPR-1

International Nuclear Information System (INIS)

Reed, B.W.; Bowen, O.N.; Hill, H.M.; Lawson, J.Q.; Newman, W.G.; Sivo, A.J.

1977-12-01

Conceptual designs for 50 MW (expandable to 100 MW) ICRF and LHRF heating systems suitable for auxiliary heating of the TEPR-1 plasma to ignition temperatures are presented. Engineering milestones are enumerated and the extensions of current technology required for successful completion of the project are identified

Estimation of Finite Population Ratio When Other Auxiliary Variables are Available in the Study

Directory of Open Access Journals (Sweden)

Jehad Al-Jararha

2014-12-01

Full Text Available The estimation of the population total $t_y,$ by using one or moreauxiliary variables, and the population ratio $\\theta_{xy}=t_y/t_x,$$t_x$ is the population total for the auxiliary variable $X$, for afinite population are heavily discussed in the literature. In thispaper, the idea of estimation the finite population ratio$\\theta_{xy}$ is extended to use the availability of auxiliaryvariable $Z$ in the study, such auxiliary variable  is not used inthe definition of the population ratio. This idea may be  supported by the fact that the variable $Z$  is highly correlated with the interest variable $Y$ than the correlation between the variables $X$ and $Y.$ The availability of such auxiliary variable can be used to improve the precision of the estimation of the population ratio.  To our knowledge, this idea is not discussed in the literature.  The bias, variance and the mean squares error  are given for our approach. Simulation from real data set,  the empirical relative bias and  the empirical relative mean squares error are computed for our approach and different estimators proposed in the literature  for estimating the population ratio $\\theta_{xy}.$ Analytically and the simulation results show that, by suitable choices, our approach gives negligible bias and has less mean squares error.  

Test system design for Hardware-in-Loop evaluation of PEM fuel cells and auxiliaries

Energy Technology Data Exchange (ETDEWEB)

Randolf, Guenter; Moore, Robert M. [Hawaii Natural Energy Institute, University of Hawaii, Honolulu, HI (United States)

2006-07-14

In order to evaluate the dynamic behavior of proton exchange membrane (PEM) fuel cells and their auxiliaries, the dynamic capability of the test system must exceed the dynamics of the fastest component within the fuel cell or auxiliary component under test. This criterion is even more critical when a simulated component of the fuel cell system (e.g., the fuel cell stack) is replaced by hardware and Hardware-in-Loop (HiL) methodology is employed. This paper describes the design of a very fast dynamic test system for fuel cell transient research and HiL evaluation. The integration of the real time target (which runs the simulation), the test stand PC (that controls the operation of the test stand), and the programmable logic controller (PLC), for safety and low-level control tasks, into one single integrated unit is successfully completed. (author)

Dual Smarandache Curves of a Timelike Curve lying on Unit dual Lorentzian Sphere

OpenAIRE

Kahraman, Tanju; Hüseyin Ugurlu, Hasan

2016-01-01

In this paper, we give Darboux approximation for dual Smarandache curves of time like curve on unit dual Lorentzian sphere. Firstly, we define the four types of dual Smarandache curves of a timelike curve lying on dual Lorentzian sphere.

Film bulk acoustic resonator pressure sensor with self temperature reference

International Nuclear Information System (INIS)

He, X L; Jin, P C; Zhou, J; Wang, W B; Dong, S R; Luo, J K; Garcia-Gancedo, L; Flewitt, A J; Milne, W I

2012-01-01

A novel film bulk acoustic resonator (FBAR) with two resonant frequencies which have opposite reactions to temperature changes has been designed. The two resonant modes respond differently to changes in temperature and pressure, with the frequency shift being linearly correlated with temperature and pressure changes. By utilizing the FBAR's sealed back trench as a cavity, an on-chip single FBAR sensor suitable for measuring pressure and temperature simultaneously is proposed and demonstrated. The experimental results show that the pressure coefficient of frequency for the lower frequency peak of the FBAR sensors is approximately −17.4 ppm kPa −1 , while that for the second peak is approximately −6.1 ppm kPa −1 , both of them being much more sensitive than other existing pressure sensors. This dual mode on-chip pressure sensor is simple in structure and operation, can be fabricated at very low cost, and yet requires no specific package, therefore has great potential for applications. (paper)

The experimental study on positioning of the surface coil for magnetic resonance imaging

Energy Technology Data Exchange (ETDEWEB)

Matsumoto, Kyoji; Yotsui, Yoritaka; Koseki, Yonoshin [Osaka Dental Univ., Hirakata (Japan)

2002-12-01

We examined the correlation between signal intensity and setting angulations for magnetic resonance imagesobtained using a surface coil, which had a three inch surface coil, and dual coil, which and a three inch surface coil and an anterior neck coil. We took T2-3D weighted, T2-2D weighted and T1-2D weighted images with the angulated three-inch surface coil at 0-90 degrees with the magnetic direction. In every sequence, the maximum intensity with the dual coil was taken with angulations of 50-60 degrees. The intensity of the dual coil could be as much as the three times that of the single coil. As the angulations increased with the dual coil, the thickness of the effective intensity was decreased until it reached 50% of the maximum thickness. With the single coil it decreased until it reached 10%. When using a high-resolution coil that cannot be setup parallel with the magnetic direction, we recommend using a dual coil rather than a single coil to increase the signal intensity. In the oral cavity, the intraoral coil should be used with the extraoral coil as the phased array coil. This is the optimum condition of coil angulation for taking high resolution images. (author)

Atomic Cholesky decompositions: A route to unbiased auxiliary basis sets for density fitting approximation with tunable accuracy and efficiency

Science.gov (United States)

Aquilante, Francesco; Gagliardi, Laura; Pedersen, Thomas Bondo; Lindh, Roland

2009-04-01

Cholesky decomposition of the atomic two-electron integral matrix has recently been proposed as a procedure for automated generation of auxiliary basis sets for the density fitting approximation [F. Aquilante et al., J. Chem. Phys. 127, 114107 (2007)]. In order to increase computational performance while maintaining accuracy, we propose here to reduce the number of primitive Gaussian functions of the contracted auxiliary basis functions by means of a second Cholesky decomposition. Test calculations show that this procedure is most beneficial in conjunction with highly contracted atomic orbital basis sets such as atomic natural orbitals, and that the error resulting from the second decomposition is negligible. We also demonstrate theoretically as well as computationally that the locality of the fitting coefficients can be controlled by means of the decomposition threshold even with the long-ranged Coulomb metric. Cholesky decomposition-based auxiliary basis sets are thus ideally suited for local density fitting approximations.

Energic, Exergic, Exergo‐economic investigation and optimization of auxiliary cooling system (ACS equipped with compression refrigerating system (CRS

Directory of Open Access Journals (Sweden)

Omid Karimi Sadaghiyani

2017-09-01

Full Text Available Heller main cooling tower as air-cooled heat exchanger is used in the combined cycle power plants (CCPP to reduce the temperature of condenser. In extreme summer heat, the efficiency of the cooling tower is reduced and it lessens performance of Steam Turbine Generation (STG unit of Combined Cycle Power Plant (CCPP. Thus, the auxiliary cooling system (ACS is equipped with compression refrigerating system (CRS. This auxiliary system is linked with the Heller main cooling tower and improves the performance of power plant. In other words, this auxiliary system increases the generated power of STG unit of CCPP by decreasing the temperature of returning water from cooling tower Therefore, in the first step, the mentioned auxiliary cooling system (ACS as a heat exchanger and compression refrigerating system (CRS have been designed via ASPEN HTFS and EES code respectively. In order to validate their results, these two systems have been built and theirs experimentally obtained data have been compared with ASPEN and EES results. There are good agreements between results. After that, exergic and exergo-economic analysis of designed systems have been carried out. Finally, the compression refrigerating system (CRS has been optimized via Genetic Algorithm (GA. Increasing in exergy efficiency (ε from 14.23% up to 36.12% and decreasing the total cost rate (ĊSystem from 378.2 ($/h to 308.2 ($/h are as results of multi-objective optimization.