WorldWideScience

Sample records for auxiliary dual resonance

  1. Auxiliary resonant DC tank converter

    Science.gov (United States)

    Peng, Fang Z.

    2000-01-01

    An auxiliary resonant dc tank (ARDCT) converter is provided for achieving soft-switching in a power converter. An ARDCT circuit is coupled directly across a dc bus to the inverter to generate a resonant dc bus voltage, including upper and lower resonant capacitors connected in series as a resonant leg, first and second dc tank capacitors connected in series as a tank leg, and an auxiliary resonant circuit comprising a series combination of a resonant inductor and a pair of auxiliary switching devices. The ARDCT circuit further includes first clamping means for holding the resonant dc bus voltage to the dc tank voltage of the tank leg, and second clamping means for clamping the resonant dc bus voltage to zero during a resonant period. The ARDCT circuit resonantly brings the dc bus voltage to zero in order to provide a zero-voltage switching opportunity for the inverter, then quickly rebounds the dc bus voltage back to the dc tank voltage after the inverter changes state. The auxiliary switching devices are turned on and off under zero-current conditions. The ARDCT circuit only absorbs ripples of the inverter dc bus current, thus having less current stress. In addition, since the ARDCT circuit is coupled in parallel with the dc power supply and the inverter for merely assisting soft-switching of the inverter without participating in real dc power transmission and power conversion, malfunction and failure of the tank circuit will not affect the functional operation of the inverter; thus a highly reliable converter system is expected.

  2. Self-dual N=2 Born-Infeld theory through auxiliary superfields

    Energy Technology Data Exchange (ETDEWEB)

    Ivanov, E.A.; Zupnik, B.M. [Bogoliubov Laboratory of Theoretical Physics, JINR,141980 Dubna, Moscow Region (Russian Federation)

    2014-05-15

    There is an evidence that the N=2 Born-Infeld theory with spontaneously broken N=4 supersymmetry exhibits self-duality. We perform a further check of this hypothesis by constructing a new representation for the N=2 Born-Infeld action through the auxiliary chiral superfield U. In such a formulation, self-duality is equivalent to U(1) invariance of the U interaction. We explicitly calculate the auxiliary interaction up to the 10th order and show its U(1) duality invariance, thus proving that the original action is self-dual to the same order. We also suggest a new method of recursive computation of the N=2 Born-Infeld action in the standard formulation, based solely on the nonlinear realization of the N=4 central charge on the N=2 superfield strengths W,W-macron.

  3. Wigner Transport Simulation of Resonant Tunneling Diodes with Auxiliary Quantum Wells

    Science.gov (United States)

    Lee, Joon-Ho; Shin, Mincheol; Byun, Seok-Joo; Kim, Wangki

    2018-03-01

    Resonant-tunneling diodes (RTDs) with auxiliary quantum wells ( e.g., emitter prewell, subwell, and collector postwell) are studied using a Wigner transport equation (WTE) discretized by a thirdorder upwind differential scheme. A flat-band potential profile is used for the WTE simulation. Our calculations revealed functions of the auxiliary wells as follows: The prewell increases the current density ( J) and the peak voltage ( V p ) while decreasing the peak-to-valley current ratio (PVCR), and the postwell decreases J while increasing the PVCR. The subwell affects J and PVCR, but its main effect is to decrease V p . When multiple auxiliary wells are used, each auxiliary well contributes independently to the transport without producing side effects.

  4. Experimental study of resonance fiber optic gyroscope employing a dual-ring resonator

    Science.gov (United States)

    Fan, Yue; Wang, Wei

    2016-09-01

    A dual-ring resonator which is available to alter the full width at half maximum (FWHM) without altering the free spectrum range (FSR) for practice applications is analyzed theoretically and set up in practice. The parameters of the dual-ring resonator have been optimized in simulation, the resonance depth and the dynamic range are enhanced. The prototype is set up with single mode fiber of 8 meter and two 95 : 5 couplers for open loop experiment. The FWHM of the dual-ring resonator is demonstrated less than 1.5MHz and the fineness is calculated to be 37 during the frequency sweeping experiment. The frequency locking experiment with demodulation curve method has been accomplished, and the locking time achieves less than 40ms. All these provide a basic reference for optimizing the resonance fiber optic gyro based on dual-ring resonator.

  5. On the quark structure of resonance states in dual models

    International Nuclear Information System (INIS)

    Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.

    1975-01-01

    It is shown using as an example the Veneziano dual model, that each particular dual model already contains a certain latent quark structure unambiauously determined by internal properties of the dual model. To prove this degeneration of the resonance state spectrum is studied by introducing an additional disturbing interaction into the model being considered. Induced transitions of particles into a vacuum act as such an additional disturbance. This method complements the known factorization method of Fubini, Gordon and Veneziano and turns out to be free from an essential limitation of the latter connected with implicit assumption about the basence of internal additive laws of conservation in the model. By using the method of induced transitions of particles into a vacuum it has been possible to show that the resonance state spectrum is indeed more degenerated than it should be expected from the factorization theorem, and that the supplementary degeneration corresponds to the quark model with an infinite number of quarks of the increasing mass. Structures of some terms of the dual amplitude expansion over the degrees of the constant of the induced transition of particles to vacuum are considered; it is shown that the summation of this expansion may be reduced to a solution of a certain integral equation. On the basis of the integral equation obtained an integral representation ofr dual amplitudes is established. The problems related with degeneration of resonance states and with determination of additive quantum numbers leading to the quark interpretation of the degeneration being considered are discussed

  6. Design of Dual-Band Bandpass Filter Using Dual-Mode Defected Stub Loaded Resonator

    Directory of Open Access Journals (Sweden)

    Dechang Huang

    2014-01-01

    Full Text Available A novel approach for designing a dual-band bandpass filter (BPF using defected stub loaded resonator (DSLR is presented in this paper. The proposed DSLR consists of two fundamental resonant modes and some resonant characteristics have been investigated by EM software of Ansoft HFSS. Then, based on two coupled DSLRs, a dual-band response BPF that operates at 2.4 GHz and 3.5 GHz is designed and implemented for WLAN and WIMAX application. The first passband is constructed by two lower frequencies of the coupled DSLRs and the second passband is produced by two higher ones; the coupling scheme of them is also given. Finally, the dual-band BPF is fabricated and measured; a good agreement between simulation and measurement is obtained, which verifies the validity of the design methodology.

  7. The early years of string theory: The dual resonance model

    International Nuclear Information System (INIS)

    Ramond, P.

    1987-10-01

    This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story

  8. Dual band metamaterial perfect absorber based on Mie resonances

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiaoming; Lan, Chuwen; Li, Bo; Zhou, Ji, E-mail: zhouji@tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Bi, Ke [School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhao, Qian [State Key Lab of Tribology, Department of Precision Instruments and Mechanology, Tsinghua University, Beijing 100084 (China)

    2016-08-08

    We numerically and experimentally demonstrated a polarization insensitive dual-band metamaterial perfect absorber working in wide incident angles based on the two magnetic Mie resonances of a single dielectric “atom” with simple structure. Two absorption bands with simulated absorptivity of 99% and 96%, experimental absorptivity of 97% and 94% at 8.45 and 11.97 GHz were achieved due to the simultaneous magnetic and electric resonances in dielectric “atom” and copper plate. Mie resonances of dielectric “atom” provide a simple way to design metamaterial perfect absorbers with high symmetry.

  9. Interacting-string picture of dual-resonance models

    International Nuclear Information System (INIS)

    Mandelstam, S.

    1985-01-01

    Dual-resonance models are an alyzed by means of operators which act within the physical Hilbert space of positive-metric states. The basis of the method is to extend the relativistic-string picture of a previous study to interacting particles. Functional methods are used, but their relation to the operator is evident, and factorization is maintained. An expression is given for the N-point amplitude in terms of physical-particle operators. For the three-point function the Neumann functions which occur in this expression are evaluated, so that we have a formula for the on- and off-energy-shell vertex. The authors assume that the string has no longitudinal degrees of freedom, and their results are Lorentz invariant and dual only if d=26

  10. Theory and Applications of Surface Plasmon Resonance, Resonant Mirror, Resonant Waveguide Grating, and Dual Polarization Interferometry Biosensors

    Directory of Open Access Journals (Sweden)

    Billy W. Day

    2010-11-01

    Full Text Available Biosensors have been used extensively in the scientific community for several purposes, most notably to determine association and dissociation kinetics, protein-ligand, protein-protein, or nucleic acid hybridization interactions. A number of different types of biosensors are available in the field, each with real or perceived benefits over the others. This review discusses the basic theory and operational arrangements of four commercially available types of optical biosensors: surface plasmon resonance, resonant mirror, resonance waveguide grating, and dual polarization interferometry. The different applications these techniques offer are discussed from experiments and results reported in recently published literature. Additionally, recent advancements or modifications to the current techniques are also discussed.

  11. Auxiliary buildings

    International Nuclear Information System (INIS)

    Lakner, I.; Lestyan, E.

    1979-01-01

    The nuclear power station represents a complicated and a particular industrial project. Consequently, the design of the auxiliary buildings serving the power station (offices, kitchen, refreshment room, workshops, depots, water treatment plant building, boiler houses, etc.) requires more attention than usual. This chapter gives a short survey of the auxiliary buildings already completed and discusses the problems of their design, location and structure. (author)

  12. Analysis and measurement of the stability of dual-resonator oscillators

    KAUST Repository

    Ghaed, Hassan

    2012-01-01

    This paper investigates the stability of oscillators with dual-resonating tanks. After deriving oscillator models, it is shown that contrary to prior belief, there can be only one stable oscillating state. Sufficient conditions for stable oscillating states are derived and silicon measurement results are used to prove their validity. A fully integrated transmitter for intraocular pressure sensing that leverages the dual-resonator tank is designed and fabricated based on the derived models. An unstable version of the transmitter is also demonstrated to prove the concept of instability in dual-resonator oscillators © 2012 IEEE.

  13. Dual resonant structure for energy harvesting from random vibration sources at low frequency

    Directory of Open Access Journals (Sweden)

    Shanshan Li

    2016-01-01

    Full Text Available We introduce a design with dual resonant structure which can harvest energy from random vibration sources at low frequency range. The dual resonant structure consists of two spring-mass subsystems with different frequency responses, which exhibit strong coupling and broad bandwidth when the two masses collide with each other. Experiments with piezoelectric elements show that the energy harvesting device with dual resonant structure can generate higher power output than the sum of the two separate devices from random vibration sources.

  14. Design of a Dual-Band Bandpass Filter Using an Open-Loop Resonator

    Directory of Open Access Journals (Sweden)

    Hyun-Seo Im

    2017-10-01

    Full Text Available In this paper, we present a novel design for a dual-band bandpass filter (BPF based on the conventional second-order, open-loop BPF. By adding series resonant circuits to the open ends of the resonator, we can create two resonant modes from the even and odd modes. One pair of the even and odd modes constitutes the upper passband, while the other pair constitutes the lower passband. By adding another series resonant circuit to the open-loop resonator, we can control the bandwidth of either the upper passband or the lower passband. We can replace the series resonant circuits with simple microstrip line resonators. A dual-band BPF working at both Wi-Fi bands (2.4 GHz and 5.8 GHz bands is designed based on the proposed method and is tested. The measured and simulated results show excellent agreement.

  15. Pluronic F127 as auxiliary template for preparing nitrogen and oxygen dual doped mesoporous carbon cathode of lithium-oxygen batteries

    Science.gov (United States)

    Wu, Junwei; Liu, Yanchen; Cui, Yanhui; Ouyang, Jue; Baker, Andrew P.; Li, Zuohua; Zhang, Huayu

    2018-02-01

    Two mesoporous carbon foam (MCF) with nitrogen and oxygen dual doped are fabricated through facile templated hydrothermal process. One using fumed silica as single template is named S-MCF, and another using fumed silica and Pluronic F127 as double templates is named D-MCF. When using Pluronic F127 as an auxiliary template, the D-MCF shows different porous architecture and surface chemical nature from S-MCF, thus they behave differently as cathode materials in Li-O2 batteries. The D-MCF electrode exhibits a slight lower discharge capacity and an increased overpotential than that of S-SCF due to the decreased surface area and oxygen content. However, a better cycle stability was proved for the D-MCF electrode because of its higher nitrogen and lower oxygen content. When further composited with RuO2 nanoparticles, the RuO2/D-MCF cathode can operate 160 cycles with capacity cutoff of 500 mAh g-1, and this prolonged cycle life, compared to the 102 cycles of S-MCF cathode, verifies the superior electrochemical stability of D-MCF further and illuminates the crucial role of carbon substrate in the cathodes of Li-O2 batteries.

  16. Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

    Energy Technology Data Exchange (ETDEWEB)

    Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)

    2017-12-15

    Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

  17. Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

    International Nuclear Information System (INIS)

    Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian

    2017-01-01

    Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

  18. Modelling and analysis of the transformer current resonance in dual active bridge converters

    DEFF Research Database (Denmark)

    Qin, Zian; Shen, Zhan; Blaabjerg, Frede

    2017-01-01

    . In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model......Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency...

  19. 360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

    DEFF Research Database (Denmark)

    Pu, Minhao; Xue, Weiqi; Liu, Liu

    2010-01-01

    We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...

  20. Design of a dual linear polarization antenna using split ring resonators at X-band

    Science.gov (United States)

    Ahmed, Sadiq; Chandra, Madhukar

    2017-11-01

    Dual linear polarization microstrip antenna configurations are very suitable for high-performance satellites, wireless communication and radar applications. This paper presents a new method to improve the co-cross polarization discrimination (XPD) for dual linear polarized microstrip antennas at 10 GHz. For this, three various configurations of a dual linear polarization antenna utilizing metamaterial unit cells are shown. In the first layout, the microstrip patch antenna is loaded with two pairs of spiral ring resonators, in the second model, a split ring resonator is placed between two microstrip feed lines, and in the third design, a complementary split ring resonators are etched in the ground plane. This work has two primary goals: the first is related to the addition of metamaterial unit cells to the antenna structure which permits compensation for an asymmetric current distribution flow on the microstrip antenna and thus yields a symmetrical current distribution on it. This compensation leads to an important enhancement in the XPD in comparison to a conventional dual linear polarized microstrip patch antenna. The simulation reveals an improvement of 7.9, 8.8, and 4 dB in the E and H planes for the three designs, respectively, in the XPD as compared to the conventional dual linear polarized patch antenna. The second objective of this paper is to present the characteristics and performances of the designs of the spiral ring resonator (S-RR), split ring resonator (SRR), and complementary split ring resonator (CSRR) metamaterial unit cells. The simulations are evaluated using the commercial full-wave simulator, Ansoft High-Frequency Structure Simulator (HFSS).

  1. Experimental results of high power dual frequency resonant magnet excitation at TRIUMF

    International Nuclear Information System (INIS)

    Reiniger, K.W.; Heritier, G.

    1988-06-01

    We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)

  2. High sensitive LPFG magnetic field sensor based on dual-peak resonance

    Science.gov (United States)

    Gu, Zhengtian; Ling, Qiang; Lan, Jinlong; Gao, Kan

    2017-11-01

    A high sensitivity magnetic field sensor based on magnetic-fluid-clad LPFG structure with dual peak resonance is presented and experimentally investigated. Based on coupled mode theory, the sensing principle of this sensor is originated from the sensibility of the dual peak based LPFG to the environment refractive index. In experiment, a dual peak interval change was available to 38 nm with a magnetic field strength varying from 0 to 12 mT when the temperature was 17.3 °C, and the dual peak interval displays a cubic polynomial dependence with the magnetic field strength at the low field regime. The sensitivity of this sensor to the magnetic field can be available to 4.08 nm/mT, and it is one order and two orders of magnitude higher than that of the sensors based on MSM and SMS fiber structure, respectively. The novel sensor has many advantages of simple technology, structure stability and high sensitivity.

  3. Design and analysis of a novel dual-mass MEMS resonant output gyroscope

    Directory of Open Access Journals (Sweden)

    Yang Gao

    2018-02-01

    Full Text Available This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS resonant output gyroscope (ROG, which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.

  4. Design and analysis of a novel dual-mass MEMS resonant output gyroscope

    Science.gov (United States)

    Gao, Yang; Ding, Xukai; Huang, Libin; Li, Hongsheng

    2018-02-01

    This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS) resonant output gyroscope (ROG), which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF) resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.

  5. Dual-Band Notch Filter Based on Twist Split Ring Resonators

    Directory of Open Access Journals (Sweden)

    Haibin Sun

    2014-01-01

    Full Text Available A novel dual-band rectangular waveguide notch filter is experimentally investigated in this paper. Such filter is realized by integrating two pairs of split ring resonators (SRRs printed on the two sides of a dielectric slab with twist angles and separated as a distance in the center of the rectangular waveguide. Due to the coupling effects between the twist SRRs and between the original SRRs and their mirror images generated by the metallic walls perpendicular to the E-field direction, it can flexibly contribute two disjunct resonance states and result in the dual-band notch properties. Furthermore, the two resonance frequencies can be controlled by changing the twist angles, resulting in the shifts of notch frequency bands.

  6. Dual-axis resonance testing of wind turbine blades

    Science.gov (United States)

    Hughes, Scott; Musial, Walter; White, Darris

    2014-01-07

    An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.

  7. Highly Selective Dual-Mode Microstrip Bandpass Filters Using Triangular Patch Resonators

    Directory of Open Access Journals (Sweden)

    K.G. Avinash

    2017-03-01

    Full Text Available In this paper, highly selective dual-mode microstrip bandpass filters are proposed using horizontal and vertical slots formed on the surface of a triangular patch. Slots are responsible for splitting and coupling of dual degenerate modes and also facilitate in controlling their resonant frequencies by varying the dimensions of the slots. Horizontal and vertical slots reroute the direction of the flow of current on the surface of the patch, which results in switching of transmission zeros. Two 2-pole and one 4-pole dual-mode filters are designed, simulated and fabricated. Two pole filters have transmission zeros on side of the passband and four pole filter have transmission zeros on both sides of the passband. The designed filters exhibit a fractional bandwidth of less than 7 % and there is a good agreement between simulated and measured results.

  8. Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

    DEFF Research Database (Denmark)

    Pu, Minhao; Liu, Liu; Xue, Weiqi

    2010-01-01

    We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator....... A quasi-linear phase shift of 360° with RF-power variation lower than 2dB and a continuous 270° phase shift without RF-power variation at a microwave frequency of 40GHz are also demonstrated....

  9. Dual and tri-band bandpass filters based on novel Π-shaped resonator

    Science.gov (United States)

    Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei

    2014-05-01

    A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.

  10. Orthodontic springs and auxiliary appliances: assessment of magnetic field interactions associated with 1.5 T and 3 T magnetic resonance systems

    International Nuclear Information System (INIS)

    Kemper, J.; Priest, A.N.; Adam, G.; Schulze, D.; Kahl-Nieke, B.; Klocke, A.

    2007-01-01

    The objective of this paper is to evaluate magnetic field interactions at 1.5 and 3 T for 20 orthodontic devices used for fixed orthodontic therapy. Twenty springs and auxiliary parts made from varying ferromagnetic alloys were tested for magnetic field interactions in the static magnetic field at 1.5 and 3 T. Magnetic translational force F z (in millinewtons) was evaluated by determining the deflection angle β [American Society for Testing and Materials (ASTM standard test method)]. Magnetic-field-induced rotational force F rot was qualitatively determined using a five-point scale. β was found to be >45 in 13(15) devices at 1.5(3) T and translational force F z exceeded gravitational force F g on the particular object [F z 10.17-261.4 mN (10.72-566.4 mN) at 1.5(3) T]. F z was found to be up to 24.1(47.5)-fold higher than F g at 1.5(3) T. Corresponding to this, F rot on the objects was shown to be high at both field strengths (≥ +3). Three objects (at 1.5 T) and one object (at 3 T) showed deflection angles rot was found to be ≥ +3 at both field strengths. For the remaining objects, β was below 45 and torque measurements ranged from 0 to +2. Of 20 objects investigated for magnetic field interactions at 1.5(3) T, 13(15) were unsafe in magnetic resonance (MR), based on the ASTM criteria of F z . The implications of these results for orthodontic patients undergoing MRI are discussed. (orig.)

  11. Experimental Study on LTCC Glass-Ceramic Based Dual Segment Cylindrical Dielectric Resonator Antenna

    Directory of Open Access Journals (Sweden)

    Ravi Kumar Gangwar

    2013-01-01

    Full Text Available The measured characteristics in C/X bands, including material properties of a dual segment cylindrical dielectric resonator antenna (CDRA fabricated from glass-ceramic material based on B2O3–La2O3–MgO glass and La(Mg0.5Ti0.5O3 ceramic, are reported. The sintering characteristic of the ceramic in presence of glass is determined from contact angle measurement and DTA. The return loss and input impedance versus frequency characteristics and radiation patterns of CDRA at its resonant frequency of 6.31 GHz are studied. The measured results for resonant frequency and return loss bandwidth of the CDRA are also compared with corresponding theoretical ones.

  12. Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams

    Directory of Open Access Journals (Sweden)

    Xiaohui Du

    2016-01-01

    Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.

  13. Low-Interference Dual Resonant Antenna Configurations for Multistandard Multifunction Handsets and Portable Computers

    Directory of Open Access Journals (Sweden)

    Mohamed Sanad

    2012-01-01

    Full Text Available Low-interference dual resonant antenna configurations are developed for multistandard multifunction mobile handsets and portable computers. Only two wideband resonant antennas can cover most of the important wireless applications in portable communication equipment. The frequency bands of the dual antenna configuration can be adjusted according to the wireless applications that are required to be covered. The bandwidth that can be covered by each antenna is about 80% without using matching or tuning circuits. Three sample dual antenna configurations with different frequency bands are presented. The interference between the low-band and high-band antennas of these three configurations is investigated, and the ways of reducing this interference are studied. The most effective factor on the interference between the low-band and high-band antennas is their relative orientations. When the low-band and high-band antennas of each configuration are perpendicular to each other, the isolation between them significantly increases. This eliminates the need for any special tools or techniques to suppress the mutual coupling between them. The new antennas have very small cross-sectional areas, and they are made of a flexible material. They do not require any additional components or ground planes. They can be used as internal, external, or partially internal and partially external antennas.

  14. Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.

    Science.gov (United States)

    Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun

    2014-03-01

    To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.

  15. Hyperbranched conjugated polyelectrolyte for dual-modality fluorescence and magnetic resonance cancer imaging.

    Science.gov (United States)

    Ding, Dan; Wang, Guan; Liu, Jianzhao; Li, Kai; Pu, Kan-Yi; Hu, Yong; Ng, Jason C Y; Tang, Ben Zhong; Liu, Bin

    2012-11-19

    Herein is reported the synthesis of gadolinium ion (Gd(III))-chelated hyperbranched conjugated polyelectrolyte (HCPE-Gd) and its application in fluorescence and magnetic resonance (MR) dual imaging in live animals. The synthesized HCPE-Gd forms nanospheres with an average diameter of ∼42 nm measured by laser light scattering and a quantum yield of 10% in aqueous solution. The absorption spectrum of HCPE-Gd has two maxima at 318 and 417 nm, and its photoluminescence maximum centers at 591 nm. Confocal laser scanning microscopy studies indicate that the HCPE-Gd is internalized in MCF-7 cancer cell cytoplasm with good photostability and low cytotoxicity. Further fluorescence and MR imaging studies on hepatoma H22 tumor-bearing mouse model reveal that HCPE-Gd can serve as an efficient optical/MR dual-modal imaging nanoprobe for in vivo cancer diagnosis. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Harmonic suppressed coupled stepped-impedance resonator based dual-band tunable bandpass filter

    Directory of Open Access Journals (Sweden)

    Amarjit Kumar

    2017-10-01

    Full Text Available In this paper, a tunable dual-band bandpass filter (BPF based on a varactor-loaded coupled stepped-impedance resonator is presented. Transmission matrices techniques are employed to explain the working concept of proposed tunable BPF. For validating the proposed concept, a hardware prototype is fabricated and characterized. As per the measured results, when the center frequency of the lower band is tuning from 2.15 to 2.40 GHz, the upper band is fixed at 4.5 GHz; and when the center frequency of the upper band is tuning from 4.5 to 4.75 GHz, the lower passband almost remains constant at 2.25 GHz. Proposed tunable filter is capable of working at higher passband frequencies. Spurious harmonic suppression up to 15 GHz is demonstrated. Center frequency of dual-passband is tunable using only two dc control voltages.

  17. CRADA Final Report for CRADA Number ORNL98-0521 : Development of an Electric Bus Inverter Based on ORNL Auxiliary Resonant Tank (ART) Soft-Switching Technology; TOPICAL

    International Nuclear Information System (INIS)

    Ayers, C.W.

    2001-01-01

    The Power Electronics and Electric Machinery Research Center (PEEMRC) of Oak Ridge National Laboratory (ORNL) has for many years been developing technologies for power converters for motor drives and many other applications. Some of the research goals are to improve efficiency and reduce audible and electromagnetic interference noise generation for inverters and the driven loads. The converters are being required to produce more power with reduced weight and volume, which requires improvements in heat removal from the electronics, as well as improved circuit designs that have fewer electrical losses. PEEMRC has recently developed and patented a soft-switching inverter topology called an Auxiliary Resonant Tank (ART), and this design has been tested and proven at ORNL using a 10-kW laboratory prototype. The objective of this project was to develop, test, and install the ART inverter technology in an electric transit bus with the final goal of evaluating performance of the ORNL inverter under field conditions in a vehicle. A scaled-up inverter with the capacity to drive a 22-e bus was built based on the 10-kW ORNL laboratory prototype ART soft-switching inverter. Most (if not all) commercially available inverters for traction drive and other applications use hard-switching inverters. A Cooperative Research and Development Agreement was established with the Chattanooga Area Regional Transit Authority (CARTA), the Electric Transit Vehicle Institute (ETVI), and Advanced Vehicle Systems (AVS), all of Chattanooga, along with ORNL. CARTA, which maintains and operates the public transit system in Chattanooga, provided an area for testing the vehicle alongside other similar vehicles in the normal operating environment. ETVI offers capabilities in standardized testing and reporting and also provides exposure in the electric transit vehicle arena for ORNL's technologies. The third Chattanooga partner, (AVS) manufactures all-electric and hybrid electric transit buses using

  18. ``Green'' functionalization of magnetic nanoparticles via tea polyphenol for magnetic resonance/fluorescent dual-imaging

    Science.gov (United States)

    Jiang, Wen; Lai, Kuilin; Liu, Kexia; Xia, Rui; Gao, Fabao; Wu, Yao; Gu, Zhongwei

    2014-01-01

    Tea polyphenol serves as an environmentally friendly ligand-exchange molecule to synthesize multifunctional metal-doped superparamagnetic iron oxide nanoparticles via a catechol-metal coordination interaction. The resultant particles not only exhibit excellent hydrophilicity and protein adsorption resistance, but also are applicable as magnetic resonance/fluorescent dual-imaging probes due to their high T2 relaxivity, autofluorescence and large cellular uptake.Tea polyphenol serves as an environmentally friendly ligand-exchange molecule to synthesize multifunctional metal-doped superparamagnetic iron oxide nanoparticles via a catechol-metal coordination interaction. The resultant particles not only exhibit excellent hydrophilicity and protein adsorption resistance, but also are applicable as magnetic resonance/fluorescent dual-imaging probes due to their high T2 relaxivity, autofluorescence and large cellular uptake. Electronic supplementary information (ESI) available: Additional information and figures (Fig. S1-S7), including experimental sections, characterization of the products, protein corona analysis, cytotoxicity and cellular uptake quantification. See DOI: 10.1039/c3nr05003c

  19. Throughput Measurement of a Dual-Band MIMO Rectangular Dielectric Resonator Antenna for LTE Applications.

    Science.gov (United States)

    Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais

    2017-01-13

    An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.

  20. Auxiliary verbs in Dinka

    DEFF Research Database (Denmark)

    Andersen, Torben

    2007-01-01

    Dinka, a Western Nilotic language, has a class of auxiliary verbs which is remarkable in the following four respects: (i) It is unusually large, comprising some 20 members; (ii) it is grammatically homogeneous in terms of both morphology and syntax; (iii) most of the auxiliary verbs correspond...... to adverbs in languages like English, while the rest are tense-aspect markers; and (iv) it is possible to combine several auxiliary verbs in a single clause. For some of the auxiliary verbs there are extant full verbs from which they have evolved. To some extent, therefore, it is possible to observe what...

  1. Dual Strip-Excited Dielectric Resonator Antenna with Parasitic Strips for Radiation Pattern Reconfigurability

    Directory of Open Access Journals (Sweden)

    M. Kamran Saleem

    2014-01-01

    Full Text Available A novel pattern reconfigurable antenna concept utilizing rectangular dielectric resonator antenna (DRA placed over dielectric substrate backed by a ground plane is presented. A dual strip excitation scheme is utilized and both excitation strips are connected together by means of a 50 Ω microstrip feed network placed over the substrate. The four vertical metallic parasitic strips are placed at corner of DRA each having a corresponding ground pad to provide a short/open circuit between the parasitic strip and antenna ground plane, through which a shift of 90° in antenna radiation pattern in elevation plane is achieved. A fractional bandwidth of approximately 40% at center frequency of 1.6 GHz is achieved. The DRA peak realized gain in whole frequency band of operation is found to be above 4 dB. The antenna configuration along with simulation and measured results are presented.

  2. A Novel Triple-Mode Bandpass Filter Based on a Dual-Mode Defected Ground Structure Resonator and a Microstrip Resonator

    Directory of Open Access Journals (Sweden)

    Xuehui Guan

    2013-01-01

    Full Text Available A novel triple-mode bandpass filter (BPF using a dual-mode defected ground structure (DGS resonator and a microstrip resonator is proposed in this paper. The dual-mode characteristic is achieved by loading a defected T-shaped stub to a uniform impedance DGS resonator. A uniform impedance microstrip resonator is designed on the top layer of the DGS resonator and a compact bandpass filter with three resonant modes in the passband can be achieved. A coupling scheme for the structure is given and the coupling matrix is synthesized. Based on the structure, a triple-mode BPF with central frequency of 2.57 GHz and equal ripple bandwidth of 15% is designed for the Wireless Local Area Network. Three transmission zeros are achieved at 1.48 GHz, 2.17 GHz, and 4.18 GHz, respectively, which improve the stopband characteristics of the filter. The proposed filter is fabricated and measured. Good agreements between measured results and simulated results verify the proposed structure well.

  3. Modification of anisotropic plasma diffusion via auxiliary electrons emitted by a carbon nanotubes-based electron gun in an electron cyclotron resonance ion source.

    Science.gov (United States)

    Malferrari, L; Odorici, F; Veronese, G P; Rizzoli, R; Mascali, D; Celona, L; Gammino, S; Castro, G; Miracoli, R; Serafino, T

    2012-02-01

    The diffusion mechanism in magnetized plasmas is a largely debated issue. A short circuit model was proposed by Simon, assuming fluxes of lost particles along the axial (electrons) and radial (ions) directions which can be compensated, to preserve the quasi-neutrality, by currents flowing throughout the conducting plasma chamber walls. We hereby propose a new method to modify Simon's currents via electrons injected by a carbon nanotubes-based electron gun. We found this improves the source performances, increasing the output current for several charge states. The method is especially sensitive to the pumping frequency. Output currents for given charge states, at different auxiliary electron currents, will be reported in the paper and the influence of the frequency tuning on the compensation mechanism will be discussed.

  4. Auxiliary Deep Generative Models

    DEFF Research Database (Denmark)

    Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    2016-01-01

    Deep generative models parameterized by neural networks have recently achieved state-of-the-art performance in unsupervised and semi-supervised learning. We extend deep generative models with auxiliary variables which improves the variational approximation. The auxiliary variables leave...... faster with better results. We show state-of-the-art performance within semi-supervised learning on MNIST (0.96%), SVHN (16.61%) and NORB (9.40%) datasets....

  5. An ultra-thin dual-band phase-gradient metasurface using hybrid resonant structures for backward RCS reduction

    Science.gov (United States)

    Cheng, Yongzhi; Wu, Chenjun; Ge, Chenchen; Yang, Jiaji; Pei, Xiaojun; Jia, Fan; Gong, Rongzhou

    2017-05-01

    We introduce and investigate, both experimentally and theoretically, a dual-band phase-gradient metasurface (PGM) to accurately facilitate dual-band beams deflection for electromagnetic waves. The designed PGM is composed of two kinds of split-ring resonators as the basic element of a super cell. These hybrid resonant structures can generate phase gradients at two distinct frequencies, which, in turn, generate appropriately artificial wave vectors that meet the requirements for anomalous reflection in terms of generalized Snell's law. Both simulations and experiments are consistent with the theoretical predictions. Further, this PGM can work at 8.9 and 11.4 GHz frequencies providing a phenomenon of anomalous reflection, which is useful for backward radar cross section reduction.

  6. Coupling Influence on Signal Readout of a Dual-Parameter LC Resonant System

    Directory of Open Access Journals (Sweden)

    Jijun Xiong

    2015-01-01

    Full Text Available Dual-parameter inductive-capacitive (LC resonant sensor is gradually becoming the measurement trend in complex harsh environments; however, the coupling between inductors greatly affects the readout signal, which becomes very difficult to resolve by means of simple mathematical tools. By changing the values of specific variables in a MATLAB code, the influence of coupling between coils on the readout signal is analyzed. Our preliminary conclusions underline that changing the coupling to antenna greatly affects the readout signal, but it simultaneously influences the other signal. When f01=f02, it is better to broaden the difference between the two coupling coefficients k1 and k2. On the other side, when f01 is smaller than f02, it is better to decrease the coupling between sensor inductors k12, in order to obtain two readout signals averaged in strength. Finally, a test system including a discrete capacitor soldered to a printed circuit board (PCB based planar spiral coil is built, and the readout signals under different relative inductors positions are analyzed. All experimental results are in good agreement with the results of the MATLAB simulation.

  7. Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency

    Directory of Open Access Journals (Sweden)

    C. Baccouch

    2016-11-01

    Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally   it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.

  8. Auxiliary mine ventilation manual

    International Nuclear Information System (INIS)

    Workplace Safety North

    2010-01-01

    An adequate ventilation system is needed for air quality and handling in a mine and is comprised of many different pieces of equipment for removing contaminated air and supplying fresh air and thereby provide a satisfactory working environment. This manual highlights auxiliary ventilation systems made up of small fans, ducts, tubes, air movers, deflectors and additional air flow controls which distribute fresh air delivered by the primary system to all areas. A review of auxiliary ventilation is provided. Design, operation and management issues are discussed and guidelines are furnished. This manual is limited to underground hard rock operations and does not address directly other, specific auxiliary systems, either in underground coal mines or uranium mines.

  9. CAREM-25. Auxiliary systems

    International Nuclear Information System (INIS)

    Acosta, Eduardo; Amaya, Daniel; Carlevaris, Rodolfo; Patrignani, A.; Ramilo, L.; Santecchia, A.; Vindrola, C.

    2000-01-01

    CAREM is an innovative PWR reactor whose prototype will be of small power generation capacity (100MWt, about 25MWe).CAREM design is based on light water integrated reactor with slightly enriched uranium.In this work, a summary of the functions and most relevant design characteristics of main auxiliary systems associated to the chain of heat removal and physicochemical - radiological treatment of the cooling fluids of the CAREM-25 prototype is presented.Even though these auxiliary systems of the reactor are not safety system, they fulfill functions related with the nuclear safety at different operative modes of the reactor

  10. CAREM-25. Auxiliary systems

    International Nuclear Information System (INIS)

    Acosta, Eduardo; Amaya, Daniel; Carlevaris, Rodolfo; Patrignani, Alberto; Santecchia, Alberto; Vindrola, Carlos; Ramilo, Lucia B.

    2000-01-01

    CAREM is an innovative PWR reactor whose prototype will be of small power generation capacity (100 M Wt, about 25 M We). CAREM design is based on light water integrated reactor with slightly enriched uranium. In this work, a summary of the functions and most relevant design characteristics of main auxiliary systems associated to the chain of heat removal and physicochemical - radiological treatment of the cooling fluids of the CAREM-25 prototype is presented. Even though these auxiliary systems of the reactor are not safety system, they fulfill functions related with the nuclear safety at different operative modes of the reactor. (author)

  11. Development of a universal dual-bolus injection scheme for the quantitative assessment of myocardial perfusion cardiovascular magnetic resonance

    Directory of Open Access Journals (Sweden)

    Alfakih Khaled

    2011-05-01

    Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined

  12. Implementation and Investigation of a Compact Circular Wide Slot UWB Antenna with Dual Notched Band Characteristics using Stepped Impedance Resonators

    Directory of Open Access Journals (Sweden)

    Yingsong Li

    2012-04-01

    Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.

  13. HTS dual-band bandpass filters using stub-loaded hair-pin resonators for mobile communication systems

    Energy Technology Data Exchange (ETDEWEB)

    Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.

    2014-09-15

    Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.

  14. Operation auxiliary system (SAO)

    International Nuclear Information System (INIS)

    Lolich, J.; Santome, D.; Drexler, J.

    1990-01-01

    This work presents an auxiliary system for nuclear power plants operation (SAO). The development purpose consisted in a computing supervision system to be installed at different sites of a reactor, mainly in the control room. The inclusion of this system to a nuclear power plant minimizes the possibility of human error for the facility operation. (Author) [es

  15. PS auxiliary magnet

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Units of the PS auxiliary magnet system. The picture shows how the new dipoles, used for vertical and horizontal high-energy beam manipulation, are split for installation and removal so that it is not necessary to break the accelerator vacuum. On the right, adjacent to the sector valve and the windings of the main magnet, is an octupole of the set.

  16. Myocardial perfusion cardiovascular magnetic resonance: optimized dual sequence and reconstruction for quantification.

    Science.gov (United States)

    Kellman, Peter; Hansen, Michael S; Nielles-Vallespin, Sonia; Nickander, Jannike; Themudo, Raquel; Ugander, Martin; Xue, Hui

    2017-04-07

    ml/min/g using the BTEX model and 3.4 ± 0.39 and 0.95 ± 0.16 using a Fermi model, for stress and rest, respectively. A dual sequence for myocardial perfusion cardiovascular magnetic resonance and AIF measurement has been optimized for quantification of myocardial blood flow. A validation in phantoms was performed to confirm that the signal conversion to gadolinium concentration was linear. The proposed sequence was integrated with a fully automatic in-line solution for pixel-wise mapping of myocardial blood flow and evaluated in adenosine stress and rest studies on N = 29 normal healthy subjects. Reliable perfusion mapping was demonstrated and produced estimates with low variability.

  17. Two-point active microrheology in a viscous medium exploiting a motional resonance excited in dual-trap optical tweezers

    Science.gov (United States)

    Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan

    2018-04-01

    Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.

  18. Dual temperature isotope exchange system

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1976-01-01

    Improvements in the method for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. In a preferred embodiment the first is a vaporizable liquid and the auxiliary fluid a gas, comprising steps for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations

  19. Dual imaging probes for magnetic resonance imaging and fluorescence microscopy based on perovskite manganite nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Kačenka, M.; Kaman, Ondřej; Kotek, J.; Falteisek, L.; Černý, J.; Jirák, D.; Herynek, V.; Zacharovová, K.; Berková, A.; Jendelová, Pavla; Kupčík, Jaroslav; Pollert, Emil; Veverka, Pavel; Lukeš, I.

    2011-01-01

    Roč. 21, č. 1 (2011), s. 157-164 ISSN 0959-9428 R&D Projects: GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z50390703; CEZ:AV0Z40720504 Keywords : cellular labelling * dual probe * magnetic nanoparticles * MRI * silica coating Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  20. Red-Green-Blue Trichromophoric Nanoparticles with Dual Fluorescence Resonance Energy Transfer: Highly Sensitive Fluorogenic Response Toward Polyanions.

    Science.gov (United States)

    Xu, Jinjia; Takai, Atsuro; Takeuchi, Masayuki

    2016-09-05

    A red-green-blue (RGB) trichromophoric fluorescent organic nanoparticle exhibiting multi-colour emission was constructed; the blue-emitting cationic oligofluorene nanoparticle acted as an energy-donor scaffold to undergo fluorescence resonance energy transfer (FRET) to a red-emitting dye embedded in the nanoparticle (interior FRET) and to a green-emitting dye adsorbed on the surface through electrostatic interactions (exterior FRET). Each FRET event occurs independently and is free from sequential FRET, thus the resultant dual-FRET system exhibits multi-colour emission, including white, in aqueous solution and film state. A characteristic white-emissive nanoparticle showed visible responses upon perturbation of the exterior FRET efficiency by acceptor displacement, leading to highly sensitive responses toward polyanions in a ratiometric manner. Specifically, our system exhibits high sensitivity toward heparin with an extremely low detection limit. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    International Nuclear Information System (INIS)

    Amoudache, Samira; Moiseyenko, Rayisa; Pennec, Yan; Rouhani, Bahram Djafari; Khater, Antoine; Lucklum, Ralf; Tigrine, Rachid

    2016-01-01

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.

  2. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    DEFF Research Database (Denmark)

    Amoudache, Samira; Moiseyenko, Rayisa; Pennec, Yan

    2016-01-01

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well......-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation...... of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes....

  3. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    Energy Technology Data Exchange (ETDEWEB)

    Amoudache, Samira [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria); Moiseyenko, Rayisa [Department of Physics, Technical University of Denmark, DTU Physics, Building 309, DK-2800 Kongens Lyngby (Denmark); Pennec, Yan, E-mail: yan.pennec@univ-lille1.fr; Rouhani, Bahram Djafari [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Khater, Antoine [Institut des Molécules et Matériaux du Mans (IMMM), UMR CNRS 6283, l' UNAM, Université du Maine, 72085 Le Mans (France); Lucklum, Ralf [Institute of Micro and Sensor Systems (IMOS), Otto-von-Guericke-University, P.O. Box 4120, D-39016 Magdeburg (Germany); Tigrine, Rachid [Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria)

    2016-03-21

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.

  4. Dual Resonant Frequencies Effects on an Induction-Based Oil Palm Fruit Sensor

    Directory of Open Access Journals (Sweden)

    Noor Hasmiza Harun

    2014-11-01

    Full Text Available As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB. Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB. A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA. To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

  5. A Compact High-Pass Filter Using Hybrid Microstrip/Nonuniform CPW with Dual-Mode Resonant Response

    Directory of Open Access Journals (Sweden)

    Hui Chen

    2016-01-01

    Full Text Available A novel and miniature high-pass filter (HPF based on a hybrid-coupled microstrip/nonuniform coplanar waveguide (CPW resonator is proposed in this article, in which the designed CPW has exhibited a wideband dual-mode characteristic within the desired high-pass frequency range. The implemented filter consists of the top microstrip coupled patches and the bottom modified nonuniformly short-circuited CPW resonator. Simulated results from the electromagnetic (EM analysis software and measured results from a vector network analyzer (VNA show a good agreement. A designed and fabricated prototype filter having a 3 dB cutoff frequency (fc of 5.78 GHz has shown an ultrawide high-pass behavior, which exhibits the highest passband frequency exceeding 4.0fc under the minimum insertion loss (IL 0.75 dB. The printed circuit board (PCB area of the filter is approximately 0.062λg×0.093λg, where λg is the guided wavelength at fc.

  6. Intersection auxiliary signal system

    Science.gov (United States)

    Zhang, Jian

    1995-12-01

    Many intersection accidents are related to drivers' inappropriate responses to an amber signal light, due to their misjudgment on the traffic situation and/or their aggressive behavior. To reduce intersection accidents of this nature, this paper proposes the Intersection Auxiliary Signal System (IAS). IAS can be installed at selected intersections, where information regarding signal phasing, intersection geometry and speed limit is transmitted from an ultrasonic/infra-red transmitter. An on-vehicle device receivers and processes the information, the provides the driver with explicit suggestions on the correct action to take (continue to pass or decelerate to stop), or warnings against on-going incorrect actions. IAS is expected to be more effective in suburban intersections, which are usually characterized by greater dimension, longer amber phases, and higher vehicle speeds. Both the intersection transmitters and the on-vehicle processors are expected to have simple structures and low costs. Simulation results show that IAS has a significant effect on reducing red signal violation, especially when there is no significant dilemma zones.

  7. Mechanical (turbines and auxiliary equipment)

    CERN Document Server

    Sherry, A; Cruddace, AE

    2013-01-01

    Modern Power Station Practice, Volume 3: Mechanical (Turbines and Auxiliary Equipment) focuses on the development of turbines and auxiliary equipment used in power stations in Great Britain. Topics covered include thermodynamics and steam turbine theory; turbine auxiliary systems such as lubrication systems, feed water heating systems, and the condenser and cooling water plants. Miscellaneous station services, and pipework in power plants are also described. This book is comprised of five chapters and begins with an overview of thermodynamics and steam turbine theory, paying particular attenti

  8. Design and analysis of dual ring resonator based 2D-photonic crystal WDDM

    Science.gov (United States)

    Venkatachalam, K.; Robinson, S.; Kumar, D. Sriram

    2017-06-01

    In this paper, four channel 2D Photonic Crystal (PC) based Wavelength Division Demultiplexer (WDDM) using 2D-Photonic Crystal is proposed and designed. The important functional parameters of the proposed demultiplexer such as transmission efficiency, Q factor and resonant wavelength are analyzed. The Plane Wave Expansion (PWE) method and Finite Difference Time Domain (FDTD) method are employed to calculate the photonic band gap and normalized output spectrum of the proposed demultiplexer. The average transmission efficiency and Q factor of this proposed device is about 93% and 781, respectively. The overall size of the demultiplexer is around 681 µm2 which will be suitable for integrated optics for future all optical networks.

  9. Study on Brilliant Blue-chitosan System by Dual-wavelength Overlapping Resonance Rayleigh Scattering Method and its Analytical Applications

    Science.gov (United States)

    Ma, Caijuan; Sun, Zijun; Liu, Guihua; Su, Zhengquan; Bai, Yan

    2018-02-01

    The method was presented for the sensitive and selective determination of chitosan (CTS) in health products with Brilliant Blue (BB) as a probe, based on dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS). In weakly acidic buffer solution, the binding of CTS and BB could result in the RRS intensities getting enhanced significantly at RRS peaks of 344 nm and 452 nm, and the scattering intensities of the two peaks were proportional to the concentration of CTS within a certain range. When the RRS intensities of the two wavelengths were superposed, the results showed higher sensitivity. Under the optimum experimental conditions, the total of the two increased RRS intensities was linear to the CTS concentration in the range of 0.02-1.80 μg/mL and the limit of detection (LOD) was 7.45 ng/mL. In this work, the optimum conditions and the effects of some foreign substances were studied. Accordingly, the new method based on DWO-RRS for the determination of CTS was developed. In addition, the effect of the molecular weight and the deacetylation degree between different chitosan molecules was discussed. Finally, this assay was applied to determine the concentration of CTS in health products with satisfactory results.

  10. Dual curved photonic crystal ring resonator based channel drop filter using two-dimensional photonic crystal structure

    Energy Technology Data Exchange (ETDEWEB)

    Chhipa, Mayur Kumar, E-mail: mayurchhipa1@gmail.com [Deptt. of Electronics and Communication Engineering, Government Engineering College Ajmer Rajasthan INDIA (India); Dusad, Lalit Kumar [Rajasthan Technical University Kota, Rajasthan (India)

    2016-05-06

    In this paper channel drop filter (CDF) is designed using dual curved photonic crystal ring resonator (PCRR). The photonic band gap (PBG) is calculated by plane wave expansion (PWE) method and the photonic crystal (PhC) based on two dimensional (2D) square lattice periodic arrays of silicon (Si) rods in air structure have been investigated using finite difference time domain (FDTD) method. The number of rods in Z and X directions is 21 and 20 respectively with lattice constant 0.540 nm and rod radius r = 0.1 µm. The channel drop filter has been optimized for telecommunication wavelengths λ = 1.591 µm with refractive indices 3.533. In the designed structure further analysis is also done by changing whole rods refractive index and it has been observed that this filter may be used for filtering several other channels also. The designed structure is useful for CWDM systems. This device may serve as a key component in photonic integrated circuits. The device is ultra compact with the overall size around 123 µm{sup 2}.

  11. White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 1: Technology and Terminology.

    Science.gov (United States)

    Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

    This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.

  12. Dual breath-hold magnetic resonance cine evaluation of global and regional cardiac function

    International Nuclear Information System (INIS)

    Wintersperger, Bernd J.; Dietrich, Olaf; Huber, Armin; Reiser, Maximilian F.; Schoenberg, Stefan O.; Sincleair, Spencer; Runge, Val M.

    2007-01-01

    The purpose of our study was to evaluate the accuracy of a multislice cine magnetic resonance imaging (MRI) technique with parallel imaging in regard to global and regional left ventricular function. Forty-two individuals underwent cine MRI on a 1.5-tesla scanner. Cine MRI used a steady-state free precession technique and was performed as a single-slice technique (nonTSENSE cine) and an accelerated multislice technique (TSENSE cine) with five slices per breath-hold. End diastolic volume (EDV), end systolic volume (ESV), and ejection fraction (EF) were evaluated for all data sets and in regard to regional wall motion and regional wall motion analysis, and quantitative regional wall thickness and systolic thickening were also assessed. EDV, ESV, and EF based on TSENSE cine showed excellent correlation to the nonTSENSE cine approach (all r 2 =0.99, P<0.001). While EDV evaluations showed a small underestimation for TSENSE cine, ESV and EF showed accurate results compared with nonTSENSE cine. Both readers showed good agreement (κ=0.72) in regional wall motion assessment comparing both techniques. Data acquisition for the multislice approach was significantly shorter (∝75%) that in single-slice cine. We conclude that accurate evaluation of regional wall motion and left ventricular EF is possible using accelerated multislice cine MR with high spatial and temporal resolution. (orig.)

  13. Dual-Mode Gas Sensor Composed of a Silicon Nanoribbon Field Effect Transistor and a Bulk Acoustic Wave Resonator: A Case Study in Freons.

    Science.gov (United States)

    Chang, Ye; Hui, Zhipeng; Wang, Xiayu; Qu, Hemi; Pang, Wei; Duan, Xuexin

    2018-01-25

    In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET) and a film bulk acoustic resonator (FBAR). We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b) is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS)-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.

  14. Dual-Mode Gas Sensor Composed of a Silicon Nanoribbon Field Effect Transistor and a Bulk Acoustic Wave Resonator: A Case Study in Freons

    Directory of Open Access Journals (Sweden)

    Ye Chang

    2018-01-01

    Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.

  15. Nanoparticles in magnetic resonance imaging: from simple to dual contrast agents

    Directory of Open Access Journals (Sweden)

    Estelrich J

    2015-03-01

    Full Text Available Joan Estelrich,1,2 María Jesús Sánchez-Martín,1 Maria Antònia Busquets1,2 1Departament de Fisicoquímica, Facultat de Farmàcia, Universitat de Barcelona, Barcelona, Catalonia, Spain; 2Institut de Nanociència I Nanotecnologia (IN2UB, Barcelona, Catalonia, SpainAbstract: Magnetic resonance imaging (MRI has become one of the most widely used and powerful tools for noninvasive clinical diagnosis owing to its high degree of soft tissue contrast, spatial resolution, and depth of penetration. MRI signal intensity is related to the relaxation times (T1, spin–lattice relaxation and T2, spin–spin relaxation of in vivo water protons. To increase contrast, various inorganic nanoparticles and complexes (the so-called contrast agents are administered prior to the scanning. Shortening T1 and T2 increases the corresponding relaxation rates, 1/T1 and 1/T2, producing hyperintense and hypointense signals respectively in shorter times. Moreover, the signal-to-noise ratio can be improved with the acquisition of a large number of measurements. The contrast agents used are generally based on either iron oxide nanoparticles or ferrites, providing negative contrast in T2-weighted images; or complexes of lanthanide metals (mostly containing gadolinium ions, providing positive contrast in T1-weighted images. Recently, lanthanide complexes have been immobilized in nanostructured materials in order to develop a new class of contrast agents with functions including blood-pool and organ (or tumor targeting. Meanwhile, to overcome the limitations of individual imaging modalities, multimodal imaging techniques have been developed. An important challenge is to design all-in-one contrast agents that can be detected by multimodal techniques. Magnetoliposomes are efficient multimodal contrast agents. They can simultaneously bear both kinds of contrast and can, furthermore, incorporate targeting ligands and chains of polyethylene glycol to enhance the accumulation of

  16. Glioma-targeting micelles for optical/magnetic resonance dual-mode imaging

    Directory of Open Access Journals (Sweden)

    Zhou Q

    2015-03-01

    Full Text Available Qing Zhou,1,* Ketao Mu,2,* Lingyu Jiang,1 Hui Xie,3 Wei Liu,1 Zhengzheng Li,1 Hui Qi,1 Shuyan Liang,1 Huibi Xu,1 Yanhong Zhu,1 Wenzhen Zhu,2 Xiangliang Yang11National Engineering Research Center for Nanomedicine, College of Life Science and Technology, 2Radiology Department, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, 3Department of Information Processing, China Patent Information Center, Wuhan, People’s Republic of China*These authors contributed equally to this workAbstract: Surgical resection is the primary mode for glioma treatment, while gross total resection is difficult to achieve, due to the invasiveness of the gliomas. Meanwhile, the tumor-resection region is closely related to survival rate and life quality. Therefore, we developed optical/magnetic resonance imaging (MRI bifunctional targeted micelles for glioma so as to delineate the glioma location before and during operation. The micelles were constructed through encapsulation of hydrophobic superparamagnetic iron oxide nanoparticles (SPIONs with polyethylene glycol-block-polycaprolactone (PEG-b-PCL by using a solvent-evaporation method, and modified with a near-infrared fluorescent probe, Cy5.5, in addition to the glioma-targeting ligand lactoferrin (Lf. Being encapsulated by PEG-b-PCL, the hydrophobic SPIONs dispersed well in phosphate-buffered saline over 4 weeks, and the relaxivity (r2 of micelles was 215.4 mM–1·s–1, with sustained satisfactory fluorescent imaging ability, which might have been due to the interval formed by PEG-b-PCL for avoiding the fluorescence quenching caused by SPIONs. The in vivo results indicated that the nanoparticles with Lf accumulated efficiently in glioma cells and prolonged the duration of hypointensity at the tumor site over 48 hours in the MR image compared to the nontarget group. Corresponding with the MRI results, the margin of the glioma was clearly demarcated in the fluorescence image

  17. Quantitative assessment of left ventricular function with dual-source CT in comparison to cardiac magnetic resonance imaging: initial findings

    Energy Technology Data Exchange (ETDEWEB)

    Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K. [University of Munich, Department of Clinical Radiology, Munich (Germany)

    2008-03-15

    Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 {+-} 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 {+-} 41.9 ml and 54.9 {+-} 29.6 ml, respectively, compared with 132.1 {+-} 40.8 ml EDV and 57.6 {+-} 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 {+-} 12.4% in DSCT and 57.9 {+-} 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P = 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter

  18. Quantitative assessment of left ventricular function with dual-source CT in comparison to cardiac magnetic resonance imaging: initial findings

    International Nuclear Information System (INIS)

    Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K.

    2008-01-01

    Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 ± 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 ± 41.9 ml and 54.9 ± 29.6 ml, respectively, compared with 132.1 ± 40.8 ml EDV and 57.6 ± 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 ± 12.4% in DSCT and 57.9 ± 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter-observer variability were

  19. The impact of dual-source parallel radiofrequency transmission with patient-adaptive shimming on the cardiac magnetic resonance in children at 3.0 T.

    Science.gov (United States)

    Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin

    2017-06-01

    The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P source than with single-source RF transmission. Both the CRs in the horizontal long axis (HLA) and short axis of cine images with dual-source RF transmission was improved (P source RF transmission were higher in both free-breathing and breath-hold groups (P source, dual-source parallel RF transmission could significantly improve the B1 homogeneity and image quality for CMR in children at 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.

  20. Magnetically engineered Cd-free quantum dots as dual-modality probes for fluorescence/magnetic resonance imaging of tumors.

    Science.gov (United States)

    Ding, Ke; Jing, Lihong; Liu, Chunyan; Hou, Yi; Gao, Mingyuan

    2014-02-01

    Magnetically engineered Cd-free CuInS2@ZnS:Mn quantum dots (QDs) were designed, synthesized, and evaluated as potential dual-modality probes for fluorescence and magnetic resonance imaging (MRI) of tumors in vivo. The synthesis of Mn-doped core-shell structured CuInS2@ZnS mainly comprised three steps, i.e., the preparation of fluorescent CuInS2 seeds, the particle surface coating of ZnS, and the Mn-doping of the ZnS shells. Systematic spectroscopy studies were carried out to illustrate the impacts of ZnS coating and the following Mn-doping on the optical properties of the QDs. In combination with conventional fluorescence, fluorescence excitation, and time-resolved fluorescence measurements, the structure of CuInS2@ZnS:Mn QDs prepared under optimized conditions presented a Zn gradient CuInS2 core and a ZnS outer shell, while Mn ions were mainly located in the ZnS shell, which well balanced the optical and magnetic properties of the resultant QDs. For the following in vivo imaging experiments, the hydrophobic CuInS2@ZnS:Mn QDs were transferred into water upon ligand exchange reactions by replacing the 1-dodecanethiol ligand with dihydrolipoic acid-poly(ethylene glycol) (DHLA-PEG) ligand. The MTT assays based on HeLa cells were carried out to evaluate the cytotoxicity of the current Cd-free CuInS2@ZnS:Mn QDs for comparing with that of water soluble CdTe QDs. Further in vivo fluorescence and MR imaging experiments suggested that the PEGylated CuInS2@ZnS:Mn QDs could well target both subcutaneous and intraperitoneal tumors in vivo. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Resonance

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2014-01-01

    A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice.......A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice....

  2. Hydraulic turbines and auxiliary equipment

    Energy Technology Data Exchange (ETDEWEB)

    Luo Gaorong [Organization of the United Nations, Beijing (China). International Centre of Small Hydroelectric Power Plants

    1995-07-01

    This document presents a general overview on hydraulic turbines and auxiliary equipment, emphasizing the turbine classification, in accordance with the different types of turbines, standard turbine series in China, turbine selection based on the basic data required for the preliminary design, general hill model curves, chart of turbine series and the arrangement of application for hydraulic turbines, hydraulic turbine testing, and speed regulating device.

  3. Aspectual auxiliary verbs in Xitsonga

    African Journals Online (AJOL)

    Kate H

    Let him always come' e. á vá hátl-é vá yá étlélà. OPT 3PL quickly-OPT 3PL go sleep. 'Let them quickly go to bed'. 3.4 Negative markers. Negation is marked on AA verbs. The auxiliary verb hatla 'quickly' is negated in three tenses.

  4. Resonances

    DEFF Research Database (Denmark)

    an impetus or drive to that account: change, innovation, rupture, or discontinuity. Resonances: Historical Essays on Continuity and Change explores the historiographical question of the modes of interrelation between these motifs in historical narratives. The essays in the collection attempt to realize...... theoretical consciousness through historical narrative ‘in practice’, by discussing selected historical topics from Western cultural history, within the disciplines of history, literature, visual arts, musicology, archaeology, philosophy, and theology. The title Resonances indicates the overall perspective...... of the book: how connotations of past meanings may resonate through time, in new contexts, assuming new meanings without surrendering the old....

  5. Dual temperature concentration system

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1975-01-01

    In a dual temperature isotope exchange system--exemplified by exchange of deuterium and protium between water and hydrogen sulfide gas in hot and cold towers, in which the feed stream (water) containing the desired isotope is passed through a pair of towers maintained at different temperatures wherein it effects isotope exchange with countercurrently circulated auxiliary fluid (H 2 S) and is impoverished in said isotope and then disposed of, e.g. discharged to waste,--the flow of isotope enriched auxiliary fluid between said towers (hot H 2 S saturated with water vapor) is divided and a part thereof is adjusted in its temperature (to cold tower conditions) and then passed to the auxiliary fluid impoverishing (cold) tower, while the remainder of the divided flow of such enriched auxiliary fluid is passed through a subsequent isotope concentration treatment to produce a product more highly enriched in the desired isotope and wherein it is also adjusted in its temperature and is impoverished in said isotope during said subsequent treatment before it is delivered to the said auxiliary fluid impoverishing (cold) tower. Certain provisions are made for returning to the hot tower liquid carried as vapor by the remainder of the divided flow to the subsequent isotope concentration treatment, for recovering sensible and latent heat, and for reducing passage of auxiliary fluid to waste

  6. 33 CFR 5.47 - Auxiliary ensign.

    Science.gov (United States)

    2010-07-01

    ... matching blue Coast Guard Auxiliary emblem is centered. The white slash shall be at a 70 degree angle, rising away from the hoist. (c) The Auxiliary emblem consists of a disk with the shield of the Coat of...

  7. Tunable sensitivity phase detection of transmitted-type dual-channel guided-mode resonance sensor based on phase-shift interferometry.

    Science.gov (United States)

    Kuo, Wen-Kai; Syu, Siang-He; Lin, Peng-Zhi; Yu, Hsin Her

    2016-02-01

    This paper reports on a transmitted-type dual-channel guided-mode resonance (GMR) sensor system that uses phase-shifting interferometry (PSI) to achieve tunable phase detection sensitivity. Five interference images are captured for the PSI phase calculation within ∼15  s by using a liquid crystal retarder and a USB web camera. The GMR sensor structure is formed by a nanoimprinting process, and the dual-channel sensor device structure for molding is fabricated using a 3D printer. By changing the rotation angle of the analyzer in front of the camera in the PSI system, the sensor detection sensitivity can be tuned. The proposed system may achieve high throughput as well as high sensitivity. The experimental results show that an optimal detection sensitivity of 6.82×10(-4)  RIU can be achieved.

  8. Dual-input two-compartment pharmacokinetic model of dynamic contrast-enhanced magnetic resonance imaging in hepatocellular carcinoma.

    Science.gov (United States)

    Yang, Jian-Feng; Zhao, Zhen-Hua; Zhang, Yu; Zhao, Li; Yang, Li-Ming; Zhang, Min-Ming; Wang, Bo-Yin; Wang, Ting; Lu, Bao-Chun

    2016-04-07

    To investigate the feasibility of a dual-input two-compartment tracer kinetic model for evaluating tumorous microvascular properties in advanced hepatocellular carcinoma (HCC). From January 2014 to April 2015, we prospectively measured and analyzed pharmacokinetic parameters [transfer constant (Ktrans), plasma flow (Fp), permeability surface area product (PS), efflux rate constant (kep), extravascular extracellular space volume ratio (ve), blood plasma volume ratio (vp), and hepatic perfusion index (HPI)] using dual-input two-compartment tracer kinetic models [a dual-input extended Tofts model and a dual-input 2-compartment exchange model (2CXM)] in 28 consecutive HCC patients. A well-known consensus that HCC is a hypervascular tumor supplied by the hepatic artery and the portal vein was used as a reference standard. A paired Student's t-test and a nonparametric paired Wilcoxon rank sum test were used to compare the equivalent pharmacokinetic parameters derived from the two models, and Pearson correlation analysis was also applied to observe the correlations among all equivalent parameters. The tumor size and pharmacokinetic parameters were tested by Pearson correlation analysis, while correlations among stage, tumor size and all pharmacokinetic parameters were assessed by Spearman correlation analysis. The Fp value was greater than the PS value (FP = 1.07 mL/mL per minute, PS = 0.19 mL/mL per minute) in the dual-input 2CXM; HPI was 0.66 and 0.63 in the dual-input extended Tofts model and the dual-input 2CXM, respectively. There were no significant differences in the kep, vp, or HPI between the dual-input extended Tofts model and the dual-input 2CXM (P = 0.524, 0.569, and 0.622, respectively). All equivalent pharmacokinetic parameters, except for ve, were correlated in the two dual-input two-compartment pharmacokinetic models; both Fp and PS in the dual-input 2CXM were correlated with Ktrans derived from the dual-input extended Tofts model (P = 0.002, r = 0.566; P

  9. 45 CFR 707.10 - Auxiliary aids.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Auxiliary aids. 707.10 Section 707.10 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION ON CIVIL RIGHTS ENFORCEMENT OF... § 707.10 Auxiliary aids. (a) The Agency shall furnish appropriate auxiliary aids where necessary to...

  10. 7 CFR 15b.37 - Auxiliary aids.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Auxiliary aids. 15b.37 Section 15b.37 Agriculture... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Other Aid, Benefits, or Services § 15b.37 Auxiliary aids... appropriate auxiliary aids to persons with impaired sensory, manual, or speaking skills, where necessary to...

  11. 78 FR 27321 - Revision of Auxiliary Regulations

    Science.gov (United States)

    2013-05-10

    ...--Auxiliary emblem: We propose to revise this section. Provisions of the existing Sec. 5.41 would be... existing Sec. 5.47(c) describing the Auxiliary emblem and explain the use of the emblem as identification...), and 5.36(c). Added language to describe the Auxiliary emblem and discuss when it can be worn and used...

  12. Dual-resonance models

    International Nuclear Information System (INIS)

    Mandelstam, S.

    1976-01-01

    Most models of theories of so-called elementary particles start from systems containing a finite number of kinds of such particles. This is true whether one works within the framework of quantum field theory, with a finite number of fields, or of S-matrix theory, where one neglects all but a finite number of particles in the unitarity condition. The concept of a Regge trajectory suggests the possibility of a more general scheme, but most conventional S-matrix models which attempt to predict the position of Regge trajectories neglect all but a finite number of particles. (Auth.)

  13. A dual-modal magnetic nanoparticle probe for preoperative and intraoperative mapping of sentinel lymph nodes by magnetic resonance and near infrared fluorescence imaging.

    Science.gov (United States)

    Zhou, Zhengyang; Chen, Hongwei; Lipowska, Malgorzata; Wang, Liya; Yu, Qiqi; Yang, Xiaofeng; Tiwari, Diana; Yang, Lily; Mao, Hui

    2013-07-01

    The ability to reliably detect sentinel lymph nodes for sentinel lymph node biopsy and lymphadenectomy is important in clinical management of patients with metastatic cancers. However, the traditional sentinel lymph node mapping with visible dyes is limited by the penetration depth of light and fast clearance of the dyes. On the other hand, sentinel lymph node mapping with radionucleotide technique has intrinsically low spatial resolution and does not provide anatomic details in the sentinel lymph node mapping procedure. This work reports the development of a dual modality imaging probe with magnetic resonance and near infrared imaging capabilities for sentinel lymph node mapping using magnetic iron oxide nanoparticles (10 nm core size) conjugated with a near infrared molecule with emission at 830 nm. Accumulation of magnetic iron oxide nanoparticles in sentinel lymph nodes leads to strong T2 weighted magnetic resonance imaging contrast that can be potentially used for preoperative localization of sentinel lymph nodes, while conjugated near infrared molecules provide optical imaging tracking of lymph nodes with a high signal to background ratio. The new magnetic nanoparticle based dual imaging probe exhibits a significant longer lymph node retention time. Near infrared signals from nanoparticle conjugated near infrared dyes last up to 60 min in sentinel lymph node compared to that of 25 min for the free near infrared dyes in a mouse model. Furthermore, axillary lymph nodes, in addition to sentinel lymph nodes, can be also visualized with this probe, given its slow clearance and sufficient sensitivity. Therefore, this new dual modality imaging probe with the tissue penetration and sensitive detection of sentinel lymph nodes can be applied for preoperative survey of lymph nodes with magnetic resonance imaging and allows intraoperative sentinel lymph node mapping using near infrared optical devices.

  14. Characterization of Monomeric MnII/III/IV–Hydroxo Complexes from X- and Q-Band Dual Mode Electron Paramagnetic Resonance (EPR) Spectroscopy

    OpenAIRE

    Gupta, Rupal; Taguchi, Taketo; Borovik, A. S.; Hendrich, Michael P.

    2013-01-01

    Manganese–hydroxo species have been implicated in C–H bond activation performed by metalloenzymes, but the electronic properties of many of these intermediates are not well characterized. The present work presents a detailed characterization of three Mnn–OH complexes (where n = II, III, and IV) of the tris[(N′-tert-butylureaylato)-N-ethylene]aminato ([H3buea]3−) ligand using X- and Q-band dual mode electron paramagnetic resonance (EPR). Quantitative simulations for the [MnIIH3buea(OH)]2− comp...

  15. Highly sensitive digital optical sensor with large measurement range based on the dual-microring resonator with waveguide-coupled feedback

    International Nuclear Information System (INIS)

    Xiang Xing-Ye; Wang Kui-Ru; Yuan Jin-Hui; Jin Bo-Yuan; Sang Xin-Zhu; Yu Chong-Xiu

    2014-01-01

    We propose a novel high-performance digital optical sensor based on the Mach—Zehnder interferential effect and the dual-microring resonators with the waveguide-coupled feedback. The simulation results show that the sensitivity of the sensor can be orders of magnitude higher than that of a conventional sensor, and high quality factor is not critical in it. Moreover, by optimizing the length of the feedback waveguide to be equal to the perimeter of the ring, the measurement range of the proposed sensor is twice as much as that of the conventional sensor in the weak coupling case

  16. A Dual-Band Band-Pass Filter with Overlap Step-Impedance and Capacitively Loaded Hairpin Resonators for Wireless LAN Systems

    Directory of Open Access Journals (Sweden)

    P. Chomtong

    2011-01-01

    Full Text Available This paper presents a dual-band band-pass filter using modified cross-coupled step-impedance and capacitively loaded hairpin resonators for WLAN systems. The proposed filter has been designed to operate at a fundamental frequency of 2.4 GHz and the first harmonics frequency of 5.2 GHz. The techniques of step impedance and load capacitor are combined in the design of the proposed filter. In particular, the techniques of modified cross-coupling and overlap resonators are applied to improve the response of insertion losses 21 at the first harmonic frequency of 5.2 GHz. The simulated and experimental results of insertion losses and return losses are better than 3 dB and 20 dB, respectively, at the operating frequencies.

  17. RESONANCE

    Indian Academy of Sciences (India)

    maceutical, paper, food, dyes, petrochemi- cals, pigments, etc., to identify molecules, to monitor reaction products and so on. One of the most spectacular contributions of NMR has been in the development of magnetic resonance imaging (MRI), a method that has today revolutionized diagnosis and treatment of diseases in ...

  18. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    CERN Document Server

    Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

    2016-01-01

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  19. Hovercraft auxiliary power units (APUs)

    Energy Technology Data Exchange (ETDEWEB)

    Russell, B.J.

    1983-08-01

    Auxiliary power units (APU) manufactured by British firms for use in hovercraft are characterized. Both diesel and gas-turbine APUs are found to be well suited to the demands of this application. The design features, dimensions, performance data, and installation requirements are discussed for the SS 90, SS 923, DA-1, BA-1, HM 5, and Gevaudan 9 APUs, as well as the TRS 18 gas-turbine smoke generator. The progress made in improving the fuel efficiency of gas turbines and reducing the weight of diesel engines is considered significant.

  20. Three-dimensional balanced steady state free precession myocardial perfusion cardiovascular magnetic resonance at 3T using dual-source parallel RF transmission: initial experience.

    Science.gov (United States)

    Jogiya, Roy; Schuster, Andreas; Zaman, Arshad; Motwani, Manish; Kouwenhoven, Marc; Nagel, Eike; Kozerke, Sebastian; Plein, Sven

    2014-11-28

    The purpose of this study was to establish the feasibility of three-dimensional (3D) balanced steady-state-free-precession (bSSFP) myocardial perfusion cardiovascular magnetic resonance (CMR) at 3T using local RF shimming with dual-source RF transmission, and to compare it with spoiled gradient echo (TGRE) acquisition. Dynamic contrast-enhanced 3D bSSFP perfusion imaging was performed on a 3T MRI scanner equipped with dual-source RF transmission technology. Images were reconstructed using k-space and time broad-use linear acquisition speed-up technique (k-t BLAST) and compartment based principle component analysis (k-t PCA). In phantoms and volunteers, local RF shimming with dual source RF transmission significantly improved B1 field homogeneity compared with single source transmission (P=0.01). 3D bSSFP showed improved signal-to-noise, contrast-to-noise and signal homogeneity compared with 3D TGRE (29.8 vs 26.9, P=0.045; 23.2 vs 21.6, P=0.049; 14.9% vs 12.4%, p=0.002, respectively). Image quality was similar between bSSFP and TGRE but there were more dark rim artefacts with bSSFP. k-t PCA reconstruction reduced artefacts for both sequences compared with k-t BLAST. In a subset of five patients, both methods correctly identified those with coronary artery disease. Three-dimensional bSSFP myocardial perfusion CMR using local RF shimming with dual source parallel RF transmission at 3T is feasible and improves signal characteristics compared with TGRE. Image artefact remains an important limitation of bSSFP imaging at 3T but can be reduced with k-t PCA.

  1. Auxiliary reactor for a hydrocarbon reforming system

    Science.gov (United States)

    Clawson, Lawrence G.; Dorson, Matthew H.; Mitchell, William L.; Nowicki, Brian J.; Bentley, Jeffrey M.; Davis, Robert; Rumsey, Jennifer W.

    2006-01-17

    An auxiliary reactor for use with a reformer reactor having at least one reaction zone, and including a burner for burning fuel and creating a heated auxiliary reactor gas stream, and heat exchanger for transferring heat from auxiliary reactor gas stream and heat transfer medium, preferably two-phase water, to reformer reaction zone. Auxiliary reactor may include first cylindrical wall defining a chamber for burning fuel and creating a heated auxiliary reactor gas stream, the chamber having an inlet end, an outlet end, a second cylindrical wall surrounding first wall and a second annular chamber there between. The reactor being configured so heated auxiliary reactor gas flows out the outlet end and into and through second annular chamber and conduit which is disposed in second annular chamber, the conduit adapted to carry heat transfer medium and being connectable to reformer reaction zone for additional heat exchange.

  2. Coordinated application of electrical auxiliaries equipment

    Energy Technology Data Exchange (ETDEWEB)

    Appiarius, J.C.; Krug, R.O.

    1977-01-01

    As the power requirements of auxiliaries continue to increase, both in total and as a percentage of generating unit capacity, coordinated application of auxiliaries system components demands more sophisticated approaches to system design. Among the techniques developed to assist system designers is a method which separates the auxiliaries system into modules for conceptual design, with analyses which consider design criteria, equipment capability, and expected operating constraints. This and other techniques, intended to optimize application of metalclad switchgear and auxiliaries transformers, can provide the designer with tools for proper selection and application of equipment which can contribute significantly to overall system performance.

  3. 47 CFR 74.6 - Licensing of broadcast auxiliary and low power auxiliary stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Licensing of broadcast auxiliary and low power auxiliary stations. 74.6 Section 74.6 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES EXPERIMENTAL RADIO, AUXILIARY, SPECIAL BROADCAST AND OTHER PROGRAM DISTRIBUTIONAL SERVICES General; Rules Applicable to Al...

  4. Radiant vessel auxiliary cooling system

    Science.gov (United States)

    Germer, John H.

    1987-01-01

    In a modular liquid-metal pool breeder reactor, a radiant vessel auxiliary cooling system is disclosed for removing the residual heat resulting from the shutdown of a reactor by a completely passive heat transfer system. A shell surrounds the reactor and containment vessel, separated from the containment vessel by an air passage. Natural circulation of air is provided by air vents at the lower and upper ends of the shell. Longitudinal, radial and inwardly extending fins extend from the shell into the air passage. The fins are heated by radiation from the containment vessel and convect the heat to the circulating air. Residual heat from the primary reactor vessel is transmitted from the reactor vessel through an inert gas plenum to a guard or containment vessel designed to contain any leaking coolant. The containment vessel is conventional and is surrounded by the shell.

  5. Aspectual auxiliary verbs in Xitsonga

    Directory of Open Access Journals (Sweden)

    Seunghun J Lee

    2016-01-01

    Full Text Available In Xitsonga, certain Aspectual Auxiliary verbs (AA verbs appear with double subject agreement. While these AA verbs have been reported in the description of Xitsonga (Baumbach 1987: 250-252, a systematic morphosyntactic study of these constructions has not been undertaken. This study aims to fill this gap. An AA verb is marked with tense, aspect, mood, negation and relative clause markers and may occur in wh-questions. The lexical verb following the AA verb may be the target of verbal extensions (applicative and reciprocal, reflexive, causative and passive markers. [Please click on "Supplementary files" in the ARTICLE TOOLS sidebar on the right for the accompanying sound files.

  6. Auxiliary feedwater system aging study

    International Nuclear Information System (INIS)

    Kueck, J.D.

    1993-07-01

    This report documents the results of a Phase I follow-on study of the Auxiliary Feedwater (AFW) System that has been conducted for the US Regulatory Commission's Nuclear Plant Aging research Program. The Phase I study found a number of significant AFW System functions that are not being adequately tested by conventional test methods and some that are actually being degraded by conventional testing. Thus, it was decided that this follow-on study would focus on these testing omissions nd equipment degradation. The deficiencies in current monitoring and operating practice are categorized and evaluated. Areas of component degradation caused by current practice are discussed. Recommendations are made for improved diagnostic methods and test procedures

  7. 46 CFR 63.25-1 - Small automatic auxiliary boilers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Small automatic auxiliary boilers. 63.25-1 Section 63.25... AUXILIARY BOILERS Requirements for Specific Types of Automatic Auxiliary Boilers § 63.25-1 Small automatic auxiliary boilers. Small automatic auxiliary boilers defined as having heat-input ratings of 400,000 Btu/hr...

  8. 47 CFR 73.1675 - Auxiliary antennas.

    Science.gov (United States)

    2010-10-01

    ... Class A TV licensees may request a decrease from the authorized facility's ERP in the license application. An FM, TV or Class A TV licensee may also increase the ERP of the auxiliary facility in a license... licensed main facility as an auxiliary facility with an ERP less than or equal to the ERP specified on the...

  9. Cy5.5 conjugated MnO nanoparticles for magnetic resonance/near-infrared fluorescence dual-modal imaging of brain gliomas.

    Science.gov (United States)

    Chen, Ning; Shao, Chen; Li, Shuai; Wang, Zihao; Qu, Yanming; Gu, Wei; Yu, Chunjiang; Ye, Ling

    2015-11-01

    The fusion of molecular and anatomical modalities facilitates more reliable and accurate detection of tumors. Herein, we prepared the PEG-Cy5.5 conjugated MnO nanoparticles (MnO-PEG-Cy5.5 NPs) with magnetic resonance (MR) and near-infrared fluorescence (NIRF) imaging modalities. The applicability of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe for the detection of brain gliomas was investigated. In vivo MR contrast enhancement of the MnO-PEG-Cy5.5 nanoprobe in the tumor region was demonstrated. Meanwhile, whole-body NIRF imaging of glioma bearing nude mouse exhibited distinct tumor localization upon injection of MnO-PEG-Cy5.5 NPs. Moreover, ex vivo CLSM imaging of the brain slice hosting glioma indicated the preferential accumulation of MnO-PEG-Cy5.5 NPs in the glioma region. Our results therefore demonstrated the potential of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe in improving the diagnostic efficacy by simultaneously providing anatomical information from deep inside the body and more sensitive information at the cellular level. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications

    DEFF Research Database (Denmark)

    Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng

    2017-01-01

    . Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...

  11. Terahertz plasmon-induced transparency based on asymmetric dual-disk resonators coupled to a semiconductor InSb waveguide and its biosensor application

    Science.gov (United States)

    Shahamat, Yadollah; Vahedi, Mohammad

    2017-06-01

    An ultracompact double eight-shaped plasmonic structure for the realization of plasmon-induced transparency (PIT) in the terahertz (THz) region has been studied. The device consists of a semiconductor-insulator-semiconductor bus waveguide coupled to the dual-disk resonators. Indium antimonide is employed to excite SPP in the THz region. The transmission characteristics of the proposed device are simulated numerically by the finite-difference time-domain method. In addition, a theoretical analysis based on the coupled-mode theory for transmission features is presented and compared with the numerical results. Results are in good agreement. Also, the dependence of PIT frequency characteristics on the radius of the outer disk is discussed in detail. In addition, by removing one of the outer disk resonators, double-PIT peaks can be observed in the transmission spectrum, and the physical mechanism of the appeared peaks is investigated. Finally, an application of the proposed structure for distinguishing different states of DNA molecules is discussed. Results show that the maximum sensitivity with 654 GHz/RIU-1 could be obtained for a single PIT structure. The frequency shifts equal to 37 and 99 GHz could be observed for the denatured and the hybridized DNA states, respectively.

  12. Microvascular obstruction on delayed enhancement cardiac magnetic resonance imaging after acute myocardial infarction, compared with myocardial {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings

    Energy Technology Data Exchange (ETDEWEB)

    Mori, Hiroaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Cardiology, Kainan Hospital, Yatomi (Japan); Isobe, Satoshi, E-mail: sisobe@med.nagoya-u.ac.jp [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Sakai, Shinichi [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Yamada, Takashi [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Watanabe, Naoki; Miura, Manabu [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Uchida, Yasuhiro; Kanashiro, Masaaki; Ichimiya, Satoshi [Department of Cardiology, Yokkaichi Municipal Hospital, Yokkaichi (Japan); Okumura, Takahiro; Murohara, Toyoaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan)

    2015-08-15

    Highlights: • The percentage infarct size (%IS) was significantly greater in the microvascular obstruction (MO) group than in the non-MO group. • The percentage mismatch score (%MMS) on dual scintigraphy significantly correlated with the %IS and the percentage MO. • The %MMS was significantly greater in the non-MO group than in the MO group, and was an independent predictor for MO. - Abstract: Background: The hypo-enhanced regions within the hyper-enhanced infarct areas detected by cardiac magnetic resonance (CMR) imaging reflect microvascular obstruction (MO) after acute myocardial infarction (AMI). The combined myocardial thallium-201 ({sup 201}Tl)/iodine-123-15-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ({sup 123}I-BMIPP) dual single-photon emission computed tomography (SPECT) is a useful tool for detecting myocardial reversibility after AMI. We evaluated whether MO could be an early predictor of irreversible myocardial damage in comparison with {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings in AMI patients. Methods: Sixty-two patients with initial AMI who successfully underwent coronary revascularization were enrolled. MO was defined by CMR imaging. Patients were divided into 2 groups as follows: MO group (n = 32) and non-MO group (n = 30). Scintigraphic defect scores were calculated using a 17-segment model with a 5-point scoring system. The mismatch score (MMS) was calculated as follows: the total sum of (Σ) {sup 123}I-BMIPP defect score minus Σ{sup 201}Tl defect score. The percentage mismatch score (%MMS) was calculated as follows: MMS/(Σ{sup 123}I-BMIPP score) × 100 (%). Results: The percentage infarct size (%IS) was significantly greater in the MO group than in the non-MO group (32.2 ± 13.8% vs. 18.3 ± 12.1%, p < 0.001). The %MMS significantly correlated with the %IS and the percentage MO (r = −0.26, p = 0.03; r = −0.45, p < 0.001, respectively). The %MMS was significantly greater in the non-MO group than in the MO group (45.4

  13. Apparatus for concentrating by dual temperature exchange

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1975-01-01

    Improvements in an apparatus for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. The first fluid is a vaporizable liquid and the auxiliary fluid a gas, the apparatus having means for cascading the auxiliary fluid and the feed fluid in vapor and preferably also in liquid form. The apparatus also contains new combinations of means for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations of the system. The reactants in the example given are hydrogen sulfide gas and liquid water

  14. Hybrid mesons with auxiliary fields

    International Nuclear Information System (INIS)

    Buisseret, F.; Mathieu, V.

    2006-01-01

    Hybrid mesons are exotic mesons in which the color field is not in the ground state. Their understanding deserves interest from a theoretical point of view, because it is intimately related to nonperturbative aspects of QCD. Moreover, it seems that some recently detected particles, such as the π 1 (1600) and the Y(4260), are serious hybrid candidates. In this work, we investigate the description of such exotic hadrons by applying the auxiliary fields technique (also known as the einbein field method) to the widely used spinless Salpeter Hamiltonian with appropriate linear confinement. Instead of the usual numerical resolution, this technique allows to find simplified analytical mass spectra and wave functions of the Hamiltonian, which still lead to reliable qualitative predictions. We analyse and compare two different descriptions of hybrid mesons, namely a two-body q system with an excited flux tube, or a three-body qg system. We also compute the masses of the 1 -+ hybrids. Our results are shown to be in satisfactory agreement with lattice QCD and other effective models. (orig.)

  15. Resolution of concerns in auxiliary feedwater piping

    International Nuclear Information System (INIS)

    Bain, R.A.; Testa, M.F.

    1994-01-01

    Auxiliary feedwater piping systems at pressurized water reactor (PWR) nuclear power plants have experienced unanticipated operating conditions during plant operation. These unanticipated conditions have included plant events involving backleakage through check valves, temperatures in portions of the auxiliary feedwater piping system that exceed design conditions, and the occurrence of unanticipated severe fluid transients. The impact of these events has had an adverse effect at some nuclear stations on plant operation, installed plant components and hardware, and design basis calculations. Beaver Valley Unit 2, a three loop pressurized water reactor nuclear plant, has observed anomalies with the auxiliary feedwater system since the unit went operational in 1987. The consequences of these anomalies and plant events have been addressed and resolved for Beaver Valley Unit 2 by performing engineering and construction activities. These activities included pipe stress, pipe support and pipe rupture analysis, the monitoring of auxiliary feedwater system temperature and pressure, and the modification to plant piping, supports, valves, structures and operating procedures

  16. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  17. Idler-resonant intracavity KTA-based OPO pumped by a dual-loss modulated-Q-switched-laser with AOM and Cr4+:YAG

    Science.gov (United States)

    Qiao, Junpeng; Zhao, Shengzhi; Yang, Kejian; Zhao, Jia; Li, Guiqiu; Li, Dechun; Li, Tao; Qiao, Wenchao

    2017-06-01

    An idler-resonant KTiOAsO4 (KTA)-based intracavity optical parametric oscillator (IOPO) pumped by a dual-loss-modulated Q-switched laser with an acousto-optic modulator (AOM) and a Cr4+:YAG saturable absorber (Cr4+:YAG-SA) has been presented. By utilizing a type-II non-critically phase-matched KTA crystal, signal wave at 1535 nm and idler wave at 3467 nm have been generated. Under an incident pump power of 18.3 W, maximum output powers of 615 mW for signal wave and 228 mW for idler wave were obtained at an AOM modulation rate of 10 kHz, corresponding to a whole optical-to-optical conversion efficiency of 4.6%. The shortest pulse widths of signal and idler wave were measured to be 898 ps and 2.9 ns, corresponding to the highest peak powers of 68.4 and 7.9 kW, respectively. In comparison with IOPO pumped by a singly Q-switched laser with an AOM, the IOPO pumped by a doubly Q-switched laser (DIOPO) with an AOM and a Cr4+:YAG-SA can generate signal wave and idler wave with shorter pulse width and higher peak power. By considering the spatial Gaussian distribution of intracavity photon density, a set of coupled rate equations for the idler-resonant DIOPO were built for the first time to the best of our knowledge. The simulation results agreed well with the experimental results.

  18. 30 CFR 75.331 - Auxiliary fans and tubing.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans and tubing. 75.331 Section 75... HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.331 Auxiliary fans and tubing. (a) When auxiliary fans and tubing are used for face ventilation, each auxiliary fan shall be— (1...

  19. 46 CFR 58.01-35 - Main propulsion auxiliary machinery.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Main propulsion auxiliary machinery. 58.01-35 Section 58.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING MAIN AND AUXILIARY MACHINERY AND RELATED SYSTEMS General Requirements § 58.01-35 Main propulsion auxiliary machinery. Auxiliary machinery vital to the main...

  20. Quantification of visceral adipose tissue in polycystic ovary syndrome: dual-energy X-ray absorptiometry versus magnetic resonance imaging.

    Science.gov (United States)

    Frøssing, Signe; Nylander, Malin Chatarina; Chabanova, Elizaveta; Kistorp, Caroline; Skouby, Sven O; Faber, Jens

    2018-01-01

    Background Polycystic ovary syndrome (PCOS) is associated with frequent overweight and abdominal obesity. Quantifying visceral adipose tissue (VAT) in PCOS patients can be a tool to assess metabolic risk and monitor effects of treatment. The latest dual-energy X-ray absorptiometry (DXA) technology can measure VAT and subcutaneous adipose tissue (SAT) in a clinical setting. Purpose To compare DXA-measurements of VAT and SAT with the gold standard MRI in women with PCOS. Material and Methods A cross-sectional study of 67 overweight women with PCOS was performed. Measurements of VAT and SAT were performed by DXA in a 5-cm thick transverse slice at the L4/L5 level and by MRI in a 1-cm thick transverse slice at the L3 level. Results Mean (SD) DXA-VAT was 81 (34) cm 3 , DXA-SAT was 498 (118) cm 3 , MRI-VAT was 117 (48) cm 3 , and MRI-SAT was 408 (122) cm 3 . MRI and DXA measures of VAT (r = 0.82, P VAT was stronger correlated with MRI-VAT than BMI (r = 0.62, P VAT coefficient of variance was 6.7% and inter correlation coefficient was 0.98. Bland-Altman analyses showed DXA to slightly underestimate VAT and SAT measurements compared with MRI. Conclusion DXA and MRI measurements of VAT and SAT correlated closely despite different size of region of interest, and DXA-VAT was superior to waist circumference and BMI in estimating MRI-VAT. DXA showed high reproducibility making it is suitable for repeated measurements in the same individual over time.

  1. Three Phase Soft Commutation Auxilary Resonant Pole Inverter

    OpenAIRE

    Vaclav Sladecek

    2006-01-01

    This paper covers the circuit modification of the power part of the inverter with auxiliary resonant poles utilising configuration of switches realised with routinely produced IGBT modules. Covered is also the control optimisation which goal is the minimisation of switching of the auxiliary resonant pole. Presented results were gained on a prototype of an inverter laboratory sample.

  2. Characterization of Monomeric MnII/III/IV–Hydroxo Complexes from X- and Q-Band Dual Mode Electron Paramagnetic Resonance (EPR) Spectroscopy

    Science.gov (United States)

    Gupta, Rupal; Taguchi, Taketo; Borovik, A. S.; Hendrich, Michael P.

    2013-01-01

    Manganese–hydroxo species have been implicated in C–H bond activation performed by metalloenzymes, but the electronic properties of many of these intermediates are not well characterized. The present work presents a detailed characterization of three Mnn–OH complexes (where n = II, III, and IV) of the tris[(N′-tert-butylureaylato)-N-ethylene]aminato ([H3buea]3−) ligand using X- and Q-band dual mode electron paramagnetic resonance (EPR). Quantitative simulations for the [MnIIH3buea(OH)]2− complex demonstrated the ability to characterize similar MnII species commonly present in the resting states of manganese-containing enzymes. The spin states of the MnIII and MnIV complexes determined from EPR spectroscopy are S = 2 and 3/2, respectively, as expected for the C3 symmetry imposed by the [H3buea]3− ligand. Simulations of the spectra indicated the constant presence of two MnIV species in solutions of [MnIVH3buea(OH)] complex. The simulations of perpendicular- and parallel-mode EPR spectra allow determination of zero-field splitting and hyperfine parameters for all complexes. For the MnIII and MnIV complexes, density functional theory calculations are used to determine the isotropic Mn hyperfine values, to compare the excited electronic state energies, and to give theoretical estimates of the zero-field energy. PMID:24156406

  3. Characterization of monomeric Mn(II/III/IV)-hydroxo complexes from X- and Q-band dual mode electron paramagnetic resonance (EPR) spectroscopy.

    Science.gov (United States)

    Gupta, Rupal; Taguchi, Taketo; Borovik, A S; Hendrich, Michael P

    2013-11-04

    Manganese-hydroxo species have been implicated in C-H bond activation performed by metalloenzymes, but the electronic properties of many of these intermediates are not well characterized. The present work presents a detailed characterization of three Mn(n)-OH complexes (where n = II, III, and IV) of the tris[(N'-tert-butylureaylato)-N-ethylene]aminato ([H3buea](3-)) ligand using X- and Q-band dual mode electron paramagnetic resonance (EPR). Quantitative simulations for the [Mn(II)H3buea(OH)](2-) complex demonstrated the ability to characterize similar Mn(II) species commonly present in the resting states of manganese-containing enzymes. The spin states of the Mn(III) and Mn(IV) complexes determined from EPR spectroscopy are S = 2 and 3/2, respectively, as expected for the C3 symmetry imposed by the [H3buea](3-) ligand. Simulations of the spectra indicated the constant presence of two Mn(IV) species in solutions of [Mn(IV)H3buea(OH)] complex. The simulations of perpendicular- and parallel-mode EPR spectra allow determination of zero-field splitting and hyperfine parameters for all complexes. For the Mn(III) and Mn(IV) complexes, density functional theory calculations are used to determine the isotropic Mn hyperfine values, to compare the excited electronic state energies, and to give theoretical estimates of the zero-field energy.

  4. Feasibility of dual gradient-echo in-phase and opposed-phase magnetic resonance imaging for the evaluation of epicardial fat

    Energy Technology Data Exchange (ETDEWEB)

    Okayama, Satoshi; Ayako, Seno; Somekawa, Satoshi; Uemura, Shiro; Saito, Yoshihiko (First Dept. of Internal Medicine, Nara Medical Univ., Nara (Japan)), email: satosi01@naramed-u.ac.jp; Kubota, Yasushi (Radiology, Hirai Hospital, Nara (Japan))

    2011-09-15

    Background: Dual gradient-echo in-phase (IP) and opposed-phase (OP) magnetic resonance imaging (MRI) can evaluate small amounts of fat, and is widely used for imaging abdominal organs. Epicardial fat has recently been revealed as having an important role in the development of heart disease, but IPOP-MRI has not been widely applied in this field, probably because of cardiac motion artifacts. Purpose: To demonstrate the feasibility of IPOP-MRI with electrocardiography (ECG)-gating for evaluation of epicardial fat in the normal human heart, compared to black-blood T1-weighted imaging (T1WI). Material and Methods: Ten healthy volunteers were studied. Epicardial fat volume was quantitatively evaluated on OP-from-IP subtraction images and T1-weighted images. Results: Epicardial fat was clearly visualized on the subtraction images as hyperintense areas that corresponded to regions identified as epicardial fat on the T1-weighted images. Epicardial fat volume correlated well between the two methods (r = 0.93, P <0.0001), and tended to be larger on the subtraction images than on the T1-weighted images (91.4 +- 30.1 vs. 84.1 +- 30.5 mL, P = 0.07). Conclusion: IPOP-MRI with ECG-gating may be a useful alternative method to black-blood T1WI for evaluation of epicardial fat

  5. Extending roGFP Emission via Förster-Type Resonance Energy Transfer Relay Enables Simultaneous Dual Compartment Ratiometric Redox Imaging in Live Cells.

    Science.gov (United States)

    Norcross, Stevie; Trull, Keelan J; Snaider, Jordan; Doan, Sara; Tat, Kiet; Huang, Libai; Tantama, Mathew

    2017-11-22

    Reactive oxygen species (ROS) mediate both intercellular and intraorganellar signaling, and ROS propagate oxidative stress between cellular compartments such as mitochondria and the cytosol. Each cellular compartment contains its own sources of ROS as well as antioxidant mechanisms, which contribute to dynamic fluctuations in ROS levels that occur during signaling, metabolism, and stress. However, the coupling of redox dynamics between cellular compartments has not been well studied because of the lack of available sensors to simultaneously measure more than one subcellular compartment in the same cell. Currently, the redox-sensitive green fluorescent protein, roGFP, has been used extensively to study compartment-specific redox dynamics because it provides a quantitative ratiometric readout and it is amenable to subcellular targeting as a genetically encoded sensor. Here, we report a new family of genetically encoded fluorescent protein sensors that extend the fluorescence emission of roGFP via Förster-type resonance energy transfer to an acceptor red fluorescent protein for dual-color live-cell microscopy. We characterize the redox and optical properties of the sensor proteins, and we demonstrate that they can be used to simultaneously measure cytosolic and mitochondrial ROS in living cells. Furthermore, we use these sensors to reveal cell-to-cell heterogeneity in redox coupling between the cytosol and mitochondria when neuroblastoma cells are exposed to reductive and metabolic stresses.

  6. Design of single-polarization coupler based on dual-core photonic band-gap fiber implied in resonant fiber optic gyro

    Science.gov (United States)

    Xu, Zhenlong; Li, Xuyou; Zhang, Chunmei; Ling, Weiwei; Liu, Pan; Xia, Linlin; Yang, Hanrui

    2016-12-01

    A novel (to our knowledge) type of single-polarization (SP) coupler based on a dual-core photonic band-gap fiber (PBF) is proposed. The effects of structure parameters on the performance of this coupler are studied numerically based on the full vector finite element method (FEM). Finally, an optimal design with a length of 0.377 mm at the wavelength of 1.55 μm is achieved, and its implication in PBF-based fiber ring resonator (FRR), the effect of angular misalignment on the SP coupler are analyzed as well. When the SP coupler is incorporated into a PBF-based FRR, it functions as the power splitter and the polarizer simultaneously, and can extinct the secondary eigenstate of polarization (ESOP) propagating in the FRR. The mode field of SP coupler can match with the polarization-maintaining (PM) PBF with ultra-low temperature sensitivity proposed in previous study, and an all PM-PBF based FRR can be established, which is of great significance in suppressing the temperature-related polarization fluctuation and improving the long-term stability for RFOG, and the SP coupler has high angular misalignment tolerance as well.

  7. The Influence of Magnetic Resonance Imaging Findings of Degenerative Disease on Dual-Energy X-ray Absorptiometry Measurements in Middle-Aged Men

    Energy Technology Data Exchange (ETDEWEB)

    Donescu, O.S.; Battie, M.C.; Videman, T. [Faculty of Rehabilitation Medicine and Dept. of Physical Therapy, Univ. of Alberta (Canada)

    2007-02-15

    Purpose: To examine degenerative features based on magnetic resonance imaging (MRI) measurements at the lumbar spine in relation to dual-energy X-ray absorptiometry (DXA), and to investigate whether bone mineral density (BMD) is reflected in the substitution of bone trabecular structure by fat at the vertebral body level indicated by MRI T1 relaxation time, endplate concavity, and hypertrophic (osteophytes and endplate sclerosis) MRI findings. Material and Methods: The sample for this cross-sectional study was composed of 102 subjects, 35-70 years old, from a population-based cohort. Data collection included DXA in the anterior-posterior projection at the L1-L4 vertebrae and right femoral neck, and MRI of the lumbar spine in the midsagittal plane. Results: Age, vertebral signal intensity, osteophytes, and endplate concavity collectively explained 20% of the variance in spine BMD. Conclusion: The study findings suggest that degenerative findings based on MRI measurements at the lumbar spine have an influence on bone assessment using DXA. Therefore, an overall bone assessment such as DXA might not offer an accurate measure of BMD.

  8. Reproducibility and accuracy of body composition assessments in mice by dual energy x-ray absorptiometry and time domain nuclear magnetic resonance.

    Science.gov (United States)

    Halldorsdottir, Solveig; Carmody, Jill; Boozer, Carol N; Leduc, Charles A; Leibel, Rudolph L

    2009-01-01

    OBJECTIVE: To assess the accuracy and reproducibility of dual-energy absorptiometry (DXA; PIXImus(™)) and time domain nuclear magnetic resonance (TD-NMR; Bruker Optics) for the measurement of body composition of lean and obese mice. SUBJECTS AND MEASUREMENTS: Thirty lean and obese mice (body weight range 19-67 g) were studied. Coefficients of variation for repeated (x 4) DXA and NMR scans of mice were calculated to assess reproducibility. Accuracy was assessed by comparing DXA and NMR results of ten mice to chemical carcass analyses. Accuracy of the respective techniques was also assessed by comparing DXA and NMR results obtained with ground meat samples to chemical analyses. Repeated scans of 10-25 gram samples were performed to test the sensitivity of the DXA and NMR methods to variation in sample mass. RESULTS: In mice, DXA and NMR reproducibility measures were similar for fat tissue mass (FTM) (DXA coefficient of variation [CV]=2.3%; and NMR CV=2.8%) (P=0.47), while reproducibility of lean tissue mass (LTM) estimates were better for DXA (1.0%) than NMR (2.2%) (advantages compared to DXA, such as speed of measurement and the ability to scan unanesthetized animals.

  9. Mesoporous composite nanoparticles for dual-modality ultrasound/magnetic resonance imaging and synergistic chemo-/thermotherapy against deep tumors.

    Science.gov (United States)

    Zhang, Nan; Wang, Ronghui; Hao, Junnian; Yang, Yang; Zou, Hongmi; Wang, Zhigang

    2017-01-01

    High-intensity focused ultrasound (HIFU) is a promising and noninvasive treatment for solid tumors, which has been explored for potential clinical applications. However, the clinical applications of HIFU for large and deep tumors such as hepatocellular carcinoma (HCC) are severely limited by unsatisfactory imaging guidance, long therapeutic times, and damage to normal tissue around the tumor due to the high power applied. In this study, we developed doxorubicin/perfluorohexane-encapsulated hollow mesoporous Prussian blue nanoparticles (HMPBs-DOX/PFH) as theranostic agents, which can effectively guide HIFU therapy and enhance its therapeutic effects in combination with chemotherapy, by decreasing the cavitation threshold. We investigated the effects of this agent on ultrasound and magnetic resonance imaging in vitro and in vivo. In addition, we showed a highly efficient HIFU therapeutic effect against HCC tumors, as well as controlled drug release, owing to the phase-transitional performance of the PFH. We therefore conclude that HMPB-DOX/PFH is a safe and efficient nanoplatform, which holds significant promise for cancer theranostics against deep tumors in clinical settings.

  10. Resonant electronic transport through a triple quantum-dot with Λ-type level structure under dual radiation fields

    International Nuclear Information System (INIS)

    Guan, Chun; Xing, Yunhui; Zhang, Chao; Ma, Zhongshui

    2014-01-01

    Due to quantum interference, light can transmit through dense atomic media, a phenomenon known as electromagnetically induced transparency (EIT). We propose that EIT is not limited to light transmission and there is an electronic analog where resonant transparency in charge transport in an opaque structure can be induced by electromagnetic radiation. A triple-quantum-dots system with Λ-type level structure is generally opaque due to the level in the center dot being significantly higher and therefore hopping from the left dot to the center dot is almost forbidden. We demonstrate that an electromagnetically induced electron transparency (EIET) in charge of transport can indeed occur in the Λ-type system. The direct evidence of EIET is that an electron can travel from the left dot to the right dot, while the center dot apparently becomes invisible. We analyze EIET and the related shot noise in both the zero and strong Coulomb blockade regimes. It is found that the EIET (position, height, and symmetry) can be tuned by several controllable parameters of the radiation fields, such as the Rabi frequencies and detuning frequencies. The result offers a transparency/opaque tuning technique in charge transport using interfering radiation fields

  11. Dual-Wavelength Surface Plasmon Resonance for Determining the Size and Concentration of Sub-Populations of Extracellular Vesicles.

    Science.gov (United States)

    Rupert, Deborah L M; Shelke, Ganesh V; Emilsson, Gustav; Claudio, Virginia; Block, Stephan; Lässer, Cecilia; Dahlin, Andreas; Lötvall, Jan O; Bally, Marta; Zhdanov, Vladimir P; Höök, Fredrik

    2016-10-04

    Accurate concentration determination of subpopulations of extracellular vesicles (EVs), such as exosomes, is of importance both in the context of understanding their fundamental biological role and of potentially using them as disease biomarkers. In principle, this can be achieved by measuring the rate of diffusion-limited mass uptake to a sensor surface modified with a receptor designed to only bind the subpopulation of interest. However, a significant error is introduced if the targeted EV subpopulation has a size, and thus hydrodynamic diffusion coefficient, that differs from the mean size and diffusion coefficient of the whole EV population and/or if the EVs become deformed upon binding to the surface. We here demonstrate a new approach to determine the mean size (or effective film thickness) of bound nanoparticles, in general, and EV subpopulation carrying a marker of interest, in particular. The method is based on operating surface plasmon resonance simultaneously at two wavelengths with different sensing depths and using the ratio of the corresponding responses to extract the particle size on the surface. By estimating in this way the degree of deformation of adsorbed EVs, we markedly improved their bulk concentration determination and showed that EVs carrying the exosomal marker CD63 correspond to not more than around 10% of the EV sample.

  12. Computation within the auxiliary field approach

    CERN Document Server

    Baeurle, S A

    2003-01-01

    Recently, the classical auxiliary field methodology has been developed as a new simulation technique for performing calculations within the framework of classical statistical mechanics. Since the approach suffers from a sign problem, a judicious choice of the sampling algorithm, allowing a fast statistical convergence and an efficient generation of field configurations, is of fundamental importance for a successful simulation. In this paper we focus on the computational aspects of this simulation methodology. We introduce two different types of algorithms, the single-move auxiliary field Metropolis Monte Carlo algorithm and two new classes of force-based algorithms, which enable multiple-move propagation. In addition, to further optimize the sampling, we describe a preconditioning scheme, which permits to treat each field degree of freedom individually with regard to the evolution through the auxiliary field configuration space. Finally, we demonstrate the validity and assess the competitiveness of these algo...

  13. Builtin vs. auxiliary detection of extrapolation risk.

    Energy Technology Data Exchange (ETDEWEB)

    Munson, Miles Arthur; Kegelmeyer, W. Philip,

    2013-02-01

    A key assumption in supervised machine learning is that future data will be similar to historical data. This assumption is often false in real world applications, and as a result, prediction models often return predictions that are extrapolations. We compare four approaches to estimating extrapolation risk for machine learning predictions. Two builtin methods use information available from the classification model to decide if the model would be extrapolating for an input data point. The other two build auxiliary models to supplement the classification model and explicitly model extrapolation risk. Experiments with synthetic and real data sets show that the auxiliary models are more reliable risk detectors. To best safeguard against extrapolating predictions, however, we recommend combining builtin and auxiliary diagnostics.

  14. CIT burn control using auxiliary power modulation

    International Nuclear Information System (INIS)

    Chaniotakis, E.A.; Freidberg, J.P.; Cohn, D.R.

    1989-01-01

    It is predicted that ignited tokamaks such as CIT will experience a thermal instability. In this work a zero dimensional transport model is used as a means of examining this thermal instability. In order to solve the problems associated with the uncertainty in predicting the behavior of an ignited tokamak plasma, auxiliary power may be used for mapping the tokamak operating space, both in the low temperature stable regime and in the high temperature unstable regime. Auxiliary power modulation as a means of burn control is the most reliable method, especially during the initial stages of CIT operation. By modulating the auxiliary power stable thermal equilibria can be created at relatively high values of Q (∼65). 20 refs., 28 figs

  15. 2-Deoxy-D-Glucose Modified Magnetic Nanoparticles with Dual Functional Properties: Nanothermotherapy and Magnetic Resonance Imaging.

    Science.gov (United States)

    Zhao, Lingyun; Zheng, Yajing; Yan, Hao; Xie, WenSheng; Sun, Xiaodan; Li, Ning; Tang, Jintian

    2016-03-01

    Superparamagnetic iron oxide nanoparticles (SPIONs) with appropriate surface chemistry have attracted wild attention in medical and biological application because of their current and potential usefulness such as magnetic resonance imaging (MRI) contrast enhancement, magnetic mediated hyperthermia (MMH), immunoassay, and in drug delivery, etc. In this study, we investigated the MRI contrast agents and MMH mediators properties of the novel 2-deoxy-D-glucose (2-DG) modified SPIONs. As a non-metabolizable glucose analogue, 2-DG can block glycolysis and inhibits protein glycosylation. Moreover, SPIONs coated with 2-DG molecules can be particularly attractive to resource-hungry cancer cells, therefore to realize the targeting strategy for the SPIONs. SPIONs with amino silane as the capping agent for amino-group surface modification were synthesized by the chemical co-precipitation method with modification. Glutaraldehyde was further applied as an activation agent through which 2-DG was conjugated to the amino-coated SPIONs. Physicochemical characterizations of the 2-DG-SPIONs, such as surface morphology, surface charge and magnetic properties were investigated by Transmission Electron Microscopy (TEM), ζ-Potential and Vibrating Sample Magnetometer (VSM), etc. Magnetic inductive heating characteristics of the 2-DG-SPIONs were analyzed by exposing the SPIONs suspension (magnetic fluid) under alternative magnetic field (AMF). U-251 human glioma cells with expression of glucose transport proteins type 1 and 3 (GLUT1 and GLUT 3), and L929 murine fibroblast cell as negative control, were employed to study the effect of 2-DG modification on the cell uptake for SPIONs. TEM images for ultra-thin sections as well as ICP-MS were applied to evaluate the SPIONs internalization within the cells. In vitro MRI was performed after cells were co-incubated with SPIONs and the T2 relaxation time was measured and compared. The results demonstrate that 2-DG-SPIONs were supermagnetic and in

  16. Quantification of trunk and android lean mass using dual energy x-ray absorptiometry compared to magnetic resonance imaging after spinal cord injury.

    Science.gov (United States)

    Rankin, Kathleen C; O'Brien, Laura C; Gorgey, Ashraf S

    2018-02-20

    To determine whether dual energy x-ray absorptiometry (DXA) compared to magnetic resonance imaging (MRI) may accurately quantify trunk lean mass (LM) after chronic spinal cord injury (SCI) and to investigate the relationships between trunk LM, visceral adiposity, trunk fat mass and basal metabolic rate (BMR). Cross-sectional design and correlational analysis. Research setting in a medical center. Twenty-two men with motor complete paraplegia (n = 14; T4-T11) and tetraplegia (n = 8; C5-C7) were recruited as part of a clinical trial. Not applicable. Trunk and android LM were measured using DXA. The volume of six trunk muscle groups were then measured using MRI to quantify trunk LM-MRI. Subcutaneous and visceral adipose tissue (VAT) cross-sectional areas were also measured using MRI. After overnight fast, BMR was evaluated using indirect calorimetry. Trunk LM-DXA (24 ± 3.3 kg) and android LM-DXA (3.6 ± 0.7 kg) overestimated (P android LM-DXA + 0.126; r 2 =0.26, SEE= 0.21 kg, P = 0.018. Percentage trunk LM-MRI was inversely related to VAT (r=-0.79, P android LM-DXA overestimated trunk LM-MRI. Percentage trunk LM-MRI, but not LM-DXA, was inversely related to trunk central adiposity. The findings highlight the importance of exercising trunk LM to attenuate cardio-metabolic disorders after SCI.

  17. Noninvasive measurements of body composition and body water via quantitative magnetic resonance, deuterium water, and dual-energy x-ray absorptiometry in awake and sedated dogs.

    Science.gov (United States)

    Zanghi, Brian M; Cupp, Carolyn J; Pan, Yuanlong; Tissot-Favre, Delphine G; Milgram, Norton W; Nagy, Tim R; Dobson, Howard

    2013-05-01

    To compare quantitative magnetic resonance (QMR), dual-energy x-ray absorptiometry (DXA), and deuterium oxide (D2O) methods for measurement of total body water (TBW), lean body mass (LBM), and fat mass (FM) in healthy dogs and to assess QMR accuracy. 58 Beagles (9 months to 11.5 years old). QMR scans were performed on awake dogs. A D2O tracer was administered (100 mg/kg, PO) immediately before dogs were sedated, which was followed by a second QMR or DXA scan. Jugular blood samples were collected before and 120 minutes after D2O administration. TBW, LBM, and FM determined via QMR were not significantly different between awake or sedated dogs, and means differed by only 2.0%, 2.2%, and 4.3%, respectively. Compared with results for D2O dilution, QMR significantly underestimated TBW (10.2%), LBM (13.4%), and FM (15.4%). Similarly, DXA underestimated LBM (7.3%) and FM (8.4%). A significant relationship was detected between FM measured via D2O dilution and QMR (r(2) > 0.89) or DXA (r(2) > 0.88). Even though means of TBW and LBM differed significantly between D2O dilution and QMR or DXA, values were highly related (r(2) > 0.92). QMR was useful for determining body composition in dogs and can be used to safely and rapidly acquire accurate data without the need for sedation or anesthesia. These benefits can facilitate frequent scans, particularly in geriatric, extremely young, or ill pets. Compared with the D2O dilution method, QMR correction equations provided accurate assessment over a range of body compositions.

  18. Enzyme kinetics, inhibitors, mutagenesis and electron paramagnetic resonance analysis of dual-affinity nitrate reductase in unicellular N(2)-fixing cyanobacterium Cyanothece sp. PCC 8801.

    Science.gov (United States)

    Wang, Tung-Hei; Chen, Yung-Han; Huang, Jine-Yung; Liu, Kang-Cheng; Ke, Shyue-Chu; Chu, Hsiu-An

    2011-11-01

    The assimilatory nitrate reductase (NarB) of N(2)-fixing cyanobacterium Cyanothece sp. PCC 8801 is a monomeric enzyme with dual affinity for substrate nitrate. We purified the recombinant NarB of Cyanothece sp. PCC 8801 and further investigated it by enzyme kinetics analysis, site-directed mutagenesis, inhibitor kinetics analysis, and electron paramagnetic resonance (EPR) spectroscopy. The NarB showed 2 kinetic regimes at pH 10.5 or 8 and electron-donor conditions methyl viologen or ferredoxin (Fd). Fd-dependent NR assay revealed NarB with very high affinity for nitrate (K(m)1, ∼1μM; K(m)2, ∼270μM). Metal analysis and EPR results showed that NarB contains a Mo cofactor and a [4Fe-4S] cluster. In addition, the R352A mutation on the proposed nitrate-binding site of NarB greatly altered both high- and low-affinity kinetic components. Furthermore, the effect of azide on the NarB of Cyanothece sp. PCC 8801 was more complex than that on the NarB of Synechococcus sp. PCC 7942 with its single kinetic regime. With 1mM azide, the kinetics of the wild-type NarB was transformed from 2 kinetic regimes to hyperbolic kinetics, and its activity was enhanced significantly under medium nitrate concentrations. Moreover, EPR results also suggested a structural difference between the two NarBs. Taken together, our results show that the NarB of Cyanothece sp. PCC 8801 contains only a single Mo-catalytic center, and we rule out that the enzyme has 2 independent, distinct catalytic sites. In addition, the NarB of Cyanothece sp. PCC 8801 may have a regulatory nitrate-binding site. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  19. Comparison of dual-energy X-ray absorptiometry and magnetic resonance imaging-measured adipose tissue depots in HIV-infected and control subjects.

    Science.gov (United States)

    Scherzer, Rebecca; Shen, Wei; Bacchetti, Peter; Kotler, Donald; Lewis, Cora E; Shlipak, Michael G; Punyanitya, Mark; Heymsfield, Steven B; Grunfeld, Carl

    2008-10-01

    Studies in persons without HIV infection have compared adipose tissue measured by dual-energy X-ray absorptiometry (DXA) and magnetic resonance imaging (MRI), but no such study has been conducted in HIV-infected (HIV+) subjects, who have a high prevalence of regional fat loss. We compared DXA- with MRI-measured trunk, leg, arm, and total fat in HIV+ and control subjects. A cross-sectional analysis was conducted in 877 HIV+ subjects and 260 control subjects in FRAM (Study of Fat Redistribution and Metabolic Change in HIV Infection), stratified by sex and HIV status. Univariate associations of DXA with MRI were strongest for total and trunk fat (r > or = 0.92) and slightly weaker for leg (r > or = 0.87) and arm (r > or = 0.71) fat. The average estimated limb fat was substantially greater for DXA than for MRI for HIV+ and control men and women (all P < 0.0001). Less of a difference was observed in trunk fat measured by DXA and MRI, but the difference was still statistically significant (P < 0.0001). Bland-Altman plots showed increasing differences and variability. Greater average limb fat in control and HIV+ subjects (both P < 0.0001) was associated with greater differences between DXA and MRI measurements. Because the control subjects had more limb fat than did the HIV+ subjects, greater amounts of fat were measured by DXA than by MRI when control subjects were compared with HIV+ subjects. More HIV+ subjects had leg fat in the bottom decile of the control subjects by DXA than by MRI (P < 0.0001). Although DXA- and MRI-measured adipose tissue depots correlate strongly in HIV+ and control subjects, differences increase as average fat increases, particularly for limb fat. DXA may estimate a higher prevalence of peripheral lipoatrophy than does MRI in HIV+ subjects.

  20. Dual-emission fluorescence resonance energy transfer (FRET) real-time PCR differentiates feline immunodeficiency virus subtypes and discriminates infected from vaccinated cats.

    Science.gov (United States)

    Wang, Chengming; Johnson, Calvin M; Ahluwalia, Sudhir K; Chowdhury, Erfan; Li, Yihang; Gao, Dongya; Poudel, Anil; Rahman, K Shamsur; Kaltenboeck, Bernhard

    2010-05-01

    Feline immunodeficiency virus (FIV) is among the most common infectious agents of cats. Five well-characterized FIV subtypes, A, B, C, D, and E, are recognized worldwide. As in HIV diagnosis, serum antibodies against FIV classically serve as an indicator of infection status. After the introduction of an inactivated FIV vaccine, this approach has become problematic, since antibodies generated by vaccination are indistinguishable from antibodies in response to infection. However, PCR detection of host-cell-integrated FIV DNA will differentiate infection-derived antibody from vaccination-derived positivity because presumably the RNA of inactivated vaccine virus will not integrate into the host genome. In this study, we established a gag gene-based dual-emission fluorescence resonance energy transfer (FRET) real-time PCR that amplifies single-target copies of all known FIV strains and differentiates five FIV subtypes. All blood samples from experimentally FIV-infected cats (n=5) were antibody positive and highly positive in the FIV PCR. In contrast, nine cats became antibody positive after FIV vaccination but remained negative in the FIV PCR. Of 101 FIV antibody-positive feline blood specimens submitted for FIV PCR diagnosis, 61 were positive (60%). A total of 23 of the positive PCRs identified subtype A, 11 identified subtype B1, 11 identified subtype B2/E, and 16 identified subtype C. FIV subtype D was not detected in any submitted specimens even though 13 blood specimens were from cats known to have received the FIV vaccine, which contains FIV subtype A and D inactivated virions. Therefore, this PCR quantitatively identifies FIV subtypes and unambiguously discriminates between FIV-vaccinated and FIV-infected cats.

  1. Curricular Guidelines for Dental Auxiliary Radiology.

    Science.gov (United States)

    Journal of Dental Education, 1981

    1981-01-01

    AADS curricular guidelines suggest objectives for these areas of dental auxiliary radiology: physical principles of X-radiation in dentistry, related radiobiological concepts, principles of radiologic health, radiographic technique, x-ray films and intensifying screens, factors contributing to film quality, darkroom, and normal variations in…

  2. Monitoring process variability using auxiliary information

    NARCIS (Netherlands)

    Riaz, M.

    2008-01-01

    In this study a Shewhart type control chart namely V (r) chart is proposed for improved monitoring of process variability (targeting large shifts) of a quality characteristic of interest Y. The proposed control chart is based on regression type estimator of variance using a single auxiliary variable

  3. Auxiliary power unit for moving a vehicle

    Science.gov (United States)

    Akasam, Sivaprasad [Peoria, IL; Johnson, Kris W [Peoria, IL; Johnson, Matthew D [Peoria, IL; Slone, Larry M [Washington, IL; Welter, James Milton [Chillicothe, IL

    2009-02-03

    A power system is provided having at least one traction device and a primary power source configured to power the at least one traction device. In addition, the power system includes an auxiliary power source also configured to power the at least one traction device.

  4. Design and scope of impact of auxiliary lanes : technical report.

    Science.gov (United States)

    2014-06-01

    For decades, Texas Department of Transportation districts have constructed auxiliary lanes to support interchange : ramp operations and to resolve congestion proximate to freeway entrance and exit ramps. While auxiliary lanes are : built throughout T...

  5. The sensitivity of auxiliary examinations in different stages of sporadic Creutzfeldt-Jakob disease

    Directory of Open Access Journals (Sweden)

    Jiao-jiao JIANG

    2017-06-01

    Full Text Available Objective To analyze the sensitivity of auxiliary examinations in different periods of sporadic Creutzfeldt-Jakob disease (sCJD. Methods The clinical data of 53 sCJD patients were retrospectively analyzed including the different stages of skull diffusion-weighted magnetic resonance imaging (DWI, 24-hour ambulatory electroencephalogram (EEG, 18F-FDG PET/CT (PET-CT and cerebrospinal fluid 14-3-3 protein. When calculating the sensitivity of an auxiliary examination, the diagnostic criteria were defined by combining the specific clinical manifestations with two or more positive results of other auxiliary examinations. Results There were 24, 53 and 22 sCJD patients, respectively, met the criterion of early (E, middle (M and later (L stage of disease (some patients fit 2 or 3 stages. The sensitivity of DWI (E: 58.3%, M: 85.4%, L: 94.7%, EEG (E: 45.8%, M: 62.7%, L: 77.8%, 14-3-3 protein in cerebrospinal fluid (E: 11.1%, M: 52.9% and PET-CT (E: 80%, M: 100% increased gradually with disease progression. The sensitivity of PET-CT was higher than the other auxiliary examinations for E and M stages; no PET-CT was conducted in L stage. High signal regions mainly distributed in the cortex in E and M stages, but in L stage, no significant difference was found on the distribution of high signal regions between cortex and basal ganglia. Conclusions The sensitivities of the auxiliary examinations were different for sCJD patients in different stages. Reexaminations in different periods may improve the sensitivity for sCJD diagnosis. The sensitivity of PET-CT was high, and the combination of PET-CT and other auxiliary examinations may play a key role in the diagnosis of sCJD. DOI: 10.11855/j.issn.0577-7402.2017.05.15

  6. Core-shell NaGdF4@CaCO3nanoparticles for enhanced magnetic resonance/ultrasonic dual-modal imaging via tumor acidic micro-enviroment triggering.

    Science.gov (United States)

    Wei, Zuwu; Lin, Xiao; Wu, Ming; Zhao, Bixing; Lin, Ruhui; Zhang, Da; Zhang, Yun; Liu, Gang; Liu, Xiaolong; Liu, Jingfeng

    2017-07-14

    For cancer diagnosis, a paramount challenge still exists in the exploring of methods that can precisely discriminate tumor tissues from their surrounding healthy tissues with a high target-to-background signal ratio. Here, we report a NaGdF 4 @CaCO 3 -PEG core-shell nanoparticle which has the tumor acidic microenvironment enhanced imaging signals of ultrasound and magnetic resonance. Under the acidic conditions, the CaCO 3 shell will gradually dissolve which then facilitate the interaction of NaGdF 4 with the external aqueous environment to enhance water proton relaxation. Meanwhile, the CO 2 bubbles generated by the CaCO 3 dissolvement will generate strong elastic echo for US detection. The core-shell structure of NaGdF 4 @CaCO 3 -PEG can be observed by TEM, and its composition can be determined by STEM. The acid triggered generation of CO 2 bubbles and the enhancement of MRI signal could be demonstrated in vitro, and the excellent dual-modal magnetic resonance/ultrasonic cancer imaging abilities of NaGdF 4 @CaCO 3 -PEG could be also proved at the tumor site in vivo. The here described proof-of-concept nanoparticles with pH triggered magnetic resonance/ultrasonic dual-modal imaging enhancement, may serve as a useful guide to develop various molecular imaging strategies for cancer diagnosis in the future.

  7. The English Primary Auxiliary Verbs: A Linguistic Theoretical Exercise

    African Journals Online (AJOL)

    Nekky Umera

    words, because the English primary auxiliary verbs are so important in our communication, speakers must consider the various ways thus type of auxiliary verbs can be grammatically used in sentences. Traditional Grammar Approach to the Use of English Auxiliaries. Greenbaum (1988) defines grammar as a general theory ...

  8. 14 CFR 25.445 - Auxiliary aerodynamic surfaces.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary aerodynamic surfaces. 25.445... § 25.445 Auxiliary aerodynamic surfaces. (a) When significant, the aerodynamic influence between auxiliary aerodynamic surfaces, such as outboard fins and winglets, and their supporting aerodynamic...

  9. 30 CFR 57.8529 - Auxiliary fan systems

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fan systems 57.8529 Section 57.8529 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND NONMETAL MINE... Underground Only § 57.8529 Auxiliary fan systems When auxiliary fan systems are used, such systems shall...

  10. Validation of dual energy X-ray absorptiometry measures of abdominal fat by comparison with magnetic resonance imaging in an Indian population.

    Directory of Open Access Journals (Sweden)

    Amy E Taylor

    Full Text Available OBJECTIVE: Abdominal adiposity is an important risk factor for diabetes and cardiovascular disease in Indians. Dual energy X-ray absorptiometry (DXA can be used to determine abdominal fat depots, being more accessible and less costly than gold standard measures such as magnetic resonance imaging (MRI. DXA has not been fully validated for use in South Asians. Here, we determined the accuracy of DXA for measurement of abdominal fat in an Indian population by comparison with MRI. DESIGN: 146 males and females (age range 18-74, BMI range 15-46 kg/m(2 from Hyderabad, India underwent whole body DXA scans on a Hologic Discovery A scanner, from which fat mass in two abdominal regions was calculated, from the L1 to L4 vertebrae (L1L4 and from the L2 to L4 vertebrae (L2L4. Abdominal MRI scans (axial T1-weighted spin echo images were taken, from which adipose tissue volumes were calculated for the same regions. RESULTS: Intra-class correlation coefficients between DXA and MRI measures of abdominal fat were high (0.98 for both regions. Although at the level of the individual, differences between DXA and MRI could be large (95% of DXA measures were between 0.8 and 1.4 times MRI measures, at the sample level, DXA only slightly overestimated MRI measures of abdominal fat mass (mean difference in L1L4 region: 2% (95% CI:0%, 5%, mean difference in L2L4 region:4% (95% CI: 1%, 7%. There was evidence of a proportional bias in the association between DXA and MRI (correlation between difference and mean -0.3, with overestimation by DXA greater in individuals with less abdominal fat (mean bias in leaner half of sample was 6% for L1L4 (95%CI: 2, 11% and 7% for L2L4 (95% CI:3,12%. CONCLUSIONS: DXA measures of abdominal fat are suitable for use in Indian populations and provide a good indication of abdominal adiposity at the population level.

  11. Modified Darboux transformations with foreign auxiliary equations

    International Nuclear Information System (INIS)

    Schulze-Halberg, Axel

    2011-01-01

    We construct a new type of first-order Darboux transformations for the stationary Schroedinger equation. In contrast to the conventional case, our Darboux transformations support arbitrary (foreign) auxiliary equations. We show that among other applications, our formalism can be used to systematically construct Darboux transformations for Schroedinger equations with energy-dependent potentials, including a recent result (Lin et al., 2007) as a special case. -- Highlights: → We generalize the Darboux transformation for the Schroedinger equation. → By admitting arbitrary auxiliary functions, we provide a new tool for generating solutions. → As a special case we recover a recent result on energy-dependent potentials. → We extend the latter result to very general energy-dependence.

  12. Ferroresonance Phenomenon in Power Plant Auxiliary Grids

    Directory of Open Access Journals (Sweden)

    Maciej Łosiński

    2015-03-01

    Full Text Available The paper discusses the problem of the ferroresonance phenomenon occurring in a medium voltage grid with an ungrounded neutral point of the supply transformer. Results of a study of ferroresonance in the auxiliary grid at Żarnowiec Pumped Storage Power Plant are presented. Analysis of the study results has led to the development and implementation of an effective method of preventing the adverse ferroresonance phenomenon.

  13. System Study: Auxiliary Feedwater 1998–2013

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, John Alton [Idaho National Lab. (INL), Idaho Falls, ID (United States). Risk Assessment and Management Services Dept.

    2014-12-31

    This report presents an unreliability evaluation of the auxiliary feedwater (AFW) system at 69 U.S. commercial nuclear power plants. Demand, run hours, and failure data from fiscal year 1998 through 2013 for selected components were obtained from the Institute of Nuclear Power Operations (INPO) Consolidated Events Database (ICES). The unreliability results are trended for the most recent 10-year period, while yearly estimates for system unreliability are provided for the entire active period. No statistically significant increasing or decreasing trends were identified in the AFW results.

  14. Hydrogen/oxygen auxiliary propulsion technology

    Science.gov (United States)

    Reed, Brian D.; Schneider, Steven J.

    1991-01-01

    This paper provides a survey of hydogen/oxygen (H/O) auxiliary propulsion system (APS) concepts and low thrust H/O rocket technology. A review of H/O APS studies performed for the Space Shuttle, Space Tug, Space Station Freedom, and Advanced Manned Launch System programs is given. The survey also includes a review of low thrust H/O rocket technology programs, covering liquid H/O and gaseous H/O thrusters, ranging from 6600 N to 440 mN thrust. Ignition concepts for H/O thrusters and high-temperature, oxidation-resistant chamber materials are also reviewed.

  15. Heat exchanger with auxiliary cooling system

    Science.gov (United States)

    Coleman, John H.

    1980-01-01

    A heat exchanger with an auxiliary cooling system capable of cooling a nuclear reactor should the normal cooling mechanism become inoperable. A cooling coil is disposed around vertical heat transfer tubes that carry secondary coolant therethrough and is located in a downward flow of primary coolant that passes in heat transfer relationship with both the cooling coil and the vertical heat transfer tubes. A third coolant is pumped through the cooling coil which absorbs heat from the primary coolant which increases the downward flow of the primary coolant thereby increasing the natural circulation of the primary coolant through the nuclear reactor.

  16. System Study: Auxiliary Feedwater 1998-2014

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, John Alton [Idaho National Lab. (INL), Idaho Falls, ID (United States). Risk Assessment and Management Services Dept.

    2015-12-01

    This report presents an unreliability evaluation of the auxiliary feedwater (AFW) system at 69 U.S. commercial nuclear power plants. Demand, run hours, and failure data from fiscal year 1998 through 2014 for selected components were obtained from the Institute of Nuclear Power Operations (INPO) Consolidated Events Database (ICES). The unreliability results are trended for the most recent 10 year period, while yearly estimates for system unreliability are provided for the entire active period. No statistically significant increasing or decreasing trends were identified in the AFW results.

  17. Dual power, constant speed electric motor system

    Science.gov (United States)

    Kirschbaum, Herbert S.

    1984-01-01

    A dual capacity permanent split capacitor electric motor system is provided with a stator having main and auxiliary windings. The main stator winding includes two winding sections which are connected in parallel with each other and across a pair of line terminals while the auxiliary winding is connected in series with a capacitor to form a circuit branch which is connected between the line terminals for operation at a first output power level. Switching means are provided to reconnect the main stator winding sections in series with each other and in series with a second capacitor to form a circuit branch which is connected between the line terminals while the stator auxiliary winding is connected directly between the line terminals for operation at a second output power level. Automatic rotation reversal occurs when the motor switches from the first to the second output power level.

  18. Auxiliary equipment cooling circuit in nuclear reactors

    International Nuclear Information System (INIS)

    Yanagisawa, Ko.

    1986-01-01

    Purpose: To prevent the propagation of bacterias that transform NO 2 into NO 3 in auxiliary equipment coolants using corrosion inhibitors of nitrite type in BWR type reactors. Method: In auxiliary equipments coolant systems, water quality is controlled by using purified water as supplement water and nitrite such as Na 2 NO 2 as the corrosion inhibitors. However, in the circumstance where dissolved oxygen is present, bacteria propagate to oxidize NO 2 into NO 3 . Thus, NO 2 at 200 ppm is reduced to 20 ppm. In view of the above, a surge tank supplied from water supplement line is connected in series and a deaeration device is disposed thereto. Since the presence of dissolved oxygen causes the bacteria to propagate it is desired that the dissolved oxygen density in the supplement water is less than 5 ppm. Deaeration and pressure reduction in the surge tank can remove the dissolved oxygen, prevent NO 3 increase and also prevent stress corrosion cracks in the system pipeways. (Horiuchi, T.)

  19. Effects of Auxiliary-Source Connection in Multichip Power Module

    DEFF Research Database (Denmark)

    Li, Helong; Munk-Nielsen, Stig; Wang, Xiongfei

    2017-01-01

    the power loop and the gate loop like how the Kelvin-source connection does, owing to their involvement in the loop of the power source current. Three effects of the auxiliary-source connections are then analyzed, which are 1) the common source stray inductance reduction, 2) the transient drain-source......Auxiliary-source bond wires and connections are widely used in power modules with paralleled MOSFETs or IGBTs. This paper investigates the operation mechanism of the auxiliary-source connections in multichip power modules. It reveals that the auxiliary-source connections cannot fully decouple...

  20. Dual Diagnosis

    Science.gov (United States)

    A person with dual diagnosis has both a mental disorder and an alcohol or drug problem. These conditions occur together frequently. In particular, ... to emotional and mental problems. Someone with a dual diagnosis must treat both conditions. For the treatment ...

  1. LOX/hydrocarbon auxiliary propulsion system study

    Science.gov (United States)

    Orton, G. F.; Mark, T. D.; Weber, D. D.

    1982-01-01

    Liquid oxygen (LOX)/hydrocarbon propulsion concepts for a "second generation' orbiter auxiliary propulsion system was evaluated. The most attractive fuel and system design approach identified, and the technology advancements that are needed to provide high confidence for a subsequent system development were determined. The fuel candidates were ethanol, methane, propane, and ammonia. Even though ammonia is not a hydrocarbon, it was included for evaluation because it is clean burning and has a good technology base. The major system design options were pump versus pressure feed, cryogenic versus ambient temperature RCS propellant feed, and the degree of OMS-RCS integration. Ethanol was determined to be the best fuel candidate. It is an earth-storable fuel with a vapor pressure slightly higher than monomethyl hydrazine. A pump-fed OMS was recommended because of its high specific impulse, enabling greater velocity change and greater payload capability than a pressure fed system.

  2. 75 FR 57200 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2010-09-20

    ... 147 [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary... proposing to amend the National Poultry Improvement Plan (the Plan) and its auxiliary provisions by... Coordinator, Poultry Improvement Staff, National Poultry Improvement Plan, Veterinary Services, APHIS, USDA...

  3. 76 FR 15791 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2011-03-22

    ... [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions... the National Poultry Improvement Plan (the Plan) and its auxiliary provisions by providing new or... National Poultry Improvement Plan (NPIP, also referred to below as ``the Plan'') is a cooperative Federal...

  4. 14 CFR 25.1142 - Auxiliary power unit controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 25.1142... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Powerplant Powerplant Controls and Accessories § 25.1142 Auxiliary power unit controls. Means must be provided on the flight deck for starting...

  5. 14 CFR 23.1142 - Auxiliary power unit controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 23.1142... Powerplant Controls and Accessories § 23.1142 Auxiliary power unit controls. Means must be provided on the... power unit. [Doc. No. 26344, 58 FR 18974, Apr. 9, 1993] ...

  6. 14 CFR 29.1142 - Auxiliary power unit controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 29.1142... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Powerplant Powerplant Controls and Accessories § 29.1142 Auxiliary power unit controls. Means must be provided on the flight deck for starting...

  7. Energy consumption of auxiliary systems of electric cars

    Directory of Open Access Journals (Sweden)

    Evtimov Ivan

    2017-01-01

    Full Text Available The paper analyzes the power demand of the auxiliary systems of electric cars. On the basis of existing electric cars an analysis of energy consumption of different auxiliary systems is done. As a result possibilities for rational use of these systems have been proposed, which can increase the mileage per one charge of the battery.

  8. The English Primary Auxiliary Verbs: A Linguistic Theoretical Exercise

    African Journals Online (AJOL)

    themselves. This paper aims at carrying out linguistic theoretical exercise as regards the use of the English primary auxiliary verbs. The paper also aims at exposing the rate at which speakers of English Language misuse the. English primary auxiliary verbs. The traditional grammar alongside structural grammar was used to ...

  9. Dedicated auxiliary power units for Hybrid Electric Vehicles

    NARCIS (Netherlands)

    Mourad, S.; Weijer, C.J.T. van de

    1998-01-01

    The use of a dedicated auxiliary power unit is essential to utilize the potential that hybrid vehicles offer for efficient and ultra-clean transportation. An example of a hybrid project at the TNO Road-Vehicles Research Institute shows the development and the results of a dedicated auxiliary power

  10. 47 CFR 80.290 - Auxiliary receiving antenna.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Auxiliary receiving antenna. 80.290 Section 80... antenna. An auxiliary receiving antenna must be provided when necessary to avoid unauthorized interruption or reduced efficiency of the required watch because the normal receiving antenna is not available...

  11. ON THE CATEGORY STATUS OF AUXILIARIES AND THE ...

    African Journals Online (AJOL)

    Seem requires a [+ stativeJ verb in its complement. However, this set of auxiliaries cannot occur in the complement of a verb like force, requiring a [- stativeJ verb in its comPlement.18). Ross explains the above data by assuming that this set of auxiliaries has the features. [: ~ux. J. The major premiss of the relevant argument ...

  12. Acute vertebral fracture after spinal fusion: a case report illustrating the added value of single-source dual-energy computed tomography to magnetic resonance imaging in a patient with spinal Instrumentation

    International Nuclear Information System (INIS)

    Fuchs, M.; Putzier, M.; Pumberger, M.; Hermann, K.G.; Diekhoff, T.

    2016-01-01

    Magnetic resonance imaging (MRI) is degraded by metal-implant-induced artifacts when used for the diagnostic assessment of vertebral compression fractures in patients with instrumented spinal fusion. Dual-energy computed tomography (DECT) offers a promising supplementary imaging tool in these patients. This case report describes an 85-year-old woman who presented with a suspected acute vertebral fracture after long posterior lumbar interbody fusion. This is the first report of a vertebral fracture that showed bone marrow edema on DECT; however, edema was missed by an MRI STIR sequence owing to metal artifacts. Bone marrow assessment using DECT is less susceptible to metal artifacts than MRI, resulting in improved visualization of vertebral edema in the vicinity of fused vertebral bodies. (orig.)

  13. Synthesis of Ferromagnetic Fe0.6 Mn0.4 O Nanoflowers as a New Class of Magnetic Theranostic Platform for In Vivo T1 -T2 Dual-Mode Magnetic Resonance Imaging and Magnetic Hyperthermia Therapy.

    Science.gov (United States)

    Liu, Xiao Li; Ng, Cheng Teng; Chandrasekharan, Prashant; Yang, Hai Tao; Zhao, Ling Yun; Peng, Erwin; Lv, Yun Bo; Xiao, Wen; Fang, Jie; Yi, Jia Bao; Zhang, Huan; Chuang, Kai-Hsiang; Bay, Boon Huat; Ding, Jun; Fan, Hai Ming

    2016-08-01

    Uniform wüstite Fe0.6 Mn0.4 O nanoflowers have been successfully developed as an innovative theranostic agent with T1 -T2 dual-mode magnetic resonance imaging (MRI), for diagnostic applications and therapeutic interventions via magnetic hyperthermia. Unlike their antiferromagnetic bulk counterpart, the obtained Fe0.6 Mn0.4 O nanoflowers show unique room-temperature ferromagnetic behavior, probably due to the presence of an exchange coupling effect. Combined with the flower-like morphology, ferromagnetic Fe0.6 Mn0.4 O nanoflowers are demonstrated to possess dual-modal MRI sensitivity, with longitudinal relaxivity r1 and transverse relaxivity r2 as high as 4.9 and 61.2 mm(-1) s(-1) [Fe]+[Mn], respectively. Further in vivo MRI carried out on the mouse orthotopic glioma model revealed gliomas are clearly delineated in both T1 - and T2 -weighted MR images, after administration of the Fe0.6 Mn0.4 O nanoflowers. In addition, the Fe0.6 Mn0.4 O nanoflowers also exhibit excellent magnetic induction heating effects. Both in vitro and in vivo magnetic hyperthermia experimentation has demonstrated that magnetic hyperthermia by using the innovative Fe0.6 Mn0.4 O nanoflowers can induce MCF-7 breast cancer cell apoptosis and a complete tumor regression without appreciable side effects. The results have demonstrated that the innovative Fe0.6 Mn0.4 O nanoflowers can be a new magnetic theranostic platform for in vivo T1 -T2 dual-mode MRI and magnetic thermotherapy, thereby achieving a one-stop diagnosis cum effective therapeutic modality in cancer management. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Elimination of the auxiliary fields in the antifield formalism

    International Nuclear Information System (INIS)

    Henneaux, M.

    1990-01-01

    The problem of the elimination of the auxiliary fields in the path integral quantization of gauge theories is investigated in the context of the antifield formalism. It is shown that gauge fixing fermions can be found such that: (i) the auxiliary fields remain auxiliary after gauge fixing; and (ii) the gauge fixed actions obtained by eliminating the auxiliary fields before or after writing down the path integral coincide. The contribution of the auxiliary fields to the integration measure is also discussed. These results are applied (i) to the problem of the equivalence between the lagrangian and hamiltonian path integral formulations; and (ii) to the problem of the elimination of the second class constraints in the hamiltonian formalism. (orig.)

  15. Effects of auxiliary source connections in multichip power module

    DEFF Research Database (Denmark)

    Li, Helong; Munk-Nielsen, Stig; Beczkowski, Szymon

    2016-01-01

    totally decouple the power loop and the gate loop like how the Kelvin source connection does, because they are still in the loop of power source current. Three effects of the auxiliary source connection are investigated and analyzed: common source stray inductance reduction, transient drain-source current......Auxiliary source bond wires and connections are widely used to in the power module with paralleled MOSFETs or IGBTs. This paper investigates the working mechanism and the effects of the auxiliary source connections in multichip power modules. It reveals that the auxiliary source connections cannot...... imbalance mitigation and influence on the steady state bond wire current distribution. Simulation and experimental results validate the working mechanism analysis and the effects of the auxiliary source connections....

  16. Use of a Simple, Inexpensive Dual-Modality Phantom as a Learning Tool for Magnetic Resonance Imaging-Ultrasound Fusion Techniques.

    Science.gov (United States)

    Walter, William R; Burke, Christopher J; Diallo, Mamadou; Adler, Ronald S

    2018-02-15

    We describe an easily constructed, customizable phantom for magnetic resonance imaging-ultrasound fusion imaging and demonstrate its role as a learning tool to initiate clinical use of this emerging modality. Magnetic resonance imaging-ultrasound fusion can prove unwieldy to integrate into routine practice. We demonstrate real-time fusion with single-sequence magnetic resonance imaging uploaded to the ultrasound console. Phantom training sessions allow radiologists and sonographers to practice fiducial marker selection and improve efficiency with the fusion hardware and software interfaces. Such a tool is useful when the modality is first introduced to a practice and in settings of sporadic use, in which intermittent training may be useful. © 2018 by the American Institute of Ultrasound in Medicine.

  17. Defining a Cohort of Men Who May Not Require Repeat Prostate Biopsy Based on PCA3 Score and Magnetic Resonance Imaging: The Dual Negative Effect.

    Science.gov (United States)

    Perlis, Nathan; Al-Kasab, Thamir; Ahmad, Ardalan; Goldberg, Estee; Fadak, Kamel; Sayid, Rashid; Finelli, Antonio; Kulkarni, Girish; Hamilton, Rob; Zlotta, Alexandre; Ghai, Sangeet; Fleshner, Neil

    2017-11-23

    Prostate cancer over diagnosis and overtreatment are concerns for clinicians and policy makers. Multiparametric magnetic resonance imaging and the PCA3 (prostate cancer antigen 3) urine test select for clinically significant cases. We explored how well the tests performed together in with previous biopsies. In accordance with ethics committee approval we collected clinicopathological data on all patients in whom a PCA3 test from was done 2011 to June 2016. This included patients on active surveillance for low risk prostate cancer and those without prostate cancer who had previous negative biopsies and suspicion of occult disease. We explored whether age, prostate specific antigen, PCA3 score, multiparametric magnetic resonance imaging, digital rectal examination, family history and prostate size would predict clinically significant prostate cancer on repeat biopsy. The negative predictive value of multiparametric magnetic resonance imaging and PCA3 score was calculated. A total of 470 patients were included in study. The PCA3 score was abnormal at 35 or greater in 32.5% of cases. In the multivariate model including 154 men only age (OR 1.08, 95% CI 1.01-1.16), multiparametric magnetic resonance imaging PI-RADS™ (Prostate Imaging-Reporting and Data System) score 4 (OR 16.6, 95% CI 3.9-70.0) or 5 (OR 28.3, 95% CI 5.7-138) and PCA3 score (OR 2.9, 95% CI 1.0-8.8) predicted clinically significant cancer on biopsy. No patient with negative multiparametric magnetic resonance imaging and a normal PCA3 score had clinically significant prostate cancer on biopsy for a negative predictive value of 100% (p magnetic resonance imaging and PCA3 score) clinically significant prostate cancer was never found on biopsy, which may be unnecessary in this group. This study was limited by its retrospective design, selection bias and lack of cost-effectiveness data. Copyright © 2018 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights

  18. Forster Resonance Energy Transfer (FRET) Analysis of Dual CFP/YFP Labeled AMPA Receptors Reveals Structural Rearrangement within the C-Terminal Domain during Receptor Activation

    DEFF Research Database (Denmark)

    Zachariassen, Linda Grønborg; Katchan, Mila; Plested, Andrew

    2014-01-01

    AMPA receptors (AMPARs) are glutamate-gated cation channels that mediate the majority of fast excitatory neurotransmission in the central nervous system. AMPARs are formed by homo- or heterotetramers of GluA1 to GluA4 sub- units. A recent X-ray crystal structure of a full-length homomeric GluA2 AM......- PAR has allowed unique insight into AMPAR molecular structure and provides an improved framework for beginning to understand the structural mechanism underlying receptor function, regulation and pharmacological modulation. In the present study, we have explored dual insertion of cyan and yellow...

  19. Aging assessment of auxiliary feedwater pumps

    International Nuclear Information System (INIS)

    Greenstreet, W.L.

    1987-01-01

    ORNL is conducting aging assessments of auxiliary feedwater pumps to provide recommendations for monitoring and assessing the severity of time-dependent degradation as well as to recommend maintenance and replacement practices. Cornerstones of these activities are the identification of failure modes and causes and ranking of causes. Failure modes and causes of interest are those due to aging and service wear. Design details, functional requirements, and operating experience data were used to identify failure modes and causes and to rank the latter. Based on this input, potentially useful inspection, surveillance, and condition monitoring methods that are currently available for use or in the developmental stage were examined and recommendations made. The methods selected are listed and discussed in terms of use and information to be obtained. Relationships between inspection, surveillance, and monitoring and maintenance practices entered prominently into maintenance recommendations. These recommendations, therefore, embrace predictive as well as corrective and preventative maintenance practices. The recommendations are described, inspection details are discussed, and periodic inspection and maintenance interval guidelines are given. Surveillance testing at low-flow conditions is also discussed. It is shown that this type of testing can lead to accelerated aging

  20. Satellite auxiliary-propulsion selection techniques. Addendum: A survey of auxiliary electric propulsion systems

    Science.gov (United States)

    Holcomb, L. B.

    1971-01-01

    A review of electric thrusters for satellite auxiliary propulsion was conducted at JPL during the past year. Comparisons of the various thrusters for attitude propulsion and east-west and north-south stationkeeping were made based upon performance, mass, power, and demonstrated life. Reliability and cost are also discussed. The method of electrical acceleration of propellant served to divide the thruster systems into two groups: electrostatic and electromagnetic. Ion and colloid thrusters fall within the electrostatically accelerated group while MPD and pulsed plasma thrusters comprise the electromagnetically accelerated group. The survey was confined to research in the United States with accent on flight and flight prototype systems.

  1. Low dose prospective ECG-gated delayed enhanced dual-source computed tomography in reperfused acute myocardial infarction comparison with cardiac magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Wang Rui, E-mail: rui_wang1979@yahoo.cn [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Zhang Zhaoqi, E-mail: zhaoqi5000@vip.sohu.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Xu Lei, E-mail: leixu2001@hotmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Ma Qin, E-mail: tel1367@gmail.com [Department of Emergency, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); He Yi, E-mail: heyi139@sina.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Lu Dongxu, E-mail: larry.hi@163.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Yu Wei, E-mail: yuwei02@gmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Fan Zhanming, E-mail: fanzm120@tom.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China)

    2011-11-15

    Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 {+-} 9.57 HU vs. 72.63 {+-} 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 {+-} 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.

  2. Dual-source computed tomography. Effect on regional and global left ventricular function assessment compared to magnetic resonance imaging; Untersuchung der regionalen und globalen linksventrikulaeren Funktion mit der Dual-Source-Computertomografie im Vergleich zur Magnetresonanztomografie

    Energy Technology Data Exchange (ETDEWEB)

    Lueders, F.; Seifarth, H.; Wessling, J.; Heindel, W.; Juergens, Kai Uwe [Inst. fuer Klinische Radiologie, Universitaetsklinikum Muenster (Germany); Fischbach, R. [Klinik fuer Radiologie, Nuklearmedizin und Neuroradiologie, Asklepios Klinik Altona (Germany)

    2009-10-15

    Purpose: to determine regional and global left ventricular (LV) functional parameters and to perform segmental wall thickness (SWT) and motion (WM) analysis of dual source CT (DSCT) with optimized temporal resolution versus MRI. Materials and Methods: 30 patients with known or suspected CAD, non-obstructive HCM, DCM, ARVCM, Fallot Tetralogy, cardiac sarcoidosis and cardiac metastasis underwent DSCT and MRI. The DSCT and MR images were evaluated: end-systolic (ESV), end-diastolic LV (EDV) volumes, stroke volume (SV), ejection fraction (EF), and myocardial mass (MM) as well as LV wall thickening and segmental WM applying the AHA model were obtained and statistically analyzed. Results: The mean LV-EDV (r = 0.96) and ESV (r = 0.98) as well as LV-EF (r = 0.97), SV (r = 0.83), and MM (r = 0.95) correlated well. Bland Altman analysis revealed little systematic underestimation of LV-EF (-1.1 {+-} 7.8%), EDV (-0.3 {+-} 18.2 ml), SV (-1.3 {+-} 16.7 ml) and little overestimation of ESV (1.1 {+-} 7.8 ml) and MM (12.8 {+-} 14.4 g) determined by DSCT. Systolic reconstruction time points correlated well (DSCT 32.2 {+-} 6.7 vs. MRI 35.6 {+-} 4.4% RR-interval). The LV wall thickness obtained by DSCT and MRI showed close correlation in all segments (diameter diff 0.42 {+-} 1 mm). In 413 segments (89%) WM abnormalities were equally rated, whereas DSCT tended to underestimate the degree of wall motion impairment. Conclusion: DSCT with optimized temporal resolution enables regional and global LV function analysis as well as segmental WM analysis in good correlation with MRI. However, the degree of WM impairment is slightly underestimated by DSCT. (orig.)

  3. 46 CFR 182.620 - Auxiliary means of steering.

    Science.gov (United States)

    2010-10-01

    ... TONS) MACHINERY INSTALLATION Steering Systems § 182.620 Auxiliary means of steering. (a) Except as... personnel hazards during normal or heavy weather operation. (b) A suitable hand tiller may be acceptable as...

  4. Parallel Auxiliary Space AMG Solver for $H(div)$ Problems

    Energy Technology Data Exchange (ETDEWEB)

    Kolev, Tzanio V. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vassilevski, Panayot S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2012-12-18

    We present a family of scalable preconditioners for matrices arising in the discretization of $H(div)$ problems using the lowest order Raviart--Thomas finite elements. Our approach belongs to the class of “auxiliary space''--based methods and requires only the finite element stiffness matrix plus some minimal additional discretization information about the topology and orientation of mesh entities. Also, we provide a detailed algebraic description of the theory, parallel implementation, and different variants of this parallel auxiliary space divergence solver (ADS) and discuss its relations to the Hiptmair--Xu (HX) auxiliary space decomposition of $H(div)$ [SIAM J. Numer. Anal., 45 (2007), pp. 2483--2509] and to the auxiliary space Maxwell solver AMS [J. Comput. Math., 27 (2009), pp. 604--623]. Finally, an extensive set of numerical experiments demonstrates the robustness and scalability of our implementation on large-scale $H(div)$ problems with large jumps in the material coefficients.

  5. New set of auxiliary fields for supergravity theories

    International Nuclear Information System (INIS)

    Oliveira Rivelles, V. de.

    1983-02-01

    A brief introduction on supersymmetry is given. The problems with the obtainment of the auxiliary fields in supergravity theories are discussed, after a short presentation of the supersymmetry algebra representations. (L.C.) [pt

  6. Study on 3D printer production of auxiliary device for upper limb for medical imaging test

    International Nuclear Information System (INIS)

    Kim, Hyeong Gyun; Yoon, Jae Ho; Choi, Seong Dae

    2015-01-01

    There is a progressive development in the medical imaging technology, especially of descriptive capability for anatomical structure of human body thanks to advancement of information technology and medical devices. But however maintenance of correct posture is essential for the medical imaging checkup on the shoulder joint requiring rotation of the upper limb due to the complexity of human body. In the cases of MRI examination, long duration and fixed posture are critical, as failure to comply with them leads to minimal possibility of reproducibility only with the efforts of the examiner and will of the patient. Thus, this study aimed to develop an auxiliary device that enables rotation of the upper limb as well as fixing it at quantitative angles for medical imaging examination capable of providing diagnostic values. An auxiliary device has been developed based on the results of precedent studies, by designing a 3D model with the CATIA software, an engineering application, and producing it with the 3D printer. The printer is Objet350 Connex from Stratasys, and acrylonitrile- butadiene-styrene(ABS) is used as the material of the device. Dimensions are 120 X 150 X 190 mm, with the inner diameter of the handle being 125.9 mm. The auxiliary device has 4 components including the body (outside), handle (inside), fixture terminal and the connection part. The body and handle have the gap of 2.1 mm for smooth rotation, while the 360 degree of scales have been etched on the handle so that the angle required for observation may be recorded per patient for traceability and dual examination

  7. Study on 3D printer production of auxiliary device for upper limb for medical imaging test

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyeong Gyun [Dept. of Radiological Science, Far East University, Eumsung (Korea, Republic of); Yoon, Jae Ho [Jukwang Precision Co., Ltd., Gumi (Korea, Republic of); Choi, Seong Dae [Dept. of Mechanical system engineering, Kumoh Institute of Technology, Gumi (Korea, Republic of)

    2015-12-15

    There is a progressive development in the medical imaging technology, especially of descriptive capability for anatomical structure of human body thanks to advancement of information technology and medical devices. But however maintenance of correct posture is essential for the medical imaging checkup on the shoulder joint requiring rotation of the upper limb due to the complexity of human body. In the cases of MRI examination, long duration and fixed posture are critical, as failure to comply with them leads to minimal possibility of reproducibility only with the efforts of the examiner and will of the patient. Thus, this study aimed to develop an auxiliary device that enables rotation of the upper limb as well as fixing it at quantitative angles for medical imaging examination capable of providing diagnostic values. An auxiliary device has been developed based on the results of precedent studies, by designing a 3D model with the CATIA software, an engineering application, and producing it with the 3D printer. The printer is Objet350 Connex from Stratasys, and acrylonitrile- butadiene-styrene(ABS) is used as the material of the device. Dimensions are 120 X 150 X 190 mm, with the inner diameter of the handle being 125.9 mm. The auxiliary device has 4 components including the body (outside), handle (inside), fixture terminal and the connection part. The body and handle have the gap of 2.1 mm for smooth rotation, while the 360 degree of scales have been etched on the handle so that the angle required for observation may be recorded per patient for traceability and dual examination.

  8. Auxiliary device for the assembly of cruciform BWR control rods

    International Nuclear Information System (INIS)

    Lippert, H.J.

    1980-01-01

    The mounting auxiliary equipment has got a frame of the size of a core cell that can be put on the core grid. Diagonally arranged link bodies serve to center the cross-shaped control rod. The mounting auxiliary equipment consists of a single piece and therefore facilitates manipulation for which a diagonal handle is provided at the upper end. It may be swung aside. (RW) [de

  9. Auxiliary device for the assembly of cruciform BWR control rods

    International Nuclear Information System (INIS)

    Lippert, H.J.

    1982-01-01

    The mounting auxiliary equipment has got a frame of the size of a core cell that can be put on the core grid. Diagonally arranged link bodies serve to center the cross-shaped control rod. The mounting auxiliary equipment consists of a single piece and therefore facilitates manipulation for which a diagonal handle is provided at the upper end. It may be swung aside. (orig./HP)

  10. Operating experiences and degradation detection for auxiliary feedwater systems

    International Nuclear Information System (INIS)

    Casada, D.; Farmer, W.S.

    1992-01-01

    A study of Pressurized Water Reactor Auxiliary Feedwater (AFW) Systems has been conducted by Oak Ridge National Laboratory (ORNL) under the auspices of the Nuclear Regulatory Commission's Nuclear Plant Aging Research Program. The results of the study are documented in NUREG/CR-5404, Vol. 1, Auxiliary Feedwater System Aging Study. The study reviewed historical failure experience and current monitoring practices for the AFW System. This paper provides an overview of the study approach and results

  11. Diesel reforming for SOFC auxiliary power units

    Energy Technology Data Exchange (ETDEWEB)

    Borup, R. L. (Rodney L.); Parkinson, W. J. (William Jerry),; Inbody, M. A. (Michael A.); Tafoya, J. I. (Jose I.); Guidry, D. R. (Dennis Ray)

    2004-01-01

    The use of a solid-oxide fuel cell (SOFC) to provide auxiliary power for heavy duty trucks can increase fuel efficiency and reduce emissions by reducing engine idling time. The logical fuel of choice for a truck SOFC APU is diesel fuel, as diesel is the fuel of choice for these vehicles. SOFC's that directly oxidize hydrocarbon fuels have lower power densities than do SOFC's that operate from hydrocarbon reformate, and since the SOFC is a costly component, maximizing the fuel cell power density provides benefits in reducing the overall APU system cost. Thus current SOFC APU systems require the reformation of higher hydrocarbons for the most efficient and cost effect fuel cell system. The objective of this research is to develop the technology to enable diesel reforming for SOFC truck APU applications. Diesel fuel can be reformed into a H{sub 2} and CO-rich fuel feed stream for a SOFC by autothermal reforming (ATR), a combination of catalytic partial oxidation (CPOx), and steam reforming (SR). The typical autothermal reformer is an adiabatic, heterogeneous catalytic reactor and the challenges in its design, operation and durability on diesel fuel are manifold. These challenges begin with the vaporization and mixing of diesel fuel with air and steam where fuel pyrolysis can occur and improper mixing leads to hot and cold spots, which contribute to carbon formation and incomplete fuel conversion. The exotherm of the partial oxidation reaction can generate temperatures in excess of 800 C, a temperature at which catalysts rapidly sinter, thus reducing their lifetime. The temperature rise can be reduced by the steam reforming endotherm, but this requires the addition of water along with proper design to balance the kinetic rates. Carbon formation during operation and startup can lead to catalyst deactivation and fouling of downstream components, thus reducing durability of the fuel processor. Water addition helps to reduce carbon formation, but a key issue is

  12. Comparison of gross body fat-water magnetic resonance imaging at 3 Tesla to dual-energy X-ray absorptiometry in obese women.

    Science.gov (United States)

    Silver, Heidi J; Niswender, Kevin D; Kullberg, Joel; Berglund, Johan; Johansson, Lars; Bruvold, Morten; Avison, Malcolm J; Welch, E Brian

    2013-04-01

    Improved understanding of how depot-specific adipose tissue mass predisposes to obesity-related comorbidities could yield new insights into the pathogenesis and treatment of obesity as well as metabolic benefits of weight loss. We hypothesized that three-dimensional (3D) contiguous "fat-water" MR imaging (FWMRI) covering the majority of a whole-body field of view (FOV) acquired at 3 Tesla (3T) and coupled with automated segmentation and quantification of amount, type, and distribution of adipose and lean soft tissue would show great promise in body composition methodology. Precision of adipose and lean soft tissue measurements in body and trunk regions were assessed for 3T FWMRI and compared to dual-energy X-ray absorptiometry (DXA). Anthropometric, FWMRI, and DXA measurements were obtained in 12 women with BMI 30-39.9 kg/m(2) . Test-retest results found coefficients of variation (CV) for FWMRI that were all under 3%: gross body adipose tissue (GBAT) 0.80%, total trunk adipose tissue (TTAT) 2.08%, visceral adipose tissue (VAT) 2.62%, subcutaneous adipose tissue (SAT) 2.11%, gross body lean soft tissue (GBLST) 0.60%, and total trunk lean soft tissue (TTLST) 2.43%. Concordance correlation coefficients between FWMRI and DXA were 0.978, 0.802, 0.629, and 0.400 for GBAT, TTAT, GBLST, and TTLST, respectively. While Bland-Altman plots demonstrated agreement between FWMRI and DXA for GBAT and TTAT, a negative bias existed for GBLST and TTLST measurements. Differences may be explained by the FWMRI FOV length and potential for DXA to overestimate lean soft tissue. While more development is necessary, the described 3T FWMRI method combined with fully-automated segmentation is fast (<30-min total scan and post-processing time), noninvasive, repeatable, and cost-effective. Copyright © 2012 The Obesity Society.

  13. Probabilistic cloning with supplementary information contained in the quantum states of two auxiliary systems

    International Nuclear Information System (INIS)

    Li, Lvjun; Qiu, Daowen

    2007-01-01

    In probabilistic cloning with two auxiliary systems, we consider and compare three different protocols for the success probabilities of cloning. We show that, in certain circumstances, it may increase the success probability to add an auxiliary system to the probabilistic cloning machine having one auxiliary system, but we always can find another cloning machine with one auxiliary system having the same success probability as that with two auxiliary systems

  14. Image quality of Gd-EOB-DTPA-enhanced magnetic resonance imaging of the liver using dual-source parallel radiofrequency transmission technology: Comparison with the post-processing correction method for B1 inhomogeneity-induced signal loss.

    Science.gov (United States)

    Takayama, Yukihisa; Nishie, Akihiro; Asayama, Yoshiki; Ishigami, Kousei; Kakihara, Daisuke; Nakayama, Tomohiro; Yoshiura, Takashi; Obara, Makoto; Hirakawa, Masakazu; Honda, Hiroshi

    2012-11-01

    To evaluate the efficacy of the dual-source parallel radiofrequency system (DS system) for gadolinium ethoxybenzyl diethylenetriamine pentaacetic acid-enhanced magnetic resonance imaging (Gd-EOB-MRI). Twenty-six subjects with liver diseases underwent hepatobiliary phase imaging of Gd-EOB-MRI using either the DS system or a single-source radiofrequency system with or without body-tuned CLEAR, which is a post-processing correction method of B1 inhomogeneity-induced signal loss (SSBTC+ and SSBTC-, respectively). The left and right lobes of the liver were separately assessed. Qualitatively, the homogeneity of signal intensity distribution was scored using a 3-point scale. Quantitatively, lesion-to-liver and spleen-to-liver contrast ratios (CRs) were calculated. The scores and CRs were compared among the three techniques by two-way analysis of variance and Tukey's Honestly Significant Difference post hoc test. Values of ppost-processing correction method independently of the site. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  15. Measurement of vertebral bone marrow lipid profile at 1.5-T proton magnetic resonance spectroscopy and bone mineral density at dual-energy X-ray absorptiometry: correlation in a swine model

    International Nuclear Information System (INIS)

    Di Leo, Giovanni; Fina, Laura; Bandirali, Michele; Messina, Carmelo; Sardanelli, Francesco

    2014-01-01

    Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.

  16. Radiolabeled cyclic arginine-glycine-aspartic (RGD)-conjugated iron oxide nanoparticles as single-photon emission computed tomography (SPECT) and magnetic resonance imaging (MRI) dual-modality agents for imaging of breast cancer

    Science.gov (United States)

    Deng, Shengming; Zhang, Wei; Zhang, Bin; Hong, Ruoyu; Chen, Qing; Dong, Jiajia; Chen, Yinyiin; Chen, Zhiqiang; Wu, Yiwei

    2015-01-01

    Ultrasmall superparamagnetic iron oxide nanoparticles (USPIOs) modified with a novel cyclic arginine-glycine-aspartate (RGD) peptide were made and radiolabeled as single-photon emission computed tomography (SPECT) and magnetic resonance imaging (MRI) dual-modality agents for imaging of breast cancer. The probe was tested both in vitro and in vivo to determine its receptor targeting efficacy and feasibility for SPECT and MRI. The radiochemical syntheses of 125I-cRGD-USPIO were accomplished with a radiochemical purity of 96.05 ± 0.33 %. High radiochemical stability was found in fresh human serum and in phosphate-buffered saline. The average hydrodynamic size of 125I-cRGD-USPIO determined by dynamic light scattering was 51.3 nm. Results of in vitro experiments verified the specificity of the radiolabeled nanoparticles to tumor cells. Preliminary biodistribution studies of 125I-radiolabeled cRGD-USPIO in Bcap37-bearing nude mice showed that it had long circulation half-life, high tumor uptake, and high initial blood retention with moderate liver uptake. In vivo tumor targeting and uptake of the radiolabeled nanoparticles in mice model were visualized by SPECT and MRI collected at different time points. Our results strongly indicated that the 125I-cRGD-USPIO could be used as a promising bifunctional radiotracer for early clinical tumor detection with high sensitivity and high spatial resolution by SPECT and MRI.

  17. Measurement of vertebral bone marrow lipid profile at 1.5-T proton magnetic resonance spectroscopy and bone mineral density at dual-energy X-ray absorptiometry: correlation in a swine model

    Energy Technology Data Exchange (ETDEWEB)

    Di Leo, Giovanni; Fina, Laura [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Bandirali, Michele; Messina, Carmelo [Universita degli Studi di Milano, Scuola di Specializzazione in Radiodiagnostica, Milan (Italy); Sardanelli, Francesco [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Universita degli Studi di Milano, Dipartimento di Scienze Biomediche per la Salute, San Donato Milanese (Italy)

    2014-08-15

    Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.

  18. Delta connected resonant snubber circuit

    Science.gov (United States)

    Lai, J.S.; Peng, F.Z.; Young, R.W. Sr.; Ott, G.W. Jr.

    1998-01-20

    A delta connected, resonant snubber-based, soft switching, inverter circuit achieves lossless switching during dc-to-ac power conversion and power conditioning with minimum component count and size. Current is supplied to the resonant snubber branches solely by the dc supply voltage through the main inverter switches and the auxiliary switches. Component count and size are reduced by use of a single semiconductor switch in the resonant snubber branches. Component count is also reduced by maximizing the use of stray capacitances of the main switches as parallel resonant capacitors. Resonance charging and discharging of the parallel capacitances allows lossless, zero voltage switching. In one embodiment, circuit component size and count are minimized while achieving lossless, zero voltage switching within a three-phase inverter. 36 figs.

  19. Delta connected resonant snubber circuit

    Science.gov (United States)

    Lai, Jih-Sheng; Peng, Fang Zheng; Young, Sr., Robert W.; Ott, Jr., George W.

    1998-01-01

    A delta connected, resonant snubber-based, soft switching, inverter circuit achieves lossless switching during dc-to-ac power conversion and power conditioning with minimum component count and size. Current is supplied to the resonant snubber branches solely by the dc supply voltage through the main inverter switches and the auxiliary switches. Component count and size are reduced by use of a single semiconductor switch in the resonant snubber branches. Component count is also reduced by maximizing the use of stray capacitances of the main switches as parallel resonant capacitors. Resonance charging and discharging of the parallel capacitances allows lossless, zero voltage switching. In one embodiment, circuit component size and count are minimized while achieving lossless, zero voltage switching within a three-phase inverter.

  20. Design and Simulation of Dual Inverter Based Energy Storage Systems for Wind Energy Systems Using MATLAB/SIMULINK

    OpenAIRE

    Harika G,; Jayakumar N

    2014-01-01

    This paper proposes the design and simulation of dual inverter based Energy Storage Systems(ESS) for wind energy systems. A dual inverter consists of MAIN inverter which is connected to grid side and an auxiliary inverter for which an energy storage system is interfaced. Typical grid connected wind energy systems includes wind turbine, PMSG, DC-DC converters, three phase dual inverter ,energy storage system and related power electronic devices. The detailed model of design and...

  1. The Explicit Determinations Of Dual Plane Curves And Dual Helices In Terms Of Its Dual Curvature And Dual Torsion

    OpenAIRE

    Lee Jae Won; Choi Jin Ho; Jin Dae Ho

    2014-01-01

    In this paper, we give the explicit determinations of dual plane curves, general dual helices and dual slant helices in terms of its dual curvature and dual torsion as a fundamental theory of dual curves in a dual 3-space

  2. Electrospinning of aligned fibers with adjustable orientation using auxiliary electrodes

    International Nuclear Information System (INIS)

    Arras, Matthias M L; Grasl, Christian; Schima, Heinrich; Bergmeister, Helga

    2012-01-01

    A conventional electrospinning setup was upgraded by two turnable plate-like auxiliary high-voltage electrodes that allowed aligned fiber deposition in adjustable directions. Fiber morphology was analyzed by scanning electron microscopy and attenuated total reflection Fourier transform infrared spectroscopy (FTIR-ATR). The auxiliary electric field constrained the jet bending instability and the fiber deposition became controllable. At target speeds of 0.9 m s −1 90% of the fibers had aligned within 2°, whereas the angular spread was 70° without the use of auxiliary electrodes. It was even possible to orient fibers perpendicular to the rotational direction of the target. The fiber diameter became smaller and its distribution narrower, while according to the FTIR-ATR measurement the molecular orientation of the polymer was unaltered. This study comprehensively documents the feasibility of directed fiber deposition and offers an easy upgrade to existing electrospinning setups. (paper)

  3. Auxiliary bearing design considerations for gas cooled reactors

    International Nuclear Information System (INIS)

    Penfield, S.R. Jr.; Rodwell, E.

    2001-01-01

    The need to avoid contamination of the primary system, along with other perceived advantages, has led to the selection of electromagnetic bearings (EMBs) in most ongoing commercial-scale gas cooled reactor (GCR) designs. However, one implication of magnetic bearings is the requirement to provide backup support to mitigate the effects of failures or overload conditions. The demands on these auxiliary or 'catcher' bearings have been substantially escalated by the recent development of direct Brayton cycle GCR concepts. Conversely, there has been only limited directed research in the area of auxiliary bearings, particularly for vertically oriented turbomachines. This paper explores the current state-of-the-art for auxiliary bearings and the implications for current GCR designs. (author)

  4. Dental auxiliaries versus community health workers: similarities and contrasts

    Directory of Open Access Journals (Sweden)

    Simone De Melo Costa

    Full Text Available INTRODUCTION: The dental auxiliaries and the community health workers (CHWs are practitioners that represent an important part in the Family Health Policy in Brazil and have several tasks. OBJECTIVE: To analyze the attributes of the dental auxiliaries and of the CHWs, regarding the application of their services and their education/training, to identify the similarities and contrasts between these health care practitioners. METHODOLOGY: Quantitative and census method data collection performed on the context of the Education Program for Health Workers - PET‑Saúde, 2010‑2012. The data collection method was a semi-structured questionnaire. The analysis has a level of significance of p0.05. CONCLUSION: Similarities and contrasts were identified between these health care workers. The dental auxiliaries, despite being mostly issued to specific assignments on a clinical environment, are able to shift their praxis by taking actions on a family and community context once integrated to a family health team.

  5. Reactor auxiliary cooling facility and coolant supplying method therefor

    Energy Technology Data Exchange (ETDEWEB)

    Ando, Koji; Kinoshita, Shoichiro

    1996-06-07

    A reactor auxiliary cooling facility of the present invention comprises a coolant recycling line for recycling coolants by way of a reactor auxiliary coolant pump and a cooling load, a gravitational surge tank for supplying coolants to the coolant recycling line and a supplemental water supplying line for supplying a supply the supplemental water to the tank. Then, a pressurization-type supply water surge tank is disposed for operating the coolant recycling line upon performing an initial system performance test in parallel with the gravitational surge tank. With such a constitution, the period of time required from the start of the installation of reactor auxiliary cooling facilities to the completion of the system performance test can be shortened at a reduced cost without enlarging the scale of the facility. (T.M.)

  6. Reactor auxiliary cooling facility and coolant supplying method therefor

    International Nuclear Information System (INIS)

    Ando, Koji; Kinoshita, Shoichiro.

    1996-01-01

    A reactor auxiliary cooling facility of the present invention comprises a coolant recycling line for recycling coolants by way of a reactor auxiliary coolant pump and a cooling load, a gravitational surge tank for supplying coolants to the coolant recycling line and a supplemental water supplying line for supplying a supply the supplemental water to the tank. Then, a pressurization-type supply water surge tank is disposed for operating the coolant recycling line upon performing an initial system performance test in parallel with the gravitational surge tank. With such a constitution, the period of time required from the start of the installation of reactor auxiliary cooling facilities to the completion of the system performance test can be shortened at a reduced cost without enlarging the scale of the facility. (T.M.)

  7. What Modals Are: Modal Verbs, Modal Words, and Auxiliary Modals

    Directory of Open Access Journals (Sweden)

    Fazira A. Kakzhanova

    2013-01-01

    Full Text Available The modals are a complicated grammatical phenomenon. As of today, the status of modals is still not precisely defined in the linguistics literature, and they are described under different names: modal verbs, modal words, auxiliary modals, or defective verbs. Modals express the result of the conversion of thought processes (deep structure about the realization of actions into surface structure. As articles determine the status of nouns as indefinite or definite things, modals determine the relation of a person to actions or the quality of an action as realizable or unrealizable. Modals cannot truly be ‘modal verbs’, because they lack the morphological characteristics of verbs (aspect, voice, mood, and tense, and the term ‘defective verb’ is flawed for the same reason. Furthermore, they cannot be ‘auxiliary modals’, because they don’t neutralize their main meanings when they become auxiliary. Thus, I propose to refer to these elements only as modals or modal words.

  8. Sampling designs dependent on sample parameters of auxiliary variables

    CERN Document Server

    Wywiał, Janusz L

    2015-01-01

    The book offers a valuable resource for students and statisticians whose work involves survey sampling. An estimation of the population parameters in finite and fixed populations assisted by auxiliary variables is considered. New sampling designs dependent on moments or quantiles of auxiliary variables are presented on the background of the classical methods. Accuracies of the estimators based on original sampling design are compared with classical estimation procedures. Specific conditional sampling designs are applied to problems of small area estimation as well as to estimation of quantiles of variables under study. .

  9. History of Sandia National Laboratories` auxiliary closure mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Weydert, J.C. [Sandia National Labs., Albuquerque, NM (United States); Ponder, G.M. [Geo-Centers, Inc., Albuquerque, NM (United States)

    1993-12-01

    An essential component of a horizontal, underground nuclear test setup at the Nevada Test Site is the auxiliary closure system. The massive gates that slam shut immediately after a device has been detonated allow the prompt radiation to pass, but block debris and hot gases from continuing down the tunnel. Thus, the gates protect experiments located in the horizontal line-of-sight steel pipe. Sandia National Laboratories has been the major designer and developer of these closure systems. This report records the history of SNL`s participation in and contributions to the technology of auxiliary closure systems used in horizontal tunnel tests in the underground test program.

  10. Vanishing auxiliary variables in PPS sampling - with applications in microscopy

    DEFF Research Database (Denmark)

    Andersen, Ina Trolle; Hahn, Ute; Jensen, Eva B. Vedel

    Recently, non-uniform sampling has been suggested in microscopy to increase efficiency. More precisely, sampling proportional to size (PPS) has been introduced where the probability of sampling a unit in the population is proportional to the value of an auxiliary variable. Unfortunately, vanishing...... auxiliary variables are a common phenomenon in microscopy and, accordingly, part of the population is not accessible, using PPS sampling. We propose a modification of the design, for which an optimal solution can be found, using a model assisted approach. The optimal design has independent interest...

  11. Analysis and Measurement of NOx Emissions in Port Auxiliary Vessels

    Directory of Open Access Journals (Sweden)

    German de Melo Rodriguez

    2013-09-01

    Full Text Available This paper is made NOx pollution emitted by port auxiliary vessels, specifically by harbour tugs, due to its unique operating characteristics of operation, require a large propulsion power changes discontinuously, also possess some peculiar technical characteristics, large tonnage and high propulsive power, that differentiate them from other auxiliary vessels of the port. Taking into account all the above features, there are no studies of the NOx emission engines caused by different working regimes of power because engine manufacturers have not measured these emissions across the range of operating power, but usually we only report the pollution produced by its engines to a maximum continuous power.

  12. QCD Dual

    DEFF Research Database (Denmark)

    Sannino, Francesco

    2009-01-01

    We uncover a novel solution of the 't Hooft anomaly matching conditions for QCD. Interestingly in the perturbative regime the new gauge theory, if interpreted as a possible QCD dual, predicts the critical number of flavors above which QCD in the nonperturbative regime, develops an infrared stable...

  13. Folding of the natural hammerhead ribozyme is enhanced by interaction of auxiliary elements

    Science.gov (United States)

    PENEDO, J. CARLOS; WILSON, TIMOTHY J.; JAYASENA, SUMEDHA D.; KHVOROVA, ANASTASIA; LILLEY, DAVID M.J.

    2004-01-01

    It has been shown that the activity of the hammerhead ribozyme at μM magnesium ion concentrations is markedly increased by the inclusion of loops in helices I and II. We have studied the effect of such loops on the magnesium ion-induced folding of the ribozyme, using fluorescence resonance energy transfer. We find that with the loops in place, folding into the active conformation occurs in a single step, in the μM range of magnesium ion concentration. Disruption of the loop–loop interaction leads to a reversion to two-step folding, with the second stage requiring mM concentrations of magnesium ion. Sodium ions also promote the folding of the natural form of the ribozyme at high concentrations, but the folding occurs as a two-stage process. The loops clearly act as important auxiliary elements in the function of the ribozyme, permitting folding to occur efficiently under physiological conditions. PMID:15100442

  14. Clinical comparison between a currently available single-loop and an investigational dual-channel endorectal receive coil for prostate magnetic resonance imaging: a feasibility study at 1.5 and 3 T.

    Science.gov (United States)

    Vos, Eline K; Sambandamurthy, Sriram; Kamel, Maged; McKenney, Robert; van Uden, Mark J; Hoeks, Caroline M A; Yakar, Derya; Scheenen, Tom W J; Fütterer, Jurgen J

    2014-01-01

    The objectives of this study were to test the feasibility of an investigational dual-channel next-generation endorectal coil (NG-ERC) in vivo, to quantitatively assess signal-to-noise ratio (SNR), and to get an impression of image quality compared with the current clinically available single-loop endorectal coil (ERC) for prostate magnetic resonance imaging at both 1.5 and 3 T. The study was approved by the institutional review board, and written informed consent was obtained from all patients. In total, 8 consecutive patients with prostate cancer underwent a local staging magnetic resonance examination with the successive use of both coils in 1 session (4 patients at 1.5 T and 4 other patients at 3 T). Quantitative comparison of both coils was performed for the apex, mid-gland and base levels at both field strengths by calculating SNR profiles in the axial plane on an imaginary line in the anteroposterior direction perpendicular to the coil surface. Two radiologists independently assessed the image quality of the T2-weighted and apparent diffusion coefficient maps calculated from diffusion-weighted imaging using a 5-point scale. Improvement of geometric distortion on diffusion-weighted imaging with the use of parallel imaging was explored. Statistical analysis included a paired Wilcoxon signed rank test for SNR and image quality evaluation as well as κ statistics for interobserver agreement. No adverse events were reported. The SNR was higher for the NG-ERC compared with the ERC up to a distance of approximately 40 mm from the surface of the coil at 1.5 T (P image quality was considered better for NG-ERC at both field strengths. Quality of apparent diffusion coefficient maps with the use of parallel imaging was rated superior with the NG-ERC at 3 T. The investigational NG-ERC for prostate imaging outperforms the current clinically available ERC in terms of SNR and is feasible for continued development for future use as the next generation endorectal coil for

  15. Image quality of Gd-EOB-DTPA-enhanced magnetic resonance imaging of the liver using dual-source parallel radiofrequency transmission technology: Comparison with the post-processing correction method for B1 inhomogeneity-induced signal loss

    Energy Technology Data Exchange (ETDEWEB)

    Takayama, Yukihisa, E-mail: ytaka@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Nishie, Akihiro, E-mail: anishie@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Asayama, Yoshiki, E-mail: asayama@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Ishigami, Kousei, E-mail: Ishigamikousei@aol.com [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Kakihara, Daisuke, E-mail: kakky@radiol.med.kyushu-u.ac.jp [Department of Molecular Imaging and Diagnosis, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Nakayama, Tomohiro, E-mail: tomo.n@maple.ocn.ne.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Yoshiura, Takashi, E-mail: tyoshiu@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan); Obara, Makoto, E-mail: makoto.obara@philips.com [Philips Electronics Japan, Kounan 2-13-37, Minato-ku, Tokyo 108-8507 (Japan); Hirakawa, Masakazu, E-mail: mahira@radiol.med.kyushu-u.ac.jp [Department of Radiology, Kyushu University Beppu Hospital, 4546 Tsurumihara, Beppu, Oita 874-0838 (Japan); Honda, Hiroshi, E-mail: honda@radiol.med.kyushu-u.ac.jp [Department of Clinical Radiology, Graduate School of Medical Sciences, Kyushu University, 3-1-1 Maidashi, Higashi-ku, Fukuoka City, Fukuoka 812-8582 (Japan)

    2012-11-15

    Purpose: To evaluate the efficacy of the dual-source parallel radiofrequency system (DS system) for gadolinium ethoxybenzyl diethylenetriamine pentaacetic acid-enhanced magnetic resonance imaging (Gd-EOB-MRI). Materials and methods: Twenty-six subjects with liver diseases underwent hepatobiliary phase imaging of Gd-EOB-MRI using either the DS system or a single-source radiofrequency system with or without body-tuned CLEAR, which is a post-processing correction method of B1 inhomogeneity-induced signal loss (SSBTC+ and SSBTC-, respectively). The left and right lobes of the liver were separately assessed. Qualitatively, the homogeneity of signal intensity distribution was scored using a 3-point scale. Quantitatively, lesion-to-liver and spleen-to-liver contrast ratios (CRs) were calculated. The scores and CRs were compared among the three techniques by two-way analysis of variance and Tukey's Honestly Significant Difference post hoc test. Values of p < 0.05 were considered statistically significant for each analysis. Results: The DS system showed a significantly better score in the left lobe of the liver, and higher lesion-to-liver and spleen-to-liver CRs in the left and right lobes of the liver, compared with SSBTC+ or SSBTC- (p < 0.05). The DS system and SSBTC- showed no significant differences in scores in the right lobe of the liver but they showed significantly better scores than SSBTC+ (p < 0.05). Conclusion: The DS system is more advantageous to improve the homogeneity of signal intensity distribution and tissue contrast of Gd-EOB-MRI than the post-processing correction method independently of the site.

  16. Quantification of stenotic mitral valve area and diagnostic accuracy of mitral stenosis by dual-source computed tomography in patients with atrial fibrillation: comparison with cardiovascular magnetic resonance and transthoracic echocardiography.

    Science.gov (United States)

    Kim, Song Soo; Ko, Sung Min; Song, Meong Gun; Chee, Hyun Kun; Kim, Jun Suk; Hwang, Hweung Kon; Lee, Jae-Hwan

    2015-06-01

    This study aimed to evaluate the utility of dual-source computed tomography (DSCT) for quantification of the mitral valve area (MVA) in patients with atrial fibrillation (AF) and mitral stenosis (MS) and to compare the results of DSCT with those of cardiovascular magnetic resonance (CMR) and transthoracic echocardiography (TTE). One hundred-two patients with AF and MS who had undergone electrocardiography-gated DSCT, TTE and CMR prior to operation were retrospectively enrolled. The MVA was planimetrically determined by DSCT, CMR, and TTE, as well as by Doppler TTE using the pressure half-time method (TTE-PHT). Agreement, relationship between measurements, and the highest accuracy were evaluated using Bland-Altman, Pearson correlation, and receiver operating characteristic analyses. The MVA on DSCT (mean, 1.27 ± 0.27 cm(2)) was significantly larger than that on CMR (1.15 ± 0.28 cm(2), P TTE-planimetry and TTE-PHT (1.16 ± 0.28 and 1.07 ± 0.30 cm(2), respectively; P TTE-planimetry had better correlation with planimetry on DSCT and CMR (r = 0.65 and 0.67, respectively; P TTE-PHT (r = 0.51 and 0.55, respectively; P TTE-planimetry and TTE-PHT as the reference, the optimal thresholds for detecting severe MS on DSCT was 1.19 cm(2). The planimetry of the MVA measured by DSCT may be a reliable, alternative method for the quantification of MS in patients with AF.

  17. 76 FR 22295 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2011-04-21

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection 9 CFR Part 145 [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions Correction In rule document 2011-6539 appearing on pages 15791-15798 in the issue of Tuesday, March 22, 2011, make the...

  18. An analysis of the auxiliary structure of basic Nigerian pidgin ...

    African Journals Online (AJOL)

    The existence of pidgin as a language should not depend on “social” recognition or “social” approval. The basis for ... Premised on the foregoing, this study strives to illustratively analyse the auxiliary structure of basic Nigerian pidgin sentences since the issue of basic word order is one of the universals of human language.

  19. On the computation of molecular auxiliary functions An and Bn

    Indian Academy of Sciences (India)

    Comment: “On the computation of molecular auxiliary functions An and Bn”. FRANK E HARRIS. Department of Physics, University of Utah, Salt Lake City, UT 84112, USA. Quantum Theory Project, University of Florida, P.O. Box 118435, Gainesville, FL 32611, USA. Email: harris@qtp.ufl.edu. Abstract. Guseinov, Mamedov ...

  20. Auxiliary services for petrochemistry. Cogeneration, thermocompression, steam distribution networks

    International Nuclear Information System (INIS)

    Vergerio, G.; Bruzzi, V.

    1999-01-01

    The article gives some guidelines for the choice of the most suitable energy vectors distributed in petrochemical plants and refineries for auxiliary services and for processes (mainly distillation). Conclusions are summed up in a diagram showing the most suitable heat sources and sinks for the various temperature ranges [it

  1. Lecture 1. on auxiliary heating in 'Breakeven Tokamaks'

    International Nuclear Information System (INIS)

    Sheffield, John

    1978-01-01

    We may identify two main areas where auxiliary heating may be used in breakeven Tokamak reactors. (1) In the start up phase of a Tokamak reactor, having a thermal energy distribution, auxiliary heating is required to bridge the gap between the ohmic state where the temperature will probably be approximately 1 keV, and the ignited condition where T>5 keV. (2) In two component and three component systems, auxiliary power is required to maintain a non-thermal ion distribution. I will follow a similar line to that taken in the above papers and will assess the auxiliary heating requirements of a 'Breakeven Tokamak' producing approximately 500 MW of thermal power, using the D-T cycle. I will consider two and three component systems insofar as they may be used during the start up phase, but not as reactor systems in their own right. In the first lecture I will not discuss details of the heating methods. Symbols and units are given in the Appendix

  2. Dental auxiliaries for dental care traditionally provided by dentists.

    Science.gov (United States)

    Dyer, Tom A; Brocklehurst, Paul; Glenny, Anne-Marie; Davies, Linda; Tickle, Martin; Issac, Ansy; Robinson, Peter G

    2014-08-20

    Poor or inequitable access to oral health care is commonly reported in high-, middle- and low-income countries. Although the severity of these problems varies, a lack of supply of dentists and their uneven distribution are important factors. Delegating care to dental auxiliaries could ease this problem, extend services to where they are unavailable and liberate time for dentists to do more complex work. Before such an approach can be advocated, it is important to know the relative effectiveness of dental auxiliaries and dentists. To assess the effectiveness, costs and cost effectiveness of dental auxiliaries in providing care traditionally provided by dentists. We searched the following electronic databases from their inception dates up to November 2013: the Cochrane Effective Practice and Organisation of Care (EPOC) Group's Specialised Register; Cochrane Oral Health Group's Specialised Register; the Cochrane Central Register of Controlled Trials (Issue 11, 2013); MEDLINE; EMBASE; CINAHL; Cochrane Database of Systematic Reviews; Database of Abstracts of Reviews of Effectiveness; five other databases and two trial registries. We also undertook a grey literature search and searched the reference list of included studies and contacted authors of relevant papers. We included randomised controlled trials (RCTs), non-randomised controlled clinical trials (NRCTs), interrupted time series (ITSs) and controlled before and after studies (CBAs) evaluating the effectiveness of dental auxiliaries compared with dentists in undertaking clinical tasks traditionally performed by a dentist. Three review authors independently applied eligibility criteria, extracted data and assessed the risk of bias of each included study and two review authors assessed the quality of the evidence from the included studies, according to The Cochrane Collaboration's procedures. Since meta-analysis was not possible, we gave a narrative description of the results. We identified five studies (one cluster

  3. On the computation of molecular auxiliary functions An and Bn

    Indian Academy of Sciences (India)

    Department of Physics, Faculty of Arts and Sciences, Onsekiz Mart University, C¸ anakkale, Turkey. Email: guseinov@cheerful.com. Abstract. The Comment 'on the computation of auxiliary functions An(p) and Bn(pt)' (F E Harris,. Pramana – J. Phys. 61, C779 (2003)) is analysed in the arbitrary range of parameters n p and pt.

  4. 49 CFR 229.125 - Headlights and auxiliary lights.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD LOCOMOTIVE SAFETY STANDARDS Safety Requirements Cabs and... compromise the integrity of the car body or be otherwise impractical. Auxiliary lights on such MU locomotives... flashing feature may be activated automatically, but shall be capable of manual activation and deactivation...

  5. Improving Semi-Supervised Learning with Auxiliary Deep Generative Models

    DEFF Research Database (Denmark)

    Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    expressive for semi-supervised learning. By utilizing the stochasticity of the auxiliary variable we demonstrate how to train discriminative classifiers resulting in state-of-the-art performance within semi-supervised learning exemplified by an 0.96% error on MNIST using 100 labeled data points. Furthermore...

  6. Development of KALIMER auxiliary sodium and cover gas management system

    International Nuclear Information System (INIS)

    Kwon, Sang Woon; Hwang, Sung Tae

    1996-11-01

    The objectives of this report are to develop and to describe the auxiliary liquid metal and cover gas management systems of KALIMER. the system includes following system: (1) Auxiliary liquid metal system (2) Inert gas receiving and processing system (3) Impurity monitoring and analysis system. Auxiliary liquid metal and cover gas management system of KALIMER was developed. Functions of each systems and design basis were describes. The auxiliary liquid metal system receives, transfers, and purifies all sodium used in the plant. The system furnishes the required sodium quantity at the pressure, temperature, flow rate, and purity specified by the interfacing system. The intermediated sodium processing subsystem (ISPS) provides continuous purification of IHTS sodium, as well as performs the initial fill operation for both the IHTS and reactor vessel. The primary sodium processing subsystem provides purification (cold trapping) for sodium used in the reactor vessel. The inert gas receiving and processing (IGRP) system provides liquefied and ambient gas storage, delivers inert gases of specified composition and purity at regulated flow rates and pressures to points of usage throughout the KALIMER, and accepts the contaminated gases through its vacuum facilities for storage and transfer to the gas radwaste system. Three gases are used in the KALIMER: helium, argon, and nitrogen. 11 tabs., 12 figs. (Author)

  7. Dual Entwining Structures and Dual Entwined Modules

    OpenAIRE

    Abuhlail, Jawad Y.

    2003-01-01

    In this note we introduce and investigate the concepts of dual entwining structures and dual entwined modules. This generalizes the concepts of dual Doi-Koppinen structures and dual Doi-Koppinen modules introduced (in the infinite case over rings) by the author is his dissertation.

  8. Approaching the Hartree-Fock Limit through the Complementary Auxiliary Basis Set Singles Correction and Auxiliary Basis Sets.

    Science.gov (United States)

    Shaw, Robert A; Hill, J Grant

    2017-04-11

    Auxiliary basis sets for use in the resolution of the identity (RI) approximation in explicitly correlated methods are presented for the elements H-Ar. These extend the cc-pVnZ-F12/OptRI (n = D-Q) auxiliary basis sets of Peterson and co-workers by the addition of a small number of s- and p-functions, optimized so as to yield the greatest complementary auxiliary basis set (CABS) singles correction to the Hartree-Fock energy. The new sets, denoted OptRI+, also lead to a reduction in errors due to the RI approximation and hence an improvement in correlation energies. The atomization energies and heats of formation for a test set of small molecules, and spectroscopic constants for 27 diatomics, calculated at the CCSD(T)-F12b level, are shown to have improved error distributions for the new auxiliary basis sets with negligible additional effort. The OptRI+ sets retain all of the desirable properties of the original OptRI, including the production of smooth potential energy surfaces, while maintaining a compact nature.

  9. An Analytical Method of Auxiliary Sources Solution for Plane Wave Scattering by Impedance Cylinders

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2004-01-01

    Analytical Method of Auxiliary Sources solutions for plane wave scattering by circular impedance cylinders are derived by transformation of the exact eigenfunction series solutions employing the Hankel function wave transformation. The analytical Method of Auxiliary Sources solution thus obtained...

  10. Soliton dual frequency combs in crystalline microresonators.

    Science.gov (United States)

    Pavlov, N G; Lihachev, G; Koptyaev, S; Lucas, E; Karpov, M; Kondratiev, N M; Bilenko, I A; Kippenberg, T J; Gorodetsky, M L

    2017-02-01

    We present a novel compact dual-comb source based on a monolithic optical crystalline MgF2 multi-resonator stack. The coherent soliton combs generated in the two microresonators of the stack with the repetition rate of 12.1 GHz and difference of 1.62 MHz provided after heterodyning a 300 MHz wide radio frequency comb. An analogous system can be used for dual-comb spectroscopy, coherent LIDAR applications, and massively parallel optical communications.

  11. Cartilage imaging of a rabbit knee using dual-energy X-ray microscopy and 1.0 T and 9.4 T magnetic resonance imaging

    Directory of Open Access Journals (Sweden)

    Ying Zhu

    2015-10-01

    Conclusion: Our results suggest that the dual-energy XRM for articular-cartilage analysis is feasible and comparable to the MRI. This technology will provide good support for high-resolution animal-osteoarthritis studies, and in the future, it may be possible to apply dual energy in a clinical setting.

  12. 47 CFR 74.601 - Classes of TV broadcast auxiliary stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Classes of TV broadcast auxiliary stations. 74... Television Broadcast Auxiliary Stations § 74.601 Classes of TV broadcast auxiliary stations. (a) TV pickup stations. A land mobile station used for the transmission of TV program material and related communications...

  13. 30 CFR 57.22209 - Auxiliary fans (I-C mines).

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-C mines). 57.22209 Section 57... Standards for Methane in Metal and Nonmetal Mines Ventilation § 57.22209 Auxiliary fans (I-C mines). Electric auxiliary fans shall be approved by MSHA under the applicable requirements of 30 CFR part 18...

  14. 30 CFR 57.8534 - Shutdown or failure of auxiliary fans.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Shutdown or failure of auxiliary fans. 57.8534... Ventilation Underground Only § 57.8534 Shutdown or failure of auxiliary fans. (a) Auxiliary fans installed and... fan maintenance or fan adjustments where air quality is maintained in compliance with the applicable...

  15. An Analytical Method of Auxiliary Sources Solution for Plane Wave Scattering by Impedance Cylinders - A Reference Solution for the Numerical Method of Auxiliary Sources

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2004-01-01

    To facilitate the validation of the numerical Method of Auxiliary Sources an analytical Method of Auxiliary Sources solution is derived in this paper. The Analytical solution is valid for transverse magnetic, and electric, plane wave scattering by circular impedance Cylinders, and it is derived...... of the numerical Method of Auxiliary Sources for a range of scattering configurations....... with their singularities at different positions away from the origin. The transformation necessitates a truncation of the wave transformation but the inaccuracy introduced hereby is shown to be negligible. The analytical Method of Auxiliary Sources solution is employed as a reference to investigate the accuracy...

  16. Contracted auxiliary Gaussian basis integral and derivative evaluation

    Science.gov (United States)

    Giese, Timothy J.; York, Darrin M.

    2008-02-01

    The rapid evaluation of two-center Coulomb and overlap integrals between contracted auxiliary solid harmonic Gaussian functions is examined. Integral expressions are derived from the application of Hobson's theorem and Dunlap's product and differentiation rules of the spherical tensor gradient operator. It is shown that inclusion of the primitive normalization constants greatly simplifies the calculation of contracted functions corresponding to a Gaussian multipole expansion of a diffuse charge density. Derivative expressions are presented and it is shown that chain rules are avoided by expressing the derivatives as a linear combination of auxiliary integrals involving no more than five terms. Calculation of integrals and derivatives requires the contraction of a single vector corresponding to the monopolar result and its scalar derivatives. Implementation of the method is discussed and comparison is made with a Cartesian Gaussian-based method. The current method is superior for the evaluation of both integrals and derivatives using either primitive or contracted functions.

  17. Aging assessment of PWR [Pressurized Water Reactor] Auxiliary Feedwater Systems

    International Nuclear Information System (INIS)

    Casada, D.A.

    1988-01-01

    In support of the Nuclear Regulatory Commission's Nuclear Plant Aging Research (NPAR) Program, Oak Ridge National Laboratory is conducting a review of Pressurized Water Reactor Auxiliary Feedwater Systems. Two of the objectives of the NPAR Program are to identify failure modes and causes and identify methods to detect and track degradation. In Phase I of the Auxiliary Feedwater System study, a detailed review of system design and operating and surveillance practices at a reference plant is being conducted to determine failure modes and to provide an indication of the ability of current monitoring methods to detect system degradation. The extent to which current practices are contributing to aging and service wear related degradation is also being assessed. This paper provides a description of the study approach, examples of results, and some interim observations and conclusions. 1 fig., 1 tab

  18. Generating Selected Color using RGB, Auxiliary Lights, and Simplex Search

    Directory of Open Access Journals (Sweden)

    Kim HyungTae

    2015-01-01

    Full Text Available A mixed light source generates various colors, with the potential to adjust intensities of multiple LEDs, which makes it possible to generate arbitrary colors. Currently, PCs and OSs provide color selection windows that can obtain the RGB or HSL color coordinates of a user’s selection. Mixed light sources are usually composed of LEDs in the primary colors, with LEDs in auxiliary colors such as white and yellow used in a few cases. When using auxiliary color LEDs, the number of LED inputs, the dimming levels, is larger than the number of elements in the color coordinate, which causes an under-determined problem. This study proposed how to determine the dimming levels of LEDs based on the selected color. Commercial LEDs have di_erent optical power values and impure color coordinates, even if they are RGB. Hence, the characteristics of the LEDs were described using a linear model derived from the tri-stimulus values (an XYZ color coordinate model and dimming levels. Color mixing models were derived for the arbitrary number of auxiliary color LEDs. The under-determined problem was solved using a simplex search method without an inverse matrix operation. The proposed method can be applied to a machine vision system and an RGBW light mixer for semiconductor inspection. The dimming levels, obtained using the proposed method were better than derived using other methods.

  19. Auxiliary Density Matrix Methods for Hartree-Fock Exchange Calculations.

    Science.gov (United States)

    Guidon, Manuel; Hutter, Jürg; VandeVondele, Joost

    2010-08-10

    The calculation of Hartree-Fock exchange (HFX) is computationally demanding for large systems described with high-quality basis sets. In this work, we show that excellent performance and good accuracy can nevertheless be obtained if an auxiliary density matrix is employed for the HFX calculation. Several schemes to derive an auxiliary density matrix from a high-quality density matrix are discussed. Key to the accuracy of the auxiliary density matrix methods (ADMM) is the use of a correction based on standard generalized gradient approximations for HFX. ADMM integrates seamlessly in existing HFX codes and, in particular, can be employed in linear scaling implementations. Demonstrating the performance of the method, the effect of HFX on the structure of liquid water is investigated in detail using Born-Oppenheimer molecular dynamics simulations (300 ps) of a system of 64 molecules. Representative for large systems are calculations on a solvated protein (Rubredoxin), for which ADMM outperforms the corresponding standard HFX implementation by approximately a factor 20.

  20. Bayesian Analysis of Geostatistical Models With an Auxiliary Lattice

    KAUST Repository

    Park, Jincheol

    2012-04-01

    The Gaussian geostatistical model has been widely used for modeling spatial data. However, this model suffers from a severe difficulty in computation: it requires users to invert a large covariance matrix. This is infeasible when the number of observations is large. In this article, we propose an auxiliary lattice-based approach for tackling this difficulty. By introducing an auxiliary lattice to the space of observations and defining a Gaussian Markov random field on the auxiliary lattice, our model completely avoids the requirement of matrix inversion. It is remarkable that the computational complexity of our method is only O(n), where n is the number of observations. Hence, our method can be applied to very large datasets with reasonable computational (CPU) times. The numerical results indicate that our model can approximate Gaussian random fields very well in terms of predictions, even for those with long correlation lengths. For real data examples, our model can generally outperform conventional Gaussian random field models in both prediction errors and CPU times. Supplemental materials for the article are available online. © 2012 American Statistical Association, Institute of Mathematical Statistics, and Interface Foundation of North America.

  1. Enhanced Deposition Uniformity via an Auxiliary Electrode in Massive Electrospinning.

    Science.gov (United States)

    Wu, Dezhi; Xiao, Zhiming; Deng, Lei; Sun, Yu; Tan, Qiulin; Dong, Linxi; Huang, Shaohua; Zhu, Rui; Liu, Yifang; Zheng, Wanxi; Zhao, Yang; Wang, Lingyun; Sun, Daoheng

    2016-07-22

    Uniform deposition of nanofibers in the massive electrospinning process is critical in the industrial applications of nanofibers. Tip-Induced Electrospinning (TIE) is a cost-effective large-scale nanofiber-manufacturing method, but it has poor deposition uniformity. An auxiliary conductive electrode connected to the emitting electrode was introduced to improve the deposition uniformity of the nanofibers. The effects of the auxiliary electrode shape, the tilted angles and the position of the boat-like electrode on the electric field distribution, the diameter of the nanofibers, the jet control and the deposition uniformity were explored by using finite element analysis of the electric field and experiments. Experiments showed that the boat-like electrode at 20 mm above the reservoir bottom with a 5° tilted angle helped to decrease the relative deposition error of nanofibers in the greatest extent to about 5.66%, indicating such an auxiliary electrode is a good candidate method to greatly improve the deposition uniformity of nanofibers in massive electrospinning.

  2. Moment approach to neoclassical flows, currents and transport in auxiliary heated tokamaks

    International Nuclear Information System (INIS)

    Kim, Yil Bong.

    1988-02-01

    The moment approach is utilized to derive the full complement of neoclassical transport processes in auxiliary heated tokamaks. The effects of auxiliary heating [neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH)] considered arise from the collisional interaction between the background plasma species and the fast-ion-tail species. From a known fast ion distribution function we evaluate the parallel (to the magnetic field) momentum and heat flow inputs to the background plasma. Then, through the momentum and heat flow balance equations, we can determine the induced parallel flows (and current) and radial transpot fluxes in ''equilibrium'' (on the time scale much longer than the collisional relaxation time, i.e., t >> 1ν/sub ii/). In addition to the fast-ion-induced current, the total neoclassical current includes the boostap current, which is driven by the pressure and temperature gradients, the Pfirsch-Schlueter current which is required for charge neutrality, and the neoclassical (including trapped particle effects) Spitzer current due to the parallel electric field. The radial transport fluxes also include off-diagonal compnents in the transport matrix which correspond to the Ware (neoclassical) pinch due to the inductive applied electric field an the fast-ion-induced radial fluxes, in addition to the usual pressure- and temperature-gradient-driven fluxes (particle diffusion and heat conduction). Once the tranport coefficient are completely determined, the radial fluxes and the heat fluxes can be substituted into the density and energy evolution equations to provide a complete description of ''equilibrium'' (δδt << ν/sub ii/) neoclassical transport processes in a plasma. 47 refs., 14 figs

  3. Some properties of dual and approximate dual of fusion frames

    OpenAIRE

    Arefijamaal, Ali Akbar; Neyshaburi, Fahimeh Arabyani

    2016-01-01

    In this paper we extend the notion of approximate dual to fusion frames and present some approaches to obtain dual and approximate alternate dual fusion frames. Also, we study the stability of dual and approximate alternate dual fusion frames.

  4. An Analytical Method of Auxiliary Sources Solution for Plane Wave Scattering by Impedance Cylinders - A Reference Solution for the Numerical Method of Auxiliary Sources

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2004-01-01

    To facilitate the validation of the numerical Method of Auxiliary Sources an analytical Method of Auxiliary Sources solution is derived in this paper. The Analytical solution is valid for transverse magnetic, and electric, plane wave scattering by circular impedance Cylinders, and it is derived b...

  5. Analysis of Nigerian dentists' opinion and consequences on expanded function dental auxiliaries.

    Science.gov (United States)

    Umanah, A U; Azodo, C

    2015-06-01

    To examine Nigerian dentists' opinion on expanded function dental auxiliaries. This cross-sectional study of Nigerian dentists attending a dental conference was conducting in 2012 using self-administered questionnaire. The data were analyzed using Statistical Package for the Social Sciences version 16.0. P opinion towards expanded duty dental auxiliaries. The mean scores on consequences, of expanded function dental auxiliaries ranked redundancy of dentist as highest. Males and non-specialist significantly reported expanded function dental auxiliaries would lead to redundancy of dentists. Practitioners working in other hospitals other than teaching hospital significantly reported that appropriate legislation are necessary before expansion of duties of the dental auxiliaries can be done. The dentists with favorable opinion significantly reported that expanded duty dental auxiliaries would not cause redundancy of dentist and the task are not too difficult for dental auxiliaries with necessary training but will increase service delivery and efficiency, increase job satisfaction, lead to dental auxiliary specialization with legislation. Data from this study revealed overall unfavorable opinion of Nigerian dentists on the expanded duty dental auxiliaries. However, those with favorable opinion were significantly supportive of expanded function dental auxiliaries. This information would serve as a useful tool for Nigerian oral healthcare policy formulators.

  6. Second-harmonic ion cyclotron resonance heating scenarios of ...

    Indian Academy of Sciences (India)

    Abstract. Plasma heating with the fast magnetosonic waves in the ion cyclotron range of fre- quencies (ICRF) is one of the auxiliary heating schemes of Aditya tokamak. Numerical simulation of second-harmonic resonance heating scenarios in low-temperature, low-density Aditya plasma has been carried out for fast ...

  7. Sampling general N-body interactions with auxiliary fields

    Science.gov (United States)

    Körber, C.; Berkowitz, E.; Luu, T.

    2017-09-01

    We present a general auxiliary field transformation which generates effective interactions containing all possible N-body contact terms. The strength of the induced terms can analytically be described in terms of general coefficients associated with the transformation and thus are controllable. This transformation provides a novel way for sampling 3- and 4-body (and higher) contact interactions non-perturbatively in lattice quantum Monte Carlo simulations. As a proof of principle, we show that our method reproduces the exact solution for a two-site quantum mechanical problem.

  8. Helicene-like chiral auxiliaries in asymmetric catalysis.

    Science.gov (United States)

    Aillard, P; Voituriez, A; Marinetti, A

    2014-11-07

    This literature overview demonstrates that helically chiral ligands and organocatalysts have been largely neglected so far. However, a few recent studies on helical pyridine, the corresponding ammonium salts and N-oxides have highlighted the significant potential of these compounds as organocatalysts for Michael type additions, aldehyde propargylations, epoxide openings, and others. In addition, helicenes displaying a fused phosphole ring at the end of their polyaromatic structures, have been used as ligands in enantioselective gold promoted cycloisomerization reactions, giving both excellent catalytic activity and high enantiomeric excesses. These recent results are expected to stimulate further research on the catalytic applications of helically chiral auxiliaries in the next few years.

  9. A deterministic global optimization using smooth diagonal auxiliary functions

    Science.gov (United States)

    Sergeyev, Yaroslav D.; Kvasov, Dmitri E.

    2015-04-01

    In many practical decision-making problems it happens that functions involved in optimization process are black-box with unknown analytical representations and hard to evaluate. In this paper, a global optimization problem is considered where both the goal function f (x) and its gradient f‧ (x) are black-box functions. It is supposed that f‧ (x) satisfies the Lipschitz condition over the search hyperinterval with an unknown Lipschitz constant K. A new deterministic 'Divide-the-Best' algorithm based on efficient diagonal partitions and smooth auxiliary functions is proposed in its basic version, its convergence conditions are studied and numerical experiments executed on eight hundred test functions are presented.

  10. Sandia Laboratories technical capabilities. Auxiliary capabilities: environmental health information science

    International Nuclear Information System (INIS)

    1975-09-01

    Sandia Laboratories is an engineering laboratory in which research, development, testing, and evaluation capabilities are integrated by program management for the generation of advanced designs. In fulfilling its primary responsibility to ERDA, Sandia Laboratories has acquired extensive research and development capabilities. The purpose of this series of documents is to catalog the many technical capabilities of the Laboratories. After the listing of capabilities, supporting information is provided in the form of highlights, which show applications. This document deals with auxiliary capabilities, in particular, environmental health and information science. (11 figures, 1 table) (RWR)

  11. Vacuum transitions in dual models

    International Nuclear Information System (INIS)

    Pashnev, A.I.; Volkov, D.V.; Zheltukhin, A.A.

    1976-01-01

    The investigation is continued of the spontaneous vacuum transition problem in the Neview-Schwartz dual model (NSDM). It is shown that vacuum transitions allow disclosing of supplementary degeneration in the resonance state spectrum. The dual amplitudes possess an internal structure corresponding to the presence of an infinite number of quarks with increasing masses and retained charges. The Adler principle holds. Analytic continuation on the constant of induced vacuum transitions makes it possible to establish the existence of spontaneous vacuum transitions in the NSDM. The consequence of this fact is the exact SU(2) symmetry of π, rho meson trajectories and the Higgs mechanism in the model. In this case the ratios of masses of particles leading trajectories are analogous to those obtained in the current algebra. It is shown that in the NSDM there arises chiral SU(2) x SU(2) x U(1) x U(1) x ... symmetry resulting from spontaneous vacuum transitions

  12. Inundation Mapping for Heterogeneous Land Covers with Synthetic Aperture Radar and Auxiliary Data

    Science.gov (United States)

    Aristizabal, F.; Judge, J.

    2017-12-01

    Synthetic Aperture Radar (SAR) has been widely used to detect surface water inundation and provides an advantage over multi-spectral instruments due to cloud penetration and higher spatial resolutions. However, detecting inundation for densely vegetated and urban areas with SAR remains a challenge due to corner reflection and diffuse scattering. Additionally, flat urban surfaces such as roads exhibit similar backscatter coefficients as urban surface water. Differences between inundated and non-inundated backscatter over vegetated land covers of static spatial domains have been demonstrated in previous studies. However, these backscatter differences are sensitive to changes in water depth, soil moisture, SAR sensor parameters, terrain, and vegetation properties. These factors tend to make accurate inundation mapping of heterogeneous regions across varying spatial and temporal extents difficult with exclusive use of SAR. This study investigates the utility of auxiliary data specifically high-resolution (10m) terrain information in conjunction with SAR (10m) for detecting inundated areas. Digital elevation models provide an absolute elevation which could enhance inundation mapping given a limited study extent with similar topography. To counter this limitation, a hydrologically relevant terrain index is proposed known as the Height Above Nearest Drainage (HAND) which normalizes topography to the local relative elevation of the nearest point along the relevant drainage line. HAND has been used for assisting remote sensing inundation mapping in the pre-processing stage as a terrain correction tool and as a post-processing mask that eliminates areas of low inundation risk. While the latter technique is useful for reduction of commission errors, it does not employ HAND for reducing omission errors that can occur from dense vegetation, spectral noise, and urban features. Sentinel-1 dual-pol SAR as well as auxiliary HAND will be used as predictors by various supervised and

  13. Assembly auxiliary system for narrow cabins of spacecraft

    Science.gov (United States)

    Liu, Yi; Li, Shiqi; Wang, Junfeng

    2015-09-01

    Due to the narrow space and complex structure of spacecraft cabin, the existing asssembly systems can not well suit for the assembly process of cabin products. This paper aims to introduce an assembly auxiliary system for cabin products. A hierarchical-classification method is proposed to re-adjust the initial assembly relationship of cabin into a new hierarchical structure for efficient assembly planning. An improved ant colony algorithm based on three assembly principles is established for searching a optimizational assembly sequence of cabin parts. A mixed reality assembly environment is constructed with enhanced information to promote interaction efficiency of assembly training and guidance. Based on the machine vision technology, the inspection of left redundant objects and measurement of parts distance in inner cabin are efficiently performed. The proposed system has been applied to the assembly work of a spacecraft cabin with 107 parts, which includes cabin assembly planning, assembly training and assembly quality inspection. The application result indicates that the proposed system can be an effective assistant tool to cabin assembly works and provide an intuitive and real assembly experience for workers. This paper presents an assembly auxiliary system for spacecraft cabin products, which can provide technical support to the spacecraft cabin assembly industry.

  14. Auxiliary lift propulsion system with oversized front fan

    Energy Technology Data Exchange (ETDEWEB)

    Castells, O.T.; Johnson, J.E.; Rundell, D.J.

    1980-09-16

    A propulsion system for use primarily in V/STOL aircraft is provided with a variable cycle, double bypass gas turbofan engine and a remote augmenter to produce auxiliary lift. The fan is oversized in air-pumping capability with respect to the cruise flight requirements of the remainder of the engine and a variable area, low pressure turbine is capable of supplying varying amounts of rotational energy to the oversized fan, thereby modulating its speed and pumping capability. During powered lift flight, the variable cycle engine is operated in the single bypass mode with the oversized fan at its maximum pumping capability. In this mode, substantially all of the bypass flow is routed as an auxiliary airstream to the remote augmenter where it is mixed with fuel, burned and exhausted through a vectorable nozzle to produce thrust for lifting. Additional lift is generated by the high energy products of combustion of the variable cycle engine which are further energized in an afterburner and exhausted through a thrust vectorable nozzle at the rear of the engine.

  15. Aging and low-flow degradation of auxiliary feedwater pumps

    International Nuclear Information System (INIS)

    Adams, M.L.

    1991-01-01

    This paper documents the results of research done under the auspices of the Nuclear Regulatory Commission Nuclear Plant Aging Research Program. It examines the degradation imparted to safety Auxiliary Feedwater System pumps at nuclear plants due to the low flow operation. The Auxiliary Feedwater (AFW) System is normally a stand-by system. As such it is operated most often in the test mode. Since few plants are equipped with full flow test loops, most testing is accomplished at minimum flow conditions in pump by-pass lines. It is the vibration and hydraulic forces generated at low flow conditions that have been shown to be the major causes of AFW pump aging and degradation. The wear can be manifested in a number of ways, such as impeller or diffuser breakage, thrust bearing and/or balance device failure due to excessive loading, cavitation damage on such stage impellers, increase seal leakage or failure, sear injection piping failure, shaft or coupling breakage, and rotating element seizure

  16. Fixed energy potentials through an auxiliary inverse eigenvalue problem

    International Nuclear Information System (INIS)

    Pálmai, Tamás; Apagyi, Barnabás

    2012-01-01

    An inverse scattering method based on an auxiliary inverse Sturm–Liouville problem recently proposed by Horváth and Apagyi (2008 Mod. Phys. Lett. B 22 2137) is examined in various aspects and developed further to (re)construct spherically symmetric fixed energy potentials of compact support realized in the three-dimensional Schrödinger equation. The method is generalized to obtain a family of inverse procedures characterized by two parameters originating, respectively, from the Liouville transformation and the solution of the inverse Sturm–Liouville problem. Both parameters affect the bound states arising in the auxiliary inverse spectral problem and one of them enables us to reduce their number which is assessed by a simple method. Various solution techniques of the underlying moment problem are proposed including the exact Cauchy matrix inversion method, usage of spurious bound state and assessment of the number of bound states. Examples include (re)productions of potentials from phase shifts known theoretically or derived from scattering experiments. (paper)

  17. On the Auxiliary Status of Dare in Old English

    Directory of Open Access Journals (Sweden)

    Tomaszewska Magdalena

    2014-12-01

    Full Text Available OE *durran ‘dare’ belongs to a group of the so-called preterite-present verbs which developed weak past tense forms replacing the originally strong forms throughout the paradigm. The present study hypothesizes that the potential sources of this development are related to the decay of the subjunctive mood in Old English. Further, this corpus-based study analyses the status of DARE in Old English, with the findings showing that the verb displayed both lexical and auxiliary verb characteristics. These results are juxtaposed and compared with the verb's developments in Middle English. The databases examined are the corpus of The Dictionary of Old English in Electronic Form (A-G and the Innsbruck Computer Archive of Machine-Readable English Texts. In both cases, a search of potential forms was performed on all the files of the corpora, the raw results were then analysed in order to eliminate irrelevant instances (adjectives, nouns, foreign words, etc.. The relevant forms were examined with the aim to check the properties of DARE as a lexical and an auxiliary verb, and compare the findings with Molencki’s (2002, 2005 observations.

  18. VLTI auxiliary telescopes: a full object-oriented approach

    Science.gov (United States)

    Chiozzi, Gianluca; Duhoux, Philippe; Karban, Robert

    2000-06-01

    The Very Large Telescope (VLT) Telescope Control Software (TCS) is a portable system. It is now in use or will be used in a whole family of ESO telescopes VLT Unit Telescopes, VLTI Auxiliary Telescopes, NTT, La Silla 3.6, VLT Survey Telescope and Astronomical Site Monitors in Paranal and La Silla). Although it has been developed making extensive usage of Object Oriented (OO) methodologies, the overall development process chosen at the beginning of the project used traditional methods. In order to warranty a longer lifetime to the system (improving documentation and maintainability) and to prepare for future projects, we have introduced a full OO process. We have taken as a basis the United Software Development Process with the Unified Modeling Language (UML) and we have adapted the process to our specific needs. This paper describes how the process has been applied to the VLTI Auxiliary Telescopes Control Software (ATCS). The ATCS is based on the portable VLT TCS, but some subsystems are new or have specific characteristics. The complete process has been applied to the new subsystems, while reused code has been integrated in the UML models. We have used the ATCS on one side to tune the process and train the team members and on the other side to provide a UML and WWW based documentation for the portable VLT TCS.

  19. Energy confinement scaling in tokamaks: some implications of recent experiments with ohmic and strong auxiliary heating

    International Nuclear Information System (INIS)

    Goldston, R.J.

    1984-02-01

    Recent results from confinement scaling experiments on tokamaks with ohmic and strong auxiliary heating are reviewed. An attempt is made to draw these results together into a low-density ohmic confinement scaling law, and a scaling law for confinement with auxiliary heating. The auxiliary heating confinement law may also serve to explain the saturation in tau/sub E/ vs anti n/sub e/ observed in some ohmic heating density scaling experiments

  20. The relationship among the solutions of two auxiliary ordinary differential equations

    International Nuclear Information System (INIS)

    Liu Xiaoping; Liu Chunping

    2009-01-01

    In a recent article [Phys. Lett. A 356 (2006) 124], Sirendaoreji extended their auxiliary equation method by introducing a new auxiliary ordinary differential equation (NAODE) and its 14 solutions. Then the author studied some nonlinear evolution equations (NLEEs) and got more exact travelling wave solutions. In this paper, we will show that the 14 solutions of the NAODE are actually the same as the solutions obtained by original auxiliary equation method, and they are only different in the form.

  1. Clinical comparison between a currently available single-loop and an investigational dual-channel endorectal receive coil for prostate magnetic resonance imaging: a feasibility study at 1.5 and 3 T

    NARCIS (Netherlands)

    Vos, E.K.; Sambandamurthy, S.; Kamel, M.; McKenney, R.; Uden, M.J. van; Hoeks, C.M.A.; Yakar, D.; Scheenen, T.W.J.; Futterer, J.J.

    2014-01-01

    The objectives of this study were to test the feasibility of an investigational dual-channel next-generation endorectal coil (NG-ERC) in vivo, to quantitatively assess signal-to-noise ratio (SNR), and to get an impression of image quality compared with the current clinically available single-loop

  2. Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

    Directory of Open Access Journals (Sweden)

    Devender Singh

    2016-12-01

    Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

  3. Improved Aqueous Solubility and Antihypercholesterolemic Activity of Ezetimibe on Formulating with Hydroxypropyl-β-Cyclodextrin and Hydrophilic Auxiliary Substances.

    Science.gov (United States)

    Srivalli, Kale Mohana Raghava; Mishra, Brahmeshwar

    2016-04-01

    The purpose of this study was to improve the aqueous solubility, dissolution, and pharmacodynamic properties of a BCS class II drug, ezetimibe (Eze) by preparing ternary cyclodextrin complex systems. We investigated the potential synergistic effect of two novel hydrophilic auxiliary substances, D-α-tocopheryl polyethylene glycol 1000 succinate (TPGS) and L-ascorbic acid-2-glucoside (AA2G) on hydroxypropyl-β-cyclodextrin (HPBCD) solubilization of poorly water-soluble hypocholesterolemic drug, Eze. In solution state, the binary and ternary systems were analyzed by phase solubility studies and Job's plot. The solid complexes prepared by freeze-drying were characterized by Fourier transform infrared (FTIR), differential scanning calorimetry (DSC), powder X-ray diffraction (XRD), nuclear magnetic resonance (NMR), and scanning electron microscopy (SEM). The log P values, aqueous solubility, dissolution, and antihypercholesterolemic activity of all systems were studied. The analytical techniques confirmed the formation of inclusion complexes in the binary and ternary systems. HPBCD complexation significantly (p solubility, dissolution, and hypocholesterolemic properties of Eze, and the addition of ternary component produced further significant improvement (p solubility, dissolution, and antihypercholesterolemic activity due to the addition of TPGS or AA2G may be attributed to enhanced wetting, dispersibility, and complete amorphization. The use of TPGS or AA2G as ternary hydrophilic auxiliary substances improved the HPBCD solubilization and antihypercholesterolemic activity of Eze.

  4. Auxiliary Frequency Parametric Excitation of Quadrupole Mass Spectrometers

    Science.gov (United States)

    Gershman, Daniel (Inventor); Block, Bruce (Inventor); Rubin, Martin (Inventor); Zurbuchen, Thomas (Inventor)

    2013-01-01

    The apparatus introduces a second adjustable resonant point in a QMS at a frequency that is close to a multiple of the fundamental frequency by adjusting driving point impedance characteristics of the QMS. The apparatus measures the first and second resonant point of the QMS to account for changes in the operational characteristics of the QMS.

  5. Coupling technology for dual-purpose nuclear-desalting plants

    International Nuclear Information System (INIS)

    Jones, J.E. Jr.; Anderson, T.D.; Reed, S.A.

    1976-11-01

    Although the basic technology for the various components of nuclear dual-purpose plants is reasonably well developed, the techniques of coupling the elements together to form a reliable, economical system that will satisfy the diverse operating requirements are not well established. The purpose of the study reported is to examine the technical, economic, and safety considerations in coupling nuclear power plants with distillation units to form a dual-purpose power and water distillation plant. The basic coupling arrangement required to provide a large-scale dual-purpose water plant is to supply steam to the water plant from the exhaust of a back-pressure turbine. The principal component at the interface that may require major research and development is the back-pressure turbine. To satisfy the operational requirements, two major auxiliary systems will be needed. These are: (1) a prime-steam bypass system, and (2) auxiliary condensers. These systems will provide a degree of independence between water and power production and can be justified economically

  6. Planar quadrature coil design using shielded-loop resonators

    DEFF Research Database (Denmark)

    Stensgaard, A

    1997-01-01

    The shielded-loop resonator is known to have a low capacitive sample loss due to a perfect balancing. In this paper, it is demonstrated that shielded-loop technology also can be used to improve design of planar quadrature coils. Both a dual-loop circuit and especially a dual-mode circuit may...... benefit from use of shielded-loop resonators. Observations in measurements agree with theory for both a dual-loop coil and a dual-mode coil. The coils were designed for use as transmit/receive coil for 1H imaging and spectroscopy at 4.7 T in rat brain....

  7. Mechanical resonator

    OpenAIRE

    Padowitz, David; Matsiev, L; Kolosov, Oleg

    2004-01-01

    A sensor and methods for making and using the same in which a mechanical resonator is employed, comprising a resonator portion for resonating in a fluid without the substantial generation of acoustic waves; and an electrical connection between the resonator portion for oscillating and a source of an input signal; wherein the portion for resonating, the electrical connection or both includes a base material and a performance-tuning material that is different from the base material.

  8. Development of the APR+ Auxiliary Building General Arrangement (GA)

    International Nuclear Information System (INIS)

    Moon, Hyung Keun; Park, Young Sheop; Kang, Yong Chul

    2011-01-01

    The general arrangement (GA) drawing of a nuclear power plant is the most basic drawing which contains all of the plant equipment, systems, and rooms. Therefore, it should be issued at an early design stage to provide the contours of the overall plant structure. This type of drawing is typically used widely throughout the design stages. The development project of APR+ (Advanced Power Reactor+), as a succeeding model of the APR1400 (Advanced Power Reactor 1400) design, has its own GA that encompasses all of its power buildings. This was developed starting in October of 2009. Among several of the buildings in this design, the Auxiliary Building (AB) is one of the most important buildings to produce electricity, and to protect against undesirable radiation emissions. This paper focuses on the design characteristics of the general arrangement of the AB

  9. Integrated hydrogen/oxygen technology applied to auxiliary propulsion systems

    Science.gov (United States)

    Gerhardt, David L.

    1990-01-01

    The purpose of the Integrated Hydrogen/Oxygen Technology (IHOT) study was to determine if the vehicle/mission needs and technology of the 1990's support development of an all cryogenic H2/O2 system. In order to accomplish this, IHOT adopted the approach of designing Integrated Auxiliary Propulsion Systems (IAPS) for a representative manned vehicle; the advanced manned launch system. The primary objectives were to develop IAPS concepts which appeared to offer viable alternatives to state-of-the-art (i.e., hypergolic, or earth-storable) APS approaches. The IHOT study resulted in the definition of three APS concepts; two cryogenic IAPS, and a third concept utilizing hypergolic propellants.

  10. Application of SMA technology to auxiliary functions in appliances

    Science.gov (United States)

    Johnson, Bart; Brei, Diann E.; Patera, John

    2002-07-01

    Traditionally smart material actuation has been reserved for high technology industries such as space and aerospace; however, as the field matures more and more instances are found in low-cost, high production areas. This paper describes one such instance - the application of shape memory alloys to auxiliary functions in appliances. This investigation focused on lid locks for washing machines because it is representative of several other applications found in appliances including valves, dispensers, locks, brakes, etc. Several competing concepts for SMA actuated lid locks are discussed including simple analytical design models and experimental characterization of proof-of-concept prototypes. A comparison of these designs based on performance (force, response times), energy (power requirements) and economic metrics is given. From this study, a final concept was developed based upon the best attributes of the different concepts. The resulting proof-of-concept prototype demonstrated improved performance over the current state with a potential for cost reduction.

  11. Auxiliary fields in the geometrical relativistic particle dynamics

    International Nuclear Information System (INIS)

    Amador, A; Bagatella, N; Rojas, E; Cordero, R

    2008-01-01

    We describe how to construct the dynamics of relativistic particles, following either timelike or null curves, by means of an auxiliary variables method instead of the standard theory of deformations for curves. There are interesting physical particle models governed by actions that involve higher order derivatives of the embedding functions of the worldline. We point out that the mechanical content of such models can be extracted wisely from a lower order action, which can be performed by implementing in the action a finite number of constraints that involve the geometrical relationship structures inherent to a curve and by using a covariant formalism. We emphasize our approach for null curves. For such systems, the natural time parameter is a pseudo-arclength whose properties resemble those of the standard proper time. We illustrate the formalism by applying it to some models for relativistic particles

  12. Auxiliary fields in the geometrical relativistic particle dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Amador, A; Bagatella, N; Rojas, E [Departamento de Fisica, Facultad de Fisica e Inteligencia Artificial, Universidad Veracruzana, 91000 Xalapa, Veracruz (Mexico); Cordero, R [Departamento de Fisica, Escuela Superior de Fisica y Matematicas del I.P.N, Edificio 9, 07738 Mexico D.F (Mexico)], E-mail: aramador@gmail.com, E-mail: nbagatella@uv.mx, E-mail: cordero@esfm.ipn.mx, E-mail: efrojas@uv.mx

    2008-03-21

    We describe how to construct the dynamics of relativistic particles, following either timelike or null curves, by means of an auxiliary variables method instead of the standard theory of deformations for curves. There are interesting physical particle models governed by actions that involve higher order derivatives of the embedding functions of the worldline. We point out that the mechanical content of such models can be extracted wisely from a lower order action, which can be performed by implementing in the action a finite number of constraints that involve the geometrical relationship structures inherent to a curve and by using a covariant formalism. We emphasize our approach for null curves. For such systems, the natural time parameter is a pseudo-arclength whose properties resemble those of the standard proper time. We illustrate the formalism by applying it to some models for relativistic particles.

  13. Stability and Confinement Properties of Auxiliary Heated NSTX Discharges

    Energy Technology Data Exchange (ETDEWEB)

    J.E. Menard; R.E.Bell; C. Bourdelle; D.S. Darrow; E.D. Fredrickson; D.A. Gates; L.R. Grisham; S.M. Kaye; B.P. LeBlanc; R. Maingi; S.S. Medley; D. Mueller; F. Paoletti; S.A. Sabbagh; D. Stutman; D.W. Swain; J.R. Wilson; M.G. Bell; J.M. Bialek; C.E.Bush; J.C. Hosea; D.W. Johnson; R. Kaita; H.W. Kugel; R.J. Maqueda; M. Ono; Y-K.M. Peng; C.H. Skinner; V.A. Soukhanovskii; E.J. Synakowski; G. Taylor; G.A. Wurden; and S.J. Zweben

    2001-07-05

    The National Spherical Torus Experiment (NSTX) is a spherical tokamak with nominal plasma major radius R(subscript ''0'') = 0.85 m, minor radius a = 0.66 m, and aspect ratio A > 1.28. Typical discharge parameters are plasma current I (subscript ''p'') = 0.7-1.4 MA, toroidal magnetic field B(subscript ''t0'') = 0.25-0.45 Tesla at major radius R(subscript ''0''), elongation = 1.7-2.2, triangularity 0.3-0.5, line-average electron density = 2-5 x 10(superscript ''19'') m(superscript ''-3''), electron temperature T(subscript ''e'')(0) = 0.5-1.5 keV, and ion temperature T(subscript ''i'')(0) = 0.5-2 keV. The NSTX auxiliary heating systems can routinely deliver 4.5 MW of 80-keV deuterium neutral beams and 3 MW of 30-MHz high-harmonic fast-wave power. Kinetic profile diagnostics presently include a 10-channel, 30-Hz multipulse Thomson scattering system (MPTS), a 17-channel charge-exchange recombination spectroscopy (CHERS) system, a 48-chord ultra-soft X-ray (USXR) array, and a 15-chord bolometry array. Initial experiments utilizing auxiliary heating on NSTX have focused on MHD stability limits, confinement trends, studying H-mode characteristics, and performing initial power balance calculations.

  14. STARTER-GENERATOR SYSTEM FOR AUXILIARY POWER UNIT

    Directory of Open Access Journals (Sweden)

    A. V. Levin

    2017-01-01

    Full Text Available The article presents a starter-generator system for an auxiliary power unit of an aircraft. A feature of the presented system is the use of a synchronous generator with excitation from permanent magnets and a semiconductor converter. The main problem of the system is the generation of electric energy of an aircraft on the basis of a synchronous generator with excitation from permanent magnets is the absence of the possibility of regulating the voltage and frequency of electrical energy, in this connection, a semiconductor converter that ensures the conversion of generated electric energy with significant mass-dimensions characteristics.The article proposes an approach to designing a starter-generator system with a parallel connection of a synchronous generator with excitation from permanent magnets and a semiconductor converter. This approach makes it possible to significantly reduce the part of the electrical energy that needs to be converted, as a consequence, the semiconductor converter has significantly smaller mass-and-batch characteristics.In the article the modes of generation of electric energy and the starter mode of operation of the starter-generator system are considered in detail, the circuit realization of the semiconductor converter is shown. A scheme for replacing one phase of the system for generating electric energy and calculating electric parameters is presented.The possibility of creating a highly efficient starter-generator system based on a synchronous generator with excitation from permanent magnets and a semiconductor converter for an auxiliary power plant of aircrafts is shown. Structural and basic schemes for constructing a system for generating electrical energy are proposed. The approach to the choice of rational circuit solutions is substantiated, basic estimates of the electrical parameters of the system are obtained. The possibility of achieving a specific mass of a semiconductor converter for synchronous

  15. Novel Compact and High Selectivity Dual-band BPF with Wide Stopband

    Directory of Open Access Journals (Sweden)

    L. Wang

    2012-04-01

    Full Text Available A novel type of compact and high selectivity dual-band bandpass filter (BPF incorporating a dual-mode defected ground structure resonator (DDGSR and a dual-mode open-stub loaded stepped impedance resonator (DOLSIR is proposed in this paper. Utilizing capacitive source-load coupling and the intrinsic characteristics of the two types of dual-mode resonators, compact dual-band BPF with multi transmission zeros near the passband edges as well as a wide stopband which can be used to achieve high selectivity is realized. An experimental dual-band BPF located at 2.4 and 3.2 GHz was designed and fabricated. The validity of the design approach is verified by good agreement between simulated and measurement results.

  16. Dual Diagnosis - Multiple Languages

    Science.gov (United States)

    ... Are Here: Home → Multiple Languages → All Health Topics → Dual Diagnosis URL of this page: https://medlineplus.gov/ ... V W XYZ List of All Topics All Dual Diagnosis - Multiple Languages To use the sharing features ...

  17. 76 FR 65935 - National Poultry Improvement Plan and Auxiliary Provisions; Correction

    Science.gov (United States)

    2011-10-25

    .... APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions; Correction... Poultry Improvement Plan (the Plan) and its auxiliary provisions by providing new or modified sampling and testing procedures for Plan participants and participating flocks. We also amended the regulations in 9...

  18. Dummy auxiliaries in child and adult second language acquisition of Dutch

    NARCIS (Netherlands)

    Blom, W.B.T.; de Korte, S.

    2011-01-01

    In previous research it has been observed that second language (L2) learners of Dutch and German use analytic verbs in contexts where the target language requires synthetic verbs. These analytic verbs consist of a semantically empty auxiliary (dummy auxiliary) that selects a lexical infinitive. In

  19. Modal Auxiliaries and Their Semantic Functions Used by Advanced EFL Learners

    Science.gov (United States)

    Torabiardakani, Najmeh; Khojasteh, Laleh; Shokrpour, Nasrin

    2015-01-01

    Since modal auxiliary verbs have been proved to be one of the most troublesome grammatical structures in English, the researchers of this study decided to do an analysis on the ways in which advanced EFL Iranian students use modal auxiliaries focusing specially on nine modals' semantic functions. Consequently, was conducted based on the following…

  20. 30 CFR 18.22 - Boring-type machines equipped for auxiliary face ventilation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Boring-type machines equipped for auxiliary... AND ACCESSORIES Construction and Design Requirements § 18.22 Boring-type machines equipped for auxiliary face ventilation. Each boring-type continuous-mining machine that is submitted for approval shall...

  1. 14 CFR 33.96 - Engine tests in auxiliary power unit (APU) mode.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Engine tests in auxiliary power unit (APU... TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: AIRCRAFT ENGINES Block Tests; Turbine Aircraft Engines § 33.96 Engine tests in auxiliary power unit (APU) mode. If the engine is designed with a propeller brake which...

  2. Auxiliary Armed Forces and Innovations in Security Governance in Mozambique’s Civil War

    NARCIS (Netherlands)

    Jentzsch, C.

    2017-01-01

    Who rules during the civil war? This article argues that the concept of armed group governance must be expanded to include auxiliary armed forces linked to rebels or the government. Comparing the organization of rebel and government auxiliaries, the article demonstrates that security governance

  3. 77 FR 11421 - Airworthiness Directives; Pratt & Whitney Canada, Auxiliary Power Units

    Science.gov (United States)

    2012-02-27

    ... Canada, Auxiliary Power Units AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... serial numbers of Pratt & Whitney Canada (P&WC) PW901A auxiliary power units (APUs) approved under... address above between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. Fax: 202-493-2251...

  4. Dual Youla parameterization

    DEFF Research Database (Denmark)

    Niemann, Hans Henrik

    2003-01-01

    A different aspect of using the parameterisation of all systems stabilised by a given controller, i.e. the dual Youla parameterisation, is considered. The relation between system change and the dual Youla parameter is derived in explicit form. A number of standard uncertain model descriptions...... are considered and the relation with the dual Youla parameter given. Some applications of the dual Youla parameterisation are considered in connection with the design of controllers and model/performance validation....

  5. Goal programming for cyclical auxiliary police scheduling at UiTM Cawangan Perlis

    Science.gov (United States)

    Mustapar, Wasilatul Effah; Nasir, Diana Sirmayunie Mohd; Nor, Nor Azriani Mohamad; Abas, Sharifah Fhahriyah Syed

    2017-11-01

    Constructing a good and fair schedule for shift workers poses a great challenge as it requires a lot of time and effort. In this study, goal programming has been applied on scheduling to achieve the hard and soft constraints for a cyclical schedule that would ease the head of auxiliary police at building new schedules. To accomplish this goal, shift types were assigned in order to provide a fair schedule that takes into account the auxiliary police's policies and preferences. The model was run using Lingo software. Three out of four goals set for the study were achieved. In addition, the results considered an equal allocation for every auxiliary police, namely 70% for total duty and 30% for the day. Furthermore, the schedule was able to cyclically generate another 10 sets schedule. More importantly, the model has provided unbiased scheduling of auxiliary policies which led to high satisfaction in auxiliary police management.

  6. DUAL TIMELIKE NORMAL AND DUAL TIMELIKE SPHERICAL CURVES IN DUAL MINKOWSKI SPACE

    OpenAIRE

    ÖNDER, Mehmet

    2009-01-01

    Abstract: In this paper, we give characterizations of dual timelike normal and dual timelike spherical curves in the dual Minkowski 3-space and we show that every dual timelike normal curve is also a dual timelike spherical curve. Keywords: Normal curves, Dual Minkowski 3-Space, Dual Timelike curves. Mathematics Subject Classifications (2000): 53C50, 53C40. DUAL MINKOWSKI UZAYINDA DUAL TIMELIKE NORMAL VE DUAL TIMELIKE KÜRESEL EĞRİLER Özet: Bu çalışmada, dual Minkowski 3-...

  7. VLTI First Fringes with Two Auxiliary Telescopes at Paranal

    Science.gov (United States)

    2005-03-01

    World's Largest Interferometer with Moving Optical Telescopes on Track Summary The Very Large Telescope Interferometer (VLTI) at Paranal Observatory has just seen another extension of its already impressive capabilities by combining interferometrically the light from two relocatable 1.8-m Auxiliary Telescopes. Following the installation of the first Auxiliary Telescope (AT) in January 2004 (see ESO PR 01/04), the second AT arrived at the VLT platform by the end of 2004. Shortly thereafter, during the night of February 2 to 3, 2005, the two high-tech telescopes teamed up and quickly succeeded in performing interferometric observations. This achievement heralds an era of new scientific discoveries. Both Auxiliary Telescopes will be offered from October 1, 2005 to the community of astronomers for routine observations, together with the MIDI instrument. By the end of 2006, Paranal will be home to four operational ATs that may be placed at 30 different positions and thus be combined in a very large number of ways ("baselines"). This will enable the VLTI to operate with enormous flexibility and, in particular, to obtain extremely detailed (sharp) images of celestial objects - ultimately with a resolution that corresponds to detecting an astronaut on the Moon. PR Photo 07a/05: Paranal Observing Platform with AT1 and AT2 PR Photo 07b/05: AT1 and AT2 with Open Domes PR Photo 07c/05: Evening at Paranal with AT1 and AT2 PR Photo 07d/05: AT1 and AT2 under the Southern Sky PR Photo 07e/05: First Fringes with AT1 and AT2 PR Video Clip 01/05: Two ATs at Paranal (Extract from ESO Newsreel 15) A Most Advanced Device ESO PR Video 01/05 ESO PR Video 01/05 Two Auxiliary Telescopes at Paranal [QuickTime: 160 x 120 pix - 37Mb - 4:30 min] [QuickTime: 320 x 240 pix - 64Mb - 4:30 min] ESO PR Photo 07a/05 ESO PR Photo 07a/05 [Preview - JPEG: 493 x400 pix - 44k] [Normal - JPEG: 985 x 800 pix - 727k] [HiRes - JPEG: 5000 x 4060 pix - 13.8M] Captions: ESO PR Video Clip 01/05 is an extract from

  8. Snake resonances

    International Nuclear Information System (INIS)

    Tepikian, S.

    1989-01-01

    Siberian Snakes provide a practical means of obtaining polarized proton beams in large accelerators. The effect of snakes can be understood by studying the dynamics of spin precession in an accelerator with snakes and a single spin resonance. This leads to a new class of energy independent spin depolarizing resonances, called snake resonances. In designing a large accelerator with snakes to preserve the spin polarization, there is an added constraint on the choice of the vertical betatron tune due to the snake resonances

  9. Multiphoton resonances

    International Nuclear Information System (INIS)

    Shore, B.W.

    1977-01-01

    The long-time average of level populations in a coherently-excited anharmonic sequence of energy levels (e.g., an anharmonic oscillator) exhibits sharp resonances as a function of laser frequency. For simple linearly-increasing anharmonicity, each resonance is a superposition of various multiphoton resonances (e.g., a superposition of 3, 5, 7, . . . photon resonances), each having its own characteristic width predictable from perturbation theory

  10. LOX/hydrocarbon auxiliary propulsion for the Space Shuttle Orbiter

    Science.gov (United States)

    Orton, G. F.; Mark, T. D.

    1982-01-01

    The completed phases of a study evaluating LOX/hydrocarbon auxiliary propulsion system concepts for a second generation Space Shuttle Orbital Maneuvering Subsystem (OMS) and Reaction Control Subsystem (RCS) are presented. The results of the preliminary system evaluation phase are summarized, and efforts regarding the in-depth system evaluation phase are described. Ethanol and methane are considered to be the best fuel candidates as both are non-coking, non-corrosive, and offer high performance capability. Ethanol affords the highest dV and total impulse capability because of its high density-specific impulse product, while methane affords the lowest system wet weight when the system is sized for a fixed dV or total impulse requirement. The LOX/ethanol system allows the use of a simple non-insulated RCS feed system, and is the most attractive LOX/hydrocarbon OMS-RCS. Its operational costs would be substantially less than the current N2O4/MMH system.

  11. A magnetorheological clutch for efficient automotive auxiliary device actuation

    Directory of Open Access Journals (Sweden)

    F. Bucchi

    2013-01-01

    Full Text Available In this paper the results of a project funded by Regione Toscana aimed at reducing the power absorption of auxiliary devices in vehicles are presented. In particular the design, testing and application of a magnetorheological clutch (MR is proposed, aimed at disengaging the vacuum pump, which draws in air from the power-brake booster chamber, in order to reduce the device power absorption. Several clutch preliminary studies done to choose the clutch geometry and the magnetic field supply are illustrated. The final choice consisted in an MR clutch with permanent magnet, which satisfied size, torque and fail-safe specifications. The clutch characteristics, in terms of torque versus slip, were obtained experimentally for three different clutch prototypes on an ad-hoc developed test bench.As result of a preliminary simulation, a comparison between the power absorption of a current production vacuum pump, an innovative vacuum pump and both vacuum pumps coupled with the MR clutch is presented. The New European Driving Cycle is considered for simulating the vacuum pump operation both in urban and highway driving. Results show that the use of the innovative vacuum pump reduces the device consumption of about 35%, whereas the use of MR clutch coupled with the innovative vacuum pump reduces it up to about 44% in urban driving and 50% in highway driving.

  12. Neutral particle diagnostics for ohmically and auxiliary heated tokamaks

    International Nuclear Information System (INIS)

    Wagner, F.

    1982-01-01

    Protons and hydrogen atoms in a plasma undergo charge-exchange collisions which give rise to an energetic charge-exchange flux emerging from the plasma. The intensity and energy distribution of the charge-exchange flux is measured separately for hydrogen or deuterium. Besides discussing the basic principles and the experimental techniques, this report concentrates on plasma characteristics accessible to neutral particle diagnostics. From the energy distribution of the charge exchange flux, the ion energy distribution can be inferred. In the case of a thermal plasma the measurement of the ion temperature profile allows the analysis of the ion energy transport, and with auxiliary heating the ion heating efficiency can be estimated. From the absolute intensity of the charge-exchange flux the hydrogen atom density can be determined; strong toroidal variation, with sharp increases at limiter and gas input valve, is observed. The atom flux which leaves the plasma hits the wall and forms one branch of plasma wall interaction which can be investigated by measuring the backscattering of neutrals from the wall and by analyzing the wall sputtering due to charge-exchange atoms. Neutral particle diagnostics carried out in the divertor chamber of a divertor tokamak reveal strong plasma wall interaction at the neutralizer plate

  13. Seismic qualification of PWR plant auxiliary feedwater systems

    International Nuclear Information System (INIS)

    Lu, S.C.; Tsai, N.C.

    1983-08-01

    The NRC Standard Review Plan specifies that the auxiliary feedwater (AFW) system of a pressurized water reactor (PWR) is a safeguard system that functions in the event of a Safe Shutdown Earthquake (SSE) to remove the decay heat via the steam generator. Only recently licensed PWR plants have an AFW system designed to the current Standard Review Plan specifications. The NRC devised the Multiplant Action Plan C-14 in order to make a survey of the seismic capability of the AFW systems of operating PWR plants. The purpose of this survey is to enable the NRC to make decisions regarding the need of requiring the licensees to upgrade the AFW systems to an SSE level of seismic capability. To implement the first phase of the C-14 plan, the NRC issued a Generic Letter (GL) 81-14 to all operating PWR licensees requesting information on the seismic capability of their AFW systems. This report summarizes Lawrence Livermore National Laboratory's efforts to assist the NRC in evaluating the status of seismic qualification of the AFW systems in 40 PWR plants, by reviewing the licensees' responses to GL 81-14

  14. Simulation of a passive auxiliary feedwater system with TRACE5

    Energy Technology Data Exchange (ETDEWEB)

    Lorduy, María; Gallardo, Sergio; Verdú, Gumersindo, E-mail: maloral@upv.es, E-mail: sergalbe@iqn.upv.es, E-mail: gverdu@iqn.upv.es [Instituto Universitario de Seguridad Industrial, Radiofísica y Medioambiental (ISIRYM), València (Spain)

    2017-07-01

    The study of the nuclear power plant accidents occurred in recent decades, as well as the probabilistic risk assessment carried out for this type of facility, present human error as one of the main contingency factors. For this reason, the design and development of generation III, III+ and IV reactors, which include inherent and passive safety systems, have been promoted. In this work, a TRACE5 model of ATLAS (Advanced Thermal- Hydraulic Test Loop for Accident Simulation) is used to reproduce an accidental scenario consisting in a prolonged Station BlackOut (SBO). In particular, the A1.2 test of the OECD-ATLAS project is analyzed, whose purpose is to study the primary system cooling by means of the water supply to one of the steam generators from a Passive Auxiliary Feedwater System (PAFS). This safety feature prevents the loss of secondary system inventory by means of the steam condensation and its recirculation. Thus, the conservation of a heat sink allows the natural circulation flow rate until restoring stable conditions. For the reproduction of the test, an ATLAS model has been adapted to the experiment conditions, and a PAFS has been incorporated. >From the simulation test results, the main thermal-hydraulic variables (pressure, flow rates, collapsed water level and temperature) are analyzed in the different circuits, contrasting them with experimental data series. As a conclusion, the work shows the TRACE5 code capability to correctly simulate the behavior of a passive feedwater system. (author)

  15. Auxiliary antenna-assisted interference mitigation for radio astronomy arrays

    Science.gov (United States)

    Jeffs, B. D.; Li, L.; Warnick, K. F.

    2005-02-01

    Interferometric image synthesis in radio astronomy is plagued by signal corruption from man-made sources. The very weak signals of interest can be overwhelmed by such interference. Recent work has proposed using array signal processing techniques of adaptive beamforming, adaptive filtering, and subspace projection to remove interference prior to image synthesis. In some practical scenarios, we have found poor cancellation performance when using such methods. Because signal-of-interest levels in radio astronomy (RA) are usually well below the noise, even interference to noise ratios (INR) less than unity can affect signal estimation. At these low INRs, it is difficult to estimate interference parameters or statistics with sufficient accuracy for high-performance adaptive cancellation or subspace projection. By adding a few (one to three) low-gain (relative to the primary telescope dishes) "auxiliary" antennas to an array, it is possible to overcome this problem. This paper will show that using such antennas (e.g. commercial-grade 3-m dishes) with an existing array can significantly improve interference rejection. New extensions to subspace projection spatial filtering methods are presented, along with analytical and simulated results for performance comparison.

  16. 849 RESONANCE | September 2013

    Indian Academy of Sciences (India)

    IAS Admin

    849. RESONANCE | September 2013. Page 2. 850. RESONANCE | September 2013. Page 3. 851. RESONANCE | September 2013. Page 4. 852. RESONANCE | September 2013. Page 5. 853. RESONANCE | September 2013. Page 6. 854. RESONANCE | September 2013. Page 7. 855. RESONANCE | September 2013.

  17. Evaluation of Transmission Grid Voltage Impact on the Operation of Power Units’ Auxiliary Systems

    Directory of Open Access Journals (Sweden)

    Józef Paska

    2015-12-01

    Full Text Available This paper presents the low voltage impact on the operation of critical auxiliaries of selected generation units in the national power system. Time limits are determined for the operation of these auxiliaries at low voltage in the power system and the acceptable reduced voltages in their secondary circuits at which the generation unit is capable of interoperation with the system. Upgrades of auxiliary systems are proposed which would enable interoperation of the unit and the system at significantly reduced system voltages.

  18. Self-patching firmware program. [Method of branching to auxiliary program without hardware or software modification

    Energy Technology Data Exchange (ETDEWEB)

    Stanchi, L.

    1976-12-01

    A method of branching to an auxiliary program without any hardware or software modification at the time the auxiliary program will be written is described. Suitable statements in the main program are already prepared to accept a future program that will be written in machine language. The main program is stored as firmware in PROM memory, while the auxiliary program is loaded into RAM memory. The method is described for the Intel 8080 microprocessor, but can be generalized for any microprocessor or minicomputer that uses ROMs or PROMs. 1 figure, 2 tables.

  19. Auxiliary System Load Schemes in Large Thermal and Nuclear Power Plants

    International Nuclear Information System (INIS)

    Kuzle, I.; Bosnjak, D.; Pandzic, H.

    2010-01-01

    Uninterrupted auxiliary system power supply in large power plants is a key factor for normal operation, transient states, start-ups and shutdowns and particularly during fault conditions. Therefore, there are many challenges in designing the main electrical system as well as the auxiliary systems power supply. Depending upon the type of fuel used and the environmental control system required, a thermal power plant may consume as much as 10% of its total generation for auxiliary power, while a nuclear power plant may require only 4 - 6% auxiliaries. In general, the larger the power generating plant, the higher the voltage selected for the AC auxiliary electric system. Most stations in the 75 to 500 MW range utilize 4,2 kV as the base auxiliary system voltage. Large generating stations 500 - 1000 MW and more use voltage levels of 6,9 kV and more. Some single dedicated loads such as electric driven boiler feed pumps are supplied ba a 13,8 kV bus. While designing the auxiliary electric system, the following areas must be considered: motor starting requirements, voltage regulation requirements, short-circuit duty requirements, economic considerations, reliability and alternate sources. Auxiliary power supply can't be completely generalized and each situation should be studied on its own merits to determine the optimal solution. Naturally, nuclear power plants have more reliability requirements and safety design criteria. Main coolant-pump power supply and continuity of service to other vital loads deserve special attention. This paper presents an overview of some up-to-date power plant auxiliary load system concepts. The main types of auxiliary loads are described and the electric diagrams of the modern auxiliary system supply concepts are given. Various alternative sources of auxiliary electrical supply are considered, the advantages and disadvantages of these are compared and proposals are made for high voltage distribution systems around the thermal and nuclear plant

  20. Capacitance of circular patch resonator

    International Nuclear Information System (INIS)

    Miano, G.; Verolino, L.; Naples Univ.; Panariello, G.; Vaccaro, V.G.; Naples Univ.

    1995-11-01

    In this paper the capacitance of the circular microstrip patch resonator is computed. It is shown that the electrostatic problem can be formulated as a system of dual integral equations, and the most interesting techniques of solutions of these systems are reviewed. Some useful approximated formulas for the capacitance are derived and plots of the capacitance are finally given in a wide range of dielectric constants

  1. Detection of global and local parameter variations using nonlinear feedback auxiliary signals and system augmentation

    Science.gov (United States)

    D'Souza, Kiran; Epureanu, Bogdan I.

    2010-06-01

    Recently, system augmentation has been combined with nonlinear feedback auxiliary signals to provide sensitivity enhancement in both linear and nonlinear systems. Augmented systems are higher dimensional linear systems that follow trajectories of a nonlinear system one at a time. These augmented systems are subject to a specialized augmented forcing which enforces the augmented system to exactly reproduce the trajectory of the nonlinear system when projected onto the lower dimensional (physical) system. Augmented systems have additional benefits outside of handling nonlinear systems, which makes them more desirable than regular linear systems for sensitivity enhancing control. One of the key advantages of augmented systems is the complete control over the augmented degrees of freedom, and the additional sensor-type knowledge from the augmented variables. These sensing and actuation features are very useful when only few physical actuators and sensors can be placed. Such restrictions are common in most applications, and they severely limit the usefulness of traditional linear sensitivity enhancing feedback approaches. Another benefit of the augmentation is that the control exerted on the augmented degrees of freedom does not require any physical energy, rather it is just signal processing. In this work, these benefits are refined to improve the robustness of detection using sensitivity enhancement. Also, the benefits of system augmentation are explored by using few actuators and sensors. An optimization algorithm is employed not only to maximize the sensitivity of resonant frequencies to added mass at particular locations, but also to detect uniform changes in mass and stiffness. In addition to increased sensitivity for both global and local parameter changes, a study of increasing the sensitivity of local changes, while decreasing the sensitivity of global changes is conducted. Additionally, a methodology is presented to accurately extract augmented frequencies

  2. Dual Supervised Learning

    OpenAIRE

    Xia, Yingce; Qin, Tao; Chen, Wei; Bian, Jiang; Yu, Nenghai; Liu, Tie-Yan

    2017-01-01

    Many supervised learning tasks are emerged in dual forms, e.g., English-to-French translation vs. French-to-English translation, speech recognition vs. text to speech, and image classification vs. image generation. Two dual tasks have intrinsic connections with each other due to the probabilistic correlation between their models. This connection is, however, not effectively utilized today, since people usually train the models of two dual tasks separately and independently. In this work, we p...

  3. Dual Income Taxes

    DEFF Research Database (Denmark)

    Sørensen, Peter Birch

    This paper discusses the principles and practices of dual income taxation in the Nordic countries. The first part of the paper explains the rationale and the historical background for the introduction of the dual income tax and describes the current Nordic tax practices. The second part...... of the paper focuses on the problems of taxing income from small businesses and the issue of corporate-personal tax integration under the dual income tax, considering alternative ways of dealing with these challenges. In the third and final part of the paper, I briefly discuss whether introducing a dual income...

  4. Analysis of Heat Transfers inside Counterflow Plate Heat Exchanger Augmented by an Auxiliary Fluid Flow

    Science.gov (United States)

    Khaled, A.-R. A.

    2014-01-01

    Enhancement of heat transfers in counterflow plate heat exchanger due to presence of an intermediate auxiliary fluid flow is investigated. The intermediate auxiliary channel is supported by transverse conducting pins. The momentum and energy equations for the primary fluids are solved numerically and validated against a derived approximate analytical solution. A parametric study including the effect of the various plate heat exchanger, and auxiliary channel dimensionless parameters is conducted. Different enhancement performance indicators are computed. The various trends of parameters that can better enhance heat transfer rates above those for the conventional plate heat exchanger are identified. Large enhancement factors are obtained under fully developed flow conditions. The maximum enhancement factors can be increased by above 8.0- and 5.0-fold for the step and exponential distributions of the pins, respectively. Finally, counterflow plate heat exchangers with auxiliary fluid flows are recommended over the typical ones if these flows can be provided with the least cost. PMID:24719572

  5. 14 CFR 23.1549 - Powerplant and auxiliary power unit instruments.

    Science.gov (United States)

    2010-01-01

    ... radial or a red line; (b) Each normal operating range must be marked with a green arc or green line, not... marked with a yellow arc or a yellow line; and (d) Each engine, auxiliary power unit, or propeller range...

  6. 14 CFR 25.1549 - Powerplant and auxiliary power unit instruments.

    Science.gov (United States)

    2010-01-01

    ...) Each normal operating range must be marked with a green arc or green line, not extending beyond the... or a yellow line; and (d) Each engine, auxiliary power unit, or propeller speed range that is...

  7. Ocean Surface Topography Mission (OSTM) /Jason-2: Auxiliary Files (NODC Accession 0044983)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the data descriptions for the OSTM/Jason-2 Auxiliary data files, which is served through the NOAA/NESDIS Comprehensive Large Array-data...

  8. Derived Requirements for Double Shell Tank (DST) High Level Waste (HLW) Auxiliary Solids Mobilization

    Energy Technology Data Exchange (ETDEWEB)

    TEDESCHI, A.R.

    2000-02-28

    The potential need for auxiliary double-shell tank waste mixing and solids mobilization requires an evaluation of optional technologies. This document formalizes those operating and design requirements needed for further engineering evaluations.

  9. Analysis of heat transfers inside counterflow plate heat exchanger augmented by an auxiliary fluid flow.

    Science.gov (United States)

    Khaled, A-R A

    2014-01-01

    Enhancement of heat transfers in counterflow plate heat exchanger due to presence of an intermediate auxiliary fluid flow is investigated. The intermediate auxiliary channel is supported by transverse conducting pins. The momentum and energy equations for the primary fluids are solved numerically and validated against a derived approximate analytical solution. A parametric study including the effect of the various plate heat exchanger, and auxiliary channel dimensionless parameters is conducted. Different enhancement performance indicators are computed. The various trends of parameters that can better enhance heat transfer rates above those for the conventional plate heat exchanger are identified. Large enhancement factors are obtained under fully developed flow conditions. The maximum enhancement factors can be increased by above 8.0- and 5.0-fold for the step and exponential distributions of the pins, respectively. Finally, counterflow plate heat exchangers with auxiliary fluid flows are recommended over the typical ones if these flows can be provided with the least cost.

  10. Precision control of high temperature furnaces using an auxiliary power supply and charged particle current flow

    Science.gov (United States)

    Pollock, G.G.

    1997-01-28

    Two power supplies are combined to control a furnace. A main power supply heats the furnace in the traditional manner, while the power from the auxiliary supply is introduced as a current flow through charged particles existing due to ionized gas or thermionic emission. The main power supply provides the bulk heating power and the auxiliary supply provides a precise and fast power source such that the precision of the total power delivered to the furnace is improved. 5 figs.

  11. Precision control of high temperature furnaces using an auxiliary power supply and charged practice current flow

    Science.gov (United States)

    Pollock, George G.

    1997-01-01

    Two power supplies are combined to control a furnace. A main power supply heats the furnace in the traditional manner, while the power from the auxiliary supply is introduced as a current flow through charged particles existing due to ionized gas or thermionic emission. The main power supply provides the bulk heating power and the auxiliary supply provides a precise and fast power source such that the precision of the total power delivered to the furnace is improved.

  12. Dual quaternions and dual projective spaces

    Energy Technology Data Exchange (ETDEWEB)

    Ata, Erhan [Department of Mathematics, Dumlupinar University, 43100 Kutahya (Turkey)], E-mail: eata@dumlupinar.edu.tr; Yayli, Yusuf [Department of Mathematics, Ankara University, 06100 Ankara (Turkey)

    2009-05-15

    In this study, dual unitary matrices SU{sub D}(2) were obtained. We correspond to one to one elements of the unit dual sphere S{sub D}{sup 3} with the dual unitary matrices SU{sub D}(2). Thus, we express spherical concepts such as meridians of longitude and parallels of latitude on SU{sub D}(2). The equality SO(R{sup 3}) {approx_equal} S{sup 3}/{l_brace}{+-}1{r_brace} = RP{sup 3} known as the real projective spaces was generalized to the dual projective space and then, the equality SO(D{sup 3}){approx_equal}S{sub D}{sup 3}/{l_brace}{+-}1{r_brace}=DP{sup 3} was acquired. In particular, 2-sphere S{sup 2} was obtained by considering dual parts as zero of S{sub D}{sup 3}. Hence, it was found that Hop fibriation map of S{sup 2} can be used for Twistors in quantum mechanics applications.

  13. Synchrobetatron resonances

    International Nuclear Information System (INIS)

    1977-03-01

    At the 1975 Particle Accelerator Conference it was reported that a class of resonances were observed in SPEAR II that had not appeared before in SPEAR I. While the existence of sideband resonances of the main betatron oscillation frequencies has been previously observed and analyzed, the resonances observed in SPEAR do not appear to be of the same variety. Experiments were performed at SPEAR to identify the mechanism believed to be the most likely explanation. Some of the current experimental knowledge and theoretical views on the source of these resonances are presented

  14. Snake resonances

    International Nuclear Information System (INIS)

    Tepikian, S.

    1988-01-01

    Siberian Snakes provide a practical means of obtaining polarized proton beams in large accelerators. The effect of snakes can be understood by studying the dynamics of spin precession in an accelerator with snakes and a single spin resonance. This leads to a new class of energy independent spin depolarizing resonances, called snake resonances. In designing a large accelerator with snakes to preserve the spin polarization, there is an added constraint on the choice of the vertical betatron tune due to the snake resonances. 11 refs., 4 figs

  15. Disturbance in the power system caused by auxiliary DC installation failure of switchyard

    Energy Technology Data Exchange (ETDEWEB)

    Mesic, M. [HEP Transmission System Operator, Zagreb (Croatia); Tesnjak, S.; Skok, S. [Zagreb Univ. (Croatia). Faculty of Electrical Engineering and Computing

    2008-07-01

    Auxiliary direct current (DC) installation failures can lead to outages in power plants and compromise the security of power systems. In this study, a simplified stationary model was used to simulate an auxiliary DC installation in a switchyard. The aim of the study was to evaluate new International Electrotechnical Commission (IEC) standards for auxiliary DC installation dimensioning and analysis. Criteria included the dimensioning and selection of batteries; the calculation of conductor heating; voltage drop calculations; conductor squares in relation to permanent currents; and the evaluation of protection elements. The new standards were compared with the previous auxiliary system installation methodology. Results of the study suggested that the new standard has introduced significant improvements in short circuit current calculation. Laboratory tests for the measurement of short circuits showed that the active network has less of an impact on the auxiliary system than previous measuring methods. Alterations to the IEC standard will be required as a result of limitations to the short circuit current and new rectifier technology. Results of the study will be used to develop a new model and scheme for dimensioning and analyzing auxiliary DC installations. 9 refs., 4 tabs., 5 figs.

  16. Off-resonance slow light

    Science.gov (United States)

    Shakhmuratov, R. N.; Odeurs, J.

    2008-12-01

    We consider the propagation of a light pulse in a medium with a single resonance. If the frequency of the pulse is tuned far from resonance and the pulse duration is much shorter than the lifetime of the excited state of the resonant particles in the medium (atoms in a gas, impurity ions in a solid, etc.), the group velocity of the pulse is appreciably reduced. It is shown that the slowing down of the group velocity of the pulse is accompanied with a pulse chirp, which produces a pulse broadening in time. It is proposed to use two samples in sequence with opposite chirps (up chirp and down chirp or vice versa) compensating the pulse broadening. Then the pulse can be delayed with almost no losses, distortion, and broadening. However, there is a maximum distance, beyond which the pulse experiences corruption. Pumping with an auxiliary laser beam can control the delay time of the light pulse in the medium. Conditions to eliminate the contribution of the dephasing processes in the pulse propagation are considered.

  17. Dual gravity and matter

    NARCIS (Netherlands)

    Bergshoeff, Eric A.; Roo, Mees de; Kerstan, Sven F.; Kleinschmidt, Axel; Riccioni, Fabio

    We consider the problem of finding a dual formulation of gravity in the presence of non-trivial matter couplings. In the absence of matter a dual graviton can be introduced only for linearised gravitational interactions. We show that the coupling of linearised gravity to matter poses obstructions to

  18. A Dual Egalitarian Solution

    NARCIS (Netherlands)

    Klijn, F.; Slikker, M.; Tijs, S.H.

    2000-01-01

    In this note we introduce an egalitarian solution, called the dual egalitarian solution, that is the natural counterpart of the egalitarian solution of Dutta and Ray (1989).We prove, among others, that for a convex game the egalitarian solution coincides with the dual egalitarian solution for its

  19. Dual Credit Report

    Science.gov (United States)

    Light, Noreen

    2016-01-01

    In 2015, legislation to improve access to dual-credit programs and to reduce disparities in access and completion--particularly for low income and underrepresented students--was enacted. The new law focused on expanding access to College in the High School but acknowledged issues in other dual-credit programs and reinforced the notion that cost…

  20. The Dual Career Family.

    Science.gov (United States)

    Gurtin, Lee

    1980-01-01

    The dual career couple is forced to make a series of choices and compromises that impact the realms of marriage and career. The dilemmas that confront dual career marriages can be overcome only by compromise, accommodation, and mutual understanding on the part of the individuals involved. A revamping of human resources and recruitment programs is…

  1. Photothermal resonance

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to a method for detecting photo-thermal absorbance of a material utilising a mechanically temperature sensitive resonator (20) and a sample being arrange in thermal communication with the temperature sensitive resonator. The present invention further relates...

  2. Role stress among auxiliary nurses midwives in Gujarat, India.

    Science.gov (United States)

    Purohit, Bhaskar; Vasava, Paul

    2017-01-23

    Understanding Role Stress is important as health service providers, especially nurses experience high levels of Role Stress which is linked to burnout, poor quality of care and high turnover. The current study explicates the concept of Role Stress and assesses the Role Stress experienced by the Auxiliary Nurse Midwives (ANMs) working with rural government health centres from Gujarat, India. The study included 84 ANMs working with government health centres from one district in India. A structured instrument with established reliability and validity was used to measure 10 dimensions of Role Stress namely: Inter-role distance, role stagnation, role expectation conflict, role erosion: role overload, role isolation, personal inadequacy, self-role distance, role ambiguity and resource inadequacy. The study instrument was based on 5 point Likert rating scale that contained 50 unidirectional negative statements, 5 for each dimension. Kolmogorov-Smirnov and Shapiro-Wilk test were carried out to assess if the data were normally distributed. Cronbach's alpha test was carried out to assess reliability of the instrument. The study data was analyzed using descriptive statistics mainly using mean scores with higher scores indicating higher Role Stress and vice versa. The data was analyzed using SPSS version 19. Kolmogorov-Smirnov and Shapiro-Wilk test indicated that the data were normally distributed. Cronbach's alpha test indicated values of 0.852 suggesting high reliability of the tool. The highest Role Stress among ANMs was experienced for resource inadequacy. Role overload, role stagnation and inter-role distance were among the other important role stressors for ANMs. The study results suggests that ANMs frequently feel that: they do not have adequate amount of resources, facilities and financial support from the high levels authorities; people have too many expectations from their roles and as result they are overloaded with work and have very limited opportunities for

  3. Nonlinear resonances

    CERN Document Server

    Rajasekar, Shanmuganathan

    2016-01-01

    This introductory text presents the basic aspects and most important features of various types of resonances and anti-resonances in dynamical systems. In particular, for each resonance, it covers the theoretical concepts, illustrates them with case studies, and reviews the available information on mechanisms, characterization, numerical simulations, experimental realizations, possible quantum analogues, applications and significant advances made over the years. Resonances are one of the most fundamental phenomena exhibited by nonlinear systems and refer to specific realizations of maximum response of a system due to the ability of that system to store and transfer energy received from an external forcing source. Resonances are of particular importance in physical, engineering and biological systems - they can prove to be advantageous in many applications, while leading to instability and even disasters in others. The book is self-contained, providing the details of mathematical derivations and techniques invo...

  4. Loss Model and Efficiency Analysis of Tram Auxiliary Converter Based on a SiC Device

    Directory of Open Access Journals (Sweden)

    Hao Liu

    2017-12-01

    Full Text Available Currently, the auxiliary converter in the auxiliary power supply system of a modern tram adopts Si IGBT as its switching device and with the 1700 V/225 A SiC MOSFET module commercially available from Cree, an auxiliary converter using all SiC devices is now possible. A SiC auxiliary converter prototype is developed during this study. The author(s derive the loss calculation formula of the SiC auxiliary converter according to the system topology and principle and each part loss in this system can be calculated based on the device datasheet. Then, the static and dynamic characteristics of the SiC MOSFET module used in the system are tested, which aids in fully understanding the performance of the SiC devices and provides data support for the establishment of the PLECS loss simulation model. Additionally, according to the actual circuit parameters, the PLECS loss simulation model is set up. This simulation model can simulate the actual operating conditions of the auxiliary converter system and calculate the loss of each switching device. Finally, the loss of the SiC auxiliary converter prototype is measured and through comparison it is found that the loss calculation theory and PLECS loss simulation model is valuable. Furthermore, the thermal images of the system can prove the conclusion about loss distribution to some extent. Moreover, these two methods have the advantages of less variables and fast calculation for high power applications. The loss models may aid in optimizing the switching frequency and improving the efficiency of the system.

  5. Dual Credit/Dual Enrollment and Data Driven Policy Implementation

    Science.gov (United States)

    Lichtenberger, Eric; Witt, M. Allison; Blankenberger, Bob; Franklin, Doug

    2014-01-01

    The use of dual credit has been expanding rapidly. Dual credit is a college course taken by a high school student for which both college and high school credit is given. Previous studies provided limited quantitative evidence that dual credit/dual enrollment is directly connected to positive student outcomes. In this study, predictive statistics…

  6. Dual energy CT

    DEFF Research Database (Denmark)

    Al-Najami, Issam; Drue, Henrik Christian; Steele, Robert

    2017-01-01

    and inaccurate with existing methods. Dual Energy Computed Tomography (DECT) enables qualitative tissue differentiation by simultaneous scanning with different levels of energy. We aimed to assess the feasibility of DECT in quantifying tumor response to neoadjuvant therapy in loco-advanced rectal cancer. METHODS...... to determine the average quantitative parameters; effective-Z, water- and iodine-concentration, Dual Energy Index (DEI), and Dual Energy Ratio (DER). These parameters were compared to the regression in the resection specimen as measured by the pathologist. RESULTS: Changes in the quantitative parameters...

  7. Total synthesis of cytochrome b562 by native chemical ligation using a removable auxiliary

    Science.gov (United States)

    Low, Donald W.; Hill, Michael G.; Carrasco, Michael R.; Kent, Stephen B. H.; Botti, Paolo

    2001-01-01

    We have completed the total chemical synthesis of cytochrome b562 and an axial ligand analogue, [SeMet7]cyt b562, by thioester-mediated chemical ligation of unprotected peptide segments. A novel auxiliary-mediated native chemical ligation that enables peptide ligation to be applied to protein sequences lacking cysteine was used. A cleavable thiol-containing auxiliary group, 1-phenyl-2-mercaptoethyl, was added to the α-amino group of one peptide segment to facilitate amide bond-forming ligation. The amine-linked 1-phenyl-2-mercaptoethyl auxiliary was stable to anhydrous hydrogen fluoride used to cleave and deprotect peptides after solid-phase peptide synthesis. Following native chemical ligation with a thioester-containing segment, the auxiliary group was cleanly removed from the newly formed amide bond by treatment with anhydrous hydrogen fluoride, yielding a full-length unmodified polypeptide product. The resulting polypeptide was reconstituted with heme and folded to form the functional protein molecule. Synthetic wild-type cyt b562 exhibited spectroscopic and electrochemical properties identical to the recombinant protein, whereas the engineered [SeMet7]cyt b562 analogue protein was spectroscopically and functionally distinct, with a reduction potential shifted by ≈45 mV. The use of the 1-phenyl-2-mercaptoethyl removable auxiliary reported here will greatly expand the applicability of total protein synthesis by native chemical ligation of unprotected peptide segments. PMID:11390992

  8. Design and Experiment of Auxiliary Bearing for Helium Blower of HTR-PM

    International Nuclear Information System (INIS)

    Yang Guojun; Shi Zhengang; Liu Xingnan; Zhao Jingjing

    2014-01-01

    The helium blower is the important equipment for HTR-PM. Active magnetic bearing (AMB) instead of mechanical bearing is selected to support the rotor of the helium blower. However, one implication of AMB is the requirement to provide the auxiliary bearing to mitigate the effects of failures or overload conditions. The auxiliary bearing is used to support the rotor when the AMB fails to work. It must support the dropping rotor and bear the great impact force and friction heat. The design of the auxiliary bearing is one of the challenging problems in the whole system. It is very important for the helium blower with AMB of HTR-PM to make success. The rotor’s length of helium blower of HTR-PM is about 3.3 m, its weight is about 4000 kg and the rotating speed is 4000 r/min. The axial load is 4500kg, and the radial load is 1950kg. The angular contact ball bearing was selected as the auxiliary bearing. The test rig has been finished. It is difficult to analyze the falling course of the rotor. The preliminary analysis of the dropping rotor was done in the special condition. The impact force of auxiliary bearing was computed for the axial and radial load. And the dropping test of the blower rotor for HTR-10 will be introduced also in this paper. Results offer the important theoretical base for the protector design of the helium blower with AMB for HTR-PM. (author)

  9. Auxiliary Linear Problem, Difference Fay Identities and Dispersionless Limit of Pfaff-Toda Hierarchy

    Directory of Open Access Journals (Sweden)

    Kanehisa Takasaki

    2009-12-01

    Full Text Available Recently the study of Fay-type identities revealed some new features of the DKP hierarchy (also known as ''the coupled KP hierarchy'' and ''the Pfaff lattice''. Those results are now extended to a Toda version of the DKP hierarchy (tentatively called ''the Pfaff-Toda hierarchy''. Firstly, an auxiliary linear problem of this hierarchy is constructed. Unlike the case of the DKP hierarchy, building blocks of the auxiliary linear problem are difference operators. A set of evolution equations for dressing operators of the wave functions are also obtained. Secondly, a system of Fay-like identities (difference Fay identities are derived. They give a generating functional expression of auxiliary linear equations. Thirdly, these difference Fay identities have well defined dispersionless limit (dispersionless Hirota equations. As in the case of the DKP hierarchy, an elliptic curve is hidden in these dispersionless Hirota equations. This curve is a kind of spectral curve, whose defining equation is identified with the characteristic equation of a subset of all auxiliary linear equations. The other auxiliary linear equations are related to quasi-classical deformations of this elliptic spectral curve.

  10. Awareness of biomedical waste management among dental professionals and auxiliary staff in Amritsar, India.

    Science.gov (United States)

    Narang, Ramandeep S; Manchanda, Adesh; Singh, Simarpreet; Verma, Nitin; Padda, Sarfaraz

    2012-12-01

    The aim of this study was to determine awareness of biomedical waste (BMW) management policies and practices among dental professionals and auxiliary staff in a dental hospital/clinics in Amritsar, India, to inform the development of future policies for effective implementation of BMW rules. The study involved 160 staff members at the Amritsar hospital/clinics (80 dentists and 80 auxiliary staff) to whom a questionnaire was distributed regarding policies, practices and awareness relating to BMW. The questionnaire was first piloted. Completed questionnaires were returned anonymously. The resulting data were statistically tested using the chi-square test for differences between the dentists and auxiliary staff. In respect of BMW management policies, there was a highly significant difference in the responses of the dentists, whose answers suggested far greater knowledge than that of the auxiliaries (Pmanagement practices, the dentists were significantly more aware (Pwaste collection in the hospital and the disposal of various items into different colour-coded bags. As for employee education/awareness, there was a significant difference (Pmanagement among dental auxiliary staff in the dental hospital/clinics in Amritsar and a lack of awareness of some aspects among dentists who work in the hospital/clinics. The results provide the hospital authorities with data upon which they can develop a strategy for improving BMW management.

  11. Decision making by auxiliary nurses to assess postpartum bleeding in a Dominican Republic maternity ward.

    Science.gov (United States)

    Foster, Jennifer; Regueira, Yadira; Heath, AnneMarie

    2006-01-01

    To understand the process of decision making by auxiliary nurses regarding postpartum bleeding among women in the Dominican Republic. An ethnographic qualitative design of semistructured interviews and participant observation. Twenty four auxiliary nurses on a maternity unit of a referral hospital in the Dominican Republic. Auxiliary nurses use specific criteria and logic to decide if postpartum maternal bleeding is excessive. However, systematic postpartum assessments are not routinely conducted on every woman. A decision tree that traces how auxiliary nurses evaluate postpartum bleeding indicates that they have knowledge of contemporary obstetric nursing care, but the organization of care delivery is not structured for them to apply it routinely. A collaboration of U.S. midwives and Dominican nurses will build on the assets of the auxiliary nurses. Rather than focusing the content of educational conferences on current knowledge of labor and delivery, an important next step is modeling woman- and family-centered care. The U.S. midwives and Dominican nurses are committed to finding empowering and effective ways to improve maternity care.

  12. Environmental practices of the auxiliary companies to the Spanish automobile industry

    Science.gov (United States)

    González-Torre, Pilar L.; González, Beatriz A.; Gupta, Surendra M.

    2005-11-01

    The automobile manufacturing industry plays a very important role in a country's economy. The importance of automobile manufacturing industry lies in its sheer size and complexity in terms of the direct and indirect influence it commands across many other industries. While millions of people are employed in the automobile manufacturing industry, it is estimated that more than two and half times that number are employed in the auxiliary companies that supply parts to the automobile manufacturing companies. The auxiliary companies represent a group of businesses of various sizes, types, and geographical locations, producing a vast variety of products ranging from the very simple to the extremely intricate. In this study, the current environmental practices of management in the core Spanish auxiliary companies that do business with the automobile manufacturing industry (and thus form a large part of the automobile manufacturing industry's supply chain) are investigated. We show that while automobile manufacturing companies are under scrutiny to become more and more environmentally friendly, not only at their manufacturing stage but also at their products' useful and EOL stages, there appears to be no such burden on the auxiliary companies. Our conclusion is based on an elaborate survey conducted during the fall of 2004 of Spanish auxiliary companies with questions about the characteristics, environmental practices and reverse logistics related activities carried out by the companies.

  13. 30 CFR 57.22208 - Auxiliary fans (I-A, II-A, III, and V-A mines).

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-A, II-A, III, and V-A mines... fans (I-A, II-A, III, and V-A mines). (a) Auxiliary fans, except fans used in shops and other areas... applicable requirements of 30 CFR part 18, and be operated so that recirculation is minimized. Auxiliary fans...

  14. Dual Dynamic Programming - DDP

    International Nuclear Information System (INIS)

    Velasquez Bermudez, Jesus M

    1998-01-01

    Objections are presented to the mathematical formulation of the denominated Dual Dynamic programming-PDD that is the theoretical base of several computational model available for the optimal formulation of interconnected hydrothermal systems

  15. Treatment for chronic daily headache by using auxiliary and alternative methods

    Directory of Open Access Journals (Sweden)

    V. A. Golovacheva

    2015-01-01

    Full Text Available Chronic daily headache (CDH is one of the top 10 causes of adult disability and one of the 5 most common causes of female disability. To treat patients with CDH is one of the most difficult tasks in neurological practice. Difficulties in managing patients with CHD are associated with the high prevalence of comorbid mental disorders, analgesic abuse, pain syndromes at another site, and misconceptions of a patient about his/her disease. A combination of drug and non-drug therapies is the mainstay of the current approach to treating patients with CDH. Standard, alternative, and auxiliary therapies are identified. The paper describes different types of current auxiliary and alternative therapy used in the world’s leading headache centers and clinics. It describes experience with cerebrolysin used as auxiliary and alternative pharmacotherapies for CDH.

  16. Terminal Sliding Mode Control with Unidirectional Auxiliary Surfaces for Hypersonic Vehicles Based on Adaptive Disturbance Observer

    Directory of Open Access Journals (Sweden)

    Naibao He

    2015-01-01

    Full Text Available A novel flight control scheme is proposed using the terminal sliding mode technique, unidirectional auxiliary surfaces and the disturbance observer model. These proposed dynamic attitude control systems can improve control performance of hypersonic vehicles despite uncertainties and external disturbances. The terminal attractor is employed to improve the convergence rate associated with the critical damping characteristics problem noted in short-period motions of hypersonic vehicles. The proposed robust attitude control scheme uses a dynamic terminal sliding mode with unidirectional auxiliary surfaces. The nonlinear disturbance observer is designed to estimate system uncertainties and external disturbances. The output of the disturbance observer aids the robust adaptive control scheme and improves robust attitude control performance. Finally, simulation results are presented to illustrate the effectiveness of the proposed terminal sliding mode with unidirectional auxiliary surfaces.

  17. On adjustment for auxiliary covariates in additive hazard models for the analysis of randomized experiments

    DEFF Research Database (Denmark)

    Vansteelandt, S.; Martinussen, Torben; Tchetgen, E. J Tchetgen

    2014-01-01

    We consider additive hazard models (Aalen, 1989) for the effect of a randomized treatment on a survival outcome, adjusting for auxiliary baseline covariates. We demonstrate that the Aalen least-squares estimator of the treatment effect parameter is asymptotically unbiased, even when the hazard...... that, in view of its robustness against model misspecification, Aalen least-squares estimation is attractive for evaluating treatment effects on a survival outcome in randomized experiments, and the primary reasons to consider baseline covariate adjustment in such settings could be interest in subgroup......'s dependence on time or on the auxiliary covariates is misspecified, and even away from the null hypothesis of no treatment effect. We furthermore show that adjustment for auxiliary baseline covariates does not change the asymptotic variance of the estimator of the effect of a randomized treatment. We conclude...

  18. Importance of continuous monitoring and control of auxiliary power consumption in thermal power plants

    Directory of Open Access Journals (Sweden)

    Nikolić Aleksandar

    2017-01-01

    Full Text Available The paper presents the conceptual solution on the basis of which a system for continuous monitoring and control of auxiliary power consumption is defined in the four most important thermal power plants within the Electric Power Industry of Serbia (TENT A and B, TE Kostolac A and B. A unique system of measuring of auxiliary power consumption at the level of EPS is established in order to perform the appropriate measurement in the following phases, whose data would be archived for the purpose of further analyzes of energy balances. The results of these measurements should be used to define the concrete measures for auxiliary power consumption reduction in power plants, which, in addition to improving energy efficiency, would directly affect the cost reduction.

  19. Evaluation of auxiliary tempering pump effectiveness at Chalk Point Steam Electric Station

    Energy Technology Data Exchange (ETDEWEB)

    Wendling, L.C.; Holland, A.F.

    1989-08-01

    The effectiveness of auxiliary tempering pump operation at Chalk Point Steam Electric Station (SES) at reducing plant-induced mortality of aquatic biota was evaluated. Several Representative Important Species (RIS) and dominant benthic and zooplankton species were used in the evaluation as indicators of overall system-wide responses. Expected mortality with and without auxiliary pump operation was estimated using thermal tolerance data available from the scientific literature for blue crabs, white perch, striped bass, spot, Macoma balthica and Acartia tonsa. The evaluation led to the conclusion that the operation of auxiliary tempering pumps at Chalk Point SES increases plant-induced mortality of spot, white perch, striped bass, and zooplankton. Operation of the tempering pumps may reduce blue crab mortality slightly under certain circumstances, and Macoma balthica mortality is probably largely unaffected by their operation.

  20. Aiming of Kirkpatrick-Baez microscope based on auxiliary optical system

    International Nuclear Information System (INIS)

    Huang Shengling; Mu Baozhong; Yi Shengzhen; Wang Xin; Wang Zhanshan; Ding Yongkun; Miao Wenyong; Dong Jianjun

    2009-01-01

    An auxiliary optical system has been designed, which can provide precise positioning for aiming Kirkpatrick-Baez (KB) microscope object location. An 8 keV X-ray imaging system by KB microscope with periodic multilayer films has been designed. The field of view and depth of field in the resolution of 5 μm are got, and then the corresponding point and depth of field in diagnostic experiments are calculated. Based on the object-image relations and precision of the KB microscope, an auxiliary visible light imaging system is designed and X-ray imaging experiments are performed, which can achieve equivalent aiming between the visible imaging system and the KB microscope. The results show that ±20 μm vertical axis plane and ±300 μm axial accuracy are achieved through the auxiliary optical path, which can meet the object point positioning requirements of the KB microscope. (authors)

  1. Estimation Method for Turn-off Collector Voltage of IGBTs Using Emitter-auxiliary Inductor

    DEFF Research Database (Denmark)

    Luo, Haoze; Iannuzzo, Francesco; Blaabjerg, Frede

    2016-01-01

    This paper presents a method for estimating the instantaneous turn-off collector voltage of high-power IGBT modules. Because of the parasitic inductors in circuit, the fast turn-off collector current usually leads to a voltage overshoot on IGBT modules during the turn-off transition. In terms...... of high-voltage and high-power IGBT module, there exists an emitter-auxiliary inductor between the power emitter and Kelvin emitter. The same variable dic/dt during turn-off transition will also induce a measurable voltage veE across the emitter-auxiliary inductor LeE. As a result, the hazardous turn......-off peak collector voltage can be reflected by the induced νeE in the case of fixed commutation loop inductors and emitter auxiliary inductor. Finally, a double pulse test platform is used to validate the effectiveness of estimation method. The estimation curves of turn-off collector voltage...

  2. Intense Red-Emitting Upconversion Nanophosphors (800 nm-Driven) with a Core/Double-Shell Structure for Dual-Modal Upconversion Luminescence and Magnetic Resonance in Vivo Imaging Applications.

    Science.gov (United States)

    Hong, A-Ra; Kim, Youngsun; Lee, Tae Sup; Kim, Sehoon; Lee, Kwangyeol; Kim, Gayoung; Jang, Ho Seong

    2018-04-18

    In this study, intense single-band red-emitting upconversion nanophosphors (UCNPs) excited with 800 nm near-infrared (NIR) light are reported. When a NaYF 4 :Nd,Yb active-shell is formed on the 12.7 nm sized NaGdF 4 :Yb,Ho,Ce UCNP core, the core/shell (C/S) UCNPs show tunable emission from green to red, depending on the Ce 3+ concentration under excitation with 800 nm NIR light. Ce 3+ -doped C/S UCNPs (30 mol %) exhibit single-band red emission peaking at 644 nm via a 5 F 5 → 5 I 8 transition of Ho 3+ . A high Nd 3+ concentration in the shell results in strong absorption at around 800 nm NIR light, even though the shell thickness is not large, and small-sized C/S UCNPs (16.3 nm) emit bright red light under 800 nm excitation. The formation of a thin NaGdF 4 shell on the C/S UCNPs further enhances the upconversion (UC) luminescence and sub-20 nm sized core/double-shell (C/D-S) UCNPs exhibit 2.8 times stronger UC luminescence compared with C/S UCNPs. Owing to the strong UC luminescence intensity and Gd 3+ ions on the surface of nanocrystals, they can be applied as a UC luminescence imaging agent and a T 1 contrast agent for magnetic resonance (MR) imaging. In vivo UC luminescence and high-contrast MR images are successfully obtained by utilizing the red-emitting C/D-S UCNPs.

  3. Dual-Mode Patch Filter with Metal Wall Structures

    Directory of Open Access Journals (Sweden)

    D. Kang

    2013-01-01

    Full Text Available A dual-mode patch filter with metal wall structures is presented. The proposed structure consists of substrate 1 with metal wall structures and substrate 2 with a patch resonator. Because the symmetry of the structure can be perturbed by both long and short strips of the metal wall structures, the dual mode is achieved. The inductive element is introduced to the patch resonator through vias of the metal wall structures. The capacitive element is introduced through a gap between the patch resonator and the metal strips. The measured 3 dB fractional bandwidth for the passband is 10.4%, and the measured minimum insertion loss is 1.3 dB.

  4. Dual-Mode Dual-Band Microstrip Bandpass Filter Based on Fourth Iteration T-Square Fractal and Shorting Pin

    Directory of Open Access Journals (Sweden)

    E. S. Ahmed

    2012-06-01

    Full Text Available A new class of dual mode microstrip fractal resonator is proposed and developed for miniaturization of the dual band bandpass filter. The perimeter of the proposed resonator is increased by employing fourth iteration T-square fractal shape. Consequently the lower resonant frequency of the filter is decreased without increasing the usable space. The self similarity of the usable structure enables it to produce the two degenerate modes which are coupled using the proper perturbation technique. The shorting pin is placed at the null in the surface current distribution at the center of the resonator. This shorting pin is coactively coupled to the resonant circuit of the resonator, effectively coupled to the lower degenerate mode and reduces the lower edge band resonant frequency. By adjusting the resonator dimensions and the size of the shorting pin, the resonant frequency and the out-of-band rejection around the transmission bands can be controlled to meet the design requirements. The simulated response of the designed filter has two transmission bands, the first band is from 2.34-3.65 GHz with resonant frequencies at 2.47GHz and 3.55GHz, the second band is from 4.37-5.324GHz with resonant frequencies at 4.5GHz and 5.13GHz. In the pass bands, the group delay is less than 0.65 ns. The proposed filter can be applied to WLAN (2.4 GHz and 5.2 GHz and WiMAX (3.5 GHz and Bluetooth and ZigBee (4.9 GHz.

  5. A new auxiliary equation and exact travelling wave solutions of nonlinear equations

    International Nuclear Information System (INIS)

    Sirendaoreji

    2006-01-01

    A new auxiliary ordinary differential equation and its solutions are used for constructing exact travelling wave solutions of nonlinear partial differential equations in a unified way. The main idea of this method is to take full advantage of the auxiliary equation which has more new exact solutions. More new exact travelling wave solutions are obtained for the quadratic nonlinear Klein-Gordon equation, the combined KdV and mKdV equation, the sine-Gordon equation and the Whitham-Broer-Kaup equations

  6. Solar combisystems with forecast control to increase the solar fraction and lower the auxiliary energy cost

    DEFF Research Database (Denmark)

    Perers, Bengt; Furbo, Simon; Fan, Jianhua

    2011-01-01

    Solar Combi systems still need quite a lot of auxiliary energy especially in small systems without seasonal storage possibilities. The control of the auxiliary energy input both in time and power is important to utilize as much as possible of the solar energy available from the collectors and also...... energy sources. It can be either direct electric heating elements or a heat pump upgrading ambient energy in the air, ground, solar collector or waste heat from the house. The paper describes system modeling and simulation results. Advanced laboratory experiments are also starting now with three...

  7. [Impact of directly compressed auxiliary materials on powder property of fermented cordyceps powder].

    Science.gov (United States)

    Chen, Li-Hua; Yue, Guo-Chao; Guan, Yong-Mei; Yang, Ming; Zhu, Wei-Feng

    2014-01-01

    To investigate such physical indexes as hygroscopicity, angle of repose, bulk density, fillibility of compression of mixed powder of directly compressed auxiliary materials and fermented cordyceps powder by using micromeritic study methods. The results showed that spray-dried lactose Flowlac100 and microcrystalline cellulose Avicel PH102 had better effect in liquidity and compressibility on fermented cordyceps powder than pregelatinized starch. The study on the impact of directly compressed auxiliary materials on the powder property of fermented cordyceps powder had guiding significant to the research of fermented cordyceps powder tablets, and could provide basis for the development of fermented cordyceps powder tablets.

  8. Pure spinors as auxiliary fields in the ten-dimensional supersymmetric Yang-Mills theory

    International Nuclear Information System (INIS)

    Nilsson, B.E.W.

    1986-01-01

    A new way of introducing auxiliary fields into the ten-dimensional supersymmetric Yang-Mills theory is proposed. The auxiliary fields are commuting 'pure spinors' and constitute a non-linear realisation of the Lorentz group. This invalidates previous no-go theorems concerning the possibility of going off-shell in this theory. There seems to be a close relation between pure spinors and the concepts usually used in twistor theory. The non-Abelian theory can be constructed for all groups having pseudo-real representations. (author)

  9. Analysis of dual coupler nested coupled cavities.

    Science.gov (United States)

    Adib, George A; Sabry, Yasser M; Khalil, Diaa

    2017-12-01

    Coupled ring resonators are now forming the basic building blocks in several optical systems serving different applications. In many of these applications, a small full width at half maximum is required, along with a large free spectral range. In this work, a configuration of passive coupled cavities constituting dual coupler nested cavities is proposed. A theoretical study of the configuration is presented allowing us to obtain analytical expressions of its different spectral characteristics. The transfer function of the configuration is also used to generate design curves while comparing these results with analytical expressions. Finally, the configuration is compared with other coupled cavity configurations.

  10. Brain activations during bimodal dual tasks depend on the nature and combination of component tasks

    Science.gov (United States)

    Salo, Emma; Rinne, Teemu; Salonen, Oili; Alho, Kimmo

    2015-01-01

    We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or “simple” (speaker-gender or font-shade) discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley's model “modality atypical,” that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks. PMID:25767443

  11. Brain activations during bimodal dual tasks depend on the nature and combination of component tasks

    Directory of Open Access Journals (Sweden)

    Emma eSalo

    2015-02-01

    Full Text Available We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or simple (speaker-gender or font-shade discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley’s model modality atypical, that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.

  12. Brain activations during bimodal dual tasks depend on the nature and combination of component tasks.

    Science.gov (United States)

    Salo, Emma; Rinne, Teemu; Salonen, Oili; Alho, Kimmo

    2015-01-01

    We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or "simple" (speaker-gender or font-shade) discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley's model "modality atypical," that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.

  13. Multiquark Resonances

    CERN Document Server

    Esposito, A.; Polosa, A.D.

    2016-01-01

    Multiquark resonances are undoubtedly experimentally observed. The number of states and the amount of details on their properties has been growing over the years. It is very recent the discovery of two pentaquarks and the confirmation of four tetraquarks, two of which had not been observed before. We mainly review the theoretical understanding of this sector of particle physics phenomenology and present some considerations attempting a coherent description of the so called X and Z resonances. The prominent problems plaguing theoretical models, like the absence of selection rules limiting the number of states predicted, motivate new directions in model building. Data are reviewed going through all of the observed resonances with particular attention to their common features and the purpose of providing a starting point to further research.

  14. Localization of executive functions in dual-task performance with fMRI.

    Science.gov (United States)

    Szameitat, André J; Schubert, Torsten; Müller, Karsten; Von Cramon, D Yves

    2002-11-15

    We report a study that investigated the neuroanatomical correlates of executive functions in dual-task performance with functional magnetic resonance imaging. Participants performed an auditory and a visual three-choice reaction task either separately as single tasks or concurrently as dual tasks. In the dual-task condition, two stimuli were presented in rapid succession to ensure interference between the component tasks (psychological refractory period). The behavioral data showed considerable performance decrements in the dual-task compared to the single-task condition. Dual-task-related activation was detected with two different neuroimaging methods. First, we determined dual-task-related activation according to the method of cognitive subtraction. For that purpose, activation in the dual-task was compared directly with activation in the single-task conditions. This analysis revealed that cortical areas along the inferior frontal sulcus (IFS), the middle frontal gyrus (MFG), and the intraparietal sulcus (IPS) are involved in dual-task performance. The results of the subtraction method were validated with the method of parametric manipulation. For this purpose, a second dual-task condition was introduced, where the difficulty of the dual-task coordination was increased compared with the first dual-task condition. As expected, behavioral dual-task performance decreased with increased dual-task difficulty. Furthermore, the increased dual-task difficulty led to an increase of activation in those cortical regions that proved to be dual-task related with the subtraction method, that is, the IFS, the MFG, and the IPS. These results support the conclusion that dorsolateral prefrontal and superior parietal cortices are involved in the coordination of concurrent and interfering task processing.

  15. Neuroaesthetic Resonance

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis

    2013-01-01

    tailored channeling of sensory stimulus aligned as ‘art-making’ and ‘game playing’ core experiences. Thus, affecting brain plasticity and human motoric-performance via the adaptability (plasticity) of digital medias result in closure of the human afferent-efferent neural feedback loop closure through...... the unencumbered motion-to-computer-generated activities - ‘Music Making’, ‘Painting’, ‘Robotic’ and ‘Video Game’ control. A focus of this position paper is to highlight how Aesthetic Resonance, in this context, relates to the growing body of research on Neuroaesthetics to evolve Neuroaesthetic Resonance....

  16. Self-dual Hopf quivers

    International Nuclear Information System (INIS)

    Huang Hualin; Li Libin; Ye Yu

    2004-07-01

    We study pointed graded self-dual Hopf algebras with a help of the dual Gabriel theorem for pointed Hopf algebras. Quivers of such Hopf algebras are said to be self-dual. An explicit classification of self-dual Hopf quivers is obtained. We also prove that finite dimensional coradically graded pointed self-dual Hopf algebras are generated by group-like and skew-primitive elements as associative algebras. This partially justifies a conjecture of Andruskiewitsch and Schneider and may help to classify finite dimensional self-dual pointed Hopf algebras

  17. Acylation, Diastereoselective Alkylation, and Cleavage of an Oxazolidinone Chiral Auxiliary: A Multistep Asymmetric Synthesis Experiment for Advanced Undergraduates

    Science.gov (United States)

    Smith, Thomas E.; Richardson, David P.; Truran, George A.; Belecki, Katherine; Onishi, Megumi

    2008-01-01

    An introduction to the concepts and experimental techniques of diastereoselective synthesis using a chiral auxiliary is described. The 4-benzyl-2-oxazolidinone chiral auxiliary developed by Evans is acylated with propionic anhydride under mild conditions using DMAP as an acyl transfer catalyst. Deprotonation with NaN(TMS)[subscript 2] at -78…

  18. Verb Placement in Second Language Acquisition: Experimental Evidence for the Different Behavior of Auxiliary and Lexical Verbs

    Science.gov (United States)

    Verhagen, Josje

    2011-01-01

    This study investigates the acquisition of verb placement by Moroccan and Turkish second language (L2) learners of Dutch. Elicited production data corroborate earlier findings from L2 German that learners who do not produce auxiliaries do not raise lexical verbs over negation, whereas learners who produce auxiliaries do. Data from elicited…

  19. 817 RESONANCE September 2013

    Indian Academy of Sciences (India)

    IAS Admin

    817. RESONANCE ⎜ September 2013. Page 2. 818. RESONANCE ⎜ September 2013. Page 3. 819. RESONANCE ⎜ September 2013. Page 4. 820. RESONANCE ⎜ September 2013. Page 5. 821. RESONANCE ⎜ September 2013. Page 6. 822. RESONANCE ⎜ September 2013. Page 7. 823. RESONANCE ⎜ September ...

  20. 996 RESONANCE November 2013

    Indian Academy of Sciences (India)

    IAS Admin

    996. RESONANCE. November 2013. Page 2. 997. RESONANCE. November 2013. Page 3. 998. RESONANCE. November 2013. Page 4. 999. RESONANCE. November 2013. Page 5. 1000. RESONANCE. November 2013. Page 6. 1001. RESONANCE. November 2013. Page 7. 1002. RESONANCE. November 2013 ...

  1. 369 RESONANCE April 2016

    Indian Academy of Sciences (India)

    IAS Admin

    369. RESONANCE ⎜ April 2016. Page 2. 370. RESONANCE ⎜ April 2016. Page 3. 371. RESONANCE ⎜ April 2016. Page 4. 372. RESONANCE ⎜ April 2016. Page 5. 373. RESONANCE ⎜ April 2016. Page 6. 374. RESONANCE ⎜ April 2016. Page 7. 375. RESONANCE ⎜ April 2016.

  2. Auxiliares "avoir" and "etre" approche psychosystematique (The Auxiliaries "avoir" and "etre," a Psychosystematic Approach)

    Science.gov (United States)

    Joly, Andre

    1977-01-01

    A brief psychosystematic analysis of the problem of auxiliaries in French, and of the solution offered by the internal psychomechanism of the language as found in Gustave Guillaume's research. "Avoir" and "etre"" are studied in some detail from several aspects. There is a short bibliography. (Text is in French.) (AMH)

  3. C1 compounds as auxiliary substrate for engineered Pseudomonas putida S12

    NARCIS (Netherlands)

    Koopman, F.W.; De Winde, J.H.; Ruijssenaars, H.J.

    2009-01-01

    The solvent-tolerant bacterium Pseudomonas putida S12 was engineered to efficiently utilize the C1 compounds methanol and formaldehyde as auxiliary substrate. The hps and phi genes of Bacillus brevis, encoding two key steps of the ribulose monophosphate (RuMP) pathway, were introduced to construct a

  4. C-terminal interactors of the AMPA receptor auxiliary subunit Shisa9.

    NARCIS (Netherlands)

    Karataeva, A.R.; Klaassen, R.V.; Ruiperez-Alonso, M.; Hjorth, J.; van Nierop, P.; Spijker, S.; Mansvelder, H.D.; Smit, A.B.

    2014-01-01

    Shisa9 (initially named CKAMP44) has been identified as auxiliary subunit of the AMPA-type glutamate receptors and was shown to modulate its physiological properties. Shisa9 is a type-I transmembrane protein and contains a C-terminal PDZ domain that potentially interacts with cytosolic proteins. In

  5. Speckle Interferometry with the McMath-Pierce East Auxiliary Telescope

    Science.gov (United States)

    Harshaw, Richard; Ray, Jimmy; Douglass, David; Prause, Lori; Genet, Russell

    2015-09-01

    Engineering runs and tests on the McMath-Pierce 0.8 meter East Auxiliary telescope successfully configured the telescope for speckle interferometry observations of close visual double stars. This paper reports the procedure and results of the speckle analysis of four double stars.

  6. The Impact Of Dental Auxiliaries In Oral Health Delivery In Cameroon

    African Journals Online (AJOL)

    Objective: To assess the impact of dental auxiliaries in oral health delivery in Cameroon. Materials and Methods: A cross-sectional study of 47 dental auxil- iaries recruited from six of 10 provinces in Cameroon was conducted in 2010. A self-administered questionnaire elicited information on demography, training received ...

  7. 77 FR 29564 - Revisions to the Export Administration Regulations: Auxiliary and Miscellaneous Items That No...

    Science.gov (United States)

    2012-05-18

    ... Administration Regulations: Auxiliary and Miscellaneous Items That No Longer Warrant Control Under the United... articles that the President determines, as part of the Administration's Export Control Reform Initiative...: Background On July 15, 2011, as part of the Administration's ongoing Export Control Reform Initiative, the...

  8. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  9. The Effect of Auxiliary Variables and Multiple Imputation on Parameter Estimation in Confirmatory Factor Analysis

    Science.gov (United States)

    Yoo, Jin Eun

    2009-01-01

    This Monte Carlo study investigates the beneficiary effect of including auxiliary variables during estimation of confirmatory factor analysis models with multiple imputation. Specifically, it examines the influence of sample size, missing rates, missingness mechanism combinations, missingness types (linear or convex), and the absence or presence…

  10. 46 CFR 52.01-35 - Auxiliary, donkey, fired thermal fluid heater, and heating boilers.

    Science.gov (United States)

    2010-10-01

    ... heating boilers. 52.01-35 Section 52.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING POWER BOILERS General Requirements § 52.01-35 Auxiliary, donkey, fired thermal fluid heater, and heating boilers. (a) To determine the appropriate part of the regulations where...

  11. Computer determination of event maps with application to auxiliary supply systems

    International Nuclear Information System (INIS)

    Wredenberg, L.; Billinton, R.

    1975-01-01

    A method of evaluating the reliability of sequential operations in systems containing standby and alternate supply facilities is presented. The method is based upon the use of a digital computer for automatic development of event maps. The technique is illustrated by application to a nuclear power plant auxiliary supply system. (author)

  12. The auxiliary elliptic-like equation and the exp-function method

    Indian Academy of Sciences (India)

    exact solutions of the nonlinear evolution equations are derived with the aid of auxiliary elliptic-like equation. As examples, the RKL models, the high-order nonlinear Schrödinger equation, the Hamilton amplitude equation, the generalized Hirota–Satsuma coupled KdV system and the generalized ZK–BBM equation are ...

  13. Application of the method of auxiliary sources in optical diffraction microscopy

    DEFF Research Database (Denmark)

    Karamehmedovic, Mirza; Sørensen, Mads Peter; Hansen, Poul-Erik

    2010-01-01

    The Method of Auxiliary Sources is used for characterisation of grating defects. Grating profiles are characterised by best fit matching of a library of diffraction efficiencies with numerical simulated diffraction efficiencies with defects. It is shown that the presented method can solve the inv...... the inverse problem with an accuracy usually thought to require rigorous electromagnetic theories....

  14. Application of the Method of Auxiliary Sources for the Analysis of Electromagnetic Scattering by Impedance Spheres

    DEFF Research Database (Denmark)

    Karamehmedovic, Mirza; Breinbjerg, Olav

    2002-01-01

    The Method of Auxiliary Sources (MAS) is applied to 3D scattering problems involving spherical impedance scatterers. The MAS results are compared with the reference spherical wave expansion (SWE) solution. It is demonstrated that good agreement is achieved between the MAS and SWE results....

  15. Infections after auxiliary partial liver transplantation. Experiences in the first ten patients

    NARCIS (Netherlands)

    J.H. van Zeijl (J.); A.C.M. Kroes (Aloys C.M.); H.J. Metselaar (Herold); P.J.A. Willemse (P. J A); H.A. Bruining (Hajo); J.F. Sluiters (Hans); S.W. Schalm (Solko); O.T. Terpstra (Onno); M.F. Michel

    1990-01-01

    markdownabstractSummary In ten auxiliary partial liver transplant recipients selective bowel decontamination (SBD) was used to reduce infections due to gram-negative microorganisms and fungi. During SBD no gram-negative infections occurred. Candida peritonitis was observed in one patient. After

  16. Progress in the integration of the ITER plant systems in auxiliary buildings

    International Nuclear Information System (INIS)

    Kotamäki, M.; Cordier, J.-J.; Kuehn, I.; Perrin, J.-L.; Sweeney, S.; Villedary, B.

    2016-01-01

    Highlights: • Usage of 3D CAD model in ITER configuration management presented. • 3D CAD models efficient in configuration and interface management. • Costly and schedule delaying changes avoided with proper interface management. • ITER buildings construction progressing. - Abstract: The ITER Tokamak machine is located in the center of Tokamak complex buildings consisting of Tokamak, Diagnostic, and Tritium buildings. Around the Tokamak complex there are over 30 auxiliary buildings housing various plant systems serving the Tokamak machine either directly or indirectly. The layout and space allocation of each auxiliary building and plant systems housed by the building are represented in the so-called Configuration Management Models (CMM). These are light 3D CAD models that define the required space envelope and the physical interfaces between the systems and the buildings and in-between the systems. The paper describes the CMM and interface management processes of the ITER auxiliary buildings and plant systems, and discusses the preparations for the plant installation phase. In addition, the current baseline configuration of the ITER plant systems in auxiliary buildings is described together with the recent developments in the configuration of different systems, as well as the current status of the construction of the buildings.

  17. Modelling the Impact of Ground Planes on Antenna Radiation Using the Method of Auxiliary Sources

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2007-01-01

    The Method of Auxiliary Sources is employed to model the impact of finite ground planes on the radiation from antennas. In many cases the computational cost of available commercial tools restricts the simulations to include only a small ground plane or, by use of the image principle, the infinitely...

  18. The auxiliary elliptic-like equation and the exp-function method

    Indian Academy of Sciences (India)

    exact solutions of the nonlinear evolution equations are derived with the aid of auxiliary elliptic-like equation. ... (NEE) have been paid attention by many researchers, especially the investigations of exact solutions for ... elliptic-like equation with the aid of the travelling wave reduction are introduced. The exact solutions of ...

  19. Meaningful questions: The acquisition of auxiliary inversion in a connectionist model of sentence production.

    Science.gov (United States)

    Fitz, Hartmut; Chang, Franklin

    2017-09-01

    Nativist theories have argued that language involves syntactic principles which are unlearnable from the input children receive. A paradigm case of these innate principles is the structure dependence of auxiliary inversion in complex polar questions (Chomsky, 1968, 1975, 1980). Computational approaches have focused on the properties of the input in explaining how children acquire these questions. In contrast, we argue that messages are structured in a way that supports structure dependence in syntax. We demonstrate this approach within a connectionist model of sentence production (Chang, 2009) which learned to generate a range of complex polar questions from a structured message without positive exemplars in the input. The model also generated different types of error in development that were similar in magnitude to those in children (e.g., auxiliary doubling, Ambridge, Rowland, & Pine, 2008; Crain & Nakayama, 1987). Through model comparisons we trace how meaning constraints and linguistic experience interact during the acquisition of auxiliary inversion. Our results suggest that auxiliary inversion rules in English can be acquired without innate syntactic principles, as long as it is assumed that speakers who ask complex questions express messages that are structured into multiple propositions. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Resonating Statements

    DEFF Research Database (Denmark)

    Hjelholt, Morten; Jensen, Tina Blegind

    2015-01-01

    IT projects are often complex arrangements of technological components, social actions, and organizational transformation that are difficult to manage in practice. This paper takes an analytical discourse perspective to explore the process of legitimizing IT projects. We introduce the concept of ...... as part of a feedback loop to re-attach the localized IT project to the broader national discourse. The paper concludes with reflections on how to actively build on resonating statements as a strategic resource for legitimizing IT projects...... of resonating statements to highlight how central actors navigate in various discourses over time. Particularly, the statements and actions of an IT project manager are portrayed to show how individuals can legitimize actions by connecting statements to historically produced discourses. The case study...... of an IT project in a Danish local government spans a two-year time period and demonstrates a double-loop legitimization process. First, resonating statements are produced to localize a national IT initiative to support the specificity of a local government discourse. Second, the resonating statements are used...

  1. Autostereogram resonators

    Science.gov (United States)

    Leavey, Sean; Rae, Katherine; Murray, Adam; Courtial, Johannes

    2012-09-01

    Autostereograms, or "Magic Eye" pictures, are repeating patterns designed to give the illusion of depth. Here we discuss optical resonators that create light patterns which, when viewed from a suitable position by a monocular observer, are autostereograms of the three-dimensional shape of one of the mirror surfaces.

  2. Dual phase evolution

    CERN Document Server

    Green, David G; Abbass, Hussein A

    2014-01-01

    This book explains how dual phase evolution operates in all these settings and provides a detailed treatment of the subject. The authors discuss the theoretical foundations for the theory, how it relates to other phase transition phenomena and its advantages in evolutionary computation and complex adaptive systems. The book provides methods and techniques to use this concept for problem solving. Dual phase evolution concerns systems that evolve via repeated phase shifts in the connectivity of their elements. It occurs in vast range of settings, including natural systems (species evolution, landscape ecology, geomorphology), socio-economic systems (social networks) and in artificial systems (annealing, evolutionary computing).

  3. Dual-Mode Combustor

    Science.gov (United States)

    Trefny, Charles J (Inventor); Dippold, Vance F (Inventor)

    2013-01-01

    A new dual-mode ramjet combustor used for operation over a wide flight Mach number range is described. Subsonic combustion mode is usable to lower flight Mach numbers than current dual-mode scramjets. High speed mode is characterized by supersonic combustion in a free-jet that traverses the subsonic combustion chamber to a variable nozzle throat. Although a variable combustor exit aperture is required, the need for fuel staging to accommodate the combustion process is eliminated. Local heating from shock-boundary-layer interactions on combustor walls is also eliminated.

  4. Dual-anticipating, dual and dual-lag synchronization in modulated time-delayed systems

    International Nuclear Information System (INIS)

    Ghosh, Dibakar; Chowdhury, A. Roy

    2010-01-01

    In this Letter, dual synchronization in modulated time delay system using delay feedback controller is proposed. Based on Lyapunov stability theory, we suggest a general method to achieve the dual-anticipating, dual, dual-lag synchronization of time-delayed chaotic systems and we find both its existing and sufficient stability conditions. Numerically it is shown that the dual synchronization is also possible when driving system contain two completely different systems. Effect of parameter mismatch on dual synchronization is also discussed. As an example, numerical simulations for the Mackey-Glass and Ikeda systems are conducted, which is in good agreement with the theoretical analysis.

  5. Multireference Density Functional Theory with Generalized Auxiliary Systems for Ground and Excited States.

    Science.gov (United States)

    Chen, Zehua; Zhang, Du; Jin, Ye; Yang, Yang; Su, Neil Qiang; Yang, Weitao

    2017-09-21

    To describe static correlation, we develop a new approach to density functional theory (DFT), which uses a generalized auxiliary system that is of a different symmetry, such as particle number or spin, from that of the physical system. The total energy of the physical system consists of two parts: the energy of the auxiliary system, which is determined with a chosen density functional approximation (DFA), and the excitation energy from an approximate linear response theory that restores the symmetry to that of the physical system, thus rigorously leading to a multideterminant description of the physical system. The electron density of the physical system is different from that of the auxiliary system and is uniquely determined from the functional derivative of the total energy with respect to the external potential. Our energy functional is thus an implicit functional of the physical system density, but an explicit functional of the auxiliary system density. We show that the total energy minimum and stationary states, describing the ground and excited states of the physical system, can be obtained by a self-consistent optimization with respect to the explicit variable, the generalized Kohn-Sham noninteracting density matrix. We have developed the generalized optimized effective potential method for the self-consistent optimization. Among options of the auxiliary system and the associated linear response theory, reformulated versions of the particle-particle random phase approximation (pp-RPA) and the spin-flip time-dependent density functional theory (SF-TDDFT) are selected for illustration of principle. Numerical results show that our multireference DFT successfully describes static correlation in bond dissociation and double bond rotation.

  6. ASCERTAINMENT OF ELECTRIC-SUPPLY SCHEMES RELIABILITY FOR THE ATOMIC POWER PLANT AUXILIARIES

    Directory of Open Access Journals (Sweden)

    A. L. Starzhinskij

    2015-01-01

    Full Text Available The paper completes ascertainment of electrical-supply scheme reliability for the auxiliaries of a nuclear power plant. Thereat the author considers the system behavior during the block normal operation, carrying out current maintenance, and capital repairs in combination with initiating events. The initiating events for reactors include complete blackout, i.e. the loss of outside power supply (normal and reserve; emergency switching one of the working turbogenerators; momentary dumping the normal rating to the level of auxiliaries with seating the cutout valve of one turbo-generator. The combination of any initiating event with the repairing mode in case of one of the system elements failure should not lead to blackout occurrence of more than one system of the reliable power supply. This requirement rests content with the help of the reliable power supply system self-dependence (electrical and functional and the emergency power-supply operational autonomy (diesel generator and accumulator batteries.The reliability indicators of the power supply system for the nuclear power plant auxiliaries are the conditional probabilities of conjoined blackout of one, two, and three sections of the reliable power supply conditional upon an initiating event emerging and the blackout of one, two, and three reliable power-supply sections under the normal operational mode. Furthermore, they also are the blackout periodicity of one and conjointly two, three, and four sections of normal operation under the block normal operational mode. It is established that the blackout of one bus section of normal operation and one section of reliable power-supply system of the auxiliaries that does not lead to complete blackout of the plant auxiliaries may occur once in three years. The probability of simultaneous power failure of two or three normal-operation sections and of two reliable power-supply sections during the power plant service life is unlikely.

  7. Self-induced light trapping in nonlinear Fabry–Perot resonators

    Energy Technology Data Exchange (ETDEWEB)

    Pichugin, K.N., E-mail: knp@tnp.krasn.ru; Sadreev, A.F., E-mail: almas@tnp.krasn.ru

    2016-10-14

    In the framework of the coupled mode theory we consider light trapping between two off-channel resonators which serve as self-adjusted Fano mirrors due to the Kerr effect. By inserting an auxiliary nonlinear resonator between the mirrors we achieve self-tuning of phase shift between the mirrors. That allows for the light trapping for arbitrary distance between the mirrors. - Highlights: • Fabry–Perot resonator traps light in a self-induced way if nonlinear cavity is inserted between mirrors.

  8. spinning self-dual particles

    International Nuclear Information System (INIS)

    Gamboa, J.; Rivelles, V.O.

    1989-01-01

    Self-dual particles in two-dimensions are presented. They were obtained from chiral boson particle by square root technique. The propagator of spinning self-dual particle is calculated using the BFV formalism. (M.C.K.)

  9. Multispectral dual isotope and NMR image analysis

    Energy Technology Data Exchange (ETDEWEB)

    Vannier, M.W.; Beihn, R.M.; Butterfield, R.L.; De Land, F.H.

    1985-05-01

    Dual isotope scintigraphy and nuclear magnetic resonance imaging produce image data that is intrinsically multispectral. That is multiple images of the same anatomic region are generated with different gray scale distribution and morphologic content that is largely redundant. Image processing technology, originally developed by NASA for satellite imaging, is available for multispectral analysis. These methods have been applied to provide tissue characterization. Tissue specific information encoded in the grapy scale data from dual isotope and NMR studies may be extracted using multispectral pattern recognition methods. The authors used table lookup minimum distance, maximum likelihood and cluster analysis techniques with data sets from Ga-67 / Tc-99m, 1-131 labeled antibodies / Tc-99m, Tc-99m perfusion / Xe-133 ventilation, and NMR studies. The results show; tissue characteristic signatures exist in dual isotope and NMR imaging, and these spectral signatures are identifiable using multispectral image analysis and provide tissue classification maps with scatter diagrams that facilitate interpretation and assist in elucidating subtle changes.

  10. A Novel Dual-Flux-Modulator Coaxial Magnetic Gear for High Torque Capability

    DEFF Research Database (Denmark)

    Zhang, Xiaoxu; Liu, Xiao; Chen, Zhe

    2018-01-01

    This paper presents a novel dual-flux-modulator coaxial magnetic gear (DFM-CMG) characterized by high torque capability and high permanent magnet (PM) utilization efficiency. The DFM-CMG adopts spoke-type outer PM rotor and introduces an auxiliary flux modulator placed on the outermost layer....... A quantitative comparison among the surface-mounted CMG (SM-CMG), spoke-type CMG (ST-CMG), and DFM-CMG is made to verify the performance improvement of the proposed CMG. With the same amount of consumed PMs, the torque capability and PM utilization efficiency of the DFM-CMG shows a 73% growth over the SM...

  11. Dual Symmetry in Gauge Theories

    OpenAIRE

    Koshkarov, A. L.

    1997-01-01

    Continuous dual symmetry in electrodynamics, Yang-Mills theory and gravitation is investigated. Dual invariant which leads to badly nonlinear motion equations is chosen as a Lagrangian of the pure classical dual nonlinear electrodynamics. In a natural manner some dual angle which is determined by the electromagnetic strengths at the point of the time-space appears in the model. Motion equations may well be interpreted as the equations of the standard Maxwell theory with source. Alternative in...

  12. Dual Smarandache Curves and Smarandache Ruled Surfaces

    OpenAIRE

    Tanju KAHRAMAN; Mehmet ÖNDER; H. Hüseyin UGURLU

    2013-01-01

    In this paper, by considering dual geodesic trihedron (dual Darboux frame) we define dual Smarandache curves lying fully on dual unit sphere S^2 and corresponding to ruled surfaces. We obtain the relationships between the elements of curvature of dual spherical curve (ruled surface) x(s) and its dual Smarandache curve (Smarandache ruled surface) x1(s) and we give an example for dual Smarandache curves of a dual spherical curve.

  13. A reconfigurable subwavelength plasmonic fano nano-antenna based on split ring resonator

    Energy Technology Data Exchange (ETDEWEB)

    Hosseinbeig, Ahmad; Pirooj, Azadeh [Faculty of Eng., Science and Research Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of); Zarrabi, Ferdows B., E-mail: ferdows.zarrabi@yahoo.com [Young Researchers and Elite Club, Babol Branch Islamic Azad University, Babol (Iran, Islamic Republic of)

    2017-02-01

    In this article, a reconfigurable subwavelength plasmonic nano-antenna with Fano resonance effect is presented based on the dual ring structure. In order to achieve reconfigurable characteristics, the interaction of gold with graphene is studied. SiN substrate with refractive index of 1.98 and gold with Palik optical characteristic modified for metal layer are utilized in the design of the proposed nano-antenna. Simulations are performed by using CST Microwave Studio. The biasing effect on extinction cross section is studied for 0 to 0.8 eV. It is shown that the gap method is useful for exciting the Fano resonance in the dual ring nano-antenna and there is only a plasmonic resonance in the simple dual ring antenna. The proposed nano-antenna is useful for THz medical spectroscopy due to its simple design and the ability to control the second resonance frequency by changing the bias of the graphene. - Highlights: • Dual ring structure for Fano resonance with reconfigurable characteristic is suggested. • The gap method is useful for exciting the Fano resonance in the dual ring nano-antenna. • By acheiving the Fano resonance the elctrical field enhanced drastically. • The ability to control the second resonance frequency by changing the bias of the graphene is studied.

  14. Dual beam vidicon digitizer

    International Nuclear Information System (INIS)

    Evans, T.L.

    1976-01-01

    A vidicon waveform digitizer which can simultaneously digitize two independent signals has been developed. Either transient or repetitive waveforms can be digitized with this system. A dual beam oscilloscope is used as the signal input device. The light from the oscilloscope traces is optically coupled to a television camera, where the signals are temporarily stored prior to digitizing

  15. Towards a Dual Approach

    DEFF Research Database (Denmark)

    Holli, Anne Maria; Harder, Mette Marie Stæhr

    2016-01-01

    Drawing on insights from state feminism and legislative studies on parliamentary committees, this article develops a dual approach for the comparative analysis of committees on gender equality. Empirically, it compares the standing committees on gender equality in Denmark and Finland, two Nordic...

  16. Dual Criteria Decisions

    DEFF Research Database (Denmark)

    Andersen, Steffen; Harrison, Glenn W.; Lau, Morten Igel

    2014-01-01

    The most popular models of decision making use a single criterion to evaluate projects or lotteries. However, decision makers may actually consider multiple criteria when evaluating projects. We consider a dual criteria model from psychology. This model integrates the familiar tradeoffs between...

  17. Dual ionization chamber

    International Nuclear Information System (INIS)

    Mallory, J.; Turlej, Z.

    1981-01-01

    Dual ionization chambers are provided for use with an electronic smoke detector. The chambers are separated by electrically-conductive partition. A single radiation source extends through the partition into both chambers, ionizing the air in each. The mid-point current of the device may be balanced by adjusting the position of the source

  18. Resonant behavior of dielectric objects (electrostatic resonances).

    Science.gov (United States)

    Fredkin, D R; Mayergoyz, I D

    2003-12-19

    Resonant behavior of dielectric objects occurs at certain frequencies for which the object permittivity is negative and the free-space wavelength is large in comparison with the object dimensions. Unique physical features of these resonances are studied and a novel technique for the calculation of resonance values of permittivity, and hence resonance frequencies, is proposed. Scale invariance of resonance frequencies, unusually strong orthogonality properties of resonance modes, and a two-dimensional phenomenon of "twin" spectra are reported. The paper concludes with brief discussions of optical controllability of these resonances in semiconductor nanoparticles and a plausible, electrostatic resonance based, mechanism for nucleation and formation of ball lightning.

  19. Neuroaesthetic Resonance

    OpenAIRE

    Brooks, Anthony Lewis

    2013-01-01

    Neuroaesthetic Resonance emerged from a mature body of patient- centered gesture-control research investigating non-formal rehabilitation via ICT-enhanced-Art to question ‘Aesthetic Resonance’. Motivating participation, ludic engagement, and augmenting physical motion in non-formal (fun) treatment sessions are achieved via adaptive action-analyzed activities. These interactive virtual environments are designed to empower patients’ creative and/or playful expressions via digital feedback stimu...

  20. 1004 RESONANCE November 2013

    Indian Academy of Sciences (India)

    IAS Admin

    1004. RESONANCE │ November 2013. Page 2. 1005. RESONANCE │ November 2013. Page 3. 1006. RESONANCE │ November 2013. Page 4. 1007. RESONANCE │ November 2013. Page 5. 1008. RESONANCE │ November 2013. Page 6. 1009. RESONANCE │ November 2013. Page 7. 1010. RESONANCE ...

  1. Even order snake resonances

    International Nuclear Information System (INIS)

    Lee, S.Y.

    1993-01-01

    We found that the perturbed spin tune due to the imperfection resonance plays an important role in beam depolarization at snake resonances. We also found that even order snake resonances exist in the overlapping intrinsic and imperfection resonances. Due to the perturbed spin tune shift of imperfection resonances, each snake resonance splits into two

  2. Regularity of Dual Gabor Windows

    Directory of Open Access Journals (Sweden)

    Ole Christensen

    2013-01-01

    Full Text Available We present a construction of dual windows associated with Gabor frames with compactly supported windows. The size of the support of the dual windows is comparable to that of the given window. Under certain conditions, we prove that there exist dual windows with higher regularity than the canonical dual window. On the other hand, there are cases where no differentiable dual window exists, even in the overcomplete case. As a special case of our results, we show that there exists a common smooth dual window for an interesting class of Gabor frames. In particular, for any value of K∈ℕ, there is a smooth function h which simultaneously is a dual window for all B-spline generated Gabor frames {EmbTnBN(x/2}m,n∈ℕ for B-splines BN of order N=1,…,2K+1 with a fixed and sufficiently small value of b.

  3. Start-up of a power unit of a thermal power plant auxiliary system with supply from a hydropower plant

    Directory of Open Access Journals (Sweden)

    Zbigniew Lubośny

    2013-09-01

    Full Text Available This article discusses the issues related to a power unit of a thermal power plant start-up with the use of a hydropower plant. Hydropower plant can supply and will enable start-up of auxiliary equipment in a power unit of a thermal power plant. Due to high capacity of auxiliary drives, startup of auxiliaries in a thermal power plant after blackout (and boiler shutdown is not possible from emergency energy sources in the power plant. In such a case an external electricity source with high capacity is required.

  4. “Wheelchair slow transit” system-based elderly auxiliary travel mode

    Directory of Open Access Journals (Sweden)

    Yan Lin

    2015-09-01

    Full Text Available Based on research of the current situation and analysis result of a case study in the Nanjing region, this paper proposes a “wheelchair slow transit”(WST system-based elderly auxiliary travel mode. The system involves three fundamental composition frames, namely, support, transit components, and connection components. Each component is designed as an armrest, ground track, or vertical type to respond to actual demands. Thus, this system may be adaptable to diverse conditions. Taking Xiangpuying community as a case study, the author examined the application of the WST auxiliary mode in particular communities. The WST system helps to increase the accessibility of existing public areas, creates a safe community traffic environment, improves municipal facilities, and strengthens universal design. The study intends to provide a reference to obtain a complete aged care design and to build a comfortable and livable aged care community environment.

  5. Postoperative imaging findings in children with auxiliary partial orthotopic liver transplant (APOLT)

    International Nuclear Information System (INIS)

    Ayyala, Rama S.; Ruzal-Shapiro, Carrie; Martinez, Mercedes; Lobritto, Steven J.; Kato, Tomoaki

    2016-01-01

    Auxiliary partial orthotopic liver transplant (APOLT) is a treatment technique for people who have acute hepatic failure secondary to fulminant hepatic failure and might ultimately recover normal liver function. This surgical procedure is complicated, involving the placement of a liver graft while maintaining viability of the remaining native portion of the liver. This method allows the native liver to recover hepatic function, therefore eliminating the need for long-term immunosuppression, as is typically needed in post-transplant settings. Postoperative imaging in these cases can be challenging given the complex anatomy, specifically the vascular anastomosis. Therefore it is important for radiologists and clinicians to be aware of the anatomy as well as the variable imaging appearances of the liver. We review the imaging findings in children who have undergone auxiliary partial orthotopic liver transplant (APOLT). (orig.)

  6. National Ignition Facility subsystem design requirements target area auxiliary subsystem SSDR 1.8.6

    International Nuclear Information System (INIS)

    Reitz, T.

    1996-01-01

    This Subsystem Design Requirement (SSDR) establishes the performance, design, development, and test requirements for the Target Area Auxiliary Subsystems (WBS 1.8.6), which is part of the NIF Target Experimental System (WBS 1.8). This document responds directly to the requirements detailed in NIF Target Experimental System SDR 003 document. Key elements of the Target Area Auxiliary Subsystems include: WBS 1.8.6.1 Local Utility Services; WBS 1.8.6.2 Cable Trays; WBS 1.8.6.3 Personnel, Safety, and Occupational Access; WBS 1.8.6.4 Assembly, Installation, and Maintenance Equipment; WBS 1.8.6.4.1 Target Chamber Service System; WBS 1.8.6.4.2 Target Bay Service Systems

  7. Modeling and stability analysis for the upper atmosphere research satellite auxiliary array switch component

    Science.gov (United States)

    Wolfgang, R.; Natarajan, T.; Day, J.

    1987-01-01

    A feedback control system, called an auxiliary array switch, was designed to connect or disconnect auxiliary solar panel segments from a spacecraft electrical bus to meet fluctuating demand for power. A simulation of the control system was used to carry out a number of design and analysis tasks that could not economically be performed with a breadboard of the hardware. These tasks included: (1) the diagnosis of a stability problem, (2) identification of parameters to which the performance of the control system was particularly sensitive, (3) verification that the response of the control system to anticipated fluctuations in the electrical load of the spacecraft was satisfactory, and (4) specification of limitations on the frequency and amplitude of the load fluctuations.

  8. Dual resonance in a waveguide-coupled ring microresonator

    Czech Academy of Sciences Publication Activity Database

    Čtyroký, Jiří; Richter, I.; Šiňor, M.

    2006-01-01

    Roč. 38, 9/11 (2006), s. 9-11 ISSN 0306-8919. [OWTNM 2006 - International Workshop on Optical Waveguide Theory and Numerical Modelling. Varese, 20.04.2006-21.04.2006] R&D Projects: GA ČR(CZ) GA102/05/0987; GA MŠk OC 288.001 Institutional research plan: CEZ:AV0Z20670512 Keywords : optical waveguide theory * integrated optics * modelling Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.644, year: 2006

  9. Resonance Capture in Unbalanced Dual-Spin Spacecraft

    Science.gov (United States)

    1994-03-01

    York, 1989. 22. Wittenburg, Jens. "Beitrige zur dynamik von gyrostaten." In Convegno Inter- nazaionale sul Tema: Metodi Valutativi Nella Fisica ...Matematica, Roma, 15-19 dicembre 1972, Problemi Attuali di Scienza e di Cultura , Quaderno N. 217, pages 217-354. Accademia Nazionale dei Lincei, 1975. 23

  10. Note on Nahm's partition function of the dual spectrum II

    CERN Document Server

    Minimi, M

    1977-01-01

    For pt.I see CERN publication TH2240. In part I, in considering the Nahm dual resonance mass spectra theory, it was noticed that there is another modular form; a generating function that transforms automorphically under T:w to -1/w and would realize the Veneziano dualism. The group structure associated with this form is studied since it appears, to the authors, to be more natural than Nahm's original. (6 refs).

  11. The application of 99Tcm-phytate scintigraphy in pig auxiliary liver transplantation

    International Nuclear Information System (INIS)

    Lin Jianhua; Li Xiaoping; Li Chaolong; He Xu; Lin Zhiqi; Zhu Weibing

    2001-01-01

    Objective: To affirm the application value of 99 Tc m -phytate scintigraphy in pig auxiliary liver transplantation. Methods: The graft was transplanted in the right subhepatic space of recipient to establish pig auxiliary liver transplantation model. The artery blood supplies were the very same in all grafts and the portal vein (PV) blood flows were differently controlled by trussing the host PV at the site neared host liver. According to the constriction degree, PV blood supplies were divided into three groups including A (constricted by 1/3), B (constricted by 1/2) and C(not constricted). The blood flows of the graft liver and the host liver were measured by 99 Tc m -phytate scintigraphy and livers functions were estimated after auxiliary liver transplantation. Contrasted with its histological findings the reflection of graft survival with 99 Tc m -phytate scintigraphy was investigated. Results: It was detected by 99 Tc m -phytate scintigraphy that the blood flows were almost equilibrated and abundant in grafts and host liver' in group A, and were abundant in grafts of group B and host livers of group C and were significantly decreased in host livers of group B and grafts of group C. Histological work-up demonstrated that the liver was not atrophic while the blood flow was abundant and the liver was atrophic while the blood flow was decreased. Conclusion: 99 Tc m -phytate scintigraphy could accurately reflect the survival and function of grafts and host livers after auxiliary liver transplantation and it is a reliable technique which can be used to estimate the survival and function of the grafts and host livers

  12. Think different: applying the old macintosh mantra to the computability of the SUSY auxiliary field problem

    International Nuclear Information System (INIS)

    Calkins, Mathew; Gates, D.E.A.; Gates, S. James Jr.; Golding, William M.

    2015-01-01

    Starting with valise supermultiplets obtained from 0-branes plus field redefinitions, valise adinkra networks, and the “Garden Algebra,” we discuss an architecture for algorithms that (starting from on-shell theories and, through a well-defined computation procedure), search for off-shell completions. We show in one dimension how to directly attack the notorious “off-shell auxiliary field” problem of supersymmetry with algorithms in the adinkra network-world formulation.

  13. The 'right hand of the hospital' in a tumultuous land': 'Auxiliary nurses' in Chiapas.

    Science.gov (United States)

    Reiss, Diana

    2005-01-01

    For many, the road to a career in nursing is an unexpected one, with challenging twists and turns along the way. But rarely does it begin with escape down a rain-beaten jungle path, pursued by wined soldiers and tanks. Such is the saga of group of young Mayan auxiliary nurses, who have steadfastly served their commuitities in the troubled southeastern Mexican state of Chiapas, a place where most doctors had fled.

  14. A new auxiliary equation method and its application to the Sharma-Tasso-Olver model

    International Nuclear Information System (INIS)

    Pan Junting; Chen Weizhong

    2009-01-01

    A new auxiliary equation method, constructed by a first order nonlinear ordinary differential equation with at most an eighth-degree nonlinear term, is first proposed for exploring more exact solutions to nonlinear evolution equations. Being concise and straightforward, the method, with the aid of symbolic computation, is applied to the Sharma-Tasso-Olver model, and some new exact solitary wave solutions are obtained. The approach is also applicable to searches for exact solutions of other nonlinear evolution equations.

  15. Auxiliary gauge mediation: a new route to mini-split supersymmetry

    Science.gov (United States)

    Kahn, Yonatan; McCullough, Matthew; Thaler, Jesse

    2013-11-01

    The discovery of a standard-model-like Higgs at 126 GeV and the absence of squark signals thus far at the LHC both point towards a mini-split spectrum for supersymmetry. Within standard paradigms, it is non-trivial to realize a mini-split spectrum with heavier sfermions but lighter gauginos while simultaneously generating Higgs sector soft terms of the correct magnitude, suggesting the need for new models of supersymmetry breaking and mediation. In this paper, we present a new approach to mini-split model building based on gauge mediation by "auxiliary groups", which are the anomaly-free continuous symmetries of the standard model in the limit of vanishing Yukawa couplings. In addition to the well-known flavor SU(3) F and baryon-minus-lepton U(1) B-L groups, we find that an additional U(1) H acting on the Higgs doublets alone can be used to generate Higgs soft masses and B-terms necessary for a complete model of mini-split. Auxiliary gauge mediation is a special case of Higgsed gauge mediation, and we review the resulting two-loop scalar soft terms as well as three-loop gaugino masses. Along the way, we present a complete two-loop calculation of A-terms and B-terms in gauge mediation, which — contrary to a common misconception — includes a non-zero contribution at the messenger threshold which can be sizable in models with light gauginos. We present several phenomenologically acceptable mini-split spectra arising from auxiliary gauge mediation and highlight a complete minimal model which realizes the required spectrum and Higgs sector soft terms with a single U(1) X auxiliary gauge symmetry. We discuss possible experimental consequences.

  16. Common-cause failure analysis of McGuire Unit 2 auxiliary feedwater system

    International Nuclear Information System (INIS)

    Rasmuson, D.M.; Shepherd, J.C.; Fowler, R.D.; Summitt, R.L.; Logan, B.W.

    1982-01-01

    A powerful method for qualitative common cause failure analysis (CCFA) of nuclear power plant systems was developed by EG and G Idaho at the Idaho National Engineering Laboratory. As a cooperative project to demonstrate and evaluate the usefulness of the method, the Duke Power Company agreed to allow a CCFA of the auxiliary feedwater system (AFWS) in their McGuire Nuclear Station Unit 2. The results of the CCFA are the subject of this discussion

  17. Dermoscopy as an auxiliary tool for the diagnosis of furuncular myiasis*

    Science.gov (United States)

    Bernardes, Fred; Martins, Gustavo; Barbará, Eduarda Faísca; de Paiva, Maria Luiza Barros; Coelho, Ricardo Luis Passos; Nery, José Augusto da Costa

    2014-01-01

    Furuncular myiasis occurs after larvae penetrate on the skin. The disease is characterized by the presence of a nodule with a central hole through which there is serosanguinous exudate drainage. The authors present a case of furuncular myiasis by Dermatobia hominis in which late diagnosis made it necessary to have the orifice margins surgically enlarged in order to extract the larva. They also emphasize that dermoscopy is a useful auxiliary tool in this diagnosis. PMID:25054760

  18. Experimental simulation of a light aircraft crash on to a nuclear power plant auxiliary building roof

    International Nuclear Information System (INIS)

    Barnes, D.; Barr, P.; Garton, G.; Howe, W.D.; Neilson, A.J.

    1984-08-01

    The experiments described were conducted at a reduced scale with geometric dimensions of prototype structures of one-fifth full size. The target was based on the auxiliary buildings for the proposed Sizewell PWR. Descriptions of the simulated aircraft model and the test panels are given, together with the instrumentation. Details are given of the test programme and the results are summarized and discussed. Comparison is made of the model aircraft tests with an equivalent hard missile impact. (U.K.)

  19. Direct enantioselective conjugate addition of carboxylic acids with chiral lithium amides as traceless auxiliaries.

    Science.gov (United States)

    Lu, Ping; Jackson, Jeffrey J; Eickhoff, John A; Zakarian, Armen

    2015-01-21

    Michael addition is a premier synthetic method for carbon-carbon and carbon-heteroatom bond formation. Using chiral dilithium amides as traceless auxiliaries, we report the direct enantioselective Michael addition of carboxylic acids. A free carboxyl group in the product provides versatility for further functionalization, and the chiral reagent can be readily recovered by extraction with aqueous acid. The method has been applied in the enantioselective total synthesis of the purported structure of pulveraven B.

  20. Utilization of Lavandula angustifolia Miller extracts as naturalrepellents, pharmaceutical and industrial auxiliaries

    Directory of Open Access Journals (Sweden)

    AYOE YUSUFOGLU

    2004-01-01

    Full Text Available Essential oils, absolutes and concretes were prepared from the flowers and leaves of the plant Lavandula angustifolia Miller cultivated in the Bosphorus region of Istanbul, Turkey. The difference in the chemical composition of the mentioned extracts was investigated and compared by using a combination of capillary GC-MS with the aim of offering them as repellent, pharmaceutical and industrial auxiliaries. The IR-spectra, the yields and the physico-chemical data of the extracts were also analysed.

  1. Sodium--NaK engineering handbook. Volume IV. Sodium pumps, valves, piping, and auxiliary equipment

    Energy Technology Data Exchange (ETDEWEB)

    Foust, O J [ed.

    1978-01-01

    The handbook is useful for designers in the Liquid Metals Fast Breeder Reactor (LMFBR) program and by the engineering and scientific community performing investigation and experimentation requiring high-temperature Na and NaK technology. Data are presented for pumps, bearings and seals, valves, vessels and piping, and auxiliary equipment including vapor traps, freeze plugs, fuel-channel flow regulators, antivortexing devices, and miscellaneous mechanical elements. Reactor materials are also discussed. (FS)

  2. A Sound Processor for Cochlear Implant Using a Simple Dual Path Nonlinear Model of Basilar Membrane

    OpenAIRE

    Kim, Kyung Hwan; Choi, Sung Jin; Kim, Jin Ho

    2013-01-01

    We propose a new active nonlinear model of the frequency response of the basilar membrane in biological cochlea called the simple dual path nonlinear (SDPN) model and a novel sound processing strategy for cochlear implants (CIs) based upon this model. The SDPN model was developed to utilize the advantages of the level-dependent frequency response characteristics of the basilar membrane for robust formant representation under noisy conditions. In comparison to the dual resonance nonlinear mode...

  3. Higher Representations Duals

    DEFF Research Database (Denmark)

    Sannino, Francesco

    2010-01-01

    We uncover novel solutions of the 't Hooft anomaly matching conditions for scalarless gauge theories with matter transforming according to higher dimensional representations of the underlying gauge group. We argue that, if the duals exist, they are gauge theories with fermions transforming accord......-Dyson approximation. We use the solutions to gain useful insight on the conformal window of the associated electric theory. A consistent picture emerges corroborating previous results obtained via different analytic methods and in agreement with first principle lattice explorations....

  4. Dual isotope assays

    International Nuclear Information System (INIS)

    Smith, G.F.W.; Stevens, R.A.J.; Jacoby, B.

    1980-01-01

    Dual isotope assays for thyroid function are performed by carrying out a radio-immunoassay for two of thyroxine (T4), tri-iodothyronine (T3), thyroid stimulating hormone (TSH), and thyroxine binding globulin (TBG), by a method wherein a version of one of the thyroid components, preferably T4 or T3 is labelled with Selenium-75 and the version of the other thyroid component is labelled with a different radionuclide, preferably Iodine-125. (author)

  5. [Auxiliary cerclage-wiring in internal fixation of displaced acetabular fractures].

    Science.gov (United States)

    Erichsen, C J; von Rüden, C; Hierholzer, C; Bühren, V; Woltmann, A

    2015-01-01

    Displaced fractures of the acetabulum involving the quadrilateral plate continue to be a surgical challenge. In this study, we describe our operation technique of auxiliary acetabular cerclage-wiring combined with plate osteosynthesis and present our results as well as short-term outcome. All patients aged 18 years and older treated with auxiliary cerclage-wiring between 2007 and 2012 were included in this study. Fractures were classified according to Letournel. Cerclage wiring was used when reposition and retention of the fracture was insufficient with plates and screws alone. Short-term outcome was evaluated by the German Short Musculoskeletal Functional Assessment (SMFA-D) questionnaire. Data from 23 patients were collected. The follow-up period was 7 months (range 2-23 months). Of the 23 patients, 22 showed excellent fracture reduction and retention. One patient had to undergo revision surgery due to loss of reposition. Patients showed good functional outcome. Auxiliary acetabular cerclage-wiring is a safe and effective method for fracture reduction and retention especially in displaced acetabular fractures involving the quadrilateral plate.

  6. Comparative LCA of methanol-fuelled SOFCs as auxiliary power systems on-board ships

    International Nuclear Information System (INIS)

    Strazza, C.; Del Borghi, A.; Costamagna, P.; Traverso, A.; Santin, M.

    2010-01-01

    Fuel cells own the potential for significant environmental improvements both in terms of air quality and climate protection. Through the use of renewable primary energies, local pollutant and greenhouse gas emissions can be significantly minimized over the full life cycle of the electricity generation process, so that marine industry accounts renewable energy as its future energy source. The aim of this paper is to evaluate the use of methanol in Solid Oxide Fuel Cells (SOFC), as auxiliary power systems for commercial vessels, through Life Cycle Assessment (LCA). The LCA methodology allows the assessment of the potential environmental impact along the whole life cycle of the process. The unit considered is a 20 kWel fuel cell system. In a first part of the study different fuel options have been compared (methanol, bio-methanol, natural gas, hydrogen from cracking, electrolysis and reforming), then the operation of the cell fed with methanol has been compared with the traditional auxiliary power system, i.e. a diesel engine. The environmental benefits of the use of fuel cells have been assessed considering different impact categories. The results of the analysis show that fuel production phase has a strong influence on the life cycle impacts and highlight that feeding with bio-methanol represents a highly attractive solution from a life cycle point of view. The comparison with the conventional auxiliary power system shows extremely lower impacts for SOFCs.

  7. Modulatory mechanisms and multiple functions of somatodendritic A-type K+ channel auxiliary subunits

    Directory of Open Access Journals (Sweden)

    Henry Hungtao Jerng

    2014-03-01

    Full Text Available Auxiliary subunits are non-conducting, modulatory components of the multi-protein ion channel complexes that underlie normal neuronal signaling. They interact with the pore-forming α-subunits to modulate surface distribution, ion conductance, and channel gating properties. For the somatodendritic subthreshold A-type potassium (ISA channel based on Kv4 α-subunits, two types of auxiliary subunits have been extensively studied: Kv channel-interacting proteins (KChIPs and dipeptidyl peptidase-like proteins (DPLPs. KChIPs are cytoplasmic calcium-binding proteins that interact with intracellular portions of the Kv4 subunits, whereas DPLPs are type II transmembrane proteins that associate with the Kv4 channel core. Both KChIPs and DPLPs genes contain multiple start sites that are used by various neuronal populations to drive the differential expression of functionally distinct N-terminal variants. In turn, these N-terminal variants generate tremendous functional diversity across the nervous system. Here, we focus our review on (1 the molecular mechanism underlying the unique properties of different N-terminal variants, (2 the shaping of native ISA properties by the concerted actions of KChIPs and DPLP variants, and (3 the surprising ways that KChIPs and DPLPs coordinate the activity of multiple channels to fine-tune neuronal excitability. Unlocking the unique contributions of different auxiliary subunit N-terminal variants may provide an important opportunity to develop novel targeted therapeutics to treat numerous neurological disorders.

  8. The SOL-2/Neto auxiliary protein modulates the function of AMPA-subtype ionotropic glutamate receptors.

    Science.gov (United States)

    Wang, Rui; Mellem, Jerry E; Jensen, Michael; Brockie, Penelope J; Walker, Craig S; Hoerndli, Frédéric J; Hauth, Linda; Madsen, David M; Maricq, Andres V

    2012-09-06

    The neurotransmitter glutamate mediates excitatory synaptic transmission by gating ionotropic glutamate receptors (iGluRs). AMPA receptors (AMPARs), a subtype of iGluR, are strongly implicated in synaptic plasticity, learning, and memory. We previously discovered two classes of AMPAR auxiliary proteins in C. elegans that modify receptor kinetics and thus change synaptic transmission. Here, we have identified another auxiliary protein, SOL-2, a CUB-domain protein that associates with both the related auxiliary subunit SOL-1 and with the GLR-1 AMPAR. In sol-2 mutants, behaviors dependent on glutamatergic transmission are disrupted, GLR-1-mediated currents are diminished, and GLR-1 desensitization and pharmacology are modified. Remarkably, a secreted variant of SOL-1 delivered in trans can rescue sol-1 mutants, and this rescue depends on in cis expression of SOL-2. Finally, we demonstrate that SOL-1 and SOL-2 have an ongoing role in the adult nervous system to control AMPAR-mediated currents. Copyright © 2012 Elsevier Inc. All rights reserved.

  9. Environmental impact assessment of the incineration of municipal solid waste with auxiliary coal in China

    DEFF Research Database (Denmark)

    Zhao, Yan; Xing, Wei; Lu, Wenjing

    2012-01-01

    The environmental impacts of waste incineration with auxiliary coal were investigated using the life-cycle-based software, EASEWASTE, based on the municipal solid waste (MSW) management system in Shuozhou City. In the current system, MSW is collected, transported, and incinerated with 250kg of co...... political reduction targets. Results indicate that heavy metal and acidic gas emissions should be given more attention in waste incineration. This study provides scientific support for the management of MSW systems dominated by incineration with auxiliary coal in China.......The environmental impacts of waste incineration with auxiliary coal were investigated using the life-cycle-based software, EASEWASTE, based on the municipal solid waste (MSW) management system in Shuozhou City. In the current system, MSW is collected, transported, and incinerated with 250kg of coal...... per ton of waste. Based on observed environmental impacts of incineration, fossil CO2 and heavy metals were primary contributors to global warming and ecotoxicity in soil, respectively. Compared with incinerators using excess coal, incineration with adequate coal presents significant benefits...

  10. Apparatus and methods for supplying auxiliary steam in a combined cycle system

    Science.gov (United States)

    Gorman, William G.; Carberg, William George; Jones, Charles Michael

    2002-01-01

    To provide auxiliary steam, a low pressure valve is opened in a combined cycle system to divert low pressure steam from the heat recovery steam generator to a header for supplying steam to a second combined cycle's steam turbine seals, sparging devices and cooling steam for the steam turbine if the steam turbine and gas turbine lie on a common shaft with the generator. Cooling steam is supplied the gas turbine in the combined cycle system from the high pressure steam turbine. Spent gas turbine cooling steam may augment the low pressure steam supplied to the header by opening a high pressure valve whereby high and low pressure steam flows are combined. An attemperator is used to reduce the temperature of the combined steam in response to auxiliary steam flows above a predetermined flow and a steam header temperature above a predetermined temperature. The auxiliary steam may be used to start additional combined cycle units or to provide a host unit with steam turbine cooling and sealing steam during full-speed no-load operation after a load rejection.

  11. Marginal hazard regression for correlated failure time data with auxiliary covariates.

    Science.gov (United States)

    Liu, Yanyan; Yuan, Zhongshang; Cai, Jianwen; Zhou, Haibo

    2012-01-01

    In many biomedical studies, it is common that due to budget constraints, the primary covariate is only collected in a randomly selected subset from the full study cohort. Often, there is an inexpensive auxiliary covariate for the primary exposure variable that is readily available for all the cohort subjects. Valid statistical methods that make use of the auxiliary information to improve study efficiency need to be developed. To this end, we develop an estimated partial likelihood approach for correlated failure time data with auxiliary information. We assume a marginal hazard model with common baseline hazard function. The asymptotic properties for the proposed estimators are developed. The proof of the asymptotic results for the proposed estimators is nontrivial since the moments used in estimating equation are not martingale-based and the classical martingale theory is not sufficient. Instead, our proofs rely on modern empirical process theory. The proposed estimator is evaluated through simulation studies and is shown to have increased efficiency compared to existing methods. The proposed method is illustrated with a data set from the Framingham study.

  12. When you have too many features: Auxiliaries, agreement and clitics in Italian varieties

    Directory of Open Access Journals (Sweden)

    Roberta D'Alessandro

    2017-05-01

    Full Text Available Syntactic variation can be ascribed to a range of factors. The Borer-Chomsky conjecture, as Mark Baker (2008 refers to it, states for instance that all parameters of variation are attributable to differences in the features of particular items (e.g. functional heads in the lexicon. In this paper, this hypothesis is carefully considered in relation to a group of Abruzzese dialects that exhibit three seemingly unrelated syntactic patterns: split auxiliary selection, split differential object marking, and omnivorous participial agreement in number/argumental agreement mismatch marking. It will be proposed that these three patterns are closely interrelated, and can be attributed to the presence of an unvalued bundle of φ-features (π. Depending on which XP this head is merged with, different agreement patterns will emerge. Furthermore, these dialects will be shown to differ from another macrogroup of northern Italian dialects purely in the locus of Merge of this extra functional head: it will also be shown that the almost perfect areal complementary distribution between languages with subject clitics and languages with person-driven auxiliary selection is not accidental, but is the result of the presence of an extra φ-probe doubling the features of the subject in different parts of the syntactic spine. A microtypology of 'v 'will be presented, unifying many phenomena that were previously considered unrelated, such as auxiliary selection, participial agreement, differential object marking and subject clitics.

  13. Dual-Schemata Model

    Science.gov (United States)

    Taniguchi, Tadahiro; Sawaragi, Tetsuo

    In this paper, a new machine-learning method, called Dual-Schemata model, is presented. Dual-Schemata model is a kind of self-organizational machine learning methods for an autonomous robot interacting with an unknown dynamical environment. This is based on Piaget's Schema model, that is a classical psychological model to explain memory and cognitive development of human beings. Our Dual-Schemata model is developed as a computational model of Piaget's Schema model, especially focusing on sensori-motor developing period. This developmental process is characterized by a couple of two mutually-interacting dynamics; one is a dynamics formed by assimilation and accommodation, and the other dynamics is formed by equilibration and differentiation. By these dynamics schema system enables an agent to act well in a real world. This schema's differentiation process corresponds to a symbol formation process occurring within an autonomous agent when it interacts with an unknown, dynamically changing environment. Experiment results obtained from an autonomous facial robot in which our model is embedded are presented; an autonomous facial robot becomes able to chase a ball moving in various ways without any rewards nor teaching signals from outside. Moreover, emergence of concepts on the target movements within a robot is shown and discussed in terms of fuzzy logics on set-subset inclusive relationships.

  14. The DUAL mission concept

    Science.gov (United States)

    von Ballmoos, Peter; Alvarez, Jose; Barriere, Nicolas; Boggs, Steve; Bykov, Andrei; Del Cura Velayos, Juan Manuel; Frontera, Filippo; Hanlon, Lorraine; Hernanz, Margarita; Hinglais, Emmanuel; Isern, Jordi; Jean, Pierre; Knödlseder, Jürgen; Kuiper, Lucien; Leising, Mark; Pirard, Benoît; Prost, Jean-Pierre; da Silva, Rui; Takahashi, Tadayuki; Tomsick, John; Walter, Roland; Zoglauer, Andreas

    2011-09-01

    DUAL will study the origin and evolution of the elements and explores new frontiers of physics: extreme energies that drive powerful stellar explosions and accelerate particles to macroscopic energies; extreme densities that modify the laws of physics around the most compact objects known; and extreme fields that influence matter in a way that is unknown on Earth. The variability of these extreme objects requires continuous all-sky coverage, while detailed study demands an improvement in sensitivity over previous technologies by at least an order of magnitude. The DUAL payload is composed of an All-Sky Compton Imager (ASCI), and two optical modules, the Laue-Lens Optic (LLO) and the Coded-Mask Optic (CMO). The ASCI serves dual roles simultaneously, both as an optimal focal-plane sensor for deep observations with the optical modules and as a sensitive true all-sky telescope in its own right for all-sky surveys and monitoring. While the optical modules are located on the main satellite, the All-Sky Compton Imager is situated on a deployable structure at a distance of 30 m from the satellite. This configuration not only permits to maintain the less massive payload at the focal distance, it also greatly reduces the spacecraft-induced detector background, and, above all it provides ASCI with a continuous all-sky exposure.

  15. Cryogenic Preamplifiers for Magnetic Resonance Imaging

    DEFF Research Database (Denmark)

    Johansen, Daniel H.; Sanchez-Heredia, Juan D.; Petersen, Jan R.

    2018-01-01

    Pursuing the ultimate limit of detection in magnetic resonance imaging (MRI) requires cryogenics to decrease the thermal noise of the electronic circuits. As cryogenic coils for MRI are slowly emerging cryogenic preamplifiers are required to fully exploit their potential. A cryogenic preamplifier...... operated at 77 K is designed and implemented for C imaging at 3 T (32.13 MHz), using off-the-shelves components. The design is based on a high electron mobility transistor (ATF54143) in a common source configuration. Required auxiliary circuitry for optimal cryogenic preamplifier performance is also...... presented consisting of a voltage regulator (noise free supply voltage and optimal power consumption), switch, and trigger (for active detuning during transmission to protect the preamplifier). A gain of 18 dB with a noise temperature of 13.7 K is achieved. Performing imaging experiments in a 3 T scanner...

  16. Longitudinal Acceleration Test of Overhead Luggage Bins and Auxiliary Fuel Tank in a Transport Airplane Airframe Section, Part 2

    National Research Council Canada - National Science Library

    McGuire, Robert

    2000-01-01

    ...). The purpose of the tests was to measure the structural responses and interaction between the fuselage, overhead stowage bins, and auxiliary fuel tank under simulated, potentially survivable, crash conditions...

  17. Longitudinal Acceleration Tests of Overhead Luggage Bins and Auxiliary Fuel Tank in a Transport Airplane Airframe Section

    National Research Council Canada - National Science Library

    McGuire, Robert

    1999-01-01

    ...). The purpose of the tests was to measure the structural responses and interaction between the fuselage, overhead stowage bins, and auxiliary fuel tank under simulated, potentially survivable, crash conditions...

  18. Mollenhauer Aligning Auxiliary for Bodily Alignment of Blocked-out Lateral Incisors in Preadjusted Edgewise Appliance Therapy

    Directory of Open Access Journals (Sweden)

    Sreekrishnan B Nair

    2014-01-01

    Conclusion: Mollenhauer aligning auxiliary can be effectively used for the bodily alignment of lingually placed lateral incisors in preadjusted edgewise appliance therapy as an alternative to torquing with rectangular wires.

  19. Lower Snake River Little Goose and Lower Granite Locks and Dams: Adult Fishway Systems Emergency Auxiliary Water Supply

    National Research Council Canada - National Science Library

    Wielick, Rolf

    2000-01-01

    ... to address the Biological Opinion requirement. This Emergency Auxiliary Water Supply, Phase II - Technical Report continues to evaluate the Phase I report alternatives for the Little Goose and Lower Granite Lock and Dams at a greater...

  20. 75 FR 3682 - Revisions to Rules Authorizing the Operation of Low Power Auxiliary Stations in the 698-806 MHz...

    Science.gov (United States)

    2010-01-22

    ... Auxiliary Stations, Including Wireless Microphones, and the Digital Television Transition AGENCY: Federal... seeks comment on the adoption in its rules marketing and labeling requirements, including possible... in part on technological innovation such as digital technology, that would enable wireless...

  1. Rates of auxiliary is and are in African American English speaking children with specific language impairment following language treatment.

    Science.gov (United States)

    Smith, Shana; Bellon-Harn, Monica L

    2015-02-01

    The purpose of this exploratory study is to examine rates of auxiliary is and are across dialect patterns produced by African American English with specific language impairment (AAE-SLI) children following language treatment. The following research question is asked: Do AAE-SLI children exhibit rates of auxiliary is and are across dialect patterns consistent with previous reports of typically developing children and adult AAE speakers? A pre-/post-test design was used to identify patterns in which auxiliary is and are were produced at significant levels. Individual performance was included to examine variable rates of use across patterns. Group and individual results suggest children used auxiliary is and are in dialect patterns at rates consistent with typically developing child and adult AAE speakers. We conclude that rates of use may contribute to evidence-based guidelines for morphological intervention with AAE-SLI children.

  2. Engineering the CernVM-Filesystem as a High Bandwidth Distributed Filesystem for Auxiliary Physics Data

    Energy Technology Data Exchange (ETDEWEB)

    Dykstra, D. [Fermilab; Bockelman, B. [Nebraska U.; Blomer, J. [CERN; Herner, K. [Fermilab; Levshina, T. [Fermilab; Slyz, M. [Fermilab

    2015-12-23

    A common use pattern in the computing models of particle physics experiments is running many distributed applications that read from a shared set of data files. We refer to this data is auxiliary data, to distinguish it from (a) event data from the detector (which tends to be different for every job), and (b) conditions data about the detector (which tends to be the same for each job in a batch of jobs). Relatively speaking, conditions data also tends to be relatively small per job where both event data and auxiliary data are larger per job. Unlike event data, auxiliary data comes from a limited working set of shared files. Since there is spatial locality of the auxiliary data access, the use case appears to be identical to that of the CernVM- Filesystem (CVMFS). However, we show that distributing auxiliary data through CVMFS causes the existing CVMFS infrastructure to perform poorly. We utilize a CVMFS client feature called 'alien cache' to cache data on existing local high-bandwidth data servers that were engineered for storing event data. This cache is shared between the worker nodes at a site and replaces caching CVMFS files on both the worker node local disks and on the site's local squids. We have tested this alien cache with the dCache NFSv4.1 interface, Lustre, and the Hadoop Distributed File System (HDFS) FUSE interface, and measured performance. In addition, we use high-bandwidth data servers at central sites to perform the CVMFS Stratum 1 function instead of the low-bandwidth web servers deployed for the CVMFS software distribution function. We have tested this using the dCache HTTP interface. As a result, we have a design for an end-to-end high-bandwidth distributed caching read-only filesystem, using existing client software already widely deployed to grid worker nodes and existing file servers already widely installed at grid sites. Files are published in a central place and are soon available on demand throughout the grid and cached

  3. Design and operation of the LAMPF Auxiliary Controller. High-speed remote processing on the CAMAC dataway

    International Nuclear Information System (INIS)

    Machen, D.R.

    1979-02-01

    A CAMAC Auxiliary Controller has been developed to further the concepts of distributed processing in both process control and experiment data-acquisition systems. The Auxiliary Controller is built around a commercially available 16-bit microcomputer and a high-speed bit-sliced microprocessor capable of instruction execution times of 140 ns. The modular nature of the controller allows the user to tailor the controller capabilities to the system problem, while maintaining the interface techniques of the CAMAC Standard

  4. Vision sensor and dual MEMS gyroscope integrated system for attitude determination on moving base

    Science.gov (United States)

    Guo, Xiaoting; Sun, Changku; Wang, Peng; Huang, Lu

    2018-01-01

    To determine the relative attitude between the objects on a moving base and the base reference system by a MEMS (Micro-Electro-Mechanical Systems) gyroscope, the motion information of the base is redundant, which must be removed from the gyroscope. Our strategy is to add an auxiliary gyroscope attached to the reference system. The master gyroscope is to sense the total motion, and the auxiliary gyroscope is to sense the motion of the moving base. By a generalized difference method, relative attitude in a non-inertial frame can be determined by dual gyroscopes. With the vision sensor suppressing accumulative drift of the MEMS gyroscope, the vision and dual MEMS gyroscope integration system is formed. Coordinate system definitions and spatial transform are executed in order to fuse inertial and visual data from different coordinate systems together. And a nonlinear filter algorithm, Cubature Kalman filter, is used to fuse slow visual data and fast inertial data together. A practical experimental setup is built up and used to validate feasibility and effectiveness of our proposed attitude determination system in the non-inertial frame on the moving base.

  5. Auxiliary variables in multiple imputation in regression with missing X: a warning against including too many in small sample research

    Directory of Open Access Journals (Sweden)

    Hardt Jochen

    2012-12-01

    Full Text Available Abstract Background Multiple imputation is becoming increasingly popular. Theoretical considerations as well as simulation studies have shown that the inclusion of auxiliary variables is generally of benefit. Methods A simulation study of a linear regression with a response Y and two predictors X1 and X2 was performed on data with n = 50, 100 and 200 using complete cases or multiple imputation with 0, 10, 20, 40 and 80 auxiliary variables. Mechanisms of missingness were either 100% MCAR or 50% MAR + 50% MCAR. Auxiliary variables had low (r=.10 vs. moderate correlations (r=.50 with X’s and Y. Results The inclusion of auxiliary variables can improve a multiple imputation model. However, inclusion of too many variables leads to downward bias of regression coefficients and decreases precision. When the correlations are low, inclusion of auxiliary variables is not useful. Conclusion More research on auxiliary variables in multiple imputation should be performed. A preliminary rule of thumb could be that the ratio of variables to cases with complete data should not go below 1 : 3.

  6. Dual Smarandache Curves of a Timelike Curve lying on Unit dual Lorentzian Sphere

    OpenAIRE

    Kahraman, Tanju; Hüseyin Ugurlu, Hasan

    2016-01-01

    In this paper, we give Darboux approximation for dual Smarandache curves of time like curve on unit dual Lorentzian sphere. Firstly, we define the four types of dual Smarandache curves of a timelike curve lying on dual Lorentzian sphere.

  7. Self-dual electromagnetic fields

    Science.gov (United States)

    Chubykalo, Andrew E.; Espinoza, Augusto; Kosyakov, B. P.

    2010-08-01

    We demonstrate the utility of self-dual fields in electrodynamics. Stable configurations of free electromagnetic fields can be represented as superpositions of standing waves, each possessing zero Poynting vector and zero orbital angular momentum. The standing waves are themselves superpositions of self-dual and anti-self-dual solutions. The idea of self-duality provides additional insights into the geometrical and spectral properties of stable electromagnetic configurations, such as those responsible for the formation of ball lightning.

  8. Applied neutron resonance theory

    International Nuclear Information System (INIS)

    Froehner, F.H.

    1978-07-01

    Utilisation of resonance theory in basic and applications-oriented neutron cross section work is reviewed. The technically important resonance formalisms, principal concepts and methods as well as representative computer programs for resonance parameter extraction from measured data, evaluation of resonance data, calculation of Doppler-broadened cross sections and estimation of level-statistical quantities from resonance parameters are described. (orig.) [de

  9. Auxiliary propulsion

    Science.gov (United States)

    Rosenberg, S. D.

    1984-02-01

    When man is put in the loop, almost anything can happen. Caution must be exercised in permitting life cycle costs analysis to control technology investment. One of the ways of reducing cost is to stay with the old tried and true technology. However, when requirements of a permanent space station are considered (15-year life, the issues associated with health monitoring, maintenance, and repair), the conclusion is that very little, if anything, is really state of the art. Before investing in old technologies to make them comply with the requirements of a permanent space station, the question of whether or not it is worth putting the money there as opposed to advancing the state of the art should be considered. Program managers and system designers must not make the mistake of selecting old technologies in the belief that they are state of the art.

  10. Dual symmetry in gauge theories

    International Nuclear Information System (INIS)

    Koshkarov, A.L.

    1997-01-01

    Continuous dual symmetry in electrodynamics, Yang-Mills theory and gravitation is investigated. Dual invariant which leads to badly nonlinear motion equations is chosen as a Lagrangian of the pure classical dual nonlinear electrodynamics. In a natural manner some dual angle which is determined by the electromagnetic strengths at the point of the time-space appears in the model. Motion equations may well be interpreted as the equations of the standard Maxwell theory with source. Alternative interpretation is the quasi-Maxwell linear theory with magnetic charge. Analogous approach is possible in the Yang-Mills theory. In this case the dual-invariant non-Abelian theory motion equations possess the same instanton solutions as the conventional Yang-Mills equations have. An Abelian two-parameter dual group is found to exist in gravitation. Irreducible representations have been obtained: the curvature tensor was expanded into the sum of twice anti-self-dual and self-dual parts. Gravitational instantons are defined as (real )solutions to the usual duality equations. Central symmetry solutions to these equations are obtained. The twice anti-self-dual part of the curvature tensor may be used for introduction of new gravitational equations generalizing Einstein''s equations. However, the theory obtained reduces to the conformal-flat Nordstroem theory

  11. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 1; Issue 10. What Can the Answer be? Reciprocal Basis and Dual Vectors. V Balakrishnan. Series Article Volume 1 Issue 10 October 1996 pp 6-13. Fulltext. Click here to view fulltext PDF. Permanent link:

  12. Dual-beam CRT

    International Nuclear Information System (INIS)

    1975-01-01

    A dual-beam cathode-ray tube having a pair of electron guns and associated deflection means disposed side-by-side on each side of a central axis is described. The electron guns are parallel and the deflection means includes beam centering plates and angled horizontal deflection plates to direct the electron beams toward the central axis, precluding the need for a large-diameter tube neck in which the entire gun structures are angled. Bowing control plates are disposed adjacent to the beam centering plates to minimize trace bowing, and an intergun shield is disposed between the horizontal deflection plates to control and correct display pattern geometry distortion

  13. Dual-band dual-polarized array for WLAN applications

    CSIR Research Space (South Africa)

    Steyn, JM

    2009-01-01

    Full Text Available Paper presents a dual-band dual-polarized antenna array design for WLAN applications. Four double-dipole elements are orthogonally interleaved to facilitate operation in both the standard WLAN frequency bands (IEEE 802.11b and IEEE 802.11a...

  14. MRI (Magnetic Resonance Imaging)

    Science.gov (United States)

    ... Medical Imaging MRI (Magnetic Resonance Imaging) MRI (Magnetic Resonance Imaging) Share Tweet Linkedin Pin it More sharing options Linkedin Pin it Email Print Magnetic Resonance Imaging (MRI) is a medical imaging procedure for ...

  15. Regenerative feedback resonant circuit

    Science.gov (United States)

    Jones, A. Mark; Kelly, James F.; McCloy, John S.; McMakin, Douglas L.

    2014-09-02

    A regenerative feedback resonant circuit for measuring a transient response in a loop is disclosed. The circuit includes an amplifier for generating a signal in the loop. The circuit further includes a resonator having a resonant cavity and a material located within the cavity. The signal sent into the resonator produces a resonant frequency. A variation of the resonant frequency due to perturbations in electromagnetic properties of the material is measured.

  16. Freudenthal Dual Lagrangians

    CERN Document Server

    Borsten, L; Ferrara, S; Marrani, A

    2013-01-01

    The global U-dualities of extended supergravity have played a central role in differentiating the distinct classes of extremal black hole solutions. When the U-duality group satisfies certain algebraic conditions, as is the case for a broad class of supergravities, the extremal black holes enjoy a further symmetry known as Freudenthal duality (F-duality), which although distinct from U-duality preserves the Bekenstein-Hawking entropy. Here it is shown that, by adopting the doubled Lagrangian formalism, F-duality, defined on the doubled field strengths, is not only a symmetry of the black hole solutions, but also of the equations of motion themselves. A further role for F-duality is introduced in the context of world-sheet actions. The Nambu-Goto world-sheet action in any (t, s) signature spacetime can be written in terms of the F-dual. The corresponding field equations and Bianchi identities are then related by F-duality allowing for an F-dual formulation of Gaillard-Zumino duality on the world-sheet. An equi...

  17. High Selectivity Dual-Band Bandpass Filter with Tunable Lower Passband

    OpenAIRE

    Pan, Wei-Qiang; Zhao, Xiao-Lan; Zhang, Yao; Xu, Jin-Xu

    2015-01-01

    This paper presents a novel method to design dual-band bandpass filters with tunable lower passband and fixed upper passband. It utilizes a trimode resonator with three controllable resonant modes. Discriminating coupling is used to suppress the unwanted mode to avoid the interference. Varactors are utilized to realize tunable responses. The bandwidth of the two bands can be controlled individually. Transmission zeros are generated near the passband edges, resulting in high selectivity. For d...

  18. An Auxiliary Variable Method for Markov Chain Monte Carlo Algorithms in High Dimension

    Directory of Open Access Journals (Sweden)

    Yosra Marnissi

    2018-02-01

    Full Text Available In this paper, we are interested in Bayesian inverse problems where either the data fidelity term or the prior distribution is Gaussian or driven from a hierarchical Gaussian model. Generally, Markov chain Monte Carlo (MCMC algorithms allow us to generate sets of samples that are employed to infer some relevant parameters of the underlying distributions. However, when the parameter space is high-dimensional, the performance of stochastic sampling algorithms is very sensitive to existing dependencies between parameters. In particular, this problem arises when one aims to sample from a high-dimensional Gaussian distribution whose covariance matrix does not present a simple structure. Another challenge is the design of Metropolis–Hastings proposals that make use of information about the local geometry of the target density in order to speed up the convergence and improve mixing properties in the parameter space, while not being too computationally expensive. These two contexts are mainly related to the presence of two heterogeneous sources of dependencies stemming either from the prior or the likelihood in the sense that the related covariance matrices cannot be diagonalized in the same basis. In this work, we address these two issues. Our contribution consists of adding auxiliary variables to the model in order to dissociate the two sources of dependencies. In the new augmented space, only one source of correlation remains directly related to the target parameters, the other sources of correlations being captured by the auxiliary variables. Experiments are conducted on two practical image restoration problems—namely the recovery of multichannel blurred images embedded in Gaussian noise and the recovery of signal corrupted by a mixed Gaussian noise. Experimental results indicate that adding the proposed auxiliary variables makes the sampling problem simpler since the new conditional distribution no longer contains highly heterogeneous

  19. Analysis of accelerated failure time data with dependent censoring using auxiliary variables via nonparametric multiple imputation.

    Science.gov (United States)

    Hsu, Chiu-Hsieh; Taylor, Jeremy M G; Hu, Chengcheng

    2015-08-30

    We consider the situation of estimating the marginal survival distribution from censored data subject to dependent censoring using auxiliary variables. We had previously developed a nonparametric multiple imputation approach. The method used two working proportional hazards (PH) models, one for the event times and the other for the censoring times, to define a nearest neighbor imputing risk set. This risk set was then used to impute failure times for censored observations. Here, we adapt the method to the situation where the event and censoring times follow accelerated failure time models and propose to use the Buckley-James estimator as the two working models. Besides studying the performances of the proposed method, we also compare the proposed method with two popular methods for handling dependent censoring through the use of auxiliary variables, inverse probability of censoring weighted and parametric multiple imputation methods, to shed light on the use of them. In a simulation study with time-independent auxiliary variables, we show that all approaches can reduce bias due to dependent censoring. The proposed method is robust to misspecification of either one of the two working models and their link function. This indicates that a working proportional hazards model is preferred because it is more cumbersome to fit an accelerated failure time model. In contrast, the inverse probability of censoring weighted method is not robust to misspecification of the link function of the censoring time model. The parametric imputation methods rely on the specification of the event time model. The approaches are applied to a prostate cancer dataset. Copyright © 2015 John Wiley & Sons, Ltd.

  20. Estimation of Finite Population Ratio When Other Auxiliary Variables are Available in the Study

    Directory of Open Access Journals (Sweden)

    Jehad Al-Jararha

    2014-12-01

    Full Text Available The estimation of the population total $t_y,$ by using one or moreauxiliary variables, and the population ratio $\\theta_{xy}=t_y/t_x,$$t_x$ is the population total for the auxiliary variable $X$, for afinite population are heavily discussed in the literature. In thispaper, the idea of estimation the finite population ratio$\\theta_{xy}$ is extended to use the availability of auxiliaryvariable $Z$ in the study, such auxiliary variable  is not used inthe definition of the population ratio. This idea may be  supported by the fact that the variable $Z$  is highly correlated with the interest variable $Y$ than the correlation between the variables $X$ and $Y.$ The availability of such auxiliary variable can be used to improve the precision of the estimation of the population ratio.  To our knowledge, this idea is not discussed in the literature.  The bias, variance and the mean squares error  are given for our approach. Simulation from real data set,  the empirical relative bias and  the empirical relative mean squares error are computed for our approach and different estimators proposed in the literature  for estimating the population ratio $\\theta_{xy}.$ Analytically and the simulation results show that, by suitable choices, our approach gives negligible bias and has less mean squares error.  

  1. Steady state flow evaluations for passive auxiliary feedwater system of APR

    International Nuclear Information System (INIS)

    Park, Jongha; Kim, Jaeyul; Seong, Hoje; Kang, Kyoungho

    2012-01-01

    This paper briefly introduces a methodology to evaluate steady state flow of APR+ Passive Auxiliary Feedwater System (PAFS). The PAFS is being developed as a safety grade passive system to completely replace the existing active Auxiliary Feedwater System (AFWS). Natural circulation cooling can be generally classified into the single-phase, two-phase, and boiling-condensation modes. The PAF is designed to be operated in a boiling-condensation natural circulation mode. The steady-state flow rate should be equal to the steady-state boiling/condensation rate determined by the steady-state energy and momentum balances in the PAFS. The determined steady-state flow rate can be used in the design optimization for the natural circulation loop of the PAFS through the steady-state momentum balance. Since the retarding force, which is to be balanced by the driving force in the natural circulation system design depends on the reliable evaluation of the success of a natural circulation system design depends on the reliable evaluation of the pressure loss coefficients. In PAFS, the core decay heat is released by natural circulation flow between the S G secondary side and the Passive Condensation Heat Exchanger (PCHX) that is immersed in the Passive Condensation Cooling Tank (PCCT). The PCCT is located on the top of Auxiliary building The driving force is determined by the difference between the S/G (heat Source) secondary water level and condensation liquid (heat sink) level. It will overcome retarding force at flowrate in the system, which is determined by vaporization and condensation of the steam which is generated at the S/G by the latent heat in system. In this study, the theoretical method to estimate the steady state flow rate in boiling-condensation natural circulation system is developed and compared with test results

  2. Environmental impact assessment of the incineration of municipal solid waste with auxiliary coal in China.

    Science.gov (United States)

    Zhao, Yan; Xing, Wei; Lu, Wenjing; Zhang, Xu; Christensen, Thomas H

    2012-10-01

    The environmental impacts of waste incineration with auxiliary coal were investigated using the life-cycle-based software, EASEWASTE, based on the municipal solid waste (MSW) management system in Shuozhou City. In the current system, MSW is collected, transported, and incinerated with 250 kg of coal per ton of waste. Based on observed environmental impacts of incineration, fossil CO(2) and heavy metals were primary contributors to global warming and ecotoxicity in soil, respectively. Compared with incinerators using excess coal, incineration with adequate coal presents significant benefits in mitigating global warming, whereas incineration with a mass of coal can avoid more impacts to acidification, photochemical ozone and nutrient enrichment because of increased electricity substitution and reduced emission from coal power plants. The "Emission standard of air pollutants for thermal power plants (GB13223-2011)" implemented in 2012 introduced stricter policies on controlling SO(2) and NO(x) emissions from coal power plants. Thus, increased use of auxiliary coal during incineration yields fewer avoided impacts on acidification and nutrient enrichment. When two-thirds of ash is source-separated and landfilled, the incineration of rest-waste presents better results on global warming, acidification, nutrient enrichment, and even ecotoxicity in soil. This process is considered a promising solution for MSW management in Shuozhou City. Weighted normalized environmental impacts were assessed based on Chinese political reduction targets. Results indicate that heavy metal and acidic gas emissions should be given more attention in waste incineration. This study provides scientific support for the management of MSW systems dominated by incineration with auxiliary coal in China. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. Asymmetry in Dual Language Practice

    Directory of Open Access Journals (Sweden)

    Audrey Amrein

    2000-01-01

    Full Text Available The capacity for dual-language programs to deliver specific benefits to students with different primary and secondary language skills continues to be debated. Individuals favoring dual language assert that as it relies upon a reciprocal approach, dual language students acquire dual language proficiency without the need for teachers to translate from one language to another. By utilizing and conserving the language skills that students bring, dual language students also gain cross-cultural understandings and an expanded opportunity to realize academic success in the future. Research that explores whether these programs meet the needs of monolingual and bilingual students is limited. The intent of this study is not to criticize dual language practice. Instead, it is to describe a newly implemented dual language immersion program that exists and operates in Phoenix, Arizona. In particular, this study examines the practices of dual language teachers at Leigh Elementary School and the challenges encountered as school personnel worked to provide students with different primary and secondary language skills increased opportunities to learn.

  4. Dual-core Itanium Processor

    CERN Multimedia

    2006-01-01

    Intel’s first dual-core Itanium processor, code-named "Montecito" is a major release of Intel's Itanium 2 Processor Family, which implements the Intel Itanium architecture on a dual-core processor with two cores per die (integrated circuit). Itanium 2 is much more powerful than its predecessor. It has lower power consumption and thermal dissipation.

  5. A reliability centered maintenance model applied to the auxiliary feedwater system of a nuclear power plant

    International Nuclear Information System (INIS)

    Araujo, Jefferson Borges

    1998-01-01

    The main objective of maintenance in a nuclear power plant is to assure that structures, systems and components will perform their design functions with reliability and availability in order to obtain a safety and economic electric power generation. Reliability Centered Maintenance (RCM) is a method of systematic review to develop or optimize Preventive Maintenance Programs. This study presents the objectives, concepts, organization and methods used in the development of RCM application to nuclear power plants. Some examples of this application are included, considering the Auxiliary Feedwater System of a generic two loops PWR nuclear power plant of Westinghouse design. (author)

  6. The integrated design of the ITER magnets and their auxiliary systems

    International Nuclear Information System (INIS)

    Huget, M.

    1999-01-01

    The magnet system design for the International Thermonuclear Experimental Reactor (ITER) has reached a high degree of integration to meet performance and operation requirements, including reliability and maintainability, in a cost effective manner. This paper identifies the requirements of long inductive burn time, large number of tokamak pulses, operational flexibility for the poloidal field (PF) system, magnet reliability and the cost constraints as the main design drivers. Key features of the magnet system which stem from these design drivers are described, together with interfaces and integration aspects of certain auxiliary systems. (author)

  7. Symbolic calculation of auxiliary functions for molecular integrals over Slater orbitals

    International Nuclear Information System (INIS)

    Barnett, M.P.

    2000-01-01

    Symbolic calculation is applied to the evaluation of molecular integrals over Slater orbitals (STOs). A recurrence scheme is developed for some new auxiliary functions that facilitate this work. Closed expressions are developed independently for use in spot checks. A table of formulas for the individual functions has been constructed and made available on-line. Applications are discussed. The derivations and tabulations were performed mechanically in runs that produced both the original typeset account of this study and more detailed documentation without manual transcription

  8. Improved 3-dimensional image processing technology for remote handling auxiliary system

    International Nuclear Information System (INIS)

    Tomizuka, Chiaki; Jinza, Keisuke; Takahashi, Hiroshi

    2008-01-01

    In the radioactive environment of a nuclear facility, access to the work environment is restricted and therefore handling operations are performed using remote controlled devices. Fuji Electric has developed a remote-controlled auxiliary system that utilizes shape recognition technology to identify and visualize the location and orientation of target objects to be handled. By watching the operation screen of this system, an operator can easily control a manipulator or other handling apparatus. This paper presents an overview and describes details of the development of the system. (author)

  9. Exact solution to the 'auxiliary extra-dimension' model of massive gravity

    International Nuclear Information System (INIS)

    Hassan, S.F.; Rosen, Rachel A.

    2011-01-01

    The 'auxiliary extra-dimension' model was proposed in order to provide a geometrical interpretation to modifications of general relativity, in particular to non-linear massive gravity. In this context, the theory was shown to be ghost free to third order in perturbations, in the decoupling limit. In this work, we exactly solve the equation of motion in the extra dimension, to obtain a purely 4-dimensional theory. Using this solution, it is shown that the ghost appears at the fourth order and beyond. We explore potential modifications to address the ghost issue and find that their consistent implementation requires going beyond the present framework.

  10. Procedure of qualification applied to motors driving auxiliaries in fossil fired and nuclear power plants

    International Nuclear Information System (INIS)

    Coperchini, C.; Fises, A.

    1984-01-01

    Twenty year operation have enabled EDF to better understand the factors improving the reliability of powerhouse auxiliary drive induction motors. Progress in the behaviour of such machines are mainly due to analysis and handling of full size test results achieved in the Saint-Denis Motor Test Laboratory. This work led to the printing of recommendations and technical specifications. Service and safety requirements of the nuclear plant new generation lead to examine again the procedures of qualification. The analysis made in this report let appear the justification to maintain the present EDF policy with some necessary adjustments, especially as far as the nuclear safety motors are concerned [fr

  11. Aging and service wear of auxiliary feedwater pumps for PWR nuclear power plants

    International Nuclear Information System (INIS)

    Greenstreet, W.L.

    1989-01-01

    This paper describes investigations on auxiliary feedwater pumps being done under the Nuclear Plant Aging Research (NPAR) Program. Objectives of these studies are: to identify and evaluate practical, cost-effective methods for detecting, monitoring, and assessing the severity of time-dependent degradation (aging and service wear); recommend inspection and maintenance practices; establish acceptance criteria; and help facilitate use of the results. Emphasis is given to identifying and assessing methods for detecting failure in the incipient stage and to developing degradation trends to allow timely maintenance, repair or replacement actions. 3 refs

  12. Charge-constrained auxiliary-density-matrix methods for the Hartree–Fock exchange contribution

    DEFF Research Database (Denmark)

    Merlot, Patrick; Izsak, Robert; Borgoo, Alex

    2014-01-01

    Three new variants of the auxiliary-density-matrix method (ADMM) of Guidon, Hutter, and VandeVondele [J. Chem. Theory Comput. 6, 2348 (2010)] are presented with the common feature thatthey have a simplified constraint compared with the full orthonormality requirement of the earlier ADMM1 method....... All ADMM variants are tested for accuracy and performance in all-electron B3LYP calculations with several commonly used basis sets. The effect of the choice of the exchange functional for the ADMM exchange–correction term is also investigated....

  13. A remarkably stable TipE gene cluster: evolution of insect Para sodium channel auxiliary subunits

    Directory of Open Access Journals (Sweden)

    Li Jia

    2011-11-01

    Full Text Available Abstract Background First identified in fruit flies with temperature-sensitive paralysis phenotypes, the Drosophila melanogaster TipE locus encodes four voltage-gated sodium (NaV channel auxiliary subunits. This cluster of TipE-like genes on chromosome 3L, and a fifth family member on chromosome 3R, are important for the optional expression and functionality of the Para NaV channel but appear quite distinct from auxiliary subunits in vertebrates. Here, we exploited available arthropod genomic resources to trace the origin of TipE-like genes by mapping their evolutionary histories and examining their genomic architectures. Results We identified a remarkably conserved synteny block of TipE-like orthologues with well-maintained local gene arrangements from 21 insect species. Homologues in the water flea, Daphnia pulex, suggest an ancestral pancrustacean repertoire of four TipE-like genes; a subsequent gene duplication may have generated functional redundancy allowing gene losses in the silk moth and mosquitoes. Intronic nesting of the insect TipE gene cluster probably occurred following the divergence from crustaceans, but in the flour beetle and silk moth genomes the clusters apparently escaped from nesting. Across Pancrustacea, TipE gene family members have experienced intronic nesting, escape from nesting, retrotransposition, translocation, and gene loss events while generally maintaining their local gene neighbourhoods. D. melanogaster TipE-like genes exhibit coordinated spatial and temporal regulation of expression distinct from their host gene but well-correlated with their regulatory target, the Para NaV channel, suggesting that functional constraints may preserve the TipE gene cluster. We identified homology between TipE-like NaV channel regulators and vertebrate Slo-beta auxiliary subunits of big-conductance calcium-activated potassium (BKCa channels, which suggests that ion channel regulatory partners have evolved distinct lineage

  14. PT-symmetric quantum models living in an auxiliary Pontryagin space

    Czech Academy of Sciences Publication Activity Database

    Znojil, Miloslav

    2012-01-01

    Roč. 2, č. 2 (2012), s. 102-109 ISSN 2159-5291. [21st International Workshop on Operator Theory and its Applications IWOTA 2010. Berlin, 12.07.2010-16.07.2010] R&D Projects: GA MŠk LC06002; GA ČR GAP203/11/1433 Institutional research plan: CEZ:AV0Z10480505 Keywords : quantum mechanics * Hermitizations of observables * auxiliary Krein and Pontryagin spaces * Jacobi-matrix Hamiltonians * Dieudonn´e equation Subject RIV: BE - Theoretical Physics http://arxiv.org/pdf/1110.1218v1.pdf

  15. Probabilistic analysis of reactor safety - The auxiliary feedwater system of Angra I

    International Nuclear Information System (INIS)

    Oliveira, L.C.R. da L.C. de.

    1981-09-01

    The unavailability of the auxiliary feedwater system (AFWS) of Angra-1, was calculated. The fault tree analysis technique was used, considering two diferent types of contribution to system unavailability: The one due to hard-ware failure and the contribution due to test and maintenance which was separately analysed. The COMBO-and SAMPLE computer codes were used. The results have shown that the AFWS of Angra-1 contains enough redundancy to guarantee a safe operation under the conditions analysed, best values having been obtained for the unavailability of AFWS of Angra 1 with those codes than with the WASH-1400. (E.G.) [pt

  16. Auxiliary plasma heating and fueling models for use in particle simulation codes

    International Nuclear Information System (INIS)

    Procassini, R.J.; Cohen, B.I.

    1989-01-01

    Computational models of a radiofrequency (RF) heating system and neutral-beam injector are presented. These physics packages, when incorporated into a particle simulation code allow one to simulate the auxiliary heating and fueling of fusion plasmas. The RF-heating package is based upon a quasilinear diffusion equation which describes the slow evolution of the heated particle distribution. The neutral-beam injector package models the charge exchange and impact ionization processes which transfer energy and particles from the beam to the background plasma. Particle simulations of an RF-heated and a neutral-beam-heated simple-mirror plasma are presented. 8 refs., 5 figs

  17. Stochastic resonance

    International Nuclear Information System (INIS)

    Wellens, Thomas; Shatokhin, Vyacheslav; Buchleitner, Andreas

    2004-01-01

    We are taught by conventional wisdom that the transmission and detection of signals is hindered by noise. However, during the last two decades, the paradigm of stochastic resonance (SR) proved this assertion wrong: indeed, addition of the appropriate amount of noise can boost a signal and hence facilitate its detection in a noisy environment. Due to its simplicity and robustness, SR has been implemented by mother nature on almost every scale, thus attracting interdisciplinary interest from physicists, geologists, engineers, biologists and medical doctors, who nowadays use it as an instrument for their specific purposes. At the present time, there exist a lot of diversified models of SR. Taking into account the progress achieved in both theoretical understanding and practical application of this phenomenon, we put the focus of the present review not on discussing in depth technical details of different models and approaches but rather on presenting a general and clear physical picture of SR on a pedagogical level. Particular emphasis will be given to the implementation of SR in generic quantum systems-an issue that has received limited attention in earlier review papers on the topic. The major part of our presentation relies on the two-state model of SR (or on simple variants thereof), which is general enough to exhibit the main features of SR and, in fact, covers many (if not most) of the examples of SR published so far. In order to highlight the diversity of the two-state model, we shall discuss several examples from such different fields as condensed matter, nonlinear and quantum optics and biophysics. Finally, we also discuss some situations that go beyond the generic SR scenario but are still characterized by a constructive role of noise

  18. Stochastic resonance

    Science.gov (United States)

    Wellens, Thomas; Shatokhin, Vyacheslav; Buchleitner, Andreas

    2004-01-01

    We are taught by conventional wisdom that the transmission and detection of signals is hindered by noise. However, during the last two decades, the paradigm of stochastic resonance (SR) proved this assertion wrong: indeed, addition of the appropriate amount of noise can boost a signal and hence facilitate its detection in a noisy environment. Due to its simplicity and robustness, SR has been implemented by mother nature on almost every scale, thus attracting interdisciplinary interest from physicists, geologists, engineers, biologists and medical doctors, who nowadays use it as an instrument for their specific purposes. At the present time, there exist a lot of diversified models of SR. Taking into account the progress achieved in both theoretical understanding and practical application of this phenomenon, we put the focus of the present review not on discussing in depth technical details of different models and approaches but rather on presenting a general and clear physical picture of SR on a pedagogical level. Particular emphasis will be given to the implementation of SR in generic quantum systems—an issue that has received limited attention in earlier review papers on the topic. The major part of our presentation relies on the two-state model of SR (or on simple variants thereof), which is general enough to exhibit the main features of SR and, in fact, covers many (if not most) of the examples of SR published so far. In order to highlight the diversity of the two-state model, we shall discuss several examples from such different fields as condensed matter, nonlinear and quantum optics and biophysics. Finally, we also discuss some situations that go beyond the generic SR scenario but are still characterized by a constructive role of noise.

  19. Gray matter volume and dual-task gait performance in mild cognitive impairment.

    Science.gov (United States)

    Doi, Takehiko; Blumen, Helena M; Verghese, Joe; Shimada, Hiroyuki; Makizako, Hyuma; Tsutsumimoto, Kota; Hotta, Ryo; Nakakubo, Sho; Suzuki, Takao

    2017-06-01

    Dual-task gait performance is impaired in older adults with mild cognitive impairment, but the brain substrates associated with dual-task gait performance are not well-established. The relationship between gray matter and gait speed under single-task and dual-task conditions (walking while counting backward) was examined in 560 seniors with mild cognitive impairment (non-amnestic mild cognitive impairment: n = 270; mean age = 72.4 yrs., 63.6 % women; amnestic mild cognitive impairment: n = 290; mean age = 73.4 yrs., 45.4 % women). Multivariate covariance-based analyses of magnetic resonance imaging data, adjusted for potential confounders including single-task gait speed, were performed to identify gray matter patterns associated with dual-task gait speed. There were no differences in gait speed or cognitive performance during dual-task gait between individuals with non-amnestic mild cognitive impairment and amnestic mild cognitive impairment. Overall, increased dual-task gait speed was associated with a gray matter pattern of increased volume in medial frontal gyrus, superior frontal gyrus, anterior cingulate, cingulate, precuneus, fusiform gyrus, middle occipital gyrus, inferior temporal gyrus and middle temporal gyrus. The relationship between dual-task gait speed and brain substrates also differed by mild cognitive impairment subtype. Our study revealed a pattern of gray matter regions associated with dual-task performance. Although dual-task gait performance was similar in amnestic and non-amnestic mild cognitive impairment, the gray matter patterns associated with dual-task gait performance differed by mild cognitive impairment subtype. These findings suggest that the brain substrates supporting dual-task gait performance in amnestic and non-amnestic subtypes are different, and consequently may respond differently to interventions, or require different interventions.

  20. Dual Tank Fuel System

    Science.gov (United States)

    Wagner, Richard William; Burkhard, James Frank; Dauer, Kenneth John

    1999-11-16

    A dual tank fuel system has primary and secondary fuel tanks, with the primary tank including a filler pipe to receive fuel and a discharge line to deliver fuel to an engine, and with a balance pipe interconnecting the primary tank and the secondary tank. The balance pipe opens close to the bottom of each tank to direct fuel from the primary tank to the secondary tank as the primary tank is filled, and to direct fuel from the secondary tank to the primary tank as fuel is discharged from the primary tank through the discharge line. A vent line has branches connected to each tank to direct fuel vapor from the tanks as the tanks are filled, and to admit air to the tanks as fuel is delivered to the engine.

  1. Dual THz comb spectroscopy

    Science.gov (United States)

    Yasui, Takeshi

    2017-08-01

    Optical frequency combs are innovative tools for broadband spectroscopy because a series of comb modes can serve as frequency markers that are traceable to a microwave frequency standard. However, a mode distribution that is too discrete limits the spectral sampling interval to the mode frequency spacing even though individual mode linewidth is sufficiently narrow. Here, using a combination of a spectral interleaving and dual-comb spectroscopy in the terahertz (THz) region, we achieved a spectral sampling interval equal to the mode linewidth rather than the mode spacing. The spectrally interleaved THz comb was realized by sweeping the laser repetition frequency and interleaving additional frequency marks. In low-pressure gas spectroscopy, we achieved an improved spectral sampling density of 2.5 MHz and enhanced spectral accuracy of 8.39 × 10-7 in the THz region. The proposed method is a powerful tool for simultaneously achieving high resolution, high accuracy, and broad spectral coverage in THz spectroscopy.

  2. Dual coolant blanket concept

    International Nuclear Information System (INIS)

    Malang, S.; Schleisiek, K.

    1994-11-01

    A self-cooled liquid metal breeder blanket with helium-cooled first wall ('Dual Coolant Blanket Concept') for a fusion DEMO reactor is described. This is one of the four blanket concepts under development in the frame of the European fusion technology program with the aim to select in 1995 the two most promising ones for further development. Described are the design of the blankets including the ancillary loop system and the results of the theoretical and experimental work in the fields of neutronics, magnetohydrodynamics, thermohydraulics, mechanical stresses, compatibility and purification of lead-lithium, tritium control, safety, reliability, and electrically insulating coatings. The remaining open questions and the required R and D programme are identified. (orig.) [de

  3. Reliability of supply of switchgear for auxiliary low voltage in substations extra high voltage to high voltage

    Directory of Open Access Journals (Sweden)

    Perić Dragoslav M.

    2015-01-01

    Full Text Available Switchgear for auxiliary low voltage in substations (SS of extra high voltages (EHV to high voltage (HV - SS EHV/HV kV/kV is of special interest for the functioning of these important SS, as it provides a supply for system of protection and other vital functions of SS. The article addresses several characteristic examples involving MV lines with varying degrees of independence of their supply, and the possible application of direct transformation EHV/LV through special voltage transformers. Auxiliary sources such as inverters and diesel generators, which have limited power and expensive energy, are also used for the supply of switchgear for auxiliary low voltage. Corresponding reliability indices are calculated for all examples including mean expected annual engagement of diesel generators. The applicability of certain solutions of switchgear for auxiliary low voltage SS EHV/HV, taking into account their reliability, feasibility and cost-effectiveness is analyzed too. In particular, the analysis of applications of direct transformation EHV/LV for supply of switchgear for auxiliary low voltage, for both new and existing SS EHV/HV.

  4. INFLUENCE OF FEEDING ELECTRIC ENERGY QUALITY ON HEATING OF THE AUXILIARY MA-CHINES OF AC ELECTRIC ROLLING STOCK

    Directory of Open Access Journals (Sweden)

    O. YU. Baliichuk

    2014-04-01

    Full Text Available Purpose. The article aims to study the problem of increase the reliability of auxiliary machines for AC electric trains during operation in real conditions. Methodology. The peculiarity of system construction of auxiliary machines for AC electric rolling stock is the use of asynchronous motors for general industrial purpose. An engineering method of influence determination on the feeding voltage asymmetry and its deviation from the nominal value on heating of auxiliary machines insulation was proposed. Findings. It is found out that in case when the auxiliary machines of AC electric trains work under asymmetry factor of the voltage 10% or more and feeding voltage deviation from the nominal order 0.6 relative unit then it is possible the overheat of their isolation, even if it has class H. Originality. For the first time the issue of the total insulation heating under such boundary parameters combinations of energy quality, when each of them contributes to the heating insulation increase as compared to the nominal regime of the "rotating phase splitter−auxiliary machinery" system was illuminated. Practical value. Conducted research allow us to establish the boundary parameter values of feeding energy quality (asymmetry factor, feeding voltage deviations from the nominal value, at which additional isolation overheating of this class under the effect of specified factors will not exceed the agreed value.

  5. Parallel-Plate Electrostatic Dual Mass Oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Allen, James J.; Dyck, Christopher W.; Huber, Robert J.

    1999-07-22

    A surface-micromachined two-degree-of-freedom system that was driven by parallel-plate actuation at antiresonance was demonstrated. The system consisted of an absorbing mass connected by folded springs to a drive mass. The system demonstrated substantial motion amplification at antiresonance. The absorber mass amplitudes were 0.8-0.85 pm at atmospheric pressure while the drive mass amplitudes were below 0.1 pm. Larger absorber mass amplitudes were not possible because of spring softening in the drive mass springs. Simple theory of the dual-mass oscillator has indicated that the absorber mass may be insensitive to limited variations in strain and damping. This needs experimental verification. Resonant and antiresonant frequencies were measured and compared to the designed values. Resonant frequency measurements were difficult to compare to the design calculations because of time-varying spring softening terms that were caused by the drive configuration. Antiresonant frequency measurements were close to the design value of 5.1 kHz. The antiresonant frequency was not dependent on spring softening. The measured absorber mass displacement at antiresonance was compared to computer simulated results. The measured value was significantly greater, possibly due to neglecting fringe fields in the force expression used in the simulation.

  6. Research of Tai-chi-chuan auxiliary training system based on Kinect

    Directory of Open Access Journals (Sweden)

    Zhihong XUE

    2017-04-01

    Full Text Available In order to promote the scientific standardization of Tai-chi-chuan teaching and training, a Tai-chi-chuan auxiliary training system based on Kinect motion capture technology and extraction of the angle feature and speed feature is proposed and designed. The dynamic time planning algorithm (DTW sampling corresponding frame is applied to replace the traditional method of sampling the key frame. The auxiliary training system consists of learning module, action acquisition module and action scoring module. Learning module with stan-dard action teaching video, to meet the requirements of students learning; action acquisition module uses Microsoft developed Kinect equipment to realize data acquisition of the spatial coordinates of the human skeleton in Tai-chi-chuan action, and through filtered noise reduction and the occlusion point data processing the skeleton data is saved. The scoring module constructs the test sequence based on the 16 angle features of eight key joint nodes and the instantaneous velocity characteristics of 20 joint nodes. By comparing with the standard sequence in real time, the original scoring rules is used to achieve the scoring function, which provides students with intuitive and reliable training recommendations, so as to improve the efficiency of learning. By increasing the number of sensors, further designing and optimizing data fusion and filtering algorithm, combining with Microsoft’s Kinect2.0 version, the system can also be applied to medical rehabilitation, physical training analysis and evaluation, virtual reality and human-computer interaction, etc.

  7. Auxiliary Sensor-Based Borehole Transient Electromagnetic System for the Nondestructive Inspection of Multipipe Strings

    Directory of Open Access Journals (Sweden)

    Bo Dang

    2017-08-01

    Full Text Available Transient electromagnetic (TEM techniques are widely used in the field of geophysical prospecting. In borehole detection, the nondestructive inspection (NDI of a metal pipe can be performed efficiently using the properties of eddy currents. However, with increasing concern for safety in oil and gas production, more than one string of pipe is used to protect wellbores, which complicates data interpretation. In this paper, an auxiliary sensor-based borehole TEM system for the NDI of multipipe strings is presented. On the basis of the characteristics of the borehole TEM model, we investigate the principle behind the NDI of multipipe strings using multiple time slices of induced electromotive force (EMF in a single sensor. The results show that the detection performance of NDI is strongly influenced by eddy-current diffusion in the longitudinal direction. To solve this problem, we used time slices of the induced EMF in both the main and auxiliary sensors. The performance of the proposed system was verified by applying it to an oil well with a production casing and liner. Moreover, field experiments were conducted, and the results demonstrate the effectiveness of the proposed method.

  8. Use of empirical likelihood to calibrate auxiliary information in partly linear monotone regression models.

    Science.gov (United States)

    Chen, Baojiang; Qin, Jing

    2014-05-10

    In statistical analysis, a regression model is needed if one is interested in finding the relationship between a response variable and covariates. When the response depends on the covariate, then it may also depend on the function of this covariate. If one has no knowledge of this functional form but expect for monotonic increasing or decreasing, then the isotonic regression model is preferable. Estimation of parameters for isotonic regression models is based on the pool-adjacent-violators algorithm (PAVA), where the monotonicity constraints are built in. With missing data, people often employ the augmented estimating method to improve estimation efficiency by incorporating auxiliary information through a working regression model. However, under the framework of the isotonic regression model, the PAVA does not work as the monotonicity constraints are violated. In this paper, we develop an empirical likelihood-based method for isotonic regression model to incorporate the auxiliary information. Because the monotonicity constraints still hold, the PAVA can be used for parameter estimation. Simulation studies demonstrate that the proposed method can yield more efficient estimates, and in some situations, the efficiency improvement is substantial. We apply this method to a dementia study. Copyright © 2013 John Wiley & Sons, Ltd.

  9. [Spatial pattern of soil fertility in Bashan tea garden: a prediction based on environmental auxiliary variables].

    Science.gov (United States)

    Qin, Le-feng; Yang, Chao; Lin, Fen-fang; Yang, Ning; Zheng, Xin-yu; Xu, Hong-wei; Wang, Ke

    2010-12-01

    Taking topographic factors and NDVI as auxiliary variables, and by using regression-kriging method, the spatial variation pattern of soil fertility in Bashan tea garden in the hilly area of Fuyang City was explored. The spatial variability of the soil fertility was mainly attributed to the structural factors such as relative elevation and flat/vertical curvature. The lower the relative elevation, the worse the soil fertility was. The overall soil fertility level was relatively high, and the area with lower soil fertility only accounted for 5% of the total. By using regression-kriging method with relative elevation as auxiliary variable, the prediction accuracy of soil fertility was obviously higher than that by using ordinary kriging method, with the mean error and root mean square error being 0. 028 and 0. 108, respectively. It was suggested that the prediction method used in this paper could fully reflect the effects of environmental variables on soil fertility , improve the prediction accuracy about the spatial pattern of soil fertility, and provide scientific basis for the precise management of tea garden.

  10. An auxiliary optimization method for complex public transit route network based on link prediction

    Science.gov (United States)

    Zhang, Lin; Lu, Jian; Yue, Xianfei; Zhou, Jialin; Li, Yunxuan; Wan, Qian

    2018-02-01

    Inspired by the missing (new) link prediction and the spurious existing link identification in link prediction theory, this paper establishes an auxiliary optimization method for public transit route network (PTRN) based on link prediction. First, link prediction applied to PTRN is described, and based on reviewing the previous studies, the summary indices set and its algorithms set are collected for the link prediction experiment. Second, through analyzing the topological properties of Jinan’s PTRN established by the Space R method, we found that this is a typical small-world network with a relatively large average clustering coefficient. This phenomenon indicates that the structural similarity-based link prediction will show a good performance in this network. Then, based on the link prediction experiment of the summary indices set, three indices with maximum accuracy are selected for auxiliary optimization of Jinan’s PTRN. Furthermore, these link prediction results show that the overall layout of Jinan’s PTRN is stable and orderly, except for a partial area that requires optimization and reconstruction. The above pattern conforms to the general pattern of the optimal development stage of PTRN in China. Finally, based on the missing (new) link prediction and the spurious existing link identification, we propose optimization schemes that can be used not only to optimize current PTRN but also to evaluate PTRN planning.

  11. High voltage bus and auxiliary heater control system for an electric or hybrid vehicle

    Science.gov (United States)

    Murty, Balarama Vempaty

    2000-01-01

    A control system for an electric or hybrid electric vehicle includes a vehicle system controller and a control circuit having an electric immersion heater. The heater is electrically connected to the vehicle's high voltage bus and is thermally coupled to a coolant loop containing a heater core for the vehicle's climate control system. The system controller responds to cabin heat requests from the climate control system by generating a pulse width modulated signal that is used by the control circuit to operate the heater at a duty cycle appropriate for the amount of cabin heating requested. The control system also uses the heater to dissipate excess energy produced by an auxiliary power unit and to provide electric braking when regenerative braking is not desirable and manual braking is not necessary. The control system further utilizes the heater to provide a safe discharge of a bank of energy storage capacitors following disconnection of the battery or one of the high voltage connectors used to transmit high voltage operating power to the various vehicle systems. The control circuit includes a high voltage clamping circuit that monitors the voltage on the bus and operates the heater to clamp down the bus voltage when it exceeds a pre-selected maximum voltage. The control system can also be used to phase in operation of the heater when the bus voltage exceeds a lower threshold voltage and can be used to phase out the auxiliary power unit charging and regenerative braking when the battery becomes fully charged.

  12. Phonetic physical feature formula for identification of radiation auxiliary workers and security applications

    International Nuclear Information System (INIS)

    Srivastava, D.N.; Srivastava, M.K.; Kher, R.K.

    1997-08-01

    This report gives a review of human physical features with the aim of evolving a simple and practical formula which can be used to identify radiation auxiliary workers even if they do not reveal their radiation work history either due to ignorance or intentionally. To have the formula short, the phonetic number system of radix 128 has been employed. The formula finally arrived at consists of three phonetic digits representing 17 features and age in blocks of 8 years. There are four main advantages of this formula. The first is binary division which has more surety and better accuracy. The second is expert redundancy, that is expert examination is not required. Third is very large number of categories (128K=131072). And the fourth is nearly equal probabilities of all categories which make the number of people in each category very few and that simplifies the search. Hence by the scan of a few records, it is easily possible to ascertain whether a person is a new entrant or an old timer. Its application ensures better monitoring of the radiation exposure of auxiliary workers. This formula can also be used by police department and investigating agencies to classify the records of suspected persons for the ease of their identification when they give misleading information

  13. A diesel fuel processor for fuel-cell-based auxiliary power unit applications

    Science.gov (United States)

    Samsun, Remzi Can; Krekel, Daniel; Pasel, Joachim; Prawitz, Matthias; Peters, Ralf; Stolten, Detlef

    2017-07-01

    Producing a hydrogen-rich gas from diesel fuel enables the efficient generation of electricity in a fuel-cell-based auxiliary power unit. In recent years, significant progress has been achieved in diesel reforming. One issue encountered is the stable operation of water-gas shift reactors with real reformates. A new fuel processor is developed using a commercial shift catalyst. The system is operated using optimized start-up and shut-down strategies. Experiments with diesel and kerosene fuels show slight performance drops in the shift reactor during continuous operation for 100 h. CO concentrations much lower than the target value are achieved during system operation in auxiliary power unit mode at partial loads of up to 60%. The regeneration leads to full recovery of the shift activity. Finally, a new operation strategy is developed whereby the gas hourly space velocity of the shift stages is re-designed. This strategy is validated using different diesel and kerosene fuels, showing a maximum CO concentration of 1.5% at the fuel processor outlet under extreme conditions, which can be tolerated by a high-temperature PEFC. The proposed operation strategy solves the issue of strong performance drop in the shift reactor and makes this technology available for reducing emissions in the transportation sector.

  14. Impact of Auxiliary Equipments Consumption on Electricity Generation Cost in Selected Power Plants of Pakistan

    Directory of Open Access Journals (Sweden)

    DILEEP KUMAR

    2017-04-01

    Full Text Available This study focuses on higher generation cost of electricity in selected TPPs (Thermal Power Plants in Sindh, Pakistan. It also investigates the energy consumed by the auxiliary equipment of the selected TPPs in Sindh, Pakistan. The AC (Auxiliary Consumption of selected TPPs is compared with that in UK and other developed countries. Results show that the AC in selected TPPs in Sindh, Pakistan exceeds the average AC of the TPPs situated in developed countries. Many energy conservation measures such as impeller trimming and de-staging, boiler feed pump, high voltage inverter, variable frequency drive, and upgrading the existing cooling tower fan blades with fiber reinforced plastic are discussed to overcome higher AC. This study shows that harnessing various available energy conservative measures the AC and unit cost can be reduced by 4.13 and 8.8%; also adverse environmental impacts can be mitigated. Results show that the unit cost of electricity can be reduced from Rs.20 to19/kWh in JTPP (Jamshoro Thermal Power Plant, Rs.9 to 8.8/kWh in GTPS (Gas Turbine Power Station Kotri and Rs. 11 to 10.27/ kWh in LPS (Lakhara Power Station. Thus, electricity production can be improved with the existing capacity, which will eventually assist to manage the current energy crisis and ensure its conservation

  15. Unsupervised Remote Sensing Domain Adaptation Method with Adversarial Network and Auxiliary Task

    Directory of Open Access Journals (Sweden)

    XU Suhui

    2017-12-01

    Full Text Available An important prerequisite when annotating the remote sensing images by machine learning is that there are enough training samples for training, but labeling the samples is very time-consuming. In this paper, we solve the problem of unsupervised learning with small sample size in remote sensing image scene classification by domain adaptation method. A new domain adaptation framework is proposed which combines adversarial network and auxiliary task. Firstly, a novel remote sensing scene classification framework is established based on deep convolution neural networks. Secondly, a domain classifier is added to the network, in order to learn the domain-invariant features. The gradient direction of the domain loss is opposite to the label loss during the back propagation, which makes the domain predictor failed to distinguish the sample's domain. Lastly, we introduce an auxiliary task for the network, which augments the training samples and improves the generalization ability of the network. The experiments demonstrate better results in unsupervised classification with small sample sizes of remote sensing images compared to the baseline unsupervised domain adaptation approaches.

  16. Small area estimation of proportions with different levels of auxiliary data.

    Science.gov (United States)

    Chandra, Hukum; Kumar, Sushil; Aditya, Kaustav

    2018-03-01

    Binary data are often of interest in many small areas of applications. The use of standard small area estimation methods based on linear mixed models becomes problematic for such data. An empirical plug-in predictor (EPP) under a unit-level generalized linear mixed model with logit link function is often used for the estimation of a small area proportion. However, this EPP requires the availability of unit-level population information for auxiliary data that may not be always accessible. As a consequence, in many practical situations, this EPP approach cannot be applied. Based on the level of auxiliary information available, different small area predictors for estimation of proportions are proposed. Analytic and bootstrap approaches to estimating the mean squared error of the proposed small area predictors are also developed. Monte Carlo simulations based on both simulated and real data show that the proposed small area predictors work well for generating the small area estimates of proportions and represent a practical alternative to the above approach. The developed predictor is applied to generate estimates of the proportions of indebted farm households at district-level using debt investment survey data from India. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Perception of Special Needs Dentistry education and practice amongst Australian dental auxiliary students.

    Science.gov (United States)

    Borromeo, G L; Ahmad, M S; Buckley, S; Bozanic, M; Cao, A; Al-Dabbagh, M; Athale, A

    2017-10-11

    The role of dental auxiliaries in collaborative care of patients with special needs is compelling. This study was undertaken to investigate the perceptions of Special Needs Dentistry (SND) education and practice amongst students enrolled in Australian programmes in dental auxiliary, namely dental hygiene, dental therapy and oral health therapy (DH/DT/OHT). All Australian institutions offering DH/DT/OHT programmes (n = 14) were invited to participate in a self-administered questionnaire survey, conducted online, involving students across all academic years. Twelve institutions agreed to participate, but only five institutions were included in the final analysis, with a student response rate of 31.1%. Answers to open-ended questions were coded and grouped for measurement of frequencies. Quantitative data were analysed via chi-squared and Fisher's exact tests (significance taken as P patients with special needs (68.9%). Nevertheless, they felt comfortable and positive about treating these patients independently. Most agreed that they should receive clinical and didactic education in SND, with many of them expressing interest in pursuing a specialty training in this field. DH/DT/OHT students' comfort levels, positive attitudes and supportiveness for SND suggested positive implications for these practitioners to partake in multidisciplinary management of patients with special needs, thus indicating the need for standardised training requirements and practice guidelines in this area of care. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. The effects of aircraft noise at Williams Air Force Base Auxiliary Field on residential property values

    Energy Technology Data Exchange (ETDEWEB)

    Morey, M.J.

    1990-11-01

    This report considers the environmental consequences of moving the flight training operations of the US Air Force's 82nd Flying Training Wing from the auxiliary airfield, Coolidge-Florence Municipal Airport (CFMA), to a more remote location in Pinal County, Arizona. It examines how actual noise from touch-and-go flights of T-37 aircraft and perceived (anticipated) noise affect the market value of residential property near CFMA. Noise, measured by a noise index, is correlated with market values through a regression analysis applied to a hedonic price model of the Coolidge-Florence housing market. Prices and characteristics of 42 residential properties sold in 1987 and 1988 were used to estimate a perceived noise effect. The report finds that the coefficient on the measure of perceived noise, based on the noise exposure forecast (NEF) index, is statistically insignificant, even though the sign and value are consistent with those estimated in other studies. It concludes that current flights do not have a significant effect on residential property values, partially because there is no housing near CFMA. This and larger studies indicate that flight operations at a new auxiliary airfield would not affect property values if runways were at least 12,000 feet away from housing. 12 refs., 2 tabs.

  19. The verb Hteti and the structure of auxiliary and modal verbs in Serbo-Croatian

    Directory of Open Access Journals (Sweden)

    Stanimir Rakić

    1984-12-01

    Full Text Available The analysis of the distribution of enclitic forms ću, ćeš, će ... and   heverb hteti shows that they cannot be naturally reduced to each other. Thi.s mean. s that the., verb hteti is not.. an auxiliary verb at all, i. e. it does not take part in compound tenses in S.erbo-Croatian. Accord,ing to their complement.& we ha­ve distinguished two verbs hteti - hteti1 and hteti. Hteti is a modal verb, hteti a main verb. Furthermore, we have shown that there is a parallelism between 'complements "da + prezent" and "sentence" which can be best accounted for by a transforma­ tion (18, which may be called in English Subjugation of Infi­ nitive. This analysis has enabled us to present the structure of auxiliary and modal verbs by rewrite rules (34. Finally, we have shown that an alternative analysis in which all verbs are conceived as main verbs is quite feasible. In this new analysis our results are preserved in the form of an obligatory filter.

  20. Differential modulations of KCNQ1 by auxiliary proteins KCNE1 and KCNE2.

    Science.gov (United States)

    Li, Pan; Liu, Haowen; Lai, Chaohua; Sun, Peibei; Zeng, Wenping; Wu, Fangming; Zhang, Longhua; Wang, Sheng; Tian, Changlin; Ding, Jiuping

    2014-05-15

    KCNQ1 channels play vital roles in cardiovascular, gastric and other systems. The conductance and dynamics of KCNQ1 could be modulated by different single transmembrane helical auxiliary proteins (such as KCNE1, KCNE2 and others). In this study, detail KCNQ1 function modulations by different regions of KCNE1 or KCNE2 were examined using combinational methods of electrophysiology, immunofluorescence, solution NMR and related backbone flexibility analysis. In the presence of KCNE2 N-terminus, decreased surface expression and consequent low activities of KCNQ1 were observed. The transmembrane domains (TMDs) of KCNE1 and KCNE2 were illustrated to associate with the KCNQ1 channel in different modes: Ile64 in KCNE2-TMD interacting with Phe340 and Phe275 in KCNQ1, while two pairs of interacting residues (Phe340-Thr58 and Ala244-Tyr65) in the KCNQ1/KCNE1 complex. The KCNE1 C-terminus could modulate gating property of KCNQ1, whereas KCNE2 C-terminus had only minimal influences on KCNQ1. All of the results demonstrated different KCNQ1 function modulations by different regions of the two auxiliary proteins.