WorldWideScience

Sample records for auxiliary dual resonance

  1. Auxiliary resonant DC tank converter

    Science.gov (United States)

    Peng, Fang Z.

    2000-01-01

    An auxiliary resonant dc tank (ARDCT) converter is provided for achieving soft-switching in a power converter. An ARDCT circuit is coupled directly across a dc bus to the inverter to generate a resonant dc bus voltage, including upper and lower resonant capacitors connected in series as a resonant leg, first and second dc tank capacitors connected in series as a tank leg, and an auxiliary resonant circuit comprising a series combination of a resonant inductor and a pair of auxiliary switching devices. The ARDCT circuit further includes first clamping means for holding the resonant dc bus voltage to the dc tank voltage of the tank leg, and second clamping means for clamping the resonant dc bus voltage to zero during a resonant period. The ARDCT circuit resonantly brings the dc bus voltage to zero in order to provide a zero-voltage switching opportunity for the inverter, then quickly rebounds the dc bus voltage back to the dc tank voltage after the inverter changes state. The auxiliary switching devices are turned on and off under zero-current conditions. The ARDCT circuit only absorbs ripples of the inverter dc bus current, thus having less current stress. In addition, since the ARDCT circuit is coupled in parallel with the dc power supply and the inverter for merely assisting soft-switching of the inverter without participating in real dc power transmission and power conversion, malfunction and failure of the tank circuit will not affect the functional operation of the inverter; thus a highly reliable converter system is expected.

  2. Analysis of Circularly Polarized Hemispheroidal Dielectric Resonator Antenna Phased Arrays Using the Method of Auxiliary Sources

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2007-01-01

    The method of auxiliary sources is employed to model and analyze probe-fed hemispheroidal dielectric resonator antennas and arrays. Circularly polarized antenna elements of different designs are analyzed, and impedance bandwidths of up to 14.7% are achieved. Selected element designs are subsequen......The method of auxiliary sources is employed to model and analyze probe-fed hemispheroidal dielectric resonator antennas and arrays. Circularly polarized antenna elements of different designs are analyzed, and impedance bandwidths of up to 14.7% are achieved. Selected element designs...

  3. Wigner Transport Simulation of Resonant Tunneling Diodes with Auxiliary Quantum Wells

    Science.gov (United States)

    Lee, Joon-Ho; Shin, Mincheol; Byun, Seok-Joo; Kim, Wangki

    2018-03-01

    Resonant-tunneling diodes (RTDs) with auxiliary quantum wells ( e.g., emitter prewell, subwell, and collector postwell) are studied using a Wigner transport equation (WTE) discretized by a thirdorder upwind differential scheme. A flat-band potential profile is used for the WTE simulation. Our calculations revealed functions of the auxiliary wells as follows: The prewell increases the current density ( J) and the peak voltage ( V p ) while decreasing the peak-to-valley current ratio (PVCR), and the postwell decreases J while increasing the PVCR. The subwell affects J and PVCR, but its main effect is to decrease V p . When multiple auxiliary wells are used, each auxiliary well contributes independently to the transport without producing side effects.

  4. Dual resonance models and their currents

    International Nuclear Information System (INIS)

    Johnson, E.A.

    1978-01-01

    It is shown how dual resonance models were rederived from the concept of a string tracing out a surface in space-time. Thus, interacting strings reproduce the dual amplitudes. A scheme for tackling the unitarity problem began to develop. As a consistent theory of hadronic processes began to be built, workers at the same time were naturally led to expect that leptons could be included with hadrons in a unified dual theory. Thus, there is a search for dual amplitudes which would describe interactions between hadrons and currents (for example, electrons), as well as interactions involving only hadrons. Such amplitudes, it is believed, will be the correct ones, describing the real world. Such amplitudes will provide valuable information concerning such things as hadronic form factors. The great difficulties in building current-amplitudes with the required properties of proper factorization on a good spectrum, duality, current algebra, and proper asymptotic behavior are described. Dual models at the present time require for consistency, an intercept value of α 0 = 1 and a dimension value of d = 26 (or d = 10). There have been speculations that the unphysical dimension may be made physical by associating the ''extra dimensions'' with certain internal degrees of freedom. However, it is desired that the theory itself, force the dimension d = 4. It is quite possible that the dimension problem and the intercept problem are tied together and that resolving either problem will resolve the other. Order by order, a new dual current is constructed that is manifestly factorizable and which appears to be valid for arbitrary space-time dimension. The fact that this current is not bound at d = 26, leads to interesting speculations on the nature of dual currents

  5. Intermediate mass distribution of the dual resonance pomeron

    International Nuclear Information System (INIS)

    Chiu, C.B.; Matsuda, S.

    1978-01-01

    The intermediate mass distribution of the dual resonance pomeron is determined at the one-loop level and it is shown that the mass distribution obtained is remarkably similar to a suitably defined mass distribution in the dual multiperipheral model. Thus it is suggestive to identify the intermediate states of the dual resonance pomeron with multiperipheral processes. (Auth.)

  6. Series resonant converter with auxiliary winding turns: analysis, design and implementation

    Science.gov (United States)

    Lin, Bor-Ren

    2018-05-01

    Conventional series resonant converters have researched and applied for high-efficiency power units due to the benefit of its low switching losses. The main problems of series resonant converters are wide frequency variation and high circulating current. Thus, resonant converter is limited at narrow input voltage range and large input capacitor is normally adopted in commercial power units to provide the minimum hold-up time requirement when AC power is off. To overcome these problems, the resonant converter with auxiliary secondary windings are presented in this paper to achieve high voltage gain at low input voltage case such as hold-up time duration when utility power is off. Since the high voltage gain is used at low input voltage cased, the frequency variation of the proposed converter compared to the conventional resonant converter is reduced. Compared to conventional resonant converter, the hold-up time in the proposed converter is more than 40ms. The larger magnetising inductance of transformer is used to reduce the circulating current losses. Finally, a laboratory prototype is constructed and experiments are provided to verify the converter performance.

  7. Auxiliary programs for resonance parameter storage and retrieval system REPSTOR. XTOREP, ETOREP, REPTOINP, REPRENUM, REPIMRG, TREP, PASSIGN, JCONV

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Kikuchi, Yasuyuki; Fukahori, Tokio

    1999-06-01

    This report describes functions and usage of eight auxiliary computer programs for REPSTOR that is a computer program for collecting the resonance parameters and evaluating them. The programs are XTOREP to convert the experimental data in EXFOR to the REPSTOR input data, ETOREP to convert the data in ENDF format to the REPSTOR input data, REPTOINP to change the data in a REPSTOR file into the REPSTOR input format, REPRENUM to renumber the level number of resonance levels, REPIMRG to merge the XTOREP output data sets, TREP to calculate mean values of resonance parameters, widths of individual resonances, etc., PASSIGN to assign orbital angular momentum by using Bayse theorem, and JCONV to assign total spin. (author)

  8. On the quark structure of resonance states in dual models

    International Nuclear Information System (INIS)

    Volkov, D.V.; Zheltukhin, A.A.; Pashnev, A.I.

    1975-01-01

    It is shown using as an example the Veneziano dual model, that each particular dual model already contains a certain latent quark structure unambiauously determined by internal properties of the dual model. To prove this degeneration of the resonance state spectrum is studied by introducing an additional disturbing interaction into the model being considered. Induced transitions of particles into a vacuum act as such an additional disturbance. This method complements the known factorization method of Fubini, Gordon and Veneziano and turns out to be free from an essential limitation of the latter connected with implicit assumption about the basence of internal additive laws of conservation in the model. By using the method of induced transitions of particles into a vacuum it has been possible to show that the resonance state spectrum is indeed more degenerated than it should be expected from the factorization theorem, and that the supplementary degeneration corresponds to the quark model with an infinite number of quarks of the increasing mass. Structures of some terms of the dual amplitude expansion over the degrees of the constant of the induced transition of particles to vacuum are considered; it is shown that the summation of this expansion may be reduced to a solution of a certain integral equation. On the basis of the integral equation obtained an integral representation ofr dual amplitudes is established. The problems related with degeneration of resonance states and with determination of additive quantum numbers leading to the quark interpretation of the degeneration being considered are discussed

  9. The early years of string theory: The dual resonance model

    International Nuclear Information System (INIS)

    Ramond, P.

    1987-10-01

    This paper reviews the past quantum mechanical history of the dual resonance model which is an early string theory. The content of this paper is listed as follows: historical review, the Veneziano amplitude, the operator formalism, the ghost story, and the string story

  10. Dual band metamaterial perfect absorber based on Mie resonances

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiaoming; Lan, Chuwen; Li, Bo; Zhou, Ji, E-mail: zhouji@tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Bi, Ke [School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Zhao, Qian [State Key Lab of Tribology, Department of Precision Instruments and Mechanology, Tsinghua University, Beijing 100084 (China)

    2016-08-08

    We numerically and experimentally demonstrated a polarization insensitive dual-band metamaterial perfect absorber working in wide incident angles based on the two magnetic Mie resonances of a single dielectric “atom” with simple structure. Two absorption bands with simulated absorptivity of 99% and 96%, experimental absorptivity of 97% and 94% at 8.45 and 11.97 GHz were achieved due to the simultaneous magnetic and electric resonances in dielectric “atom” and copper plate. Mie resonances of dielectric “atom” provide a simple way to design metamaterial perfect absorbers with high symmetry.

  11. Interacting-string picture of dual-resonance models

    International Nuclear Information System (INIS)

    Mandelstam, S.

    1985-01-01

    Dual-resonance models are an alyzed by means of operators which act within the physical Hilbert space of positive-metric states. The basis of the method is to extend the relativistic-string picture of a previous study to interacting particles. Functional methods are used, but their relation to the operator is evident, and factorization is maintained. An expression is given for the N-point amplitude in terms of physical-particle operators. For the three-point function the Neumann functions which occur in this expression are evaluated, so that we have a formula for the on- and off-energy-shell vertex. The authors assume that the string has no longitudinal degrees of freedom, and their results are Lorentz invariant and dual only if d=26

  12. Covariant introduction of quark spin into the dual resonance model

    International Nuclear Information System (INIS)

    Iroshnikov, G.S.

    1979-01-01

    A very simple method of insertion of a quark spin into the dual resonance model of hadron interaction is proposed. The method is suitable for amplitudes with an arbitrary number of particles. The amplitude of interaction of real particles is presented as a product of contribution of oscillatory excitations in the (q anti q) system and of a spin factor. The latter is equal to the trace of the product of the external particle wave functions constructed from structural quarks and satisfying the relativistic Bargman-Wigner equations. Two examples of calculating the meson interaction amplitudes are presented

  13. Theory and Applications of Surface Plasmon Resonance, Resonant Mirror, Resonant Waveguide Grating, and Dual Polarization Interferometry Biosensors

    Directory of Open Access Journals (Sweden)

    Billy W. Day

    2010-11-01

    Full Text Available Biosensors have been used extensively in the scientific community for several purposes, most notably to determine association and dissociation kinetics, protein-ligand, protein-protein, or nucleic acid hybridization interactions. A number of different types of biosensors are available in the field, each with real or perceived benefits over the others. This review discusses the basic theory and operational arrangements of four commercially available types of optical biosensors: surface plasmon resonance, resonant mirror, resonance waveguide grating, and dual polarization interferometry. The different applications these techniques offer are discussed from experiments and results reported in recently published literature. Additionally, recent advancements or modifications to the current techniques are also discussed.

  14. A dual resonance model for high energy electroweak reactions

    International Nuclear Information System (INIS)

    Picard, Jean-Francois

    1995-01-01

    The aim of this work is to propose an original model for the weak interaction at high energy (about 1 TeV) that is inspired from resonance dual models established for hadron physics. The first chapter details the basis and assumptions of the standard model. The second chapter deals with various scenarios that go beyond the standard model and that involve a strong interaction and a perturbative approach to assess coupling. The third chapter is dedicated to the main teachings of hadron physics concerning resonances, the model of Regge poles and the concept of duality. We present our new model in the fourth chapter, we build a scenario in which standard fermions and the 3 massive gauge bosons would have a sub-structure alike that of hadrons. In order to give non-null values to the width of resonances we use the K matrix method, we describe this method in the last chapter and we apply it for the computation of the width of the Z 0 boson. Our model predicts a large spectra of states particularly with the 143-up-lets of ff-bar states. The K matrix method has allowed us to compute amplitudes for helicity, then to collapse them in amplitudes invariant with SU(2) and to project these amplitudes in partial waves of helicity. For most resonances partial widths are very low compared to their mass

  15. Design and Experimental Investigations on a new ZCS Non-Isolated Bidirectional Converter based on Auxiliary resonant Circuit for DC Traction Vehicles

    Directory of Open Access Journals (Sweden)

    Veera Venkata Subrahmanya Kumar Bhajana

    2017-12-01

    Full Text Available This paper proposes a new ZCS non-isolated bidirectional converter for energy storage systems in DC Traction vehicles. The conventional hard-switched non-isolated bidirectional converter is additionally assisted with an auxiliary resonant cell, which is implemented with auxiliary IGBTs, resonant inductor and capacitor will provide the zero current switching, while the main IGBT commutates. This paper mainly deals with the design analysis, simulation and experimental investigations of the proposed converter are provided to prove the soft-switching capability and its overall performance. The 100-200V/2kW laboratory prototype has been implemented and tested to verify the theoretical assumptions and simulation results.

  16. Auxiliary buildings

    International Nuclear Information System (INIS)

    Lakner, I.; Lestyan, E.

    1979-01-01

    The nuclear power station represents a complicated and a particular industrial project. Consequently, the design of the auxiliary buildings serving the power station (offices, kitchen, refreshment room, workshops, depots, water treatment plant building, boiler houses, etc.) requires more attention than usual. This chapter gives a short survey of the auxiliary buildings already completed and discusses the problems of their design, location and structure. (author)

  17. Dual resonant structure for energy harvesting from random vibration sources at low frequency

    Directory of Open Access Journals (Sweden)

    Shanshan Li

    2016-01-01

    Full Text Available We introduce a design with dual resonant structure which can harvest energy from random vibration sources at low frequency range. The dual resonant structure consists of two spring-mass subsystems with different frequency responses, which exhibit strong coupling and broad bandwidth when the two masses collide with each other. Experiments with piezoelectric elements show that the energy harvesting device with dual resonant structure can generate higher power output than the sum of the two separate devices from random vibration sources.

  18. Analysis and measurement of the stability of dual-resonator oscillators

    KAUST Repository

    Ghaed, Hassan

    2012-01-01

    This paper investigates the stability of oscillators with dual-resonating tanks. After deriving oscillator models, it is shown that contrary to prior belief, there can be only one stable oscillating state. Sufficient conditions for stable oscillating states are derived and silicon measurement results are used to prove their validity. A fully integrated transmitter for intraocular pressure sensing that leverages the dual-resonator tank is designed and fabricated based on the derived models. An unstable version of the transmitter is also demonstrated to prove the concept of instability in dual-resonator oscillators © 2012 IEEE.

  19. Dual-Resonant Implantable Circular Patch Antenna for Biotelemetry Communication

    Directory of Open Access Journals (Sweden)

    Rongqiang Li

    2016-01-01

    Full Text Available A compact broadband implantable circular patch antenna is designed and experimentally demonstrated for Medical Implant Communications Service (MICS band (402–405 MHz. Compared with other similar implantable antennas, the proposed antenna incorporates three advantages for biotelemetry communication. First, it can realize a broad impedance bandwidth by exhibiting dual resonances. Second, it can obtain a compact structure by introducing two arc-shaped slots, a rectangular slot and a circular slot on metal radiating patch. Finally, it can display a friendly shape by using a circular structure. The proposed antenna occupies a volume of about 431.5 mm3 (10.42 × 1.27π mm3, which is a compromise between miniaturization and bandwidth. The measured −10 dB impedance bandwidth is 55 MHz (385–440 MHz. Furthermore, the radiation performance and human body safety consideration of the antenna are examined and characterized.

  20. Dual-band plasmonic resonator based on Jerusalem cross-shaped nanoapertures

    Science.gov (United States)

    Cetin, Arif E.; Kaya, Sabri; Mertiri, Alket; Aslan, Ekin; Erramilli, Shyamsunder; Altug, Hatice; Turkmen, Mustafa

    2015-06-01

    In this paper, we both experimentally and numerically introduce a dual-resonant metamaterial based on subwavelength Jerusalem cross-shaped apertures. We numerically investigate the physical origin of the dual-resonant behavior, originating from the constituting aperture elements, through finite difference time domain calculations. Our numerical calculations show that at the dual-resonances, the aperture system supports large and easily accessible local electromagnetic fields. In order to experimentally realize the aperture system, we utilize a high-precision and lift-off free fabrication method based on electron-beam lithography. We also introduce a fine-tuning mechanism for controlling the dual-resonant spectral response through geometrical device parameters. Finally, we show the aperture system's highly advantageous far- and near-field characteristics through numerical calculations on refractive index sensitivity. The quantitative analyses on the availability of the local fields supported by the aperture system are employed to explain the grounds behind the sensitivity of each spectral feature within the dual-resonant behavior. Possessing dual-resonances with large and accessible electromagnetic fields, Jerusalem cross-shaped apertures can be highly advantageous for wide range of applications demanding multiple spectral features with strong nearfield characteristics.

  1. A dual resonant rectilinear-to-rotary oscillation converter for low frequency broadband electromagnetic energy harvesting

    Science.gov (United States)

    Deng, Wei; Wang, Ya

    2017-09-01

    This paper reports a dual resonant rectilinear-to-rotary oscillation converter (RROC) for low frequency broadband electromagnetic energy harvesting from ambient vibrations. An approximate theoretical model has been established to integrate the electromechanical coupling into a comprehensive electromagnetic-dynamic model of the dual resonant RROC. Numerical simulation has proved the nature of dual resonances by revealing that both the rectilinear resonance and the rotary resonance could be achieved when the stand-alone rectilinear oscillator (RLO) and the stand-alone rotary oscillator (RTO) were excited independently. Simulation on the magnetically coupled RROC has also shown that the rectilinear resonance and the rotary resonance could be obtained simultaneously in the low-frequency region (2-14 Hz) with well-defined restoring torque (M r ) and the initial rotation angle of the RLO (ψ). The magnetic interaction patterns between the rectilinear and the RTOs have been categorized based on aforementioned simulation results. Both simulation and experimental results have demonstrated broadband output attributing from the dual resonances. Experimental results have also indicated that the RROC could have wide bandwidth in a much lower frequency region (2-8 Hz) even without the rotary resonance as long as the system parameters are carefully tuned. Parameter analysis on different values of M r and ψ are experimentally carried out to provide a quantitative guidance of designing the RROC to achieve an optimal power density.

  2. Widely tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

    DEFF Research Database (Denmark)

    Pu, Minhao; Liu, Liu; Xue, Weiqi

    2010-01-01

    We propose and demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator microring resonators. The phase-shifting range and the RF-power variation are analyzed. A maximum phase-shifting range of 0~600° is achieved by utilizing a dual-microring resonator...

  3. Compact Dual-Band Bandpass Filter Using Stubs Loaded Ring Resonator

    Science.gov (United States)

    Xu, Jin

    2016-01-01

    This paper presents a novel second-order dual-band bandpass filter (BPF) by using proposed stubs loaded ring resonator. The resonant behavior of proposed stubs loaded ring resonator is analyzed by even-/odd-mode method, which shows its multiple-mode resonant characteristic. Parameters sweep is done so as to give the design guidelines. As an example, a second-order dual-band BPF operating at 1.8/5.2 GHz for GSM and WLAN applications is designed, fabricated and measured. The fabricated filter has a very compact size of 0.05λg×0.15λg. Measured results also show that the proposed dual-band BPF has a better than 20 dB rejection upper stopband from 5.47 GHz to 12.56 GHz. Good agreement is shown between the simulated and measured results.

  4. Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

    Energy Technology Data Exchange (ETDEWEB)

    Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P. [Hospital for Special Surgery, Department of Radiology and Imaging, New York, NY (United States); Feinberg, Joseph H. [Physical Medicine and Rehabilitation, Hospital for Special Surgery, New York, NY (United States); Amber, Ian [MedStar Georgetown University Hospital, Department of Radiology, DC, Washington (United States)

    2017-12-15

    Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

  5. Magnetic resonance imaging patterns of mononeuropathic denervation in muscles with dual innervation

    International Nuclear Information System (INIS)

    Sneag, Darryl B.; Lee, Susan C.; Melisaratus, Darius P.; Feinberg, Joseph H.; Amber, Ian

    2017-01-01

    Magnetic resonance imaging (MRI) of mononeuropathy in muscles with dual innervation depicts geographic denervation corresponding to the affected nerve. Knowledge of the normal distribution of a muscle's neural supply is clinically relevant as partial muscle denervation represents a potential imaging pitfall that can be confused with other pathology, such as muscle strain. This article reviews the normal innervation pattern of extremity muscles with dual supply, providing illustrative examples of mononeuropathy affecting such muscles. (orig.)

  6. Theoretical approach for plasma series resonance effect in geometrically symmetric dual radio frequency plasma

    International Nuclear Information System (INIS)

    Bora, B.; Bhuyan, H.; Favre, M.; Wyndham, E.; Chuaqui, H.

    2012-01-01

    Plasma series resonance (PSR) effect is well known in geometrically asymmetric capacitively couple radio frequency plasma. However, plasma series resonance effect in geometrically symmetric plasma has not been properly investigated. In this work, a theoretical approach is made to investigate the plasma series resonance effect and its influence on Ohmic and stochastic heating in geometrically symmetric discharge. Electrical asymmetry effect by means of dual frequency voltage waveform is applied to excite the plasma series resonance. The results show considerable variation in heating with phase difference between the voltage waveforms, which may be applicable in controlling the plasma parameters in such plasma.

  7. Modelling and analysis of the transformer current resonance in dual active bridge converters

    DEFF Research Database (Denmark)

    Qin, Zian; Shen, Zhan; Blaabjerg, Frede

    2017-01-01

    Due to the parasitic capacitances of the transformer and inductor in Dual Active Bridge (DAB) converters, resonance happens in the transformer currents. This high frequency resonant current flowing into the full bridges will worsen their soft-switching performance and thereby reduce its efficiency....... In order to study the generation mechanism of this current resonance, the impedance of the transformer and inductor with parasitic components is modelled in this digest. Then, based on the impedance model, an approach is proposed to mitigate the current resonance. Finally, both the impedance model...

  8. 360° tunable microwave phase shifter based on silicon-on-insulator dual-microring resonator

    DEFF Research Database (Denmark)

    Pu, Minhao; Xue, Weiqi; Liu, Liu

    2010-01-01

    We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained......We demonstrate tunable microwave phase shifters based on electrically tunable silicon-on-insulator dual-microring resonators. A quasi-linear phase shift of 360° with ~2dB radio frequency power variation at a microwave frequency of 40GHz is obtained...

  9. Compact Dual-Band Zeroth-Order Resonance Antenna

    International Nuclear Information System (INIS)

    Xu He-Xiu; Wang Guang-Ming; Gong Jian-Qiang

    2012-01-01

    A novel microstrip zeroth-order resonator (ZOR) antenna and its equivalent circuit model are exploited with two zeroth-order resonances. It is constructed based on a resonant-type composite right/left handed transmission line (CRLH TL) using a Wunderlich-shaped extended complementary single split ring resonator pair (W-ECSSRRP) and a series capacitive gap. The gap either can be utilized for double negative (DNG) ZOR antenna or be removed to engineer a simplified elision-negative ZOR (ENG) antenna. For verification, a DNG ZOR antenna sample is fabricated and measured. Numerical and experimental results agree well with each other, indicating that the omnidirectional radiations occur at two frequency bands which are accounted for by two shunt branches in the circuit model. The size of the antenna is 49% more compact than its previous counterpart. The superiority of W-ECSSRRP over CSSRRP lies in the lower fundamental resonance of the antenna by 38.2% and the introduction of a higher zeroth-order resonance. (fundamental areas of phenomenology(including applications))

  10. Modelling and simulation of a thermally induced optical transparency in a dual micro-ring resonator.

    Science.gov (United States)

    Lydiate, Joseph

    2017-07-01

    This paper introduces the simulation and modelling of a novel dual micro-ring resonator. The geometric configuration of the resonators, and the implementation of a simulated broadband excitation source, results in the realization of optical transparencies in the combined through port output spectrum. The 130 nm silicon on insulator rib fabrication process is adopted for the simulation of the dual-ring configuration. Two titanium nitride heaters are positioned over the coupling regions of the resonators, which can be operated independently, to control the spectral position of the optical transparency. A third heater, centrally located above the dual resonator rings, can be used to red shift the entire spectrum to a required reference resonant wavelength. The free spectral range with no heater currents applied is 4.29 nm. For a simulated heater current of 7 mA (55.7 mW heater power) applied to one of the through coupling heaters, the optical transparency exhibits a red shift of 1.79 nm from the reference resonant wavelength. The ring-to-ring separation of approximately 900 nm means that it can be assumed that there is a zero ring-to-ring coupling field in this model. This novel arrangement has potential applications as a gas mass airflow sensor or a gas species identification sensor.

  11. Electrostatic energy harvesting device with dual resonant structure for wideband random vibration sources at low frequency.

    Science.gov (United States)

    Zhang, Yulong; Wang, Tianyang; Zhang, Ai; Peng, Zhuoteng; Luo, Dan; Chen, Rui; Wang, Fei

    2016-12-01

    In this paper, we present design and test of a broadband electrostatic energy harvester with a dual resonant structure, which consists of two cantilever-mass subsystems each with a mass attached at the free edge of a cantilever. Comparing to traditional devices with single resonant frequency, the proposed device with dual resonant structure can resonate at two frequencies. Furthermore, when one of the cantilever-masses is oscillating at resonance, the vibration amplitude is large enough to make it collide with the other mass, which provides strong mechanical coupling between the two subsystems. Therefore, this device can harvest a decent power output from vibration sources at a broad frequency range. During the measurement, continuous power output up to 6.2-9.8 μW can be achieved under external vibration amplitude of 9.3 m/s 2 at a frequency range from 36.3 Hz to 48.3 Hz, which means the bandwidth of the device is about 30% of the central frequency. The broad bandwidth of the device provides a promising application for energy harvesting from the scenarios with random vibration sources. The experimental results indicate that with the dual resonant structure, the vibration-to-electricity energy conversion efficiency can be improved by 97% when an external random vibration with a low frequency filter is applied.

  12. Design of a dual linear polarization antenna using split ring resonators at X-band

    Science.gov (United States)

    Ahmed, Sadiq; Chandra, Madhukar

    2017-11-01

    Dual linear polarization microstrip antenna configurations are very suitable for high-performance satellites, wireless communication and radar applications. This paper presents a new method to improve the co-cross polarization discrimination (XPD) for dual linear polarized microstrip antennas at 10 GHz. For this, three various configurations of a dual linear polarization antenna utilizing metamaterial unit cells are shown. In the first layout, the microstrip patch antenna is loaded with two pairs of spiral ring resonators, in the second model, a split ring resonator is placed between two microstrip feed lines, and in the third design, a complementary split ring resonators are etched in the ground plane. This work has two primary goals: the first is related to the addition of metamaterial unit cells to the antenna structure which permits compensation for an asymmetric current distribution flow on the microstrip antenna and thus yields a symmetrical current distribution on it. This compensation leads to an important enhancement in the XPD in comparison to a conventional dual linear polarized microstrip patch antenna. The simulation reveals an improvement of 7.9, 8.8, and 4 dB in the E and H planes for the three designs, respectively, in the XPD as compared to the conventional dual linear polarized patch antenna. The second objective of this paper is to present the characteristics and performances of the designs of the spiral ring resonator (S-RR), split ring resonator (SRR), and complementary split ring resonator (CSRR) metamaterial unit cells. The simulations are evaluated using the commercial full-wave simulator, Ansoft High-Frequency Structure Simulator (HFSS).

  13. Experimental evidence for dual diffractive resonances in nucleon-nucleus scattering

    International Nuclear Information System (INIS)

    Ion, D.B.; Ion-Mihai, R.

    1981-09-01

    Experimental data on nucleon-nucleus scattering for laboratory momenta between 0.9:10 GeV/c are analysed in terms of the dual diffractive resonance (DDR) mechanism. The experimental data for all the nuclei are found to agree well with the predictions of the collective DDR states dominance. (authors)

  14. Experimental results of high power dual frequency resonant magnet excitation at TRIUMF

    International Nuclear Information System (INIS)

    Reiniger, K.W.; Heritier, G.

    1988-06-01

    We present some results of duel frequency resonant magnet excitation at full power using the old NINA synchrotron dipoles. These tests will simulate a typical resonant cell as proposed for the accelerating rings of the TRIUMF KAON Factory. These test have two main purposes: to verify circuit parameters and component ratings for the dual frequency resonant power supply system; and to measure directly electrical losses in a transverse magnet field, such as eddy current losses in magnet conductors, vacuum tubes and core losses in laminations. These data will be required for the detailed design of the accelerator system components. (Author) (Ref., 9 figs., tab.)

  15. Design and analysis of a novel dual-mass MEMS resonant output gyroscope

    Directory of Open Access Journals (Sweden)

    Yang Gao

    2018-02-01

    Full Text Available This paper presents the design and analysis of a novel dual-mass microelectromechanical systems (MEMS resonant output gyroscope (ROG, which can effectively eliminate the influence of common-mode disturbance, such as the linear acceleration, on the gyroscope working mode by the design of dual-mass form, as well as on the frequency outputs of the double-ended tuning fork (DETF resonators by the differential arrangement. The concept of the ROG is introduced first. Then the dynamics of the gyroscope and the force-frequency characteristics of the DETF resonator are theoretically analyzed. By establishing the distribution coefficient of force and the reasonable equivalent of the force-frequency characteristics of the DETF resonator, the accurate expression of the device sensitivity is obtained. Based on the analysis results, the leverage mechanism and the DETF resonator are designed in detail. Then the configuration of the gyroscope, a dual-mass structure, is given. Finally, the validity of the analysis and design are verified by numerical simulations.

  16. Dual-axis resonance testing of wind turbine blades

    Science.gov (United States)

    Hughes, Scott; Musial, Walter; White, Darris

    2014-01-07

    An apparatus (100) for fatigue testing test articles (104) including wind turbine blades. The apparatus (100) includes a test stand (110) that rigidly supports an end (106) of the test article (104). An actuator assembly (120) is attached to the test article (104) and is adapted for substantially concurrently imparting first and second forcing functions in first and second directions on the test article (104), with the first and second directions being perpendicular to a longitudinal axis. A controller (130) transmits first and second sets of displacement signals (160, 164) to the actuator assembly (120) at two resonant frequencies of the test system (104). The displacement signals (160, 164) initiate the actuator assembly (120) to impart the forcing loads to concurrently oscillate the test article (104) in the first and second directions. With turbine blades, the blades (104) are resonant tested concurrently for fatigue in the flapwise and edgewise directions.

  17. Dual and tri-band bandpass filters based on novel Π-shaped resonator

    Science.gov (United States)

    Xiao, Jian-Kang; Zhu, Wen-Jun; Zhao, Wei

    2014-05-01

    A novel Π-shaped resonator is proposed, and compact dual-band and tri-band bandpass filters that meet IEEE 802.11 application requirements by using the new resonator are designed. The dual-band bandpass filter centres at 2.45 and 5.6 GHz with a simulated passband insertion loss of no more than 0.8 dB, and the tri-band bandpass filter which is got by two-path coupling achieves simulated passband insertion loss of no more than 1.1 dB. The new designs are demonstrated by experiment. The new filters have advantages of simple and compact structures, low passband insertion losses, good frequency selectivity and miniature circuit sizes. All these have prospect to be applied in future wireless communication systems.

  18. Orthodontic springs and auxiliary appliances: assessment of magnetic field interactions associated with 1.5 T and 3 T magnetic resonance systems

    International Nuclear Information System (INIS)

    Kemper, J.; Priest, A.N.; Adam, G.; Schulze, D.; Kahl-Nieke, B.; Klocke, A.

    2007-01-01

    The objective of this paper is to evaluate magnetic field interactions at 1.5 and 3 T for 20 orthodontic devices used for fixed orthodontic therapy. Twenty springs and auxiliary parts made from varying ferromagnetic alloys were tested for magnetic field interactions in the static magnetic field at 1.5 and 3 T. Magnetic translational force F z (in millinewtons) was evaluated by determining the deflection angle β [American Society for Testing and Materials (ASTM standard test method)]. Magnetic-field-induced rotational force F rot was qualitatively determined using a five-point scale. β was found to be >45 in 13(15) devices at 1.5(3) T and translational force F z exceeded gravitational force F g on the particular object [F z 10.17-261.4 mN (10.72-566.4 mN) at 1.5(3) T]. F z was found to be up to 24.1(47.5)-fold higher than F g at 1.5(3) T. Corresponding to this, F rot on the objects was shown to be high at both field strengths (≥ +3). Three objects (at 1.5 T) and one object (at 3 T) showed deflection angles rot was found to be ≥ +3 at both field strengths. For the remaining objects, β was below 45 and torque measurements ranged from 0 to +2. Of 20 objects investigated for magnetic field interactions at 1.5(3) T, 13(15) were unsafe in magnetic resonance (MR), based on the ASTM criteria of F z . The implications of these results for orthodontic patients undergoing MRI are discussed. (orig.)

  19. Orthodontic springs and auxiliary appliances: assessment of magnetic field interactions associated with 1.5 T and 3 T magnetic resonance systems

    Energy Technology Data Exchange (ETDEWEB)

    Kemper, J.; Priest, A.N.; Adam, G. [University Medical Center of Hamburg-Eppendorf, Clinic of Diagnostic and Interventional Radiology, Hamburg (Germany); Schulze, D. [University Hospital of Freiburg, Department of Oral and Maxillofacial Surgery, Freiburg (Germany); Kahl-Nieke, B.; Klocke, A. [University Medical Center of Hamburg-Eppendorf, Department of Orthodontics, Hamburg (Germany)

    2007-02-15

    The objective of this paper is to evaluate magnetic field interactions at 1.5 and 3 T for 20 orthodontic devices used for fixed orthodontic therapy. Twenty springs and auxiliary parts made from varying ferromagnetic alloys were tested for magnetic field interactions in the static magnetic field at 1.5 and 3 T. Magnetic translational force F{sub z} (in millinewtons) was evaluated by determining the deflection angle {beta} [American Society for Testing and Materials (ASTM standard test method)]. Magnetic-field-induced rotational force F{sub rot} was qualitatively determined using a five-point scale. {beta} was found to be >45 in 13(15) devices at 1.5(3) T and translational force F{sub z} exceeded gravitational force F{sub g} on the particular object [F{sub z} 10.17-261.4 mN (10.72-566.4 mN) at 1.5(3) T]. F{sub z} was found to be up to 24.1(47.5)-fold higher than F{sub g} at 1.5(3) T. Corresponding to this, F{sub rot} on the objects was shown to be high at both field strengths ({>=} +3). Three objects (at 1.5 T) and one object (at 3 T) showed deflection angles <45 , but F{sub rot} was found to be {>=} +3 at both field strengths. For the remaining objects, {beta} was below 45 and torque measurements ranged from 0 to +2. Of 20 objects investigated for magnetic field interactions at 1.5(3) T, 13(15) were unsafe in magnetic resonance (MR), based on the ASTM criteria of F{sub z}. The implications of these results for orthodontic patients undergoing MRI are discussed. (orig.)

  20. Design of ultrathin dual-resonant reflective polarization converter with customized bandwidths

    Science.gov (United States)

    Kundu, Debidas; Mohan, Akhilesh; Chakrabarty, Ajay

    2017-10-01

    In this paper, an ultrathin dual-resonant reflective polarization converter is proposed to obtain customized bandwidths using precise space-filling technique to its top geometry. The unit cell of the dual-resonant prototype consists of conductive square ring with two diagonally arranged slits, supported by metal-backed thin dielectric layer. It offers two narrow bands with fractional bandwidths of 3.98 and 6.65% and polarization conversion ratio (PCR) of 97.16 and 98.87% at 4.52 and 6.97 GHz, respectively. The resonances are brought in proximity to each other by changing the length of surface current paths of the two resonances. By virtue of this mechanism, two polarization converters with two different types of bandwidths are obtained. One polarization converter produces a full-width at half-maxima PCR bandwidth of 34%, whereas another polarization converter produces a 90% PCR bandwidth of 19%. All the proposed polarization converters are insensitive to wide variations of incident angle for both TE- and TM-polarized incident waves. Measured results show good agreement with the numerically simulated results.

  1. Laterally Driven Resonant Pressure Sensor with Etched Silicon Dual Diaphragms and Combined Beams

    Directory of Open Access Journals (Sweden)

    Xiaohui Du

    2016-01-01

    Full Text Available A novel structure of the resonant pressure sensor is presented in this paper, which tactfully employs intercoupling between dual pressure-sensing diaphragms and a laterally driven resonant strain gauge. After the resonant pressure sensor principle is introduced, the coupling mechanism of the diaphragms and resonator is analyzed and the frequency equation of the resonator based on the triangle geometry theory is developed for this new coupling structure. The finite element (FE simulation results match the theoretical analysis over the full scale of the device. This pressure sensor was first fabricated by dry/wet etching and thermal silicon bonding, followed by vacuum-packaging using anodic bonding technology. The test maximum error of the fabricated sensor is 0.0310%F.S. (full scale in the range of 30 to 190 kPa, its pressure sensitivity is negative and exceeding 8 Hz/kPa, and its Q-factor reaches 20,000 after wafer vacuum-packaging. A novel resonant pressure sensor with high accuracy is presented in this paper.

  2. Reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning.

    Science.gov (United States)

    Song, Ying; Zhu, Zhen; Lu, Yang; Liu, Qiegen; Zhao, Jun

    2014-03-01

    To improve the magnetic resonance imaging (MRI) data acquisition speed while maintaining the reconstruction quality, a novel method is proposed for multislice MRI reconstruction from undersampled k-space data based on compressed-sensing theory using dictionary learning. There are two aspects to improve the reconstruction quality. One is that spatial correlation among slices is used by extending the atoms in dictionary learning from patches to blocks. The other is that the dictionary-learning scheme is used at two resolution levels; i.e., a low-resolution dictionary is used for sparse coding and a high-resolution dictionary is used for image updating. Numerical experiments are carried out on in vivo 3D MR images of brains and abdomens with a variety of undersampling schemes and ratios. The proposed method (dual-DLMRI) achieves better reconstruction quality than conventional reconstruction methods, with the peak signal-to-noise ratio being 7 dB higher. The advantages of the dual dictionaries are obvious compared with the single dictionary. Parameter variations ranging from 50% to 200% only bias the image quality within 15% in terms of the peak signal-to-noise ratio. Dual-DLMRI effectively uses the a priori information in the dual-dictionary scheme and provides dramatically improved reconstruction quality. Copyright © 2013 Wiley Periodicals, Inc.

  3. Dual-band reflective polarization converter based on slotted wire resonators

    Science.gov (United States)

    Li, Fengxia; Zhang, Linbo; Zhou, Peiheng; Chen, Haiyan; Zhao, Rui; Zhou, Yang; Liang, Difei; Lu, Haipeng; Deng, Longjiang

    2018-02-01

    A dual-band and high-efficiency reflective linear polarization converter composed of a layer of slotted metal wires has been proposed. Both the simulated and experimental results indicate that the structure can convert a linearly polarized wave to its cross-polarized state for two distinct frequency bands under normal incidence: 9.8-15.1 and 19.2-25.7 GHz. This phenomenon is attributed to a resonance that corresponds to the "trapped mode" at 15.8 GHz. This mode is stable with structural parameters and incident angle at a relatively wide range, and thus becomes promising for dual-band (also multiband) devices design. By surface current distribution and electric field analysis, the operation mechanism has been illuminated, especially for the "trapped mode", identified by the equally but also oppositely directed currents in each unit cell.

  4. CRADA Final Report for CRADA Number ORNL98-0521 : Development of an Electric Bus Inverter Based on ORNL Auxiliary Resonant Tank (ART) Soft-Switching Technology; TOPICAL

    International Nuclear Information System (INIS)

    Ayers, C.W.

    2001-01-01

    The Power Electronics and Electric Machinery Research Center (PEEMRC) of Oak Ridge National Laboratory (ORNL) has for many years been developing technologies for power converters for motor drives and many other applications. Some of the research goals are to improve efficiency and reduce audible and electromagnetic interference noise generation for inverters and the driven loads. The converters are being required to produce more power with reduced weight and volume, which requires improvements in heat removal from the electronics, as well as improved circuit designs that have fewer electrical losses. PEEMRC has recently developed and patented a soft-switching inverter topology called an Auxiliary Resonant Tank (ART), and this design has been tested and proven at ORNL using a 10-kW laboratory prototype. The objective of this project was to develop, test, and install the ART inverter technology in an electric transit bus with the final goal of evaluating performance of the ORNL inverter under field conditions in a vehicle. A scaled-up inverter with the capacity to drive a 22-e bus was built based on the 10-kW ORNL laboratory prototype ART soft-switching inverter. Most (if not all) commercially available inverters for traction drive and other applications use hard-switching inverters. A Cooperative Research and Development Agreement was established with the Chattanooga Area Regional Transit Authority (CARTA), the Electric Transit Vehicle Institute (ETVI), and Advanced Vehicle Systems (AVS), all of Chattanooga, along with ORNL. CARTA, which maintains and operates the public transit system in Chattanooga, provided an area for testing the vehicle alongside other similar vehicles in the normal operating environment. ETVI offers capabilities in standardized testing and reporting and also provides exposure in the electric transit vehicle arena for ORNL's technologies. The third Chattanooga partner, (AVS) manufactures all-electric and hybrid electric transit buses using

  5. Study of loading by beam of dual-resonator structure of linear electron accelerator

    International Nuclear Information System (INIS)

    Milovanov, O.S.; Smirnov, I.A.

    1988-01-01

    Loading by the beam of the accelerating structure of an Argus dual-resonator linear electron accelerator with a kinetic energy of ∼ 1 MeV and a pulsed beam current of up to 0.5 A is studied experimentally. It is shown that the conditions for stable single-frequency operation of the magnetron are disrupted and the acceleration process is cut off at certain electron-beam currents. Experimental curves of the maximum beam current and maximum electron efficiency of the Argus linear electron accelerator as functions of rf power are given

  6. The Hagedorn Spectrum and the Dual Resonance Model: An Old Love Affair

    CERN Document Server

    Veneziano, Gabriele

    2016-01-01

    In this contribution I recall how people working in the late 1960s on the dual resonance model came to the surprising discovery of a Hagedorn-like spectrum, and why they should not have been surprised. I will then turn to discussing the Hagedorn spectrum from a string theory viewpoint (which adds a huge degeneracy to the exponential spectrum). Finally, I will discuss how all this can be reinterpreted in the new incarnation of string theory through the properties of quantum black holes.

  7. Dielectric Meta-Holograms Enabled with Dual Magnetic Resonances in Visible Light.

    Science.gov (United States)

    Li, Zile; Kim, Inki; Zhang, Lei; Mehmood, Muhammad Q; Anwar, Muhammad S; Saleem, Murtaza; Lee, Dasol; Nam, Ki Tae; Zhang, Shuang; Luk'yanchuk, Boris; Wang, Yu; Zheng, Guoxing; Rho, Junsuk; Qiu, Cheng-Wei

    2017-09-26

    Efficient transmission-type meta-holograms have been demonstrated using high-index dielectric nanostructures based on Huygens' principle. It is crucial that the geometry size of building blocks be judiciously optimized individually for spectral overlap of electric and magnetic dipoles. In contrast, reflection-type meta-holograms using the metal/insulator/metal scheme and geometric phase can be readily achieved with high efficiency and small thickness. Here, we demonstrate a general platform for design of dual magnetic resonance based meta-holograms based on the geometric phase using silicon nanostructures that are quarter wavelength thick for visible light. Significantly, the projected holographic image can be unambiguously observed without a receiving screen even under the illumination of natural light. Within the well-developed semiconductor industry, our ultrathin magnetic resonance-based meta-holograms may have promising applications in anticounterfeiting and information security.

  8. Performance Improvement of Polymer Solar Cells by Surface-Energy-Induced Dual Plasmon Resonance.

    Science.gov (United States)

    Yao, Mengnan; Shen, Ping; Liu, Yan; Chen, Boyuan; Guo, Wenbin; Ruan, Shengping; Shen, Liang

    2016-03-09

    The surface plasmon resonance (SPR) effect of metal nanoparticles (MNPs) is effectively applied on polymer solar cells (PSCs) to improve power conversion efficiency (PCE). However, universality of the reported results mainly focused on utilizing single type of MNPs to enhance light absorption only in specific narrow wavelength range. Herein, a surface-energy-induced dual MNP plasmon resonance by thermally evaporating method was presented to achieve the absorption enhancement in wider range. The differences of surface energy between silver (Ag), gold (Au), and tungsten trioxide (WO3) compared by contact angle images enable Ag and Au prefer to respectively aggregate into isolated islands rather than films at the initial stage of the evaporation process, which was clearly demonstrated in the atomic force microscopy (AFM) measurement. The sum of plasmon-enhanced wavelength range induced by both Ag NPs (350-450 nm) and Au NPs (450-600 nm) almost cover the whole absorption spectra of active layers, which compatibly contribute a significant efficiency improvement from 4.57 ± 0.16 to 6.55 ± 0.12% compared to the one without MNPs. Besides, steady state photoluminescence (PL) measurements provide strong evidence that the SPR induced by the Ag-Au NPs increase the intensity of light absorption. Finally, ultraviolet photoelectron spectroscopy (UPS) reveals that doping Au and Ag causes upper shift of both the work function and valence band of WO3, which is directly related to hole collection ability. We believe the surface-energy-induced dual plasmon resonance enhancement by simple thermally evaporating technique might pave the way toward higher-efficiency PSCs.

  9. Fluorescence and Magnetic Resonance Dual-Modality Imaging-Guided Photothermal and Photodynamic Dual-Therapy with Magnetic Porphyrin-Metal Organic Framework Nanocomposites

    Science.gov (United States)

    Zhang, Hui; Li, Yu-Hao; Chen, Yang; Wang, Man-Man; Wang, Xue-Sheng; Yin, Xue-Bo

    2017-03-01

    Phototherapy shows some unique advantages in clinical application, such as remote controllability, improved selectivity, and low bio-toxicity, than chemotherapy. In order to improve the safety and therapeutic efficacy, imaging-guided therapy seems particularly important because it integrates visible information to speculate the distribution and metabolism of the probe. Here we prepare biocompatible core-shell nanocomposites for dual-modality imaging-guided photothermal and photodynamic dual-therapy by the in situ growth of porphyrin-metal organic framework (PMOF) on Fe3O4@C core. Fe3O4@C core was used as T2-weighted magnetic resonance (MR) imaging and photothermal therapy (PTT) agent. The optical properties of porphyrin were well remained in PMOF, and PMOF was therefore selected for photodynamic therapy (PDT) and fluorescence imaging. Fluorescence and MR dual-modality imaging-guided PTT and PDT dual-therapy was confirmed with tumour-bearing mice as model. The high tumour accumulation of Fe3O4@C@PMOF and controllable light excitation at the tumour site achieved efficient cancer therapy, but low toxicity was observed to the normal tissues. The results demonstrated that Fe3O4@C@PMOF was a promising dual-imaging guided PTT and PDT dual-therapy platform for tumour diagnosis and treatment with low cytotoxicity and negligible in vivo toxicity.

  10. Throughput Measurement of a Dual-Band MIMO Rectangular Dielectric Resonator Antenna for LTE Applications.

    Science.gov (United States)

    Nasir, Jamal; Jamaluddin, Mohd Haizal; Ahmad Khan, Aftab; Kamarudin, Muhammad Ramlee; Yen, Bruce Leow Chee; Owais, Owais

    2017-01-13

    An L-shaped dual-band multiple-input multiple-output (MIMO) rectangular dielectric resonator antenna (RDRA) for long term evolution (LTE) applications is proposed. The presented antenna can transmit and receive information independently using fundamental TE 111 and higher order TE 121 modes of the DRA. TE 111 degenerate mode covers LTE band 2 (1.85-1.99 GHz), 3 (1.71-1.88 GHz), and 9 (1.7499-1.7849 GHz) at f r = 1.8 GHz whereas TE 121 covers LTE band 7 (2.5-2.69 GHz) at f r = 2.6 GHz, respectively. An efficient design method has been used to reduce mutual coupling between ports by changing the effective permittivity values of DRA by introducing a cylindrical air-gap at an optimal position in the dielectric resonator. This air-gap along with matching strips at the corners of the dielectric resonator keeps the isolation at a value more than 17 dB at both the bands. The diversity performance has also been evaluated by calculating the envelope correlation coefficient, diversity gain, and mean effective gain of the proposed design. MIMO performance has been evaluated by measuring the throughput of the proposed MIMO antenna. Experimental results successfully validate the presented design methodology in this work.

  11. Ultrasmall Dual-Band Metamaterial Antennas Based on Asymmetrical Hybrid Resonators

    Directory of Open Access Journals (Sweden)

    Ji-Xu Zhu

    2016-01-01

    Full Text Available A new type of hybrid resonant circuit model is investigated theoretically and experimentally. The resonant model consists of a right hand (RH patch part and a composite right and left handed (CRLH part (RH + CRLH, which determines a compact size and also a convenient frequency modulation characteristic for the proposed antennas. For experimental demonstration, two antennas are fabricated. The former dual-band antenna operating at f-1=3.5 GHz (Wimax and f+1=5.25 GHz (WLAN occupies an area of 0.21λ0×0.08λ0, and two dipolar radiation patterns are obtained with comparable gains of about 6.1 and 6.2 dB, respectively. The latter antenna advances in many aspects such as an ultrasmall size of only 0.16λ0×0.08λ0, versatile radiation patterns with a monopolar pattern at f0=2.4 GHz (Bluetooth, and a dipole one at f+1=3.5 GHz (Wimax and also comparable antenna gains. Circuit parameters are extracted and researched. Excellent performances of the antennas based on hybrid resonators predict promising applications in multifunction wireless communication systems.

  12. Auxiliary verbs in Dinka

    DEFF Research Database (Denmark)

    Andersen, Torben

    2007-01-01

    Dinka, a Western Nilotic language, has a class of auxiliary verbs which is remarkable in the following four respects: (i) It is unusually large, comprising some 20 members; (ii) it is grammatically homogeneous in terms of both morphology and syntax; (iii) most of the auxiliary verbs correspond...... to adverbs in languages like English, while the rest are tense-aspect markers; and (iv) it is possible to combine several auxiliary verbs in a single clause. For some of the auxiliary verbs there are extant full verbs from which they have evolved. To some extent, therefore, it is possible to observe what...

  13. Dynamic Breast Magnetic Resonance Imaging without Complications in a Patient with Dual-Chamber Demand Pacemaker

    International Nuclear Information System (INIS)

    Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M.

    2006-01-01

    Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma

  14. Dynamic Breast Magnetic Resonance Imaging without Complications in a Patient with Dual-Chamber Demand Pacemaker

    Energy Technology Data Exchange (ETDEWEB)

    Sardanelli, F.; Lupo, P.; Esseridou, A.; Fausto, A.; Quarenghi, M. [Policlinico San Donato, San Donato Milanese, Milan (Italy). Depts. of Radiology, Arrhythmia and Electrophysiology Center

    2006-02-15

    Mammography and ultrasound indicated a cancer of the right breast in a 77-year-old woman with a dual-chamber demand pacemaker. The patient was not pacemaker-dependent. She underwent breast 1.5T magnetic resonance imaging (MRI) (dynamic gradient echo sequence with Gd-DOTA 0.1 mmol/kg). Before the patient entered the MR room, the configuration of the device was changed (the response to magnet was switched from asynchronous to off and the rate-responsive algorithm was disabled). No relevant modifications of heart rhythm or rate were observed during the MR examination. No symptom was reported. Immediately after the examination, the pacemaker interrogation showed neither program changes nor alert warnings. MRI detected a bifocal cancer in the right breast which allowed tailored breast-conserving treatment to be initiated. Histopathology confirmed a bifocal invasive ductal carcinoma.

  15. Integrated nanohole array surface plasmon resonance sensing device using a dual-wavelength source

    International Nuclear Information System (INIS)

    Escobedo, C; Vincent, S; Choudhury, A I K; Campbell, J; Gordon, R; Brolo, A G; Sinton, D

    2011-01-01

    In this paper, we demonstrate a compact integrated nanohole array-based surface plasmon resonance sensing device. The unit includes a LED light source, driving circuitry, CCD detector, microfluidic network and computer interface, all assembled from readily available commercial components. A dual-wavelength LED scheme was implemented to increase spectral diversity and isolate intensity variations to be expected in the field. The prototype shows bulk sensitivity of 266 pixel intensity units/RIU and a limit of detection of 6 × 10 −4 RIU. Surface binding tests were performed, demonstrating functionality as a surface-based sensing system. This work is particularly relevant for low-cost point-of-care applications, especially those involving multiple tests and field studies. While nanohole arrays have been applied to many sensing applications, and their suitability to device integration is well established, this is the first demonstration of a fully integrated nanohole array-based sensing device.

  16. Hybrid method to predict the resonant frequencies and to characterise dual band proximity coupled microstrip antennas

    Science.gov (United States)

    Varma, Ruchi; Ghosh, Jayanta

    2018-06-01

    A new hybrid technique, which is a combination of neural network (NN) and support vector machine, is proposed for designing of different slotted dual band proximity coupled microstrip antennas. Slots on the patch are employed to produce the second resonance along with size reduction. The proposed hybrid model provides flexibility to design the dual band antennas in the frequency range from 1 to 6 GHz. This includes DCS (1.71-1.88 GHz), PCS (1.88-1.99 GHz), UMTS (1.92-2.17 GHz), LTE2300 (2.3-2.4 GHz), Bluetooth (2.4-2.485 GHz), WiMAX (3.3-3.7 GHz), and WLAN (5.15-5.35 GHz, 5.725-5.825 GHz) bands applications. Also, the comparative study of this proposed technique is done with the existing methods like knowledge based NN and support vector machine. The proposed method is found to be more accurate in terms of % error and root mean square % error and the results are in good accord with the measured values.

  17. A Low-Cost and Portable Dual-Channel Fiber Optic Surface Plasmon Resonance System.

    Science.gov (United States)

    Liu, Qiang; Liu, Yun; Chen, Shimeng; Wang, Fang; Peng, Wei

    2017-12-04

    A miniaturization and integration dual-channel fiber optic surface plasmon resonance (SPR) system was proposed and demonstrated in this paper. We used a yellow light-emitting diode (LED, peak wavelength 595 nm) and built-in web camera as a light source and detector, respectively. Except for the detection channel, one of the sensors was used as a reference channel to compensate nonspecific binding and physical absorption. We packaged the LED and surface plasmon resonance (SPR) sensors together, which are flexible enough to be applied to mobile devices as a compact and portable system. Experimental results show that the normalized intensity shift and refractive index (RI) of the sample have a good linear relationship in the RI range from 1.328 to 1.348. We used this sensor to monitor the reversible, specific interaction between lectin concanavalin A (Con A) and glycoprotein ribonuclease B (RNase B), which demonstrate its capabilities of specific identification and biochemical samples concentration detection. This sensor system has potential applications in various fields, such as medical diagnosis, public health, food safety, and environment monitoring.

  18. Steam generator auxiliary systems

    International Nuclear Information System (INIS)

    Heinz, A.

    1982-01-01

    The author deals with damage and defect types obtaining in auxiliary systems of power plants. These concern water/steam auxiliary systems (feed-water tank, injection-control valves, slide valves) and air/fluegas auxiliary systems (blowers, air preheaters, etc.). Operating errors and associated damage are not dealt with; by contrast, weak spots are pointed out which result from planning and design. Damage types and events are collected in statistics in order to facilitate damage evaluation for arriving at improved design solutions. (HAG) [de

  19. Modification of anisotropic plasma diffusion via auxiliary electrons emitted by a carbon nanotubes-based electron gun in an electron cyclotron resonance ion source.

    Science.gov (United States)

    Malferrari, L; Odorici, F; Veronese, G P; Rizzoli, R; Mascali, D; Celona, L; Gammino, S; Castro, G; Miracoli, R; Serafino, T

    2012-02-01

    The diffusion mechanism in magnetized plasmas is a largely debated issue. A short circuit model was proposed by Simon, assuming fluxes of lost particles along the axial (electrons) and radial (ions) directions which can be compensated, to preserve the quasi-neutrality, by currents flowing throughout the conducting plasma chamber walls. We hereby propose a new method to modify Simon's currents via electrons injected by a carbon nanotubes-based electron gun. We found this improves the source performances, increasing the output current for several charge states. The method is especially sensitive to the pumping frequency. Output currents for given charge states, at different auxiliary electron currents, will be reported in the paper and the influence of the frequency tuning on the compensation mechanism will be discussed.

  20. High-temperature superconducting coplanar-waveguide quarter-wavelength resonator with odd- and even-mode resonant frequencies for dual-band bandpass filter

    Energy Technology Data Exchange (ETDEWEB)

    Satoh, Kei; Takagi, Yuta; Narahashi, Shoichi [Research Laboratories, NTT DOCOMO, INC., 3-6 Hikari-no-oka Yokosuka, Kanagawa 239-8536 Japan (Japan); Nojima, Toshio, E-mail: satokei@nttdocomo.co.j [Graduate School of Information Science and Technology, Hokkaido University, Kita 14, Nishi 9, Kita-ku, Sapporo, Hokkaido 060-0814 Japan (Japan)

    2010-06-01

    This paper presents a high-temperature superconducting coplanar-waveguide quarter-wavelength resonator that has two different resonant modes for use in a dual-band bandpass filter (DBPF). An RF filter with multiple passbands such as the DBPF is a basic element that is expected to achieve broadband transmission by using separated frequency bands aggregately and simultaneously in future mobile communication systems. The proposed resonator has a folded center conductor and two open stubs that are aligned close to it. The odd- and even-mode resonant frequencies are configured using the space between the folded center conductor and the open stubs. It is easy to configure the odd- and even-mode coupling coefficients independently because the two resonant modes have different current density distributions. Consequently, a DBPF with two different bandwidths can be easily designed. This paper presents three design examples for a four-pole Chebyshev DBPF with different combinations of fractional bandwidths in order to investigate the validity of the proposed resonator. This paper also presents measured results of the DBPF based on the design examples from the standpoint of experimental investigation. The designed and measured frequency responses confirm that the proposed resonator is effective in achieving DBPFs not only with two of the same bandwidths but also with two different bandwidths.

  1. Slow light based on plasmon-induced transparency in dual-ring resonator-coupled MDM waveguide system

    International Nuclear Information System (INIS)

    Zhan, Shiping; Li, Hongjian; He, Zhihui; Li, Boxun; Yang, Hui; Cao, Guangtao

    2014-01-01

    We report a theoretical and numerical investigation of the plasmon-induced transparency (PIT) effect in a dual-ring resonator-coupled metal–dielectric–metal waveguide system. A transfer matrix method (TMM) is introduced to analyse the transmission and dispersion properties in the transparency window. A tunable PIT is realized in a constant separation design. The phase dispersion and slow-light effect are discussed in both the resonance and non-resonance conditions. Finally, a propagation constant based on the TMM is derived for the periodic system. It is found that the group index in the transparency window of the proposed structure can be easily tuned by the period p, which provides a new understanding, and a group index ∼51 is achieved. The quality factor of resonators can also be effective in adjusting the dispersion relation. These observations could be helpful to fundamental research and applications for integrated plasmonic devices. (paper)

  2. Dual-mode ferromagnetic resonance in an FeCoB/Ru/FeCoB synthetic antiferromagnet with uniaxial anisotropy

    Science.gov (United States)

    Wang, Cuiling; Zhang, Shouheng; Qiao, Shizhu; Du, Honglei; Liu, Xiaomin; Sun, Ruicong; Chu, Xian-Ming; Miao, Guo-Xing; Dai, Youyong; Kang, Shishou; Yan, Shishen; Li, Shandong

    2018-05-01

    Dual-mode ferromagnetic resonance is observed in FeCoB/Ru/FeCoB trilayer synthetic antiferromagnets with uniaxial in-plane magnetic anisotropy. The optical mode is present in the (0-108 Oe) magnetic field range, where the top and bottom layer magnetizations are aligned in opposite directions. The strong acoustic mode appears, when the magnetic field exceeds the 300 Oe value, which corresponds to the flop transition in the trilayer. Magnetic field and angular dependences of resonant frequencies are studied for both optical (low-field) and acoustic (high field) modes. The low-field mode is found to be anisotropic but insensitive to the magnetic field value. In contrast, the high field mode is quasi-isotropic, but its resonant frequency is tunable by the value of the magnetic field. The coexistence of two modes of ferromagnetic resonance as well as switching between them with the increase in the magnetic field originates from the difference in the sign of interlayer coupling energy at the parallel and antiparallel configurations of the synthetic antiferromagnet. The dual-mode resonance in the studied trilayer structures provides greater flexibility in the design and functionalization of micro-inductors in monolithic microwave integrated circuits.

  3. A Dual-Bridge LLC Resonant Converter with Fixed-Frequency PWM Control for Wide Input Applications

    DEFF Research Database (Denmark)

    Xiaofeng, Sun; Li, Xiaohua; Shen, Yanfeng

    2017-01-01

    This paper proposes a dual-bridge (DB) LLC resonant converter for wide input applications. The topology is an integration of a half-bridge (HB) LLC circuit and a full-bridge (FB) LLC circuit. The fixed-frequency PWM control is employed and a range of twice the minimum input voltage can be covered....... Compared with the traditional pulse frequency modulation (PFM) controlled HB/FB LLC resonant converter, the voltage gain range is independent of the quality factor and the magnetizing inductor has little influence on the voltage gain, which can simplify the parameter selection process and benefit...

  4. Real-time biodetection using a smartphone-based dual-color surface plasmon resonance sensor

    Science.gov (United States)

    Liu, Qiang; Yuan, Huizhen; Liu, Yun; Wang, Jiabin; Jing, Zhenguo; Peng, Wei

    2018-04-01

    We proposed a compact and cost-effective red-green dual-color fiber optic surface plasmon resonance (SPR) sensor based on the smartphone. Inherent color selectivity of phone cameras was utilized for real-time monitoring of red and green color channels simultaneously, which can reduce the chance of false detection and improve the sensitivity. Because there are no external prisms, complex optical lenses, or diffraction grating, simple optical configuration is realized. It has a linear response in a refractive index range of 1.326 to 1.351 (R2 = 0.991) with a resolution of 2.3 × 10 - 4 RIU. We apply it for immunoglobulin G (IgG) concentration measurement. Experimental results demonstrate that a linear SPR response was achieved for IgG concentrations varying from 0.02 to 0.30 mg / ml with good repeatability. It may find promising applications in the fields of public health and environment monitoring owing to its simple optics design and applicability in real-time, label-free biodetection.

  5. Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency

    Directory of Open Access Journals (Sweden)

    C. Baccouch

    2016-11-01

    Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally   it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.

  6. White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 2: Radiation Dose and Iodine Sensitivity.

    Science.gov (United States)

    Foley, W Dennis; Shuman, William P; Siegel, Marilyn J; Sahani, Dushyant V; Boll, Daniel T; Bolus, David N; De Cecco, Carlo N; Kaza, Ravi K; Morgan, Desiree E; Schoepf, U Joseph; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

    This is the second of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography. This paper, part 2, addresses radiation dose and iodine sensitivity in dual-energy computed tomography.

  7. Auxiliary Deep Generative Models

    DEFF Research Database (Denmark)

    Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    2016-01-01

    Deep generative models parameterized by neural networks have recently achieved state-of-the-art performance in unsupervised and semi-supervised learning. We extend deep generative models with auxiliary variables which improves the variational approximation. The auxiliary variables leave...... the generative model unchanged but make the variational distribution more expressive. Inspired by the structure of the auxiliary variable we also propose a model with two stochastic layers and skip connections. Our findings suggest that more expressive and properly specified deep generative models converge...... faster with better results. We show state-of-the-art performance within semi-supervised learning on MNIST (0.96%), SVHN (16.61%) and NORB (9.40%) datasets....

  8. Auxiliary mine ventilation manual

    International Nuclear Information System (INIS)

    Workplace Safety North

    2010-01-01

    An adequate ventilation system is needed for air quality and handling in a mine and is comprised of many different pieces of equipment for removing contaminated air and supplying fresh air and thereby provide a satisfactory working environment. This manual highlights auxiliary ventilation systems made up of small fans, ducts, tubes, air movers, deflectors and additional air flow controls which distribute fresh air delivered by the primary system to all areas. A review of auxiliary ventilation is provided. Design, operation and management issues are discussed and guidelines are furnished. This manual is limited to underground hard rock operations and does not address directly other, specific auxiliary systems, either in underground coal mines or uranium mines.

  9. Auxiliary mine ventilation manual

    Energy Technology Data Exchange (ETDEWEB)

    Workplace Safety North

    2010-07-01

    An adequate ventilation system is needed for air quality and handling in a mine and is comprised of many different pieces of equipment for removing contaminated air and supplying fresh air and thereby provide a satisfactory working environment. This manual highlights auxiliary ventilation systems made up of small fans, ducts, tubes, air movers, deflectors and additional air flow controls which distribute fresh air delivered by the primary system to all areas. A review of auxiliary ventilation is provided. Design, operation and management issues are discussed and guidelines are furnished. This manual is limited to underground hard rock operations and does not address directly other, specific auxiliary systems, either in underground coal mines or uranium mines.

  10. CAREM-25. Auxiliary systems

    International Nuclear Information System (INIS)

    Acosta, Eduardo; Amaya, Daniel; Carlevaris, Rodolfo; Patrignani, A.; Ramilo, L.; Santecchia, A.; Vindrola, C.

    2000-01-01

    CAREM is an innovative PWR reactor whose prototype will be of small power generation capacity (100MWt, about 25MWe).CAREM design is based on light water integrated reactor with slightly enriched uranium.In this work, a summary of the functions and most relevant design characteristics of main auxiliary systems associated to the chain of heat removal and physicochemical - radiological treatment of the cooling fluids of the CAREM-25 prototype is presented.Even though these auxiliary systems of the reactor are not safety system, they fulfill functions related with the nuclear safety at different operative modes of the reactor

  11. CAREM-25. Auxiliary systems

    International Nuclear Information System (INIS)

    Acosta, Eduardo; Amaya, Daniel; Carlevaris, Rodolfo; Patrignani, Alberto; Santecchia, Alberto; Vindrola, Carlos; Ramilo, Lucia B.

    2000-01-01

    CAREM is an innovative PWR reactor whose prototype will be of small power generation capacity (100 M Wt, about 25 M We). CAREM design is based on light water integrated reactor with slightly enriched uranium. In this work, a summary of the functions and most relevant design characteristics of main auxiliary systems associated to the chain of heat removal and physicochemical - radiological treatment of the cooling fluids of the CAREM-25 prototype is presented. Even though these auxiliary systems of the reactor are not safety system, they fulfill functions related with the nuclear safety at different operative modes of the reactor. (author)

  12. A Low-Profile Dual-Layer Patch Antenna with a Circular Polarizer Consisting of Dual Semicircular Resonators

    Directory of Open Access Journals (Sweden)

    Li Guo

    2018-06-01

    Full Text Available In this paper, a circular polarizer comprising dual semicircular split-rings (DSSRs is presented. By placing it above an elliptical radiator that radiates linearly polarized (LP waves, dual-layer patch antennas capable of radiating right-hand (RH or left-hand (LH circularly polarized (CP waves are achieved in terms of the different offset direction of the bottom splits of the DSSRs. Because of both the capacitive coupling to the radiator and the degenerate modes existing in the excited DSSRs, the DSSRs collaboratively result in a circularly polarized radiation, successfully converting incident LP waves into CP ones. Simulated results show that the impedance, axial ratio (AR, and gain frequency response of both proposed CP antennas are identical, with a simulated 3-dB AR bandwidth of 72 MHz covering 2.402–2.474 GHz and a gain enhanced by 3.9 dB. The proposed antennas were fabricated and measured, revealing an operational bandwidth of 65 MHz (2.345–2.41 GHz and a peak gain up to 9 dBi. Moreover, a low profile of 0.063λ0 is maintained. The proposed CP antennas could be as a candidate for wireless target detection applications in terms of their identical frequency response property.

  13. Development of a universal dual-bolus injection scheme for the quantitative assessment of myocardial perfusion cardiovascular magnetic resonance

    Directory of Open Access Journals (Sweden)

    Alfakih Khaled

    2011-05-01

    Full Text Available Abstract Background The dual-bolus protocol enables accurate quantification of myocardial blood flow (MBF by first-pass perfusion cardiovascular magnetic resonance (CMR. However, despite the advantages and increasing demand for the dual-bolus method for accurate quantification of MBF, thus far, it has not been widely used in the field of quantitative perfusion CMR. The main reasons for this are that the setup for the dual-bolus method is complex and requires a state-of-the-art injector and there is also a lack of post processing software. As a solution to one of these problems, we have devised a universal dual-bolus injection scheme for use in a clinical setting. The purpose of this study is to show the setup and feasibility of the universal dual-bolus injection scheme. Methods The universal dual-bolus injection scheme was tested using multiple combinations of different contrast agents, contrast agent dose, power injectors, perfusion sequences, and CMR scanners. This included 3 different contrast agents (Gd-DO3A-butrol, Gd-DTPA and Gd-DOTA, 4 different doses (0.025 mmol/kg, 0.05 mmol/kg, 0.075 mmol/kg and 0.1 mmol/kg, 2 different types of injectors (with and without "pause" function, 5 different sequences (turbo field echo (TFE, balanced TFE, k-space and time (k-t accelerated TFE, k-t accelerated balanced TFE, turbo fast low-angle shot and 3 different CMR scanners from 2 different manufacturers. The relation between the time width of dilute contrast agent bolus curve and cardiac output was obtained to determine the optimal predefined pause duration between dilute and neat contrast agent injection. Results 161 dual-bolus perfusion scans were performed. Three non-injector-related technical errors were observed (1.9%. No injector-related errors were observed. The dual-bolus scheme worked well in all the combinations of parameters if the optimal predefined pause was used. Linear regression analysis showed that the optimal duration for the predefined

  14. Implementation and Investigation of a Compact Circular Wide Slot UWB Antenna with Dual Notched Band Characteristics using Stepped Impedance Resonators

    Directory of Open Access Journals (Sweden)

    Yingsong Li

    2012-04-01

    Full Text Available A coplanar waveguide (CPW fed ultra-wideband (UWB antenna with dual notched band characteristics is presented in this paper. The circular wide slot and circular radiation patch are utilized to broaden the impedance bandwidth of the UWB antenna. The dual notched band functions are achieved by employing two stepped impedance resonators (SIRs which etched on the circular radiation patch and CPW excitation line, respectively. The two notched bands can be controlled by adjusting the dimensions of the two stepped impedance resonators which give tunable notched band functions. The proposed dual notched band UWB antenna has been designed in details and optimized by means of HFSS. Experimental and numerical results show that the proposed antenna with compact size of 32 × 24 mm2, has an impedance bandwidth range from 2.8 GHz to 13.5 Hz for voltage standing-wave ratio (VSWR less than 2, except the notch bands 5.0 GHz - 6.2 GHz for HIPERLAN/2 and IEEE 802.11a (5.1 GHz - 5.9 GHz and 8.0 GHz - 9.3 GHz for satellite and military applications.

  15. HTS dual-band bandpass filters using stub-loaded hair-pin resonators for mobile communication systems

    Energy Technology Data Exchange (ETDEWEB)

    Sekiya, N., E-mail: nsekiya@yamanashi.ac.jp; Sugiyama, S.

    2014-09-15

    Highlights: • We have developed a HTS five-pole dual-band bandpass filter using stub-loaded hair-pin resonators. • The proposed dual-band BPF can independently control of the center frequency. • Flexibly adjustment of the bandwidth can be achieved by the H-shaped waveguide. • The proposed BPF is evaluated by simulation and measurement with good agreement. - Abstract: A HTS dual-band bandpass filter is developed to obtain sharp-cut off characteristics for mobile communication systems. The filter is composed of five stub-loaded hair-pin resonators with H-shaped waveguides between them. The main advantage of the proposed filter is to allow independent control of the center frequency of the first and second bands. The bandwidths can be flexibly adjusted using the H-shaped waveguide. An electromagnetic simulator was used to design and analyze the filter, which have a 3.5-GHz center frequency and a 70-MHz (2%) bandwidth for the first band and a 5.0-GHz center frequency and a 100-MHz (2%) bandwidth for the second band. The filter was fabricated using YBa{sub 2}Cu{sub 3}O{sub y} thin film on an Al{sub 2}O{sub 3} substrate. Ground plane was fabricated using Au thin film. The measured frequency responses of the filter tally well with the simulated ones.

  16. Auxiliary partial liver transplantation

    NARCIS (Netherlands)

    C.B. Reuvers (Cornelis Bastiaan)

    1986-01-01

    textabstractIn this thesis studies on auxiliary partial liver transplantation in the dog and the pig are reported. The motive to perform this study was the fact that patients with acute hepatic failure or end-stage chronic liver disease are often considered to form too great a risk for successful

  17. PS auxiliary magnet

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Units of the PS auxiliary magnet system. The picture shows how the new dipoles, used for vertical and horizontal high-energy beam manipulation, are split for installation and removal so that it is not necessary to break the accelerator vacuum. On the right, adjacent to the sector valve and the windings of the main magnet, is an octupole of the set.

  18. Operation auxiliary system (SAO)

    International Nuclear Information System (INIS)

    Lolich, J.; Santome, D.; Drexler, J.

    1990-01-01

    This work presents an auxiliary system for nuclear power plants operation (SAO). The development purpose consisted in a computing supervision system to be installed at different sites of a reactor, mainly in the control room. The inclusion of this system to a nuclear power plant minimizes the possibility of human error for the facility operation. (Author) [es

  19. Generalized viscothermoelasticity theory of dual-phase-lagging model for damping analysis in circular micro-plate resonators

    Science.gov (United States)

    Grover, D.; Seth, R. K.

    2018-05-01

    Analysis and numerical results are presented for the thermoelastic dissipation of a homogeneous isotropic, thermally conducting, Kelvin-Voigt type circular micro-plate based on Kirchhoff's Love plate theory utilizing generalized viscothermoelasticity theory of dual-phase-lagging model. The analytical expressions for thermoelastic damping of vibration and frequency shift are obtained for generalized dual-phase-lagging model and coupled viscothermoelastic plates. The scaled thermoelastic damping has been illustrated in case of circular plate and axisymmetric circular plate for fixed aspect ratio for clamped and simply supported boundary conditions. It is observed that the damping of vibrations significantly depend on time delay and mechanical relaxation times in addition to thermo-mechanical coupling in circular plate under resonance conditions and plate dimensions.

  20. Enhanced optical transmission through a star-shaped bull's eye at dual resonant-bands in UV and the visible spectral range.

    Science.gov (United States)

    Nazari, Tavakol; Khazaeinezhad, Reza; Jung, Woohyun; Joo, Boram; Kong, Byung-Joo; Oh, Kyunghwan

    2015-07-13

    Dual resonant bands in UV and the visible range were simultaneously observed in the enhanced optical transmission (EOT) through star-shaped plasmonic structures. EOTs through four types of polygonal bull's eyes with a star aperture surrounded by the concentric star grooves were analyzed and compared for 3, 4, 5, and 6 corners, using finite difference time domain (FDTD) method. In contrast to plasmonic resonances in the visible range, the UV-band resonance intensity was found to scale with the number of corners, which is related with higher order multipole interactions. Spectral positions and relative intensities of the dual resonances were analyzed parametrically to find optimal conditions to maximize EOT in UV-visible dual bands.

  1. Auxiliary office chair

    OpenAIRE

    Pascual Osés, Maite

    2007-01-01

    The aim of this project is to develop an auxiliary office chair, which favorably will compete with the existing chairs on the market. Evolutions of ergonomical survey in the work environment and on the configuration of offices require new products which fulfill the requirements properly. In order to achieve it a survey about office chairs has been carried out: types, characteristics, ways of usage and products on the market besides a large antropometrical study and ergonomics related to work ...

  2. Dual Contrast - Magnetic Resonance Fingerprinting (DC-MRF): A Platform for Simultaneous Quantification of Multiple MRI Contrast Agents.

    Science.gov (United States)

    Anderson, Christian E; Donnola, Shannon B; Jiang, Yun; Batesole, Joshua; Darrah, Rebecca; Drumm, Mitchell L; Brady-Kalnay, Susann M; Steinmetz, Nicole F; Yu, Xin; Griswold, Mark A; Flask, Chris A

    2017-08-16

    Injectable Magnetic Resonance Imaging (MRI) contrast agents have been widely used to provide critical assessments of disease for both clinical and basic science imaging research studies. The scope of available MRI contrast agents has expanded over the years with the emergence of molecular imaging contrast agents specifically targeted to biological markers. Unfortunately, synergistic application of more than a single molecular contrast agent has been limited by MRI's ability to only dynamically measure a single agent at a time. In this study, a new Dual Contrast - Magnetic Resonance Fingerprinting (DC - MRF) methodology is described that can detect and independently quantify the local concentration of multiple MRI contrast agents following simultaneous administration. This "multi-color" MRI methodology provides the opportunity to monitor multiple molecular species simultaneously and provides a practical, quantitative imaging framework for the eventual clinical translation of molecular imaging contrast agents.

  3. Two-point active microrheology in a viscous medium exploiting a motional resonance excited in dual-trap optical tweezers

    Science.gov (United States)

    Paul, Shuvojit; Kumar, Randhir; Banerjee, Ayan

    2018-04-01

    Two-point microrheology measurements from widely separated colloidal particles approach the bulk viscosity of the host medium more reliably than corresponding single-point measurements. In addition, active microrheology offers the advantage of enhanced signal to noise over passive techniques. Recently, we reported the observation of a motional resonance induced in a probe particle in dual-trap optical tweezers when the control particle was driven externally [Paul et al., Phys. Rev. E 96, 050102(R) (2017), 10.1103/PhysRevE.96.050102]. We now demonstrate that the amplitude and phase characteristics of the motional resonance can be used as a sensitive tool for active two-point microrheology to measure the viscosity of a viscous fluid. Thus, we measure the viscosity of viscous liquids from both the amplitude and phase response of the resonance, and demonstrate that the zero crossing of the phase response of the probe particle with respect to the external drive is superior compared to the amplitude response in measuring viscosity at large particle separations. We compare our viscosity measurements with those using a commercial rheometer and obtain an agreement ˜1 % . The method can be extended to viscoelastic material where the frequency dependence of the resonance may provide further accuracy for active microrheological measurements.

  4. Compact Microstrip Triple-Mode Bandpass Filters Using Dual-Stub-Loaded Spiral Resonators

    Directory of Open Access Journals (Sweden)

    K. D. Xu

    2017-04-01

    Full Text Available Two new microstrip triple-mode resonators loaded with T-shaped open stubs using axially and centrally symmetric spiral structures, respectively, are presented. Spiraled for circuit size reduction, these two half-wavelength resonators can both generate three resonant modes over a wide frequency band by loading two T-stubs with different lengths. Due to the structural symmetry, they can be analyzed by odd- and even-mode method. To validate the design concept, two compact bandpass filters (BPFs using these two novel resonators with center frequencies of 1.76 GHz and 2.44 GHz for the GSM1800 and WLAN/Zigbee applications, respectively, have been designed, fabricated and tested. The center frequencies and bandwidths can be tunable through the analysis of resonant frequency responses, fractional bandwidths and external quality factor versus the resonator parameters. The final measured results have achieved good consistence with the simulations of these two BPFs.

  5. Dual temperature isotope exchange system

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1976-01-01

    Improvements in the method for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. In a preferred embodiment the first is a vaporizable liquid and the auxiliary fluid a gas, comprising steps for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations

  6. Dual imaging probes for magnetic resonance imaging and fluorescence microscopy based on perovskite manganite nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Kačenka, M.; Kaman, Ondřej; Kotek, J.; Falteisek, L.; Černý, J.; Jirák, D.; Herynek, V.; Zacharovová, K.; Berková, A.; Jendelová, Pavla; Kupčík, Jaroslav; Pollert, Emil; Veverka, Pavel; Lukeš, I.

    2011-01-01

    Roč. 21, č. 1 (2011), s. 157-164 ISSN 0959-9428 R&D Projects: GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z10100521; CEZ:AV0Z50390703; CEZ:AV0Z40720504 Keywords : cellular labelling * dual probe * magnetic nanoparticles * MRI * silica coating Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 5.968, year: 2011

  7. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    DEFF Research Database (Denmark)

    Amoudache, Samira; Moiseyenko, Rayisa; Pennec, Yan

    2016-01-01

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defi...... of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.......-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation...

  8. Optical and acoustic sensing using Fano-like resonances in dual phononic and photonic crystal plate

    Energy Technology Data Exchange (ETDEWEB)

    Amoudache, Samira [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria); Moiseyenko, Rayisa [Department of Physics, Technical University of Denmark, DTU Physics, Building 309, DK-2800 Kongens Lyngby (Denmark); Pennec, Yan, E-mail: yan.pennec@univ-lille1.fr; Rouhani, Bahram Djafari [Institut d' Electronique, de Microélectronique et de Nanotechnologie, Université de Lille 1, 59655 Villeneuve d' Ascq (France); Khater, Antoine [Institut des Molécules et Matériaux du Mans (IMMM), UMR CNRS 6283, l' UNAM, Université du Maine, 72085 Le Mans (France); Lucklum, Ralf [Institute of Micro and Sensor Systems (IMOS), Otto-von-Guericke-University, P.O. Box 4120, D-39016 Magdeburg (Germany); Tigrine, Rachid [Laboratoire de Physique et Chimie Quantique, Université Mouloud Mammeri, B.P. 17 RP, 15000 Tizi-Ouzou (Algeria)

    2016-03-21

    We perform a theoretical study based on the transmissions of optical and acoustic waves normally impinging to a periodic perforated silicon plate when the embedded medium is a liquid and show the existence of Fano-like resonances in both cases. The signature of the resonances appears as well-defined asymmetric peaks in the phononic and photonic transmission spectra. We show that the origin of the Fano-like resonances is different with respect to the nature of the wave. In photonic, the origin comes from guided modes in the photonic plate while in phononic we show that it comes from the excitation of standing waves confined inside the cavity coming from the deformation of the water/silicon edges of the cylindrical inclusion. We finally use these features for sensing and show ultra-sensitivity to the light and sound velocities for different concentrations of analytes.

  9. Dual Resonant Frequencies Effects on an Induction-Based Oil Palm Fruit Sensor

    Directory of Open Access Journals (Sweden)

    Noor Hasmiza Harun

    2014-11-01

    Full Text Available As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB. Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB. A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA. To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

  10. Dual resonant frequencies effects on an induction-based oil palm fruit sensor.

    Science.gov (United States)

    Harun, Noor Hasmiza; Misron, Norhisam; Mohd Sidek, Roslina; Aris, Ishak; Wakiwaka, Hiroyuki; Tashiro, Kunihisa

    2014-11-19

    As the main exporter in the oil palm industry, the need to improve the quality of palm oil has become the main interest among all the palm oil millers in Malaysia. To produce good quality palm oil, it is important for the miller to harvest a good oil palm Fresh Fruit Bunch (FFB). Conventionally, the main reference used by Malaysian harvesters is the manual grading standard published by the Malaysian Palm Oil Board (MPOB). A good oil palm FFB consists of all matured fruitlets, aged between 18 to 21 weeks of antheses (WAA). To expedite the harvesting process, it is crucial to implement an automated detection system for determining the maturity of the oil palm FFB. Various automated detection methods have been proposed by researchers in the field to replace the conventional method. In our preliminary study, a novel oil palm fruit sensor to detect the maturity of oil palm fruit bunch was proposed. The design of the proposed air coil sensor based on the inductive sensor was further investigated mainly in the context of the effect of coil diameter to improve its sensitivity. In this paper, the sensitivity of the inductive sensor was further examined with a dual flat-type shape of air coil. The dual air coils were tested on fifteen samples of fruitlet from two categories, namely ripe and unripe. Samples were tested within 20 Hz to 10 MHz while evaluations on both peaks were done separately before the gap between peaks was analyzed. A comparative analysis was conducted to investigate the improvement in sensitivity of the induction-based oil palm fruit sensor as compared to previous works. Results from the comparative study proved that the inductive sensor using a dual flat-type shape air coil has improved by up to 167%. This provides an indication in the improvement in the coil sensitivity of the palm oil fruit sensor based on the induction concept.

  11. Polymer dual ring resonators for label-free optical biosensing using microfluidics.

    Science.gov (United States)

    Salleh, Muhammad H M; Glidle, Andrew; Sorel, Marc; Reboud, Julien; Cooper, Jonathan M

    2013-04-18

    We demonstrate a polymer resonator microfluidic biosensor that overcomes the complex manufacturing procedures required to fabricate traditional devices. In this new format, we show that a gapless light coupling photonic configuration, fabricated in SU8 polymer, can achieve high sensitivity, label-free chemical sensing in solution and high sensitivity biological sensing, at visible wavelengths.

  12. Mechanical (turbines and auxiliary equipment)

    CERN Document Server

    Sherry, A; Cruddace, AE

    2013-01-01

    Modern Power Station Practice, Volume 3: Mechanical (Turbines and Auxiliary Equipment) focuses on the development of turbines and auxiliary equipment used in power stations in Great Britain. Topics covered include thermodynamics and steam turbine theory; turbine auxiliary systems such as lubrication systems, feed water heating systems, and the condenser and cooling water plants. Miscellaneous station services, and pipework in power plants are also described. This book is comprised of five chapters and begins with an overview of thermodynamics and steam turbine theory, paying particular attenti

  13. A dual surface plasmon resonance assay for the determination of ribonuclease H activity

    Czech Academy of Sciences Publication Activity Database

    Šípová, Hana; Vaisocherová, Hana; Štepánek, J.; Homola, Jiří

    2010-01-01

    Roč. 26, č. 4 (2010), s. 1605-1611 ISSN 0956-5663 R&D Projects: GA AV ČR KAN200670701; GA MŠk OC09058; GA ČR GA202/09/0193 Grant - others:Univerzita Karlova(CZ) SVV-2010-261 304 Institutional research plan: CEZ:AV0Z20670512 Keywords : Surface plasmon resonance * Enzyme activity assay * Ribonuclease H * Biosensor Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 5.361, year: 2010

  14. A dual-wavelength overlapping resonance Rayleigh scattering method for the determination of chondroitin sulfate with nile blue sulfate

    Science.gov (United States)

    Cui, Zhiping; Hu, Xiaoli; Liu, Shaopu; Liu, Zhongfang

    2011-12-01

    A dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) method was developed to detect chondroitin sulfate (CS) with nile blue sulfate (NBS). At pH 3.0-4.0 Britton-Robinson (BR) buffer medium, CS interacted with NBS to form an ion-association complex. As a result, the new spectra of resonance Rayleigh scattering (RRS), second order scattering (SOS) and frequence doubling scattering (FDS) appeared and their intensities were enhanced greatly. Their maximum wavelengths were located at 303 nm (RRS), 362 nm (RRS), 588 nm (SOS) and 350 nm (FDS), respectively. The scattering intensities of the three methods were proportional to the concentration of CS in certain ranges. The methods had high sensitivity and the detection limits were between 1.5 and 7.1 ng mL -1. The DWO-RRS method had the highest sensitivity with the detection limit being 1.5 ng mL -1. The characteristics of the spectra and optimal reaction conditions of RRS method were investigated. The effects of coexistent substances on the determination of CS were evaluated. Owing to the high sensitivity, RRS method had been applied to the determination of CS in eye drops with satisfactory results. The recovery range was between 99.4% and 104.6% and the relative standard deviation (RSD) was between 0.4% and 0.8%. In addition, the reasons for RRS enhancement were discussed and the shape of ion-association complex was characterized by atomic force microscopy (AFM).

  15. Dual curved photonic crystal ring resonator based channel drop filter using two-dimensional photonic crystal structure

    Energy Technology Data Exchange (ETDEWEB)

    Chhipa, Mayur Kumar, E-mail: mayurchhipa1@gmail.com [Deptt. of Electronics and Communication Engineering, Government Engineering College Ajmer Rajasthan INDIA (India); Dusad, Lalit Kumar [Rajasthan Technical University Kota, Rajasthan (India)

    2016-05-06

    In this paper channel drop filter (CDF) is designed using dual curved photonic crystal ring resonator (PCRR). The photonic band gap (PBG) is calculated by plane wave expansion (PWE) method and the photonic crystal (PhC) based on two dimensional (2D) square lattice periodic arrays of silicon (Si) rods in air structure have been investigated using finite difference time domain (FDTD) method. The number of rods in Z and X directions is 21 and 20 respectively with lattice constant 0.540 nm and rod radius r = 0.1 µm. The channel drop filter has been optimized for telecommunication wavelengths λ = 1.591 µm with refractive indices 3.533. In the designed structure further analysis is also done by changing whole rods refractive index and it has been observed that this filter may be used for filtering several other channels also. The designed structure is useful for CWDM systems. This device may serve as a key component in photonic integrated circuits. The device is ultra compact with the overall size around 123 µm{sup 2}.

  16. Accelerating the reconstruction of magnetic resonance imaging by three-dimensional dual-dictionary learning using CUDA.

    Science.gov (United States)

    Jiansen Li; Jianqi Sun; Ying Song; Yanran Xu; Jun Zhao

    2014-01-01

    An effective way to improve the data acquisition speed of magnetic resonance imaging (MRI) is using under-sampled k-space data, and dictionary learning method can be used to maintain the reconstruction quality. Three-dimensional dictionary trains the atoms in dictionary in the form of blocks, which can utilize the spatial correlation among slices. Dual-dictionary learning method includes a low-resolution dictionary and a high-resolution dictionary, for sparse coding and image updating respectively. However, the amount of data is huge for three-dimensional reconstruction, especially when the number of slices is large. Thus, the procedure is time-consuming. In this paper, we first utilize the NVIDIA Corporation's compute unified device architecture (CUDA) programming model to design the parallel algorithms on graphics processing unit (GPU) to accelerate the reconstruction procedure. The main optimizations operate in the dictionary learning algorithm and the image updating part, such as the orthogonal matching pursuit (OMP) algorithm and the k-singular value decomposition (K-SVD) algorithm. Then we develop another version of CUDA code with algorithmic optimization. Experimental results show that more than 324 times of speedup is achieved compared with the CPU-only codes when the number of MRI slices is 24.

  17. Magnetic resonance imaging and dual energy X-ray absorptiometry of the lumbar spine in professional wrestlers and untrained men.

    Science.gov (United States)

    Hu, M; Sheng, J; Kang, Z; Zou, L; Guo, J; Sun, P

    2014-08-01

    The aim of this study was to examine the relation between bone marrow adipose tissue (BMAT) and bone mineral density (BMD) of lumbar spine in male professional wrestlers and healthy untrained men. A total of 14 wrestlers (22.9±3.4 years) and 11 controls (24.4±1.6 years) were studied cross-sectionally. Body composition and BMD were measured by dual-energy X-ray absorptiometry. Magnetic resonance imaging of the lumbar spine was examined in a sagittal T1-weighted (T1-w) spin-echo (SE) sequence. The averaged bone marrow signal intensity (SI) of L2-L4 was related to the signal of an adjacent nondegenerative disk. Mean SI of T1-w SE in wrestlers was lower than controls (P=0.001), indicating L2-L4 BMAT in wrestlers was lower compared to controls. L2-L4 BMD in wrestlers was higher than controls (PBMAT and BMD was confirmed in this relatively small subject sample with narrow age range, which implies that exercise training is an important determinant of this association.

  18. Study on Brilliant Blue-chitosan System by Dual-wavelength Overlapping Resonance Rayleigh Scattering Method and its Analytical Applications

    Science.gov (United States)

    Ma, Caijuan; Sun, Zijun; Liu, Guihua; Su, Zhengquan; Bai, Yan

    2018-02-01

    The method was presented for the sensitive and selective determination of chitosan (CTS) in health products with Brilliant Blue (BB) as a probe, based on dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS). In weakly acidic buffer solution, the binding of CTS and BB could result in the RRS intensities getting enhanced significantly at RRS peaks of 344 nm and 452 nm, and the scattering intensities of the two peaks were proportional to the concentration of CTS within a certain range. When the RRS intensities of the two wavelengths were superposed, the results showed higher sensitivity. Under the optimum experimental conditions, the total of the two increased RRS intensities was linear to the CTS concentration in the range of 0.02-1.80 μg/mL and the limit of detection (LOD) was 7.45 ng/mL. In this work, the optimum conditions and the effects of some foreign substances were studied. Accordingly, the new method based on DWO-RRS for the determination of CTS was developed. In addition, the effect of the molecular weight and the deacetylation degree between different chitosan molecules was discussed. Finally, this assay was applied to determine the concentration of CTS in health products with satisfactory results.

  19. White Paper of the Society of Computed Body Tomography and Magnetic Resonance on Dual-Energy CT, Part 1: Technology and Terminology.

    Science.gov (United States)

    Siegel, Marilyn J; Kaza, Ravi K; Bolus, David N; Boll, Daniel T; Rofsky, Neil M; De Cecco, Carlo N; Foley, W Dennis; Morgan, Desiree E; Schoepf, U Joseph; Sahani, Dushyant V; Shuman, William P; Vrtiska, Terri J; Yeh, Benjamin M; Berland, Lincoln L

    This is the first of a series of 4 white papers that represent Expert Consensus Documents developed by the Society of Computed Body Tomography and Magnetic Resonance through its task force on dual-energy computed tomography (DECT). This article, part 1, describes the fundamentals of the physical basis for DECT and the technology of DECT and proposes uniform nomenclature to account for differences in proprietary terms among manufacturers.

  20. Dual breath-hold magnetic resonance cine evaluation of global and regional cardiac function

    International Nuclear Information System (INIS)

    Wintersperger, Bernd J.; Dietrich, Olaf; Huber, Armin; Reiser, Maximilian F.; Schoenberg, Stefan O.; Sincleair, Spencer; Runge, Val M.

    2007-01-01

    The purpose of our study was to evaluate the accuracy of a multislice cine magnetic resonance imaging (MRI) technique with parallel imaging in regard to global and regional left ventricular function. Forty-two individuals underwent cine MRI on a 1.5-tesla scanner. Cine MRI used a steady-state free precession technique and was performed as a single-slice technique (nonTSENSE cine) and an accelerated multislice technique (TSENSE cine) with five slices per breath-hold. End diastolic volume (EDV), end systolic volume (ESV), and ejection fraction (EF) were evaluated for all data sets and in regard to regional wall motion and regional wall motion analysis, and quantitative regional wall thickness and systolic thickening were also assessed. EDV, ESV, and EF based on TSENSE cine showed excellent correlation to the nonTSENSE cine approach (all r 2 =0.99, P<0.001). While EDV evaluations showed a small underestimation for TSENSE cine, ESV and EF showed accurate results compared with nonTSENSE cine. Both readers showed good agreement (κ=0.72) in regional wall motion assessment comparing both techniques. Data acquisition for the multislice approach was significantly shorter (∝75%) that in single-slice cine. We conclude that accurate evaluation of regional wall motion and left ventricular EF is possible using accelerated multislice cine MR with high spatial and temporal resolution. (orig.)

  1. Dual-Mode Gas Sensor Composed of a Silicon Nanoribbon Field Effect Transistor and a Bulk Acoustic Wave Resonator: A Case Study in Freons

    Directory of Open Access Journals (Sweden)

    Ye Chang

    2018-01-01

    Full Text Available In this paper, we develop a novel dual-mode gas sensor system which comprises a silicon nanoribbon field effect transistor (Si-NR FET and a film bulk acoustic resonator (FBAR. We investigate their sensing characteristics using polar and nonpolar organic compounds, and demonstrate that polarity has a significant effect on the response of the Si-NR FET sensor, and only a minor effect on the FBAR sensor. In this dual-mode system, qualitative discrimination can be achieved by analyzing polarity with the Si-NR FET and quantitative concentration information can be obtained using a polymer-coated FBAR with a detection limit at the ppm level. The complementary performance of the sensing elements provides higher analytical efficiency. Additionally, a dual mixture of two types of freons (CFC-113 and HCFC-141b is further analyzed with the dual-mode gas sensor. Owing to the small size and complementary metal-oxide semiconductor (CMOS-compatibility of the system, the dual-mode gas sensor shows potential as a portable integrated sensing system for the analysis of gas mixtures in the future.

  2. Nanoparticles in magnetic resonance imaging: from simple to dual contrast agents

    Directory of Open Access Journals (Sweden)

    Estelrich J

    2015-03-01

    Full Text Available Joan Estelrich,1,2 María Jesús Sánchez-Martín,1 Maria Antònia Busquets1,2 1Departament de Fisicoquímica, Facultat de Farmàcia, Universitat de Barcelona, Barcelona, Catalonia, Spain; 2Institut de Nanociència I Nanotecnologia (IN2UB, Barcelona, Catalonia, SpainAbstract: Magnetic resonance imaging (MRI has become one of the most widely used and powerful tools for noninvasive clinical diagnosis owing to its high degree of soft tissue contrast, spatial resolution, and depth of penetration. MRI signal intensity is related to the relaxation times (T1, spin–lattice relaxation and T2, spin–spin relaxation of in vivo water protons. To increase contrast, various inorganic nanoparticles and complexes (the so-called contrast agents are administered prior to the scanning. Shortening T1 and T2 increases the corresponding relaxation rates, 1/T1 and 1/T2, producing hyperintense and hypointense signals respectively in shorter times. Moreover, the signal-to-noise ratio can be improved with the acquisition of a large number of measurements. The contrast agents used are generally based on either iron oxide nanoparticles or ferrites, providing negative contrast in T2-weighted images; or complexes of lanthanide metals (mostly containing gadolinium ions, providing positive contrast in T1-weighted images. Recently, lanthanide complexes have been immobilized in nanostructured materials in order to develop a new class of contrast agents with functions including blood-pool and organ (or tumor targeting. Meanwhile, to overcome the limitations of individual imaging modalities, multimodal imaging techniques have been developed. An important challenge is to design all-in-one contrast agents that can be detected by multimodal techniques. Magnetoliposomes are efficient multimodal contrast agents. They can simultaneously bear both kinds of contrast and can, furthermore, incorporate targeting ligands and chains of polyethylene glycol to enhance the accumulation of

  3. Glioma-targeting micelles for optical/magnetic resonance dual-mode imaging

    Directory of Open Access Journals (Sweden)

    Zhou Q

    2015-03-01

    Full Text Available Qing Zhou,1,* Ketao Mu,2,* Lingyu Jiang,1 Hui Xie,3 Wei Liu,1 Zhengzheng Li,1 Hui Qi,1 Shuyan Liang,1 Huibi Xu,1 Yanhong Zhu,1 Wenzhen Zhu,2 Xiangliang Yang11National Engineering Research Center for Nanomedicine, College of Life Science and Technology, 2Radiology Department, Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, 3Department of Information Processing, China Patent Information Center, Wuhan, People’s Republic of China*These authors contributed equally to this workAbstract: Surgical resection is the primary mode for glioma treatment, while gross total resection is difficult to achieve, due to the invasiveness of the gliomas. Meanwhile, the tumor-resection region is closely related to survival rate and life quality. Therefore, we developed optical/magnetic resonance imaging (MRI bifunctional targeted micelles for glioma so as to delineate the glioma location before and during operation. The micelles were constructed through encapsulation of hydrophobic superparamagnetic iron oxide nanoparticles (SPIONs with polyethylene glycol-block-polycaprolactone (PEG-b-PCL by using a solvent-evaporation method, and modified with a near-infrared fluorescent probe, Cy5.5, in addition to the glioma-targeting ligand lactoferrin (Lf. Being encapsulated by PEG-b-PCL, the hydrophobic SPIONs dispersed well in phosphate-buffered saline over 4 weeks, and the relaxivity (r2 of micelles was 215.4 mM–1·s–1, with sustained satisfactory fluorescent imaging ability, which might have been due to the interval formed by PEG-b-PCL for avoiding the fluorescence quenching caused by SPIONs. The in vivo results indicated that the nanoparticles with Lf accumulated efficiently in glioma cells and prolonged the duration of hypointensity at the tumor site over 48 hours in the MR image compared to the nontarget group. Corresponding with the MRI results, the margin of the glioma was clearly demarcated in the fluorescence image

  4. Improving Energy Efficiency of Auxiliaries

    International Nuclear Information System (INIS)

    Carl T. Vuk

    2001-01-01

    The summaries of this report are: Economics Ultimately Dictates Direction; Electric Auxiliaries Provide Solid Benefits. The Impact on Vehicle Architecture Will be Important; Integrated Generators With Combined With Turbo Generators Can Meet the Electrical Demands of Electric Auxiliaries; Implementation Will Follow Automotive 42V Transition; Availability of Low Cost Hardware Will Slow Implementation; Industry Leadership and Cooperation Needed; Standards and Safety Protocols Will be Important. Government Can Play an Important Role in Expediting: Funding Technical Development; Incentives for Improving Fuel Economy; Developing Standards, Allowing Economy of Scale; and Providing Safety Guidelines

  5. Quantitative assessment of left ventricular function with dual-source CT in comparison to cardiac magnetic resonance imaging: initial findings

    Energy Technology Data Exchange (ETDEWEB)

    Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K. [University of Munich, Department of Clinical Radiology, Munich (Germany)

    2008-03-15

    Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 {+-} 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 {+-} 41.9 ml and 54.9 {+-} 29.6 ml, respectively, compared with 132.1 {+-} 40.8 ml EDV and 57.6 {+-} 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 {+-} 12.4% in DSCT and 57.9 {+-} 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P = 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter

  6. Quantitative assessment of left ventricular function with dual-source CT in comparison to cardiac magnetic resonance imaging: initial findings

    International Nuclear Information System (INIS)

    Busch, S.; Johnson, T.R.C.; Wintersperger, B.J.; Minaifar, N.; Bhargava, A.; Rist, C.; Reiser, M.F.; Becker, C.; Nikolaou, K.

    2008-01-01

    Cardiac magnetic resonance imaging and echocardiography are currently regarded as standard modalities for the quantification of left ventricular volumes and ejection fraction. With the recent introduction of dual-source computedtomography (DSCT), the increased temporal resolution of 83 ms should also improve the assessment of cardiac function in CT. The aim of this study was to evaluate the accuracy of DSCT in the assessment of left ventricular functional parameters with cardiac magnetic resonance imaging (MRI) as standard of reference. Fifteen patients (two female, 13 male; mean age 50.8 ± 19.2 years) underwent CT and MRI examinations on a DSCT (Somatom Definition; Siemens Medical Solutions, Forchheim, Germany) and a 3.0-Tesla MR scanner (Magnetom Trio; Siemens Medical Solutions), respectively. Multiphase axial CT images were analysed with a semiautomatic region growing algorithms (Syngo Circulation; Siemens Medical Solutions) by two independent blinded observers. In MRI, dynamic cine loops of short axis slices were evaluated with semiautomatic contour detection software (ARGUS; Siemens Medical Solutions) independently by two readers. End-systolic volume (ESV), end-diastolic volume (EDV), ejection fraction (EF) and stroke volume (SV) were determined for both modalities, and correlation coefficient, systematic error, limits of agreement and inter-observer variability were assessed. In DSCT, EDV and ESV were 135.8 ± 41.9 ml and 54.9 ± 29.6 ml, respectively, compared with 132.1 ± 40.8 ml EDV and 57.6 ± 27.3 ml ESV in MRI. Thus, EDV was overestimated by 3.7 ml (limits of agreement -46.1/+53.6), while ESV was underestimated by 2.6 ml (-36.6/+31.4). Mean EF was 61.6 ± 12.4% in DSCT and 57.9 ± 9.0% in MRI, resulting in an overestimation of EF by 3.8% with limits of agreement at -14.7 and +22.2%. Rank correlation rho values were 0.81 for EDV (P = 0.0024), 0.79 for ESV (P 0.0031) and 0.64 for EF (P = 0.0168). The kappa value of inter-observer variability were

  7. Determination of trace uranium by resonance fluorescence method coupled with photo-catalytic technology and dual cloud point extraction.

    Science.gov (United States)

    Li, Jiekang; Li, Guirong; Han, Qian

    2016-12-05

    In this paper, two kinds of salophens (Sal) with different solubilities, Sal1 and Sal2, have been respectively synthesized, and they all can combine with uranyl to form stable complexes: [UO2(2+)-Sal1] and [UO2(2+)-Sal2]. Among them, [UO2(2+)-Sal1] was used as ligand to extract uranium in complex samples by dual cloud point extraction (dCPE), and [UO2(2+)-Sal2] was used as catalyst for the determination of uranium by photocatalytic resonance fluorescence (RF) method. The photocatalytic characteristic of [UO2(2+)-Sal2] on the oxidized pyronine Y (PRY) by potassium bromate which leads to the decrease of RF intensity of PRY were studied. The reduced value of RF intensity of reaction system (ΔF) is in proportional to the concentration of uranium (c), and a novel photo-catalytic RF method was developed for the determination of trace uranium (VI) after dCPE. The combination of photo-catalytic RF techniques and dCPE procedure endows the presented methods with enhanced sensitivity and selectivity. Under optimal conditions, the linear calibration curves range for 0.067 to 6.57ngmL(-1), the linear regression equation was ΔF=438.0 c (ngmL(-1))+175.6 with the correlation coefficient r=0.9981. The limit of detection was 0.066ngmL(-1). The proposed method was successfully applied for the separation and determination of uranium in real samples with the recoveries of 95.0-103.5%. The mechanisms of the indicator reaction and dCPE are discussed. Copyright © 2016 Elsevier B.V. All rights reserved.

  8. Dual-echo, chemical shift gradient-echo magnetic resonance imaging to quantify hepatic steatosis: Implications for living liver donation.

    Science.gov (United States)

    Rinella, Mary E; McCarthy, Richard; Thakrar, Kiran; Finn, John Paul; Rao, Sambasiva M; Koffron, Alan J; Abecassis, Michael; Blei, Andres T

    2003-08-01

    In living liver donation, a fatty liver poses risks for both recipient and donor. Currently, liver biopsy is the standard for assessing the presence and extent of steatosis. The goals of this study were to correlate a steatosis index derived from magnetic resonance imaging (MRI) to the histologic grade on biopsy as well as to determine the topographic distribution of steatosis within the liver. We examined the ability of dual-echo, chemical shift gradient-echo MRI to predict the degree of steatosis on liver biopsy. A total of 22 subjects received both a liver biopsy and detailed MRI evaluation. These individuals included 15 potential living donors and 7 patients with nonalcoholic fatty liver disease. MRI steatosis index was then compared with histologic grade on liver biopsy. The topographic distribution of hepatic steatosis was determined from those subjects in whom MRI detected hepatic steatosis. The steatosis index had a positive correlation with grade of steatosis on liver biopsy (correlation coefficient, 0.84). There was no significant variation in the degree of steatosis among segments. A steatosis index of >0.2 had good positive and negative predictive value for the presence of significant steatosis (>15%) on biopsy. Our quantitative MRI protocol can predict the degree of hepatic steatosis when it is minimal to moderate, and may obviate the need for liver biopsy for the purpose of quantification of steatosis in living donors. Fat saturation added to the MRI protocol may further improve diagnostic accuracy. This technique may be applicable to the larger population with hepatic steatosis.

  9. Mesoporous composite nanoparticles for dual-modality ultrasound/magnetic resonance imaging and synergistic chemo-/thermotherapy against deep tumors

    Directory of Open Access Journals (Sweden)

    Zhang N

    2017-10-01

    Full Text Available Nan Zhang,1 Ronghui Wang,2 Junnian Hao,1 Yang Yang,1 Hongmi Zou,3 Zhigang Wang1 1Chongqing Key Laboratory of Ultrasound Molecular Imaging, Second Affiliated Hospital of Chongqing Medical University, Chongqing Medical University, Chongqing, 2Department of Ultrasound, Ruijin Hospital, Shanghai Jiao Tong University School of Medicine, Shanghai, 3Department of Ophthalmology, Second Affiliated Hospital of Chongqing Medical University, Chongqing, People’s Republic of China Abstract: High-intensity focused ultrasound (HIFU is a promising and noninvasive treatment for solid tumors, which has been explored for potential clinical applications. However, the clinical applications of HIFU for large and deep tumors such as hepatocellular carcinoma (HCC are severely limited by unsatisfactory imaging guidance, long therapeutic times, and damage to normal tissue around the tumor due to the high power applied. In this study, we developed doxorubicin/perfluorohexane-encapsulated hollow mesoporous Prussian blue nanoparticles (HMPBs-DOX/PFH as theranostic agents, which can effectively guide HIFU therapy and enhance its therapeutic effects in combination with chemotherapy, by decreasing the cavitation threshold. We investigated the effects of this agent on ultrasound and magnetic resonance imaging in vitro and in vivo. In addition, we showed a highly efficient HIFU therapeutic effect against HCC tumors, as well as controlled drug release, owing to the phase-transitional performance of the PFH. We therefore conclude that HMPB-DOX/PFH is a safe and efficient nanoplatform, which holds significant promise for cancer theranostics against deep tumors in clinical settings. Keywords: high-intensity focused ultrasound, HIFU, hollow mesoporous Prussian blue nanoplatforms, hepatocellular carcinoma, dual-modality imaging, synergistic chemo-/thermotherapy, theranostics

  10. Resonance

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2014-01-01

    A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice.......A chapter in a book about terminology within the field of medievalism: the chapter discusses the resonance of medieval music and ritual in modern (classical) music culture and liturgical practice....

  11. Hydraulic turbines and auxiliary equipment

    Energy Technology Data Exchange (ETDEWEB)

    Luo Gaorong [Organization of the United Nations, Beijing (China). International Centre of Small Hydroelectric Power Plants

    1995-07-01

    This document presents a general overview on hydraulic turbines and auxiliary equipment, emphasizing the turbine classification, in accordance with the different types of turbines, standard turbine series in China, turbine selection based on the basic data required for the preliminary design, general hill model curves, chart of turbine series and the arrangement of application for hydraulic turbines, hydraulic turbine testing, and speed regulating device.

  12. Aspectual auxiliary verbs in Xitsonga

    African Journals Online (AJOL)

    Kate H

    Let him always come' e. á vá hátl-é vá yá étlélà. OPT 3PL quickly-OPT 3PL go sleep. 'Let them quickly go to bed'. 3.4 Negative markers. Negation is marked on AA verbs. The auxiliary verb hatla 'quickly' is negated in three tenses.

  13. The impact of dual-source parallel radiofrequency transmission with patient-adaptive shimming on the cardiac magnetic resonance in children at 3.0 T.

    Science.gov (United States)

    Wang, Haipeng; Qiu, Liyun; Wang, Guangbin; Gao, Fei; Jia, Haipeng; Zhao, Junyu; Chen, Weibo; Wang, Cuiyan; Zhao, Bin

    2017-06-01

    The cardiac magnetic resonance (CMR) of children at 3.0 T presents a unique set of technical challenges because of their small cardiac anatomical structures, fast heart rates, and the limited ability to keep motionless and hold breathe, which could cause problems associated with field inhomogeneity and degrade the image quality. The aim of our study was to evaluate the effect of dual-source parallel radiofrequency (RF) transmission on the B1 homogeneity and image quality in children with CMR at 3.0 T. The study was approved by the institutional ethics committee and written informed consent was obtained. A total of 30 free-breathing children and 30 breath-hold children performed CMR examinations with dual-source and single-source RF transmission. The B1 homogeneity, contrast ratio (CR) of cine images, and off-resonance artifacts in cine images between dual-source and single-source RF transmission were assessed in free-breathing and breath-hold groups, respectively. In both free-breathing and breath-hold groups, higher mean percentage of flip angle (free-breathing group: 104.2 ± 4.6 vs 95.5 ± 6.3, P 3.0 T. This technology could be taken into account in CMR for children with cardiac diseases.

  14. Auxiliary cooling device for power plant

    International Nuclear Information System (INIS)

    Yamanoi, Kozo.

    1996-01-01

    An auxiliary cooling sea water pipeline for pumping up cooling sea water, an auxiliary cooling sea water pipeline and a primary side of an auxiliary cooling heat exchanger are connected between a sea water taking vessel and a sea water discharge pit. An auxiliary cooling water pump is connected to an auxiliary water cooling pipeline on the second side of the auxiliary cooling heat exchanger. The auxiliary cooling water pipeline is connected with each of auxiliary equipments of a reactor system and each of auxiliary equipments of the turbine system connected to a turbine auxiliary cooling water pipeline in parallel. During ordinary operation of the reactor, heat exchange for each of the auxiliary equipments of the reactor and heat exchange for each of the equipments of the turbine system are conducted simultaneously. Since most portions of the cooling devices of each of the auxiliary equipments of the reactor system and each of the auxiliary equipments of the turbine system can be used in common, the operation efficiency of the cooling device is improved. In addition, the space for the pipelines and the cost for the equipments can be reduced. (I.N.)

  15. 33 CFR 5.47 - Auxiliary ensign.

    Science.gov (United States)

    2010-07-01

    ... matching blue Coast Guard Auxiliary emblem is centered. The white slash shall be at a 70 degree angle, rising away from the hoist. (c) The Auxiliary emblem consists of a disk with the shield of the Coat of...

  16. Metamaterial Combining Electric- and Magnetic-Dipole-Based Configurations for Unique Dual-Band Signal Enhancement in Ultrahigh-Field Magnetic Resonance Imaging.

    Science.gov (United States)

    Schmidt, Rita; Webb, Andrew

    2017-10-11

    Magnetic resonance imaging and spectroscopy (MRI and MRS) are both widely used techniques in medical diagnostics and research. One of the major thrusts in recent years has been the introduction of ultrahigh-field magnets in order to boost the sensitivity. Several MRI studies have examined further potential improvements in sensitivity using metamaterials, focusing on single frequency applications. However, metamaterials have yet to reach a level that is practical for routine MRI use. In this work, we explore a new metamaterial implementation for MRI, a dual-nuclei resonant structure, which can be used for both proton and heteronuclear magnetic resonance. Our approach combines two configurations, one based on a set of electric dipoles for the low frequency band, and the second based on a set of magnetic dipoles for the high frequency band. We focus on the implementation of a dual-nuclei metamaterial for phosphorus and proton imaging and spectroscopy at an ultrahigh-field strength of 7 T. In vivo scans using this flexible and compact structure show that it locally enhances both the phosphorus and proton transmit and receive sensitivities.

  17. Dual temperature concentration system

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1975-01-01

    In a dual temperature isotope exchange system--exemplified by exchange of deuterium and protium between water and hydrogen sulfide gas in hot and cold towers, in which the feed stream (water) containing the desired isotope is passed through a pair of towers maintained at different temperatures wherein it effects isotope exchange with countercurrently circulated auxiliary fluid (H 2 S) and is impoverished in said isotope and then disposed of, e.g. discharged to waste,--the flow of isotope enriched auxiliary fluid between said towers (hot H 2 S saturated with water vapor) is divided and a part thereof is adjusted in its temperature (to cold tower conditions) and then passed to the auxiliary fluid impoverishing (cold) tower, while the remainder of the divided flow of such enriched auxiliary fluid is passed through a subsequent isotope concentration treatment to produce a product more highly enriched in the desired isotope and wherein it is also adjusted in its temperature and is impoverished in said isotope during said subsequent treatment before it is delivered to the said auxiliary fluid impoverishing (cold) tower. Certain provisions are made for returning to the hot tower liquid carried as vapor by the remainder of the divided flow to the subsequent isotope concentration treatment, for recovering sensible and latent heat, and for reducing passage of auxiliary fluid to waste

  18. In vivo magnetic resonance and fluorescence dual imaging of tumor sites by using dye-doped silica-coated iron oxide nanoparticles

    International Nuclear Information System (INIS)

    Jang, Haeyun; Lee, Chaedong; Nam, Gi-Eun; Quan, Bo; Choi, Hyuck Jae; Yoo, Jung Sun; Piao, Yuanzhe

    2016-01-01

    The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex ® with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.

  19. In vivo magnetic resonance and fluorescence dual imaging of tumor sites by using dye-doped silica-coated iron oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Jang, Haeyun; Lee, Chaedong [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Nam, Gi-Eun [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Quan, Bo [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of); Choi, Hyuck Jae [University of Ulsan College of Medicine, Department of Radiology, Asan Medical Center (Korea, Republic of); Yoo, Jung Sun [Seoul National University, Department of Transdisciplinary Studies, Graduate School of Convergence Science and Technology, Smart Humanity Convergence Center (Korea, Republic of); Piao, Yuanzhe, E-mail: parkat9@snu.ac.kr [Seoul National University, Program in Nano Science and Technology, Graduate School of Convergence Science and Technology (Korea, Republic of)

    2016-02-15

    The difficulty in delineating tumor is a major obstacle for better outcomes in cancer treatment of patients. The use of single-imaging modality is often limited by inadequate sensitivity and resolution. Here, we present the synthesis and the use of monodisperse iron oxide nanoparticles coated with fluorescent silica nano-shells for fluorescence and magnetic resonance dual imaging of tumor. The as-synthesized core–shell nanoparticles were designed to improve the accuracy of diagnosis via simultaneous tumor imaging with dual imaging modalities by a single injection of contrast agent. The iron oxide nanocrystals (∼11 nm) were coated with Rhodamine B isothiocyanate-doped silica shells via reverse microemulsion method. Then, the core–shell nanoparticles (∼54 nm) were analyzed to confirm their size distribution by transmission electron microscopy and dynamic laser scattering. Photoluminescence spectroscopy was used to characterize the fluorescent property of the dye-doped silica shell-coated nanoparticles. The cellular compatibility of the as-prepared nanoparticles was confirmed by a trypan blue dye exclusion assay and the potential as a dual-imaging contrast agent was verified by in vivo fluorescence and magnetic resonance imaging. The experimental results show that the uniform-sized core–shell nanoparticles are highly water dispersible and the cellular toxicity of the nanoparticles is negligible. In vivo fluorescence imaging demonstrates the capability of the developed nanoparticles to selectively target tumors by the enhanced permeability and retention effects and ex vivo tissue analysis was corroborated this. Through in vitro phantom test, the core/shell nanoparticles showed a T2 relaxation time comparable to Feridex{sup ®} with smaller size, indicating that the as-made nanoparticles are suitable for imaging tumor. This new dual-modality-nanoparticle approach has promised for enabling more accurate tumor imaging.

  20. 45 CFR 707.10 - Auxiliary aids.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Auxiliary aids. 707.10 Section 707.10 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION ON CIVIL RIGHTS ENFORCEMENT OF... § 707.10 Auxiliary aids. (a) The Agency shall furnish appropriate auxiliary aids where necessary to...

  1. 7 CFR 15b.37 - Auxiliary aids.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Auxiliary aids. 15b.37 Section 15b.37 Agriculture... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Other Aid, Benefits, or Services § 15b.37 Auxiliary aids... appropriate auxiliary aids to persons with impaired sensory, manual, or speaking skills, where necessary to...

  2. 30 CFR 57.6161 - Auxiliary facilities.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary facilities. 57.6161 Section 57.6161...-Underground Only § 57.6161 Auxiliary facilities. (a) Auxiliary facilities used to store explosive material near work places shall be wooden, box-type containers equipped with covers or doors, or facilities...

  3. Induced dual EIT and EIA resonances with optical trapping phenomenon in near/far fields in the N-type four-level system

    Science.gov (United States)

    Osman, Kariman I.; Joshi, Amitabh

    2017-01-01

    The optical trapping phenomenon is investigated in the probe absorptive susceptibility spectra, during the interaction of four-level N-type atomic system with three transverse Gaussian fields, in a Doppler broadened medium. The system was studied under different temperature settings of 87Rb atomic vapor as well as different non-radiative decay rate. The system exhibits a combination of dual electromagnetically induced transparency with electromagnetically induced absorption (EIA) or transparency (EIT) resonances simultaneously in near/far field. Also, the optical trapping phenomenon is considerably affected by the non-radiative decay rate.

  4. Highly sensitive digital optical sensor with large measurement range based on the dual-microring resonator with waveguide-coupled feedback

    International Nuclear Information System (INIS)

    Xiang Xing-Ye; Wang Kui-Ru; Yuan Jin-Hui; Jin Bo-Yuan; Sang Xin-Zhu; Yu Chong-Xiu

    2014-01-01

    We propose a novel high-performance digital optical sensor based on the Mach—Zehnder interferential effect and the dual-microring resonators with the waveguide-coupled feedback. The simulation results show that the sensitivity of the sensor can be orders of magnitude higher than that of a conventional sensor, and high quality factor is not critical in it. Moreover, by optimizing the length of the feedback waveguide to be equal to the perimeter of the ring, the measurement range of the proposed sensor is twice as much as that of the conventional sensor in the weak coupling case

  5. Proceedings: Power Plant Electric Auxiliary Systems Workshop

    International Nuclear Information System (INIS)

    1992-06-01

    The EPRI Power Plant Electric Auxiliary Systems Workshop, held April 24--25, 1991, in Princeton, New Jersey, brought together utilities, architect/engineers, and equipment suppliers to discuss common problems with power plant auxiliary systems. Workshop participants presented papers on monitoring, identifying, and solving problems with auxiliary systems. Panel discussions focused on improving systems and existing and future plants. The solutions presented to common auxiliary system problems focused on practical ideas that can enhance plant availability, reduce maintenance costs, and simplify the engineering process. The 13 papers in these proceedings include: Tutorials on auxiliary electrical systems and motors; descriptions of evaluations, software development, and new technologies used recently by electric utilities; an analysis of historical performance losses caused by power plant auxiliary systems; innovative design concepts for improving auxiliary system performance in future power plants

  6. Resonances

    DEFF Research Database (Denmark)

    an impetus or drive to that account: change, innovation, rupture, or discontinuity. Resonances: Historical Essays on Continuity and Change explores the historiographical question of the modes of interrelation between these motifs in historical narratives. The essays in the collection attempt to realize...

  7. Dual-mode T_1 and T_2 magnetic resonance imaging contrast agent based on ultrasmall mixed gadolinium-dysprosium oxide nanoparticles: synthesis, characterization, and in vivo application

    International Nuclear Information System (INIS)

    Tegafaw, Tirusew; Xu, Wenlong; Ahmad, Md Wasi; Lee, Gang Ho; Baeck, Jong Su; Chang, Yongmin; Bae, Ji Eun; Chae, Kwon Seok; Kim, Tae Jeong

    2015-01-01

    A new type of dual-mode T_1 and T_2 magnetic resonance imaging (MRI) contrast agent based on mixed lanthanide oxide nanoparticles was synthesized. Gd"3"+ ("8S_7_/_2) plays an important role in T_1 MRI contrast agents because of its large electron spin magnetic moment resulting from its seven unpaired 4f-electrons, and Dy"3"+ ("6H_1_5_/_2) has the potential to be used in T_2 MRI contrast agents because of its very large total electron magnetic moment: among lanthanide oxide nanoparticles, Dy_2O_3 nanoparticles have the largest magnetic moments at room temperature. Using these properties of Gd"3"+ and Dy"3"+ and their oxide nanoparticles, ultrasmall mixed gadolinium-dysprosium oxide (GDO) nanoparticles were synthesized and their potential to act as a dual-mode T_1 and T_2 MRI contrast agent was investigated in vitro and in vivo. The D-glucuronic acid coated GDO nanoparticles (d_a_v_g = 1.0 nm) showed large r_1 and r_2 values (r_2/r_1 ≈ 6.6) and as a result clear dose-dependent contrast enhancements in R_1 and R_2 map images. Finally, the dual-mode imaging capability of the nanoparticles was confirmed by obtaining in vivo T_1 and T_2 MR images. (paper)

  8. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    Energy Technology Data Exchange (ETDEWEB)

    Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN, CH-1211 Geneva 23 (Switzerland); School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Fedorov, D. [Petersburg Nuclear Physics Institute, 188350 Gatchina (Russian Federation); Fedosseev, V.N.; Forster, L.; Marsh, B.A. [CERN, CH-1211 Geneva 23 (Switzerland); Rossel, R.E. [CERN, CH-1211 Geneva 23 (Switzerland); Institut für Physik, Johannes Gutenberg Universität, D-55099 Mainz (Germany); Faculty of Design, Computer Science and Media, Hochschule RheinMain, Wiesbaden (Germany); Rothe, S.; Veinhard, M. [CERN, CH-1211 Geneva 23 (Switzerland)

    2016-09-11

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  9. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    CERN Document Server

    Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

    2016-01-01

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  10. Smart Drug Delivery System-Inspired Enzyme-Linked Immunosorbent Assay Based on Fluorescence Resonance Energy Transfer and Allochroic Effect Induced Dual-Modal Colorimetric and Fluorescent Detection.

    Science.gov (United States)

    Miao, Luyang; Zhu, Chengzhou; Jiao, Lei; Li, He; Du, Dan; Lin, Yuehe; Wei, Qin

    2018-02-06

    Numerous analytical techniques have been undertaken for the detection of protein biomarkers because of their extensive and significant applications in clinical diagnosis, whereas there are few strategies to develop dual-readout immunosensors to achieve more accurate results. To the best of our knowledge, inspired by smart drug delivery system (DDS), a novel pH-responsive modified enzyme-linked immunosorbent assay (ELISA) was innovatively developed for the first time, realizing dual-modal colorimetric and fluorescent detection of cardiac troponin I (cTnI). Curcumin (CUR) was elaborately selected as a reporter molecule, which played the same role of drugs in DDS based on the following considerations: (1) CUR can be used as a kind of pH indicator by the inherited allochroic effect induced by basic pH value; (2) the fluorescence of CUR can be quenched by certain nanocarriers as the acceptor because of the occurrence of fluorescence resonance energy transfer (FRET), while recovered by the stimuli of basic pH value, which can produce "signal-on" fluorescence detection. Three-dimensional MoS 2 nanoflowers (3D-MoS 2 NFs) were employed in immobilizing CUR to constitute a nanoprobe for the determination of cTnI by virtue of good biocompatibility, high absorption capacity, and fluorescence quench efficiency toward CUR. The proposed DDS-inspired ELISA offered dual-modal colorimetric and fluorescent detection of cTnI, thereby meeting the reliable and precise analysis requirements. We believe that the developed dual-readout ELISA will create a new avenue and bring innovative inspirations for biological detections.

  11. Three-dimensional balanced steady state free precession myocardial perfusion cardiovascular magnetic resonance at 3T using dual-source parallel RF transmission: initial experience.

    Science.gov (United States)

    Jogiya, Roy; Schuster, Andreas; Zaman, Arshad; Motwani, Manish; Kouwenhoven, Marc; Nagel, Eike; Kozerke, Sebastian; Plein, Sven

    2014-11-28

    The purpose of this study was to establish the feasibility of three-dimensional (3D) balanced steady-state-free-precession (bSSFP) myocardial perfusion cardiovascular magnetic resonance (CMR) at 3T using local RF shimming with dual-source RF transmission, and to compare it with spoiled gradient echo (TGRE) acquisition. Dynamic contrast-enhanced 3D bSSFP perfusion imaging was performed on a 3T MRI scanner equipped with dual-source RF transmission technology. Images were reconstructed using k-space and time broad-use linear acquisition speed-up technique (k-t BLAST) and compartment based principle component analysis (k-t PCA). In phantoms and volunteers, local RF shimming with dual source RF transmission significantly improved B1 field homogeneity compared with single source transmission (P=0.01). 3D bSSFP showed improved signal-to-noise, contrast-to-noise and signal homogeneity compared with 3D TGRE (29.8 vs 26.9, P=0.045; 23.2 vs 21.6, P=0.049; 14.9% vs 12.4%, p=0.002, respectively). Image quality was similar between bSSFP and TGRE but there were more dark rim artefacts with bSSFP. k-t PCA reconstruction reduced artefacts for both sequences compared with k-t BLAST. In a subset of five patients, both methods correctly identified those with coronary artery disease. Three-dimensional bSSFP myocardial perfusion CMR using local RF shimming with dual source parallel RF transmission at 3T is feasible and improves signal characteristics compared with TGRE. Image artefact remains an important limitation of bSSFP imaging at 3T but can be reduced with k-t PCA.

  12. Auxiliary reactor for a hydrocarbon reforming system

    Science.gov (United States)

    Clawson, Lawrence G.; Dorson, Matthew H.; Mitchell, William L.; Nowicki, Brian J.; Bentley, Jeffrey M.; Davis, Robert; Rumsey, Jennifer W.

    2006-01-17

    An auxiliary reactor for use with a reformer reactor having at least one reaction zone, and including a burner for burning fuel and creating a heated auxiliary reactor gas stream, and heat exchanger for transferring heat from auxiliary reactor gas stream and heat transfer medium, preferably two-phase water, to reformer reaction zone. Auxiliary reactor may include first cylindrical wall defining a chamber for burning fuel and creating a heated auxiliary reactor gas stream, the chamber having an inlet end, an outlet end, a second cylindrical wall surrounding first wall and a second annular chamber there between. The reactor being configured so heated auxiliary reactor gas flows out the outlet end and into and through second annular chamber and conduit which is disposed in second annular chamber, the conduit adapted to carry heat transfer medium and being connectable to reformer reaction zone for additional heat exchange.

  13. Auxiliary feedwater system aging study

    International Nuclear Information System (INIS)

    Kueck, J.D.

    1992-01-01

    The Phase 1 Auxiliary Feedwater (AFW) System Aging Study, NUREG/CR-5404 V1, focused on how and to what extent the various AFW system component types fail, how the failures have been and can be detected, and on the value of current testing requirements and practices. This follow-on study, which will be provided in full in NUREG/CR-5404 V2, provides a closure to the Phase 1 Study. For each of the component types and for the various sources of component failure identified in the Phase 1 Study, the methods of failure detection were designated and tabulated and the following findings became evident: Instrumentation and Control (I and C) related failures dominated the group of failures that were detected during demand conditions; many of the potential failure sources not detectable by the current monitoring practices were related to the I and C portion of the system; some component failure modes are actually aggravated by conventional test methods; and several important system functions did not undergo any function verification test. The goal of this follow-on study was to categorize and evaluate the deficiencies in testing identified by Phase 1 and to make specific recommendations for corrective action. In addition, this study presents discussions of alternate, state-of-the-art test methods, and provides a proposed Auxiliary Feedwater Pump test at normal operating pressure which should do much to verify system operability while eliminating degradation

  14. The Acquisition of Auxiliary Syntax: A Longitudinal Elicitation Study. Part 1: Auxiliary BE

    Science.gov (United States)

    Theakston, Anna L.; Rowland, Caroline F.

    2009-01-01

    Purpose: The question of how and when English-speaking children acquire auxiliaries is the subject of extensive debate. Some researchers posit the existence of innately given Universal Grammar principles to guide acquisition, although some aspects of the auxiliary system must be learned from the input. Others suggest that auxiliaries can be…

  15. Auxiliary feedwater system aging study

    International Nuclear Information System (INIS)

    Kueck, J.D.

    1993-07-01

    This report documents the results of a Phase I follow-on study of the Auxiliary Feedwater (AFW) System that has been conducted for the US Regulatory Commission's Nuclear Plant Aging research Program. The Phase I study found a number of significant AFW System functions that are not being adequately tested by conventional test methods and some that are actually being degraded by conventional testing. Thus, it was decided that this follow-on study would focus on these testing omissions nd equipment degradation. The deficiencies in current monitoring and operating practice are categorized and evaluated. Areas of component degradation caused by current practice are discussed. Recommendations are made for improved diagnostic methods and test procedures

  16. Prediction of appendicular skeletal and fat mass in children: excellent concordance of dual-energy X-ray absorptiometry and magnetic resonance imaging.

    Science.gov (United States)

    Bridge, Pascale; Pocock, Nicholas A; Nguyen, Tuan; Munns, Craig; Cowell, Christopher T; Thompson, Martin W

    2009-09-01

    Body composition studies in children have great potential to help understand the aetiology and evolution of acute and chronic. diseases. To validate appendicular lean soft tissue mass (LSTM) and fat mass (FM) measured using dual energy X-ray absorptiometry (DXA), with magnetic resonance imaging (MRI) as the reference standard, in healthy peri-pubertal adolescents. Peri-pubertal Caucasian children (n = 74) aged 11-14 years were evaluated. DXA LSTM and FM of the mid third femur were measured and skeletal muscle mass (SM) and FM of the same region were measured on the same day by MRI. There was a strong correlation between MRI SM and DXA LSTM (r2 = 0.98, index of concordance [C] = 0.91). DXA estimation of LSTM exceeded MRI SM by a mean of 189 g, from 6-371 g (p LSTM measurement in children, confirming its potential in clinical and research roles in paediatric diseases affecting and related to body composition.

  17. Incorporation of flow injection analysis with dual-wavelength overlapping resonance Rayleigh scattering for rapid determination of malachite green and its metabolite in fish.

    Science.gov (United States)

    Zhu, Jinghui; Qin, Mingyou; Liu, Shaopu; Liu, Zhongfang; Yang, Jidong; Hu, Xiaoli

    2014-09-15

    A flow injection analysis (FIA) system combined with dual-wavelength overlapping resonance Rayleigh scattering (DWO-RRS) has been established and validated for rapid determination of malachite green (MG) and its metabolite in fish samples. Under experimental condition, MG would react with Erythrosin (Ery) to form ion-association complexes, resulting in the occurrence of two RRS peaks and a dramatic enhancement of RRS intensity. The maximum RRS peaks were located at 286 nm and 337 nm. It is noted that the increments of both of these two peaks were proportional to the concentration of MG. The detection limit of DWO-RRS was 1.5 ng/mL, which was comparable to several reported methods. Moreover, the results of real sample analysis exhibited an acceptable recovery between 97.5% and 103.6%, indicating that the method had good reproducibility. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Multicolor Upconversion Nanoprobes Based on a Dual Luminescence Resonance Energy Transfer Assay for Simultaneous Detection and Bioimaging of [Ca2+ ]i and pHi in Living Cells.

    Science.gov (United States)

    Song, Xinyue; Yue, Zihong; Zhang, Jiayu; Jiang, Yanxialei; Wang, Zonghua; Zhang, Shusheng

    2018-04-25

    Intracellular [Ca 2+ ] i and pH i have a close relationship, and their abnormal levels can result in cell dysfunction and accompanying diseases. Thus, simultaneous determination of [Ca 2+ ] i and pH i can more accurately investigate complex biological processes in an integrated platform. Herein, multicolor upconversion nanoparticles (UCNPs) were prepared with the advantages of no spectral overlapping, single NIR excitation wavelengths, and greater tissue penetration depth. The upconversion nanoprobes were easily prepared by the attachment of two fluorescent dyes, Fluo-4 and SNARF-4F. Based on the dual luminescence resonance energy transfer (LRET) process, the blue and green fluorescence of the UCNPs were specially quenched and selectively recovered after the detachment and/or absorbance change of the attached fluorescent dyes, enabling dual detection. Importantly, the developed nanoprobe could successfully be applied for the detection of [Ca 2+ ] i and pH i change in adenosine triphosphate (ATP) and ethylene glycol tetraacetic acid (EGTA) stimulation in living cells. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Cy5.5 conjugated MnO nanoparticles for magnetic resonance/near-infrared fluorescence dual-modal imaging of brain gliomas.

    Science.gov (United States)

    Chen, Ning; Shao, Chen; Li, Shuai; Wang, Zihao; Qu, Yanming; Gu, Wei; Yu, Chunjiang; Ye, Ling

    2015-11-01

    The fusion of molecular and anatomical modalities facilitates more reliable and accurate detection of tumors. Herein, we prepared the PEG-Cy5.5 conjugated MnO nanoparticles (MnO-PEG-Cy5.5 NPs) with magnetic resonance (MR) and near-infrared fluorescence (NIRF) imaging modalities. The applicability of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe for the detection of brain gliomas was investigated. In vivo MR contrast enhancement of the MnO-PEG-Cy5.5 nanoprobe in the tumor region was demonstrated. Meanwhile, whole-body NIRF imaging of glioma bearing nude mouse exhibited distinct tumor localization upon injection of MnO-PEG-Cy5.5 NPs. Moreover, ex vivo CLSM imaging of the brain slice hosting glioma indicated the preferential accumulation of MnO-PEG-Cy5.5 NPs in the glioma region. Our results therefore demonstrated the potential of MnO-PEG-Cy5.5 NPs as a dual-modal (MR/NIRF) imaging nanoprobe in improving the diagnostic efficacy by simultaneously providing anatomical information from deep inside the body and more sensitive information at the cellular level. Copyright © 2015 Elsevier Inc. All rights reserved.

  20. 1,3-Bis(2-chloroethyl)-1-nitrosourea-loaded bovine serum albumin nanoparticles with dual magnetic resonance-fluorescence imaging for tracking of chemotherapeutic agents.

    Science.gov (United States)

    Wei, Kuo-Chen; Lin, Feng-Wei; Huang, Chiung-Yin; Ma, Chen-Chi M; Chen, Ju-Yu; Feng, Li-Ying; Yang, Hung-Wei

    To date, knowing how to identify the location of chemotherapeutic agents in the human body after injection is still a challenge. Therefore, it is urgent to develop a drug delivery system with molecular imaging tracking ability to accurately understand the distribution, location, and concentration of a drug in living organisms. In this study, we developed bovine serum albumin (BSA)-based nanoparticles (NPs) with dual magnetic resonance (MR) and fluorescence imaging modalities (fluorescein isothiocyanate [FITC]-BSA-Gd/1,3-bis(2-chloroethyl)-1-nitrosourea [BCNU] NPs) to deliver BCNU for inhibition of brain tumor cells (MBR 261-2). These BSA-based NPs are water dispersible, stable, and biocompatible as confirmed by XTT cell viability assay. In vitro phantoms and in vivo MR and fluorescence imaging experiments show that the developed FITC-BSA-Gd/BCNU NPs enable dual MR and fluorescence imaging for monitoring cellular uptake and distribution in tumors. The T1 relaxivity (R1) of FITC-BSA-Gd/BCNU NPs was 3.25 mM(-1) s(-1), which was similar to that of the commercial T1 contrast agent (R1 =3.36 mM(-1) s(-1)). The results indicate that this multifunctional drug delivery system has potential bioimaging tracking of chemotherapeutic agents ability in vitro and in vivo for cancer therapy.

  1. In Vivo Dual-Modality Fluorescence and Magnetic Resonance Imaging-Guided Lymph Node Mapping with Good Biocompatibility Manganese Oxide Nanoparticles

    Directory of Open Access Journals (Sweden)

    Yonghua Zhan

    2017-12-01

    Full Text Available Multifunctional manganese oxide nanoparticles (NPs with impressive enhanced T1 contrast ability show great promise in biomedical diagnosis. Herein, we developed a dual-modality imaging agent system based on polyethylene glycol (PEG-coated manganese oxide NPs conjugated with organic dye (Cy7.5, which functions as a fluorescence imaging (FI agent as well as a magnetic resonance imaging (MRI imaging agent. The formed Mn3O4@PEG-Cy7.5 NPs with the size of ~10 nm exhibit good colloidal stability in different physiological media. Serial FI and MRI studies that non-invasively assessed the bio-distribution pattern and the feasibility for in vivo dual-modality imaging-guided lymph node mapping have been investigated. In addition, histological and biochemical analyses exhibited low toxicity even at a dose of 20 mg/kg in vivo. Since Mn3O4@PEG-Cy7.5 NPs exhibited desirable properties as imaging agents and good biocompatibility, this work offers a robust, safe, and accurate diagnostic platform based on manganese oxide NPs for tumor metastasis diagnosis.

  2. 46 CFR 63.25-1 - Small automatic auxiliary boilers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Small automatic auxiliary boilers. 63.25-1 Section 63.25... AUXILIARY BOILERS Requirements for Specific Types of Automatic Auxiliary Boilers § 63.25-1 Small automatic auxiliary boilers. Small automatic auxiliary boilers defined as having heat-input ratings of 400,000 Btu/hr...

  3. 47 CFR 73.1675 - Auxiliary antennas.

    Science.gov (United States)

    2010-10-01

    ... Class A TV licensees may request a decrease from the authorized facility's ERP in the license application. An FM, TV or Class A TV licensee may also increase the ERP of the auxiliary facility in a license... licensed main facility as an auxiliary facility with an ERP less than or equal to the ERP specified on the...

  4. 78 FR 27321 - Revision of Auxiliary Regulations

    Science.gov (United States)

    2013-05-10

    ... Auxiliary organizational structure, extending civil liability protection to Auxiliary units and members, and... entities. C. Assistance for Small Entities If you think that your business, organization, or governmental..., explain why you think your business or organization qualifies, how and to what degree this rule would...

  5. Terahertz plasmon-induced transparency based on asymmetric dual-disk resonators coupled to a semiconductor InSb waveguide and its biosensor application

    Science.gov (United States)

    Shahamat, Yadollah; Vahedi, Mohammad

    2017-06-01

    An ultracompact double eight-shaped plasmonic structure for the realization of plasmon-induced transparency (PIT) in the terahertz (THz) region has been studied. The device consists of a semiconductor-insulator-semiconductor bus waveguide coupled to the dual-disk resonators. Indium antimonide is employed to excite SPP in the THz region. The transmission characteristics of the proposed device are simulated numerically by the finite-difference time-domain method. In addition, a theoretical analysis based on the coupled-mode theory for transmission features is presented and compared with the numerical results. Results are in good agreement. Also, the dependence of PIT frequency characteristics on the radius of the outer disk is discussed in detail. In addition, by removing one of the outer disk resonators, double-PIT peaks can be observed in the transmission spectrum, and the physical mechanism of the appeared peaks is investigated. Finally, an application of the proposed structure for distinguishing different states of DNA molecules is discussed. Results show that the maximum sensitivity with 654 GHz/RIU-1 could be obtained for a single PIT structure. The frequency shifts equal to 37 and 99 GHz could be observed for the denatured and the hybridized DNA states, respectively.

  6. Microvascular obstruction on delayed enhancement cardiac magnetic resonance imaging after acute myocardial infarction, compared with myocardial {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings

    Energy Technology Data Exchange (ETDEWEB)

    Mori, Hiroaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Department of Cardiology, Kainan Hospital, Yatomi (Japan); Isobe, Satoshi, E-mail: sisobe@med.nagoya-u.ac.jp [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Sakai, Shinichi [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Yamada, Takashi [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Watanabe, Naoki; Miura, Manabu [Department of Cardiology, Kainan Hospital, Yatomi (Japan); Uchida, Yasuhiro; Kanashiro, Masaaki; Ichimiya, Satoshi [Department of Cardiology, Yokkaichi Municipal Hospital, Yokkaichi (Japan); Okumura, Takahiro; Murohara, Toyoaki [Department of Cardiology, Nagoya University Graduate School of Medicine, Nagoya (Japan)

    2015-08-15

    Highlights: • The percentage infarct size (%IS) was significantly greater in the microvascular obstruction (MO) group than in the non-MO group. • The percentage mismatch score (%MMS) on dual scintigraphy significantly correlated with the %IS and the percentage MO. • The %MMS was significantly greater in the non-MO group than in the MO group, and was an independent predictor for MO. - Abstract: Background: The hypo-enhanced regions within the hyper-enhanced infarct areas detected by cardiac magnetic resonance (CMR) imaging reflect microvascular obstruction (MO) after acute myocardial infarction (AMI). The combined myocardial thallium-201 ({sup 201}Tl)/iodine-123-15-(p-iodophenyl)-3-(R,S)-methylpentadecanoic acid ({sup 123}I-BMIPP) dual single-photon emission computed tomography (SPECT) is a useful tool for detecting myocardial reversibility after AMI. We evaluated whether MO could be an early predictor of irreversible myocardial damage in comparison with {sup 201}Tl and {sup 123}I-BMIPP dual SPECT findings in AMI patients. Methods: Sixty-two patients with initial AMI who successfully underwent coronary revascularization were enrolled. MO was defined by CMR imaging. Patients were divided into 2 groups as follows: MO group (n = 32) and non-MO group (n = 30). Scintigraphic defect scores were calculated using a 17-segment model with a 5-point scoring system. The mismatch score (MMS) was calculated as follows: the total sum of (Σ) {sup 123}I-BMIPP defect score minus Σ{sup 201}Tl defect score. The percentage mismatch score (%MMS) was calculated as follows: MMS/(Σ{sup 123}I-BMIPP score) × 100 (%). Results: The percentage infarct size (%IS) was significantly greater in the MO group than in the non-MO group (32.2 ± 13.8% vs. 18.3 ± 12.1%, p < 0.001). The %MMS significantly correlated with the %IS and the percentage MO (r = −0.26, p = 0.03; r = −0.45, p < 0.001, respectively). The %MMS was significantly greater in the non-MO group than in the MO group (45.4

  7. Determination of effective resonance energies for the (n,γ) reactions of 152Sm and 165Ho by using dual monitors

    International Nuclear Information System (INIS)

    Budak, M.G.; Karadag, M.; Yuecel, H.

    2010-01-01

    The effective resonance energies E - bar r for the (n,γ) reactions of 152 Sm and 165 Ho isotopes were determined by using dual monitors ( 55 Mn- 98 Mo) due to their favourable resonance properties. The samples were irradiated in an isotropic neutron field obtained from 241 Am-Be neutron sources. The induced activities were measured with a high efficient, p-type Ge detector. The necessary correction factors for thermal neutron self-shielding (G th ), resonance neutron self-shielding (G epi ), self absorption (F s ) and true coincidence summing (F coi ) effects for the measured γ-rays were taken into account. Thus, the experimental E - bar r -values for above (n,γ) reactions are found to be 8.65 ± 1.80 eV for 152 Sm and 12.90 ± 2.69 eV for 165 Ho isotopes, respectively. The E - bar r -values for both 152 Sm and 165 Ho isotopes were also theoretically calculated from the newest resonance data in the literature. Theoretically calculated E - bar r -values are estimated to be 8.34 eV and 8.53 eV for 152 Sm by two different approaches, which are generally, much smaller than that the present experimental value by 1.4-3.6% for 152 Sm. In case of 165 Ho isotope, the theoretically calculated E - bar r -value of 8.63 eV from the first approach deviates substantially from the measured value by about 33%, whereas the theoretical E - bar r -value of 12.95 eV from the second approach agrees very well with our experimentally determined E - bar r -value. The results show that the present experimental E - bar r -values for 152 Sm and 165 Ho isotopes agree with the calculated ones from the second approach within limits of the estimated uncertainty if the recently evaluated resonance data are used. However, it is worth noting that the results for E - bar r -value calculated from the first approach are not satisfactorily accurate because of neglecting the neutron widths in that approach. Therefore, this study implies that it be regarded to the experimentally determined E - bar r

  8. Hybrid mesons with auxiliary fields

    International Nuclear Information System (INIS)

    Buisseret, F.; Mathieu, V.

    2006-01-01

    Hybrid mesons are exotic mesons in which the color field is not in the ground state. Their understanding deserves interest from a theoretical point of view, because it is intimately related to nonperturbative aspects of QCD. Moreover, it seems that some recently detected particles, such as the π 1 (1600) and the Y(4260), are serious hybrid candidates. In this work, we investigate the description of such exotic hadrons by applying the auxiliary fields technique (also known as the einbein field method) to the widely used spinless Salpeter Hamiltonian with appropriate linear confinement. Instead of the usual numerical resolution, this technique allows to find simplified analytical mass spectra and wave functions of the Hamiltonian, which still lead to reliable qualitative predictions. We analyse and compare two different descriptions of hybrid mesons, namely a two-body q system with an excited flux tube, or a three-body qg system. We also compute the masses of the 1 -+ hybrids. Our results are shown to be in satisfactory agreement with lattice QCD and other effective models. (orig.)

  9. Apparatus for concentrating by dual temperature exchange

    International Nuclear Information System (INIS)

    Spevack, J.S.

    1975-01-01

    Improvements in an apparatus for isotope concentration by dual temperature exchange between feed and auxiliary fluids in a multistage system are described. The first fluid is a vaporizable liquid and the auxiliary fluid a gas, the apparatus having means for cascading the auxiliary fluid and the feed fluid in vapor and preferably also in liquid form. The apparatus also contains new combinations of means for improving the heating and/or cooling and/or humidifying and/or dehumidifying operations of the system. The reactants in the example given are hydrogen sulfide gas and liquid water

  10. Dual contrast enhanced magnetic resonance imaging of the liver with superparamagnetic iron oxide followed by gadolinium for lesion detection and characterization

    International Nuclear Information System (INIS)

    Kubaska, Samantha; Sahani, Dushyant V.; Saini, Sanjay; Hahn, Peter F.; Halpern, Elkan

    2001-01-01

    AIM: Iron oxide contrast agents are useful for lesion detection, and extracellular gadolinium chelates are advocated for lesion characterization. We undertook a study to determine if dual contrast enhanced liver imaging with sequential use of ferumoxides particles and gadolinium (Gd)-DTPA can be performed in the same imaging protocol. MATERIALS AND METHODS: Sixteen patients underwent dual contrast magnetic resonance imaging (MRI) of the liver for evaluation of known/suspected focal lesions which included, metastases (n = 5), hepatocellular carcinoma (HCC;n = 3), cholangiocharcinoma(n = 1) and focal nodular hyperplasia (FNH;n = 3). Pre- and post-iron oxide T1-weighted gradient recalled echo (GRE) and T2-weighted fast spin echo (FSE) sequences were obtained, followed by post-Gd-DTPA (0.1 mmol/kg) multi-phase dynamic T1-weighted out-of-phase GRE imaging. Images were analysed in a blinded fashion by three experts using a three-point scoring system for lesion conspicuity on pre- and post-iron oxide T1 images as well as for reader's confidence in characterizing liver lesions on post Gd-DTPA T1 images. RESULTS: No statistically significant difference in lesion conspicuity was observed on pre- and post-iron oxide T1-GRE images in this small study cohort. The presence of iron oxide did not appreciably diminish image quality of post-gadolinium sequences and did not prevent characterization of liver lesions. CONCLUSION: Our results suggest that characterization of focal liver lesion with Gd-enhanced liver MRI is still possible following iron oxide enhanced imaging. Kubaska, S. et al. (2001)

  11. Resolution of concerns in auxiliary feedwater piping

    International Nuclear Information System (INIS)

    Bain, R.A.; Testa, M.F.

    1994-01-01

    Auxiliary feedwater piping systems at pressurized water reactor (PWR) nuclear power plants have experienced unanticipated operating conditions during plant operation. These unanticipated conditions have included plant events involving backleakage through check valves, temperatures in portions of the auxiliary feedwater piping system that exceed design conditions, and the occurrence of unanticipated severe fluid transients. The impact of these events has had an adverse effect at some nuclear stations on plant operation, installed plant components and hardware, and design basis calculations. Beaver Valley Unit 2, a three loop pressurized water reactor nuclear plant, has observed anomalies with the auxiliary feedwater system since the unit went operational in 1987. The consequences of these anomalies and plant events have been addressed and resolved for Beaver Valley Unit 2 by performing engineering and construction activities. These activities included pipe stress, pipe support and pipe rupture analysis, the monitoring of auxiliary feedwater system temperature and pressure, and the modification to plant piping, supports, valves, structures and operating procedures

  12. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  13. Design and analysis of dual-resonant filters in visible and infra-red region based on polymer LPWG

    Science.gov (United States)

    Sharma, Mukesh; Kushwaha, Aniruddha Singh; Pal, Suchandan

    2013-01-01

    Long-period waveguide gratings (LPWGs), by using a SU-8 polymer-based channel waveguide along with NOA61 optical epoxy coated upper- and lower-cladding, are designed and theoretical analyzed. Grating period of ~ 68μm is considered with optimized grating tooth-heights, so that the transmission spectra of the gratings show strong rejection bands both at visible (450 - 460 nm) and infrared (1530 - 1540 nm) wavelength regions. Phase-matching graphs are studied in order to observe the change in resonance wavelength of the grating with the variation of waveguide parameters. LPWG-based band pass filter are also designed and analyzed by considering the same set of polymer materials. Further, temperature sensitivity of these LPWGs is analyzed theoretically. These types of waveguide gratingbased filters can widely be used for visible and infrared wavelength sensing applications.

  14. 30 CFR 75.331 - Auxiliary fans and tubing.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans and tubing. 75.331 Section 75... HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.331 Auxiliary fans and tubing. (a) When auxiliary fans and tubing are used for face ventilation, each auxiliary fan shall be— (1...

  15. The Influence of Magnetic Resonance Imaging Findings of Degenerative Disease on Dual-Energy X-ray Absorptiometry Measurements in Middle-Aged Men

    International Nuclear Information System (INIS)

    Donescu, O.S.; Battie, M.C.; Videman, T.

    2007-01-01

    Purpose: To examine degenerative features based on magnetic resonance imaging (MRI) measurements at the lumbar spine in relation to dual-energy X-ray absorptiometry (DXA), and to investigate whether bone mineral density (BMD) is reflected in the substitution of bone trabecular structure by fat at the vertebral body level indicated by MRI T1 relaxation time, endplate concavity, and hypertrophic (osteophytes and endplate sclerosis) MRI findings. Material and Methods: The sample for this cross-sectional study was composed of 102 subjects, 35-70 years old, from a population-based cohort. Data collection included DXA in the anterior-posterior projection at the L1-L4 vertebrae and right femoral neck, and MRI of the lumbar spine in the midsagittal plane. Results: Age, vertebral signal intensity, osteophytes, and endplate concavity collectively explained 20% of the variance in spine BMD. Conclusion: The study findings suggest that degenerative findings based on MRI measurements at the lumbar spine have an influence on bone assessment using DXA. Therefore, an overall bone assessment such as DXA might not offer an accurate measure of BMD

  16. Extending roGFP Emission via Förster-Type Resonance Energy Transfer Relay Enables Simultaneous Dual Compartment Ratiometric Redox Imaging in Live Cells.

    Science.gov (United States)

    Norcross, Stevie; Trull, Keelan J; Snaider, Jordan; Doan, Sara; Tat, Kiet; Huang, Libai; Tantama, Mathew

    2017-11-22

    Reactive oxygen species (ROS) mediate both intercellular and intraorganellar signaling, and ROS propagate oxidative stress between cellular compartments such as mitochondria and the cytosol. Each cellular compartment contains its own sources of ROS as well as antioxidant mechanisms, which contribute to dynamic fluctuations in ROS levels that occur during signaling, metabolism, and stress. However, the coupling of redox dynamics between cellular compartments has not been well studied because of the lack of available sensors to simultaneously measure more than one subcellular compartment in the same cell. Currently, the redox-sensitive green fluorescent protein, roGFP, has been used extensively to study compartment-specific redox dynamics because it provides a quantitative ratiometric readout and it is amenable to subcellular targeting as a genetically encoded sensor. Here, we report a new family of genetically encoded fluorescent protein sensors that extend the fluorescence emission of roGFP via Förster-type resonance energy transfer to an acceptor red fluorescent protein for dual-color live-cell microscopy. We characterize the redox and optical properties of the sensor proteins, and we demonstrate that they can be used to simultaneously measure cytosolic and mitochondrial ROS in living cells. Furthermore, we use these sensors to reveal cell-to-cell heterogeneity in redox coupling between the cytosol and mitochondria when neuroblastoma cells are exposed to reductive and metabolic stresses.

  17. A versatile and modular quasi optics-based 200 GHz dual dynamic nuclear polarization and electron paramagnetic resonance instrument

    Science.gov (United States)

    Siaw, Ting Ann; Leavesley, Alisa; Lund, Alicia; Kaminker, Ilia; Han, Songi

    2016-03-01

    Solid-state dynamic nuclear polarization (DNP) at higher magnetic fields (>3 T) and cryogenic temperatures (∼2-90 K) has gained enormous interest and seen major technological advances as an NMR signal enhancing technique. Still, the current state of the art DNP operation is not at a state at which sample and freezing conditions can be rationally chosen and the DNP performance predicted a priori, but relies on purely empirical approaches. An important step towards rational optimization of DNP conditions is to have access to DNP instrumental capabilities to diagnose DNP performance and elucidate DNP mechanisms. The desired diagnoses include the measurement of the "DNP power curve", i.e. the microwave (MW) power dependence of DNP enhancement, the "DNP spectrum", i.e. the MW frequency dependence of DNP enhancement, the electron paramagnetic resonance (EPR) spectrum, and the saturation and spectral diffusion properties of the EPR spectrum upon prolonged MW irradiation typical of continuous wave (CW) DNP, as well as various electron and nuclear spin relaxation parameters. Even basic measurements of these DNP parameters require versatile instrumentation at high magnetic fields not commercially available to date. In this article, we describe the detailed design of such a DNP instrument, powered by a solid-state MW source that is tunable between 193 and 201 GHz and outputs up to 140 mW of MW power. The quality and pathway of the transmitted and reflected MWs is controlled by a quasi-optics (QO) bridge and a corrugated waveguide, where the latter couples the MW from an open-space QO bridge to the sample located inside the superconducting magnet and vice versa. Crucially, the versatility of the solid-state MW source enables the automated acquisition of frequency swept DNP spectra, DNP power curves, the diagnosis of MW power and transmission, and frequency swept continuous wave (CW) and pulsed EPR experiments. The flexibility of the DNP instrument centered around the QO MW

  18. A versatile and modular quasi optics-based 200GHz dual dynamic nuclear polarization and electron paramagnetic resonance instrument.

    Science.gov (United States)

    Siaw, Ting Ann; Leavesley, Alisa; Lund, Alicia; Kaminker, Ilia; Han, Songi

    2016-03-01

    Solid-state dynamic nuclear polarization (DNP) at higher magnetic fields (>3T) and cryogenic temperatures (∼ 2-90K) has gained enormous interest and seen major technological advances as an NMR signal enhancing technique. Still, the current state of the art DNP operation is not at a state at which sample and freezing conditions can be rationally chosen and the DNP performance predicted a priori, but relies on purely empirical approaches. An important step towards rational optimization of DNP conditions is to have access to DNP instrumental capabilities to diagnose DNP performance and elucidate DNP mechanisms. The desired diagnoses include the measurement of the "DNP power curve", i.e. the microwave (MW) power dependence of DNP enhancement, the "DNP spectrum", i.e. the MW frequency dependence of DNP enhancement, the electron paramagnetic resonance (EPR) spectrum, and the saturation and spectral diffusion properties of the EPR spectrum upon prolonged MW irradiation typical of continuous wave (CW) DNP, as well as various electron and nuclear spin relaxation parameters. Even basic measurements of these DNP parameters require versatile instrumentation at high magnetic fields not commercially available to date. In this article, we describe the detailed design of such a DNP instrument, powered by a solid-state MW source that is tunable between 193 and 201 GHz and outputs up to 140 mW of MW power. The quality and pathway of the transmitted and reflected MWs is controlled by a quasi-optics (QO) bridge and a corrugated waveguide, where the latter couples the MW from an open-space QO bridge to the sample located inside the superconducting magnet and vice versa. Crucially, the versatility of the solid-state MW source enables the automated acquisition of frequency swept DNP spectra, DNP power curves, the diagnosis of MW power and transmission, and frequency swept continuous wave (CW) and pulsed EPR experiments. The flexibility of the DNP instrument centered around the QO MW

  19. Resonant electronic transport through a triple quantum-dot with Λ-type level structure under dual radiation fields

    International Nuclear Information System (INIS)

    Guan, Chun; Xing, Yunhui; Zhang, Chao; Ma, Zhongshui

    2014-01-01

    Due to quantum interference, light can transmit through dense atomic media, a phenomenon known as electromagnetically induced transparency (EIT). We propose that EIT is not limited to light transmission and there is an electronic analog where resonant transparency in charge transport in an opaque structure can be induced by electromagnetic radiation. A triple-quantum-dots system with Λ-type level structure is generally opaque due to the level in the center dot being significantly higher and therefore hopping from the left dot to the center dot is almost forbidden. We demonstrate that an electromagnetically induced electron transparency (EIET) in charge of transport can indeed occur in the Λ-type system. The direct evidence of EIET is that an electron can travel from the left dot to the right dot, while the center dot apparently becomes invisible. We analyze EIET and the related shot noise in both the zero and strong Coulomb blockade regimes. It is found that the EIET (position, height, and symmetry) can be tuned by several controllable parameters of the radiation fields, such as the Rabi frequencies and detuning frequencies. The result offers a transparency/opaque tuning technique in charge transport using interfering radiation fields

  20. The Acquisition of Auxiliary Syntax: A Longitudinal Elicitation Study. Part 2: The Modals and Auxiliary DO

    Science.gov (United States)

    Rowland, Caroline F.; Theakston, Anna L.

    2009-01-01

    Purpose: The study of auxiliary acquisition is central to work on language development and has attracted theoretical work from both nativist and constructivist approaches. This study is part of a 2-part companion set that represents a unique attempt to trace the development of auxiliary syntax by using a longitudinal elicitation methodology. The…

  1. A passive dual-circulator based transmit/receive switch for use with reflection resonators in pulse EPR

    Science.gov (United States)

    Subramanian, V. S.; Epel, Boris; Mailer, Colin; Halpern, Howard J.

    2009-01-01

    In order to protect the low noise amplifier (LNA) in the receive arm of a pulsed 250 MHz EPR bridge, it is necessary to install as much isolation as possible between the power exciting the spin system and the LNA when high power is present in the receive arm of the bridge, while allowing the voltage induced by the magnetization in the spin sample to be passed undistorted and undiminished to the LNA once power is reduced below the level that can cause a LNA damage. We discuss a combination of techniques to accomplish this involving the power-routing circulator in the bridge, a second circulator acting as an isolator with passive shunt PIN diodes immediately following the second circulator. The low resistance of the forward biased PIN diode passively generates an impedance mismatch at the second circulator output port during the high power excitation pulse and resonator ring down. The mismatch reflects the high power to the remaining port of the second circulator, dumping it into a system impedance matched load. Only when the power diminishes below the diode conduction threshold will the resistance of the PIN diode rise to a value much higher than the system impedance. This brings the device into conduction mode. We find that the present design passively limits the output power to 14 dBm independent of the input power. For high input power levels the isolation may exceed 60 dB. This level of isolation is sufficient to fully protect the LNA of pulse EPR bridge. PMID:20052312

  2. Multi-level converter with auxiliary resonant-commutated pole

    NARCIS (Netherlands)

    Dijkhuizen, F.R.; Duarte, J.L.; Groningen, van W.D.H.

    1998-01-01

    The family of multi-level power converters offers advantages for high-power, high-voltage systems. A multi-level nested-cell structure has the attractive feature of static and dynamic voltage sharing among the switches. This is achieved by using clamping capacitors (floating capacitors) rather than

  3. 2-Deoxy-D-Glucose Modified Magnetic Nanoparticles with Dual Functional Properties: Nanothermotherapy and Magnetic Resonance Imaging.

    Science.gov (United States)

    Zhao, Lingyun; Zheng, Yajing; Yan, Hao; Xie, WenSheng; Sun, Xiaodan; Li, Ning; Tang, Jintian

    2016-03-01

    Superparamagnetic iron oxide nanoparticles (SPIONs) with appropriate surface chemistry have attracted wild attention in medical and biological application because of their current and potential usefulness such as magnetic resonance imaging (MRI) contrast enhancement, magnetic mediated hyperthermia (MMH), immunoassay, and in drug delivery, etc. In this study, we investigated the MRI contrast agents and MMH mediators properties of the novel 2-deoxy-D-glucose (2-DG) modified SPIONs. As a non-metabolizable glucose analogue, 2-DG can block glycolysis and inhibits protein glycosylation. Moreover, SPIONs coated with 2-DG molecules can be particularly attractive to resource-hungry cancer cells, therefore to realize the targeting strategy for the SPIONs. SPIONs with amino silane as the capping agent for amino-group surface modification were synthesized by the chemical co-precipitation method with modification. Glutaraldehyde was further applied as an activation agent through which 2-DG was conjugated to the amino-coated SPIONs. Physicochemical characterizations of the 2-DG-SPIONs, such as surface morphology, surface charge and magnetic properties were investigated by Transmission Electron Microscopy (TEM), ζ-Potential and Vibrating Sample Magnetometer (VSM), etc. Magnetic inductive heating characteristics of the 2-DG-SPIONs were analyzed by exposing the SPIONs suspension (magnetic fluid) under alternative magnetic field (AMF). U-251 human glioma cells with expression of glucose transport proteins type 1 and 3 (GLUT1 and GLUT 3), and L929 murine fibroblast cell as negative control, were employed to study the effect of 2-DG modification on the cell uptake for SPIONs. TEM images for ultra-thin sections as well as ICP-MS were applied to evaluate the SPIONs internalization within the cells. In vitro MRI was performed after cells were co-incubated with SPIONs and the T2 relaxation time was measured and compared. The results demonstrate that 2-DG-SPIONs were supermagnetic and in

  4. Builtin vs. auxiliary detection of extrapolation risk.

    Energy Technology Data Exchange (ETDEWEB)

    Munson, Miles Arthur; Kegelmeyer, W. Philip,

    2013-02-01

    A key assumption in supervised machine learning is that future data will be similar to historical data. This assumption is often false in real world applications, and as a result, prediction models often return predictions that are extrapolations. We compare four approaches to estimating extrapolation risk for machine learning predictions. Two builtin methods use information available from the classification model to decide if the model would be extrapolating for an input data point. The other two build auxiliary models to supplement the classification model and explicitly model extrapolation risk. Experiments with synthetic and real data sets show that the auxiliary models are more reliable risk detectors. To best safeguard against extrapolating predictions, however, we recommend combining builtin and auxiliary diagnostics.

  5. Nuclear reactor auxiliary heat removal system

    International Nuclear Information System (INIS)

    Thompson, R.E.; Pierce, B.L.

    1977-01-01

    An auxiliary heat removal system to remove residual heat from gas-cooled nuclear reactors is described. The reactor coolant is expanded through a turbine, cooled in a heat exchanger and compressed by a compressor before reentering the reactor coolant. The turbine powers both the compressor and the pump which pumps a second fluid through the heat exchanger to cool the reactor coolant. A pneumatic starter is utilized to start the turbine, thereby making the auxiliary heat removal system independent of external power sources

  6. Nuclear reactors with auxiliary boiler circuit

    International Nuclear Information System (INIS)

    George, B.V.; Cook, R.K.

    1976-01-01

    A gas-cooled nuclear reactor has a main circulatory system for the gaseous coolant incorporating one or more main energy converting units, such as gas turbines, and an auxiliary circulatory system for the gaseous coolant incorporating at least one steam generating boiler arranged to be heated by the coolant after its passage through the reactor core to provide steam for driving an auxiliary steam turbine, such an arrangement providing a simplified start-up procedure also providing emergency duties associated with long term heat removal on reactor shut down

  7. Transport in Auxiliary Heated NSTX Discharges

    International Nuclear Information System (INIS)

    LeBlanc, B.P.; Bell, M.G.; Bell, R.E.; Bitte, M.L.; Bourdelle, C.; Gates, D.A.; Kaye, S.M.; Maingi, R.; Menard, J.E.; Mueller, D.; Ono, M.; Paul, S.F.; Redi, M.H.; Roquemore, A.L.; Rosenberg, A.; Sabbagh, S.A.; Stutman, D.; Synakowski, E.J.; Soukhanovskii, V.A.; Wilson, J.R.

    2003-01-01

    The NSTX spherical torus (ST) provides a unique platform to investigate magnetic confinement in auxiliary-heated plasmas at low aspect ratio. Auxiliary power is routinely coupled to ohmically heated plasmas by deuterium neutral-beam injection (NBI) and by high-harmonic fast waves (HHFW) launch. While theory predicts both techniques to preferentially heat electrons, experiment reveals the electron temperature is greater than the ion temperature during HHFW, but the electron temperature is less than the ion temperature during NBI. In the following we present the experimental data and the results of transport analyses

  8. Gastrin-releasing peptide receptor-targeted gadolinium oxide-based multifunctional nanoparticles for dual magnetic resonance/fluorescent molecular imaging of prostate cancer

    Directory of Open Access Journals (Sweden)

    Cui DT

    2017-09-01

    Full Text Available Danting Cui,1 Xiaodan Lu,1 Chenggong Yan,1 Xiang Liu,1 Meirong Hou,1 Qi Xia,2 Yikai Xu,1 Ruiyuan Liu2,3 1Department of Medical Imaging Center, Nanfang Hospital, Southern Medical University, Guangzhou, People’s Republic of China; 2School of Pharmaceutical Sciences, Southern Medical University, Guangzhou, People’s Republic of China; 3School of Biomedical Engineering, Southern Medical University, Guangzhou, People’s Republic of China Abstract: Bombesin (BBN, an analog of gastrin-releasing peptide (GRP, specifically binds to GRP receptors, which are overexpressed in human prostate cancer (PC. Here, we synthesized a BBN-modified gadolinium oxide (Gd2O3 nanoprobe containing fluorescein (Gd2O3-5(6-carboxyfluorescein [FI]-polyethylene glycol [PEG]-BBN for targeted magnetic resonance (MR/optical dual-modality imaging of PC. The Gd2O3-FI-PEG-BBN nanoparticles exhibited a relatively uniform particle size with an average diameter of 52.3 nm and spherical morphology as depicted by transmission electron microscopy. The longitudinal relaxivity (r1 of Gd2O3-FI-PEG-BBN (r1 =4.23 mM–1s–1 is comparable to that of clinically used Magnevist (Gd-DTPA. Fluorescence microscopy and in vitro cellular MRI demonstrated GRP receptor-specific and enhanced cellular uptake of the Gd2O3-FI-PEG-BBN in PC-3 tumor cells. Moreover, Gd2O3-FI-PEG-BBN showed more remarkable contrast enhancement than the corresponding nontargeted Gd2O3-FI-PEG according to in vivo MRI and fluorescent imaging. Tumor immunohistochemical analysis further demonstrated improved accumulation of the targeted nanoprobe in tumors. BBN-conjugated Gd2O3 may be a promising nanoplatform for simultaneous GRP receptor-targeted molecular cancer diagnosis and antitumor drug delivery in future clinical applications. Keywords: magnetic resonance imaging, gadolinium oxide, bombesin, gastrin-releasing peptide receptor, molecular imaging

  9. Quantification of trunk and android lean mass using dual energy x-ray absorptiometry compared to magnetic resonance imaging after spinal cord injury.

    Science.gov (United States)

    Rankin, Kathleen C; O'Brien, Laura C; Gorgey, Ashraf S

    2018-02-20

    To determine whether dual energy x-ray absorptiometry (DXA) compared to magnetic resonance imaging (MRI) may accurately quantify trunk lean mass (LM) after chronic spinal cord injury (SCI) and to investigate the relationships between trunk LM, visceral adiposity, trunk fat mass and basal metabolic rate (BMR). Cross-sectional design and correlational analysis. Research setting in a medical center. Twenty-two men with motor complete paraplegia (n = 14; T4-T11) and tetraplegia (n = 8; C5-C7) were recruited as part of a clinical trial. Not applicable. Trunk and android LM were measured using DXA. The volume of six trunk muscle groups were then measured using MRI to quantify trunk LM-MRI. Subcutaneous and visceral adipose tissue (VAT) cross-sectional areas were also measured using MRI. After overnight fast, BMR was evaluated using indirect calorimetry. Trunk LM-DXA (24 ± 3.3 kg) and android LM-DXA (3.6 ± 0.7 kg) overestimated (P android LM-DXA + 0.126; r 2 =0.26, SEE= 0.21 kg, P = 0.018. Percentage trunk LM-MRI was inversely related to VAT (r=-0.79, P android LM-DXA overestimated trunk LM-MRI. Percentage trunk LM-MRI, but not LM-DXA, was inversely related to trunk central adiposity. The findings highlight the importance of exercising trunk LM to attenuate cardio-metabolic disorders after SCI.

  10. Comparison of dual-energy X-ray absorptiometry and magnetic resonance imaging-measured adipose tissue depots in HIV-infected and control subjects.

    Science.gov (United States)

    Scherzer, Rebecca; Shen, Wei; Bacchetti, Peter; Kotler, Donald; Lewis, Cora E; Shlipak, Michael G; Punyanitya, Mark; Heymsfield, Steven B; Grunfeld, Carl

    2008-10-01

    Studies in persons without HIV infection have compared adipose tissue measured by dual-energy X-ray absorptiometry (DXA) and magnetic resonance imaging (MRI), but no such study has been conducted in HIV-infected (HIV+) subjects, who have a high prevalence of regional fat loss. We compared DXA- with MRI-measured trunk, leg, arm, and total fat in HIV+ and control subjects. A cross-sectional analysis was conducted in 877 HIV+ subjects and 260 control subjects in FRAM (Study of Fat Redistribution and Metabolic Change in HIV Infection), stratified by sex and HIV status. Univariate associations of DXA with MRI were strongest for total and trunk fat (r > or = 0.92) and slightly weaker for leg (r > or = 0.87) and arm (r > or = 0.71) fat. The average estimated limb fat was substantially greater for DXA than for MRI for HIV+ and control men and women (all P < 0.0001). Less of a difference was observed in trunk fat measured by DXA and MRI, but the difference was still statistically significant (P < 0.0001). Bland-Altman plots showed increasing differences and variability. Greater average limb fat in control and HIV+ subjects (both P < 0.0001) was associated with greater differences between DXA and MRI measurements. Because the control subjects had more limb fat than did the HIV+ subjects, greater amounts of fat were measured by DXA than by MRI when control subjects were compared with HIV+ subjects. More HIV+ subjects had leg fat in the bottom decile of the control subjects by DXA than by MRI (P < 0.0001). Although DXA- and MRI-measured adipose tissue depots correlate strongly in HIV+ and control subjects, differences increase as average fat increases, particularly for limb fat. DXA may estimate a higher prevalence of peripheral lipoatrophy than does MRI in HIV+ subjects.

  11. Enzyme kinetics, inhibitors, mutagenesis and electron paramagnetic resonance analysis of dual-affinity nitrate reductase in unicellular N(2)-fixing cyanobacterium Cyanothece sp. PCC 8801.

    Science.gov (United States)

    Wang, Tung-Hei; Chen, Yung-Han; Huang, Jine-Yung; Liu, Kang-Cheng; Ke, Shyue-Chu; Chu, Hsiu-An

    2011-11-01

    The assimilatory nitrate reductase (NarB) of N(2)-fixing cyanobacterium Cyanothece sp. PCC 8801 is a monomeric enzyme with dual affinity for substrate nitrate. We purified the recombinant NarB of Cyanothece sp. PCC 8801 and further investigated it by enzyme kinetics analysis, site-directed mutagenesis, inhibitor kinetics analysis, and electron paramagnetic resonance (EPR) spectroscopy. The NarB showed 2 kinetic regimes at pH 10.5 or 8 and electron-donor conditions methyl viologen or ferredoxin (Fd). Fd-dependent NR assay revealed NarB with very high affinity for nitrate (K(m)1, ∼1μM; K(m)2, ∼270μM). Metal analysis and EPR results showed that NarB contains a Mo cofactor and a [4Fe-4S] cluster. In addition, the R352A mutation on the proposed nitrate-binding site of NarB greatly altered both high- and low-affinity kinetic components. Furthermore, the effect of azide on the NarB of Cyanothece sp. PCC 8801 was more complex than that on the NarB of Synechococcus sp. PCC 7942 with its single kinetic regime. With 1mM azide, the kinetics of the wild-type NarB was transformed from 2 kinetic regimes to hyperbolic kinetics, and its activity was enhanced significantly under medium nitrate concentrations. Moreover, EPR results also suggested a structural difference between the two NarBs. Taken together, our results show that the NarB of Cyanothece sp. PCC 8801 contains only a single Mo-catalytic center, and we rule out that the enzyme has 2 independent, distinct catalytic sites. In addition, the NarB of Cyanothece sp. PCC 8801 may have a regulatory nitrate-binding site. Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  12. Curricular Guidelines for Dental Auxiliary Radiology.

    Science.gov (United States)

    Journal of Dental Education, 1981

    1981-01-01

    AADS curricular guidelines suggest objectives for these areas of dental auxiliary radiology: physical principles of X-radiation in dentistry, related radiobiological concepts, principles of radiologic health, radiographic technique, x-ray films and intensifying screens, factors contributing to film quality, darkroom, and normal variations in…

  13. Auxiliary power unit for moving a vehicle

    Science.gov (United States)

    Akasam, Sivaprasad [Peoria, IL; Johnson, Kris W [Peoria, IL; Johnson, Matthew D [Peoria, IL; Slone, Larry M [Washington, IL; Welter, James Milton [Chillicothe, IL

    2009-02-03

    A power system is provided having at least one traction device and a primary power source configured to power the at least one traction device. In addition, the power system includes an auxiliary power source also configured to power the at least one traction device.

  14. Window-mounted auxiliary solar heater

    Science.gov (United States)

    Anthony, K. G.; Herndon, E. P.

    1977-01-01

    System uses hot-air collectors, no thermal storage, and fan with thermostat switches. At cost of heating efficiency, unit could be manufactured and sold at price allowing immediate entry to market as auxiliary heating system. Its simplicity allows homeowner installation, and maintenance is minimal.

  15. Computation within the auxiliary field approach

    International Nuclear Information System (INIS)

    Baeurle, S.A.

    2003-01-01

    Recently, the classical auxiliary field methodology has been developed as a new simulation technique for performing calculations within the framework of classical statistical mechanics. Since the approach suffers from a sign problem, a judicious choice of the sampling algorithm, allowing a fast statistical convergence and an efficient generation of field configurations, is of fundamental importance for a successful simulation. In this paper we focus on the computational aspects of this simulation methodology. We introduce two different types of algorithms, the single-move auxiliary field Metropolis Monte Carlo algorithm and two new classes of force-based algorithms, which enable multiple-move propagation. In addition, to further optimize the sampling, we describe a preconditioning scheme, which permits to treat each field degree of freedom individually with regard to the evolution through the auxiliary field configuration space. Finally, we demonstrate the validity and assess the competitiveness of these algorithms on a representative practical example. We believe that they may also provide an interesting possibility for enhancing the computational efficiency of other auxiliary field methodologies

  16. Vacuum switchgear for power station auxiliary switchboards

    International Nuclear Information System (INIS)

    Coombs, P.E.

    1992-01-01

    Sizewell B is the first UK power station in which vacuum switchgear is used for the auxiliary switchboards. Previously the 3.3kV, 6.6kV or 11kV switchgear has used air-break circuit breakers and fused air-break contactors, known as motor starting devices or fused switching devices (FSD). The use of vacuum interrupters is therefore a new technology in this application, although it has been established in the UK distribution network and in industrial installations from the mid 1970s. Vacuum switchgear was already in use in the USA for power station auxiliary switchgear at the time that it was proposed for Sizewell B. The Sizewell B high voltage auxiliary switchgear comprises eight Unit and Station Auxiliary Switchboards at 3.3kV and 11kV, and four 3.3kV Essential Switchboards for the essential safety related circuits, making a total of 65 circuit breakers plus FSD panels. (Author)

  17. Aging assessment of auxiliary feedwater systems

    International Nuclear Information System (INIS)

    Casada, D.A.

    1989-01-01

    A study of Pressurized Water Reactor Auxiliary Feedwater (AFW) Systems has been conducted by Oak Ridge National Laboratory (ORNL) under the auspices of the Nuclear Regulatory Commission's Nuclear Plant Aging Research Program. The study has reviewed historical failure experience and current monitoring practices for the AFW System. This paper provides an overview of the study approach and results. 7 figs

  18. Bistable energy harvesting enhancement with an auxiliary linear oscillator

    Science.gov (United States)

    Harne, R. L.; Thota, M.; Wang, K. W.

    2013-12-01

    Recent work has indicated that linear vibrational energy harvesters with an appended degree-of-freedom (DOF) may be advantageous for introducing new dynamic forms to extend the operational bandwidth. Given the additional interest in bistable harvester designs, which exhibit a propitious snap through effect from one stable state to the other, it is a logical extension to explore the influence of an added DOF to a bistable system. However, bistable snap through is not a resonant phenomenon, which tempers the presumption that the dynamics induced by an additional DOF on bistable designs would inherently be beneficial as for linear systems. This paper presents two analytical formulations to assess the fundamental and superharmonic steady-state dynamics of an excited bistable energy harvester to which is attached an auxiliary linear oscillator. From an energy harvesting perspective, the model predicts that the additional linear DOF uniformly amplifies the bistable harvester response magnitude and generated power for excitation frequencies less than the attachment’s resonance while improved power density spans a bandwidth below this frequency. Analyses predict bandwidths having co-existent responses composed of a unique proportion of fundamental and superharmonic dynamics. Experiments validate key analytical predictions and observe the ability for the coupled system to develop an advantageous multi-harmonic interwell response when the initial conditions are insufficient for continuous high-energy orbit at the excitation frequency. Overall, the addition of an auxiliary linear oscillator to a bistable harvester is found to be an effective means of enhancing the energy harvesting performance and robustness.

  19. The English Primary Auxiliary Verbs: A Linguistic Theoretical Exercise

    African Journals Online (AJOL)

    Nekky Umera

    Abstract. Obviously, the fact remains that English Language is a sensitive Language ... Even though the English auxiliary verbs are of two kinds: Primary and Modal auxiliary ..... Therefore we are of the opinion that most speakers lack adequate.

  20. Design and scope of impact of auxiliary lanes : technical report.

    Science.gov (United States)

    2014-06-01

    For decades, Texas Department of Transportation districts have constructed auxiliary lanes to support interchange : ramp operations and to resolve congestion proximate to freeway entrance and exit ramps. While auxiliary lanes are : built throughout T...

  1. 14 CFR 29.757 - Hull and auxiliary float strength.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and auxiliary float strength. 29.757... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Design and Construction Floats and Hulls § 29.757 Hull and auxiliary float strength. The hull, and auxiliary floats if used, must withstand the...

  2. 30 CFR 57.8529 - Auxiliary fan systems

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fan systems 57.8529 Section 57.8529 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND NONMETAL MINE... Underground Only § 57.8529 Auxiliary fan systems When auxiliary fan systems are used, such systems shall...

  3. Bayesian Analysis of Geostatistical Models With an Auxiliary Lattice

    KAUST Repository

    Park, Jincheol; Liang, Faming

    2012-01-01

    of observations is large. In this article, we propose an auxiliary lattice-based approach for tackling this difficulty. By introducing an auxiliary lattice to the space of observations and defining a Gaussian Markov random field on the auxiliary lattice, our model

  4. The sensitivity of auxiliary examinations in different stages of sporadic Creutzfeldt-Jakob disease

    Directory of Open Access Journals (Sweden)

    Jiao-jiao JIANG

    2017-06-01

    Full Text Available Objective To analyze the sensitivity of auxiliary examinations in different periods of sporadic Creutzfeldt-Jakob disease (sCJD. Methods The clinical data of 53 sCJD patients were retrospectively analyzed including the different stages of skull diffusion-weighted magnetic resonance imaging (DWI, 24-hour ambulatory electroencephalogram (EEG, 18F-FDG PET/CT (PET-CT and cerebrospinal fluid 14-3-3 protein. When calculating the sensitivity of an auxiliary examination, the diagnostic criteria were defined by combining the specific clinical manifestations with two or more positive results of other auxiliary examinations. Results There were 24, 53 and 22 sCJD patients, respectively, met the criterion of early (E, middle (M and later (L stage of disease (some patients fit 2 or 3 stages. The sensitivity of DWI (E: 58.3%, M: 85.4%, L: 94.7%, EEG (E: 45.8%, M: 62.7%, L: 77.8%, 14-3-3 protein in cerebrospinal fluid (E: 11.1%, M: 52.9% and PET-CT (E: 80%, M: 100% increased gradually with disease progression. The sensitivity of PET-CT was higher than the other auxiliary examinations for E and M stages; no PET-CT was conducted in L stage. High signal regions mainly distributed in the cortex in E and M stages, but in L stage, no significant difference was found on the distribution of high signal regions between cortex and basal ganglia. Conclusions The sensitivities of the auxiliary examinations were different for sCJD patients in different stages. Reexaminations in different periods may improve the sensitivity for sCJD diagnosis. The sensitivity of PET-CT was high, and the combination of PET-CT and other auxiliary examinations may play a key role in the diagnosis of sCJD. DOI: 10.11855/j.issn.0577-7402.2017.05.15

  5. Modified Darboux transformations with foreign auxiliary equations

    International Nuclear Information System (INIS)

    Schulze-Halberg, Axel

    2011-01-01

    We construct a new type of first-order Darboux transformations for the stationary Schroedinger equation. In contrast to the conventional case, our Darboux transformations support arbitrary (foreign) auxiliary equations. We show that among other applications, our formalism can be used to systematically construct Darboux transformations for Schroedinger equations with energy-dependent potentials, including a recent result (Lin et al., 2007) as a special case. -- Highlights: → We generalize the Darboux transformation for the Schroedinger equation. → By admitting arbitrary auxiliary functions, we provide a new tool for generating solutions. → As a special case we recover a recent result on energy-dependent potentials. → We extend the latter result to very general energy-dependence.

  6. Eigenstates with the auxiliary field method

    Energy Technology Data Exchange (ETDEWEB)

    Semay, Claude [Service de Physique Nucleaire et Subnucleaire, Universite de Mons-UMONS, 20 Place du Parc, 7000 Mons (Belgium); Silvestre-Brac, Bernard, E-mail: claude.semay@umons.ac.b, E-mail: silvestre@lpsc.in2p3.f [LPSC Universite Joseph Fourier, Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, Avenue des Martyrs 53, F-38026 Grenoble-Cedex (France)

    2010-07-02

    The auxiliary field method is a powerful technique to obtain approximate closed-form energy formulas for eigenequations in quantum mechanics. Very good results can be obtained for Schroedinger and semirelativistic Hamiltonians with various potentials, even in the case of many-body problems. This method can also provide approximate eigenstates in terms of well-known wavefunctions, for instance harmonic oscillator or hydrogen-like states, but with a characteristic size which depends on quantum numbers. In this paper, we consider two-body Schroedinger equations with linear, logarithmic and exponential potentials and show that analytical approximations of the corresponding eigenstates can be obtained with the auxiliary field method, with very good accuracy in some cases.

  7. Eigenstates with the auxiliary field method

    International Nuclear Information System (INIS)

    Semay, Claude; Silvestre-Brac, Bernard

    2010-01-01

    The auxiliary field method is a powerful technique to obtain approximate closed-form energy formulas for eigenequations in quantum mechanics. Very good results can be obtained for Schroedinger and semirelativistic Hamiltonians with various potentials, even in the case of many-body problems. This method can also provide approximate eigenstates in terms of well-known wavefunctions, for instance harmonic oscillator or hydrogen-like states, but with a characteristic size which depends on quantum numbers. In this paper, we consider two-body Schroedinger equations with linear, logarithmic and exponential potentials and show that analytical approximations of the corresponding eigenstates can be obtained with the auxiliary field method, with very good accuracy in some cases.

  8. Auxiliary facilities on nuclear ship 'MUTSU'

    International Nuclear Information System (INIS)

    Tsujimura, Shotaro; Takigami, Yoshio.

    1989-01-01

    The nuclear ship 'MUTSU' has been moored at SEKINEHAMA, MUTU City in AOMORI Prefecture and several tests and works are being carried out on the ship. The construction of the auxiliary facilities for these works on the ship was completed in safety in August 1988. After that the facilities have fulfilled their function. The outlines of design, fabrication and construction of the facilities are described in this paper. (author)

  9. Auxiliary Heat Exchanger Flow Distribution Test

    International Nuclear Information System (INIS)

    Kaufman, J.S.; Bressler, M.M.

    1983-01-01

    The Auxiliary Heat Exchanger Flow Distribution Test was the first part of a test program to develop a water-cooled (tube-side), compact heat exchanger for removing heat from the circulating gas in a high-temperature gas-cooled reactor (HTGR). Measurements of velocity and pressure were made with various shell side inlet and outlet configurations. A flow configuration was developed which provides acceptable velocity distribution throughout the heat exchanger without adding excessive pressure drop

  10. Categorical Data Fusion Using Auxiliary Information

    OpenAIRE

    Fosdick, Bailey K.; DeYoreo, Maria; Reiter, Jerome P.

    2015-01-01

    In data fusion, analysts seek to combine information from two databases comprised of disjoint sets of individuals, in which some variables appear in both databases and other variables appear in only one database. Most data fusion techniques rely on variants of conditional independence assumptions. When inappropriate, these assumptions can result in unreliable inferences. We propose a data fusion technique that allows analysts to easily incorporate auxiliary information on the dependence struc...

  11. Model predictions for auxiliary heating in spheromaks

    International Nuclear Information System (INIS)

    Fauler, T.K.; Khua, D.D.

    1997-01-01

    Calculations are presented of the plasma temperature waited for under auxiliary heating in spheromaks. A model, ensuring good agreement of earlier experiments with joule heating results, is used. The model includes heat losses due to magnetic fluctuations and shows that the plasma temperatures of the kilo-electron-volt order may be achieved in a small device with the radius of 0.3 m only

  12. Self-dual spin-3 and 4 theories

    International Nuclear Information System (INIS)

    Aragone, C.; Khoudeir, A.

    1991-08-01

    We present self-dual pure spin-3 and 4 actions using the physical relevant Dreibein fields. Since these actions start with a Chern-Simons like kinetic term (and therefore cannot be obtained through dimensional reduction) one might wonder whether they need the presence of auxiliary, ghost-killing fields. It turns out that they must contain, also in this three dimensional case, auxiliary fields. Auxiliary scalars do not break self-duality; their free action does not contain kinetic terms. (author). 12 refs

  13. Dual-Recognition Förster Resonance Energy Transfer Based Platform for One-Step Sensitive Detection of Pathogenic Bacteria Using Fluorescent Vancomycin-Gold Nanoclusters and Aptamer-Gold Nanoparticles.

    Science.gov (United States)

    Yu, Mengqun; Wang, Hong; Fu, Fei; Li, Linyao; Li, Jing; Li, Gan; Song, Yang; Swihart, Mark T; Song, Erqun

    2017-04-04

    The effective monitoring, identification, and quantification of pathogenic bacteria is essential for addressing serious public health issues. In this study, we present a universal and facile one-step strategy for sensitive and selective detection of pathogenic bacteria using a dual-molecular affinity-based Förster (fluorescence) resonance energy transfer (FRET) platform based on the recognition of bacterial cell walls by antibiotic and aptamer molecules, respectively. As a proof of concept, Vancomycin (Van) and a nucleic acid aptamer were employed in a model dual-recognition scheme for detecting Staphylococcus aureus (Staph. aureus). Within 30 min, by using Van-functionalized gold nanoclusters and aptamer-modified gold nanoparticles as the energy donor and acceptor, respectively, the FRET signal shows a linear variation with the concentration of Staph. aureus in the range from 20 to 10 8 cfu/mL with a detection limit of 10 cfu/mL. Other nontarget bacteria showed negative results, demonstrating the good specificity of the approach. When employed to assay Staph. aureus in real samples, the dual-recognition FRET strategy showed recoveries from 99.00% to the 109.75% with relative standard derivations (RSDs) less than 4%. This establishes a universal detection platform for sensitive, specific, and simple pathogenic bacteria detection, which could have great impact in the fields of food/public safety monitoring and infectious disease diagnosis.

  14. System Study: Auxiliary Feedwater 1998-2014

    Energy Technology Data Exchange (ETDEWEB)

    Schroeder, John Alton [Idaho National Lab. (INL), Idaho Falls, ID (United States). Risk Assessment and Management Services Dept.

    2015-12-01

    This report presents an unreliability evaluation of the auxiliary feedwater (AFW) system at 69 U.S. commercial nuclear power plants. Demand, run hours, and failure data from fiscal year 1998 through 2014 for selected components were obtained from the Institute of Nuclear Power Operations (INPO) Consolidated Events Database (ICES). The unreliability results are trended for the most recent 10 year period, while yearly estimates for system unreliability are provided for the entire active period. No statistically significant increasing or decreasing trends were identified in the AFW results.

  15. Dual power, constant speed electric motor system

    Science.gov (United States)

    Kirschbaum, H.S.

    1984-07-31

    A dual capacity permanent split capacitor electric motor system is provided with a stator having main and auxiliary windings. The main stator winding includes two winding sections which are connected in parallel with each other and across a pair of line terminals while the auxiliary winding is connected in series with a capacitor to form a circuit branch which is connected between the line terminals for operation at a first output power level. Switching means are provided to reconnect the main stator winding sections in series with each other and in series with a second capacitor to form a circuit branch which is connected between the line terminals while the stator auxiliary winding is connected directly between the line terminals for operation at a second output power level. Automatic rotation reversal occurs when the motor switches from the first to the second output power level. 6 figs.

  16. Dual power, constant speed electric motor system

    Science.gov (United States)

    Kirschbaum, Herbert S.

    1984-01-01

    A dual capacity permanent split capacitor electric motor system is provided with a stator having main and auxiliary windings. The main stator winding includes two winding sections which are connected in parallel with each other and across a pair of line terminals while the auxiliary winding is connected in series with a capacitor to form a circuit branch which is connected between the line terminals for operation at a first output power level. Switching means are provided to reconnect the main stator winding sections in series with each other and in series with a second capacitor to form a circuit branch which is connected between the line terminals while the stator auxiliary winding is connected directly between the line terminals for operation at a second output power level. Automatic rotation reversal occurs when the motor switches from the first to the second output power level.

  17. Auxiliary equipment cooling circuit in nuclear reactors

    International Nuclear Information System (INIS)

    Yanagisawa, Ko.

    1986-01-01

    Purpose: To prevent the propagation of bacterias that transform NO 2 into NO 3 in auxiliary equipment coolants using corrosion inhibitors of nitrite type in BWR type reactors. Method: In auxiliary equipments coolant systems, water quality is controlled by using purified water as supplement water and nitrite such as Na 2 NO 2 as the corrosion inhibitors. However, in the circumstance where dissolved oxygen is present, bacteria propagate to oxidize NO 2 into NO 3 . Thus, NO 2 at 200 ppm is reduced to 20 ppm. In view of the above, a surge tank supplied from water supplement line is connected in series and a deaeration device is disposed thereto. Since the presence of dissolved oxygen causes the bacteria to propagate it is desired that the dissolved oxygen density in the supplement water is less than 5 ppm. Deaeration and pressure reduction in the surge tank can remove the dissolved oxygen, prevent NO 3 increase and also prevent stress corrosion cracks in the system pipeways. (Horiuchi, T.)

  18. Resonance self-shielding effect analysis of neutron data libraries applied for the dual-cooled waste transmutation blanket of the fusion-driven subcritical system

    International Nuclear Information System (INIS)

    Liu Haibo; Wu Yican; Zheng Shanliang; Zhang Chunzao

    2004-01-01

    Based on the Fusion-Driven Subcritical System (FDS-I), the 25 groups, 175 groups and 620 groups neutron nuclear data libraries with/without resonance self-shielding correction are made with the Njoy and Transx codes, and the K eff and reaction rates are calculated with the Anisn code. The conclusion indicates that the resonance self-shielding effect affects the reaction rates strongly. (authors)

  19. Auxiliary Electrodes for Chromium Vapor Sensors

    Energy Technology Data Exchange (ETDEWEB)

    Fergus, Jeffrey; Shahzad, Moaiz; Britt, Tommy

    2018-05-15

    Measurement of chromia-containing vapors in solid oxide fuel cell systems is useful for monitoring and addressing cell degradation caused by oxidation of the chomia scale formed on alloys for interconnects and balance-of-plant components. One approach to measuring chromium is to use a solid electrolyte with an auxiliary electrode that relates the partial pressure of the chromium containing species to the mobile species in the electrolyte. One example is YCrO3 which can equilibrate with the chromium containing vapor and yttrium in yttria stabilized zirconia to establish an oxygen activity. Another is Na2CrO4 which can equilibrate with the chromium-containing vapor to establish a sodium activity.

  20. Auxiliary accelerating system for TRIUMF cyclotron

    International Nuclear Information System (INIS)

    Zach, M.; Fong, K.; Laxdal, R.; Mackenzie, G.H.; Pacak, V.; Pearson, J.; Richardson, J.R.; Stanford, G.; Worsham, R.

    1990-06-01

    A 92 MHz auxiliary accelerating cavity has been designed and manufactured for installation in the TRIUMF cyclotron. Operating at the fourth harmonic of the RF with a peak voltage of 150 kV, it almost doubles the present energy gain per turn in the 400-500 MeV range, and reduces by ∼50% the stripping loss of the H - beam. This significant improvement will allow a substantial increase in the extracted current above the present routine level of 150μA while maintaining the same levels of residual radioactivity. The system is completed and being commissioned. A description of the design and commissioning procedures is presented, and results of beam tests given. (Author) 7 refs., 5 figs

  1. On Estimating Quantiles Using Auxiliary Information

    Directory of Open Access Journals (Sweden)

    Berger Yves G.

    2015-03-01

    Full Text Available We propose a transformation-based approach for estimating quantiles using auxiliary information. The proposed estimators can be easily implemented using a regression estimator. We show that the proposed estimators are consistent and asymptotically unbiased. The main advantage of the proposed estimators is their simplicity. Despite the fact the proposed estimators are not necessarily more efficient than their competitors, they offer a good compromise between accuracy and simplicity. They can be used under single and multistage sampling designs with unequal selection probabilities. A simulation study supports our finding and shows that the proposed estimators are robust and of an acceptable accuracy compared to alternative estimators, which can be more computationally intensive.

  2. Cooling system for auxiliary reactor component

    International Nuclear Information System (INIS)

    Fujihira, Tomoko.

    1991-01-01

    A cooling system for auxiliary reactor components comprises three systems, that is, two systems of reactor component cooling water systems (RCCW systems) and a high pressure component cooling water system (HPCCW system). Connecting pipelines having partition valves are intervened each in a cooling water supply pipeline to an emmergency component of each of the RCCW systems, a cooling water return pipeline from the emmergency component of each of the RCCW systems, a cooling water supply pipeline to each of the emmergency components of one of the RCCW system and the HPCCW system and a cooling water return pipeline from each of the emmergency components of one of the RCCW system and the HPCCW system. With such constitution, cooling water can be supplied also to the emmergency components in the stand-by system upon periodical inspection or ISI, thereby enabling to improve the backup performance of the emmergency cooling system. (I.N.)

  3. Major factors in critical equipment reliability - Auxiliary systems; The development of an auxiliary system

    International Nuclear Information System (INIS)

    Forsthoffer, W.E.

    1992-01-01

    In this article, the author details the development of an actual auxiliary system in order to fully understand the function of each major component and how it contributes to the total operation and reliability of the system. Only after the function of an auxiliary system is thoroughly understood, can one proceed to discuss specifications, design audits, testing, operation and preventive maintenance. The application selected will be to develop a pressurized lubrication and steam turbine control oil system for the critical equipment unit. This example was selected since many readers will be familiar with this type and because it provides a good foundation towards understanding fluid sealing systems. In the exercise that follow, he will define the system requirements and determine the system parameters. This information will then be used for component sizing

  4. Acute vertebral fracture after spinal fusion: a case report illustrating the added value of single-source dual-energy computed tomography to magnetic resonance imaging in a patient with spinal Instrumentation

    International Nuclear Information System (INIS)

    Fuchs, M.; Putzier, M.; Pumberger, M.; Hermann, K.G.; Diekhoff, T.

    2016-01-01

    Magnetic resonance imaging (MRI) is degraded by metal-implant-induced artifacts when used for the diagnostic assessment of vertebral compression fractures in patients with instrumented spinal fusion. Dual-energy computed tomography (DECT) offers a promising supplementary imaging tool in these patients. This case report describes an 85-year-old woman who presented with a suspected acute vertebral fracture after long posterior lumbar interbody fusion. This is the first report of a vertebral fracture that showed bone marrow edema on DECT; however, edema was missed by an MRI STIR sequence owing to metal artifacts. Bone marrow assessment using DECT is less susceptible to metal artifacts than MRI, resulting in improved visualization of vertebral edema in the vicinity of fused vertebral bodies. (orig.)

  5. Energy consumption of auxiliary systems of electric cars

    Directory of Open Access Journals (Sweden)

    Evtimov Ivan

    2017-01-01

    Full Text Available The paper analyzes the power demand of the auxiliary systems of electric cars. On the basis of existing electric cars an analysis of energy consumption of different auxiliary systems is done. As a result possibilities for rational use of these systems have been proposed, which can increase the mileage per one charge of the battery.

  6. 14 CFR 25.1142 - Auxiliary power unit controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 25.1142... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Powerplant Powerplant Controls and Accessories § 25.1142 Auxiliary power unit controls. Means must be provided on the flight deck for starting...

  7. 14 CFR 23.1142 - Auxiliary power unit controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 23.1142... Powerplant Controls and Accessories § 23.1142 Auxiliary power unit controls. Means must be provided on the... power unit. [Doc. No. 26344, 58 FR 18974, Apr. 9, 1993] ...

  8. 14 CFR 29.1142 - Auxiliary power unit controls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Auxiliary power unit controls. 29.1142... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Powerplant Powerplant Controls and Accessories § 29.1142 Auxiliary power unit controls. Means must be provided on the flight deck for starting...

  9. Optimization of feed water control for auxiliary boiler

    International Nuclear Information System (INIS)

    Li Lingmao

    2004-01-01

    This paper described the feed water control system of the auxiliary boiler steam drum in Qinshan Phase III Nuclear Power Plant, analyzed the deficiency of the original configuration, and proposed the optimized configuration. The optimized feed water control system can ensure the stable and safe operation of the auxiliary boiler, and the normal operation of the users. (author)

  10. Dedicated auxiliary power units for Hybrid Electric Vehicles

    NARCIS (Netherlands)

    Mourad, S.; Weijer, C.J.T. van de

    1998-01-01

    The use of a dedicated auxiliary power unit is essential to utilize the potential that hybrid vehicles offer for efficient and ultra-clean transportation. An example of a hybrid project at the TNO Road-Vehicles Research Institute shows the development and the results of a dedicated auxiliary power

  11. The Range of Gapping and the Status of Auxiliaries.

    Science.gov (United States)

    Warner, A. R.

    Full verbs and auxiliaries are subject to gapping. In the simplest cases, this construction type involves apparent ellipsis within one or more clausal conjuncts under identity with the finite verb or auxiliary of a preceding conjunct. It has often been suggested that the apparent ellipsis must involve at least a verb. Some researchers see in the…

  12. A design procedure for an acoustic mirror providing dual reflection of longitudinal and shear waves in Solidly Mounted BAW Resonators (SMRs)

    NARCIS (Netherlands)

    Jose, Sumy; Jansman, Andreas; Hueting, Raymond Josephus Engelbart

    The quality factor of the traditional Solidly Mounted Resonator (SMR) is limited by substrate losses, as the traditionally employed acoustic mirror reflects longitudinal waves but not shear waves. Modern mirrors do reflect both waves, but design rules for such mirrors have not been published so far.

  13. Comparison of collective Thomson scattering signals due to fast ions in ITER scenarios with fusion and auxiliary heating

    DEFF Research Database (Denmark)

    Salewski, Mirko; Asunta, O.; Eriksson, L.-G.

    2009-01-01

    Auxiliary heating such as neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH) will accelerate ions in ITER up to energies in the MeV range, i.e. energies which are also typical for alpha particles. Fast ions of any of these populations will elevate the collective Thomson...... functions of fast ions generated by NBI and ICRH are calculated for a steady-state ITER burning plasma equilibrium with the ASCOT and PION codes, respectively. The parameters for the auxiliary heating systems correspond to the design currently foreseen for ITER. The geometry of the CTS system for ITER...... is chosen such that near perpendicular and near parallel velocity components are resolved. In the investigated ICRH scenario, waves at 50MHz resonate with tritium at the second harmonic off-axis on the low field side. Effects of a minority heating scheme with He-3 are also considered. CTS scattering...

  14. Sea water take-up facility for cooling reactor auxiliary

    International Nuclear Information System (INIS)

    Numata, Noriko; Mizutani, Akira; Hirako, Shizuka; Uchiyama, Yuichi; Oda, Atsushi.

    1997-01-01

    The present invention provides an improvement of a cooling sea water take-up facility for cooling auxiliary equipments of nuclear power plant. Namely, an existent sea water take-up facility for cooling reactor auxiliary equipments has at least two circulation water systems and three independent sea water systems for cooling reactor auxiliary equipments. In this case, a communication water channel is disposed, which connects the three independent sea water systems for cooling reactor auxiliary equipments mutually by an opening/closing operation of a flow channel partitioning device. With such a constitution, even when any combination of two systems among the three circulation water systems is in inspection at the same time, one system for cooling the reactor auxiliary equipments can be kept operated, and one system is kept in a stand-by state by the communication water channel upon periodical inspection of water take-up facility for cooling the auxiliary equipments. As a result, the sea water take-up facility for cooling auxiliary equipments of the present invention have operation efficiency higher than that of a conventional case while keeping the function and safety at the same level as in the conventional case. (I.S.)

  15. Aging assessment of auxiliary feedwater pumps

    International Nuclear Information System (INIS)

    Greenstreet, W.L.

    1987-01-01

    ORNL is conducting aging assessments of auxiliary feedwater pumps to provide recommendations for monitoring and assessing the severity of time-dependent degradation as well as to recommend maintenance and replacement practices. Cornerstones of these activities are the identification of failure modes and causes and ranking of causes. Failure modes and causes of interest are those due to aging and service wear. Design details, functional requirements, and operating experience data were used to identify failure modes and causes and to rank the latter. Based on this input, potentially useful inspection, surveillance, and condition monitoring methods that are currently available for use or in the developmental stage were examined and recommendations made. The methods selected are listed and discussed in terms of use and information to be obtained. Relationships between inspection, surveillance, and monitoring and maintenance practices entered prominently into maintenance recommendations. These recommendations, therefore, embrace predictive as well as corrective and preventative maintenance practices. The recommendations are described, inspection details are discussed, and periodic inspection and maintenance interval guidelines are given. Surveillance testing at low-flow conditions is also discussed. It is shown that this type of testing can lead to accelerated aging

  16. Dual Regression

    OpenAIRE

    Spady, Richard; Stouli, Sami

    2012-01-01

    We propose dual regression as an alternative to the quantile regression process for the global estimation of conditional distribution functions under minimal assumptions. Dual regression provides all the interpretational power of the quantile regression process while avoiding the need for repairing the intersecting conditional quantile surfaces that quantile regression often produces in practice. Our approach introduces a mathematical programming characterization of conditional distribution f...

  17. Low dose prospective ECG-gated delayed enhanced dual-source computed tomography in reperfused acute myocardial infarction comparison with cardiac magnetic resonance

    International Nuclear Information System (INIS)

    Wang Rui; Zhang Zhaoqi; Xu Lei; Ma Qin; He Yi; Lu Dongxu; Yu Wei; Fan Zhanming

    2011-01-01

    Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 ± 9.57 HU vs. 72.63 ± 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 ± 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.

  18. Low dose prospective ECG-gated delayed enhanced dual-source computed tomography in reperfused acute myocardial infarction comparison with cardiac magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Wang Rui, E-mail: rui_wang1979@yahoo.cn [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Zhang Zhaoqi, E-mail: zhaoqi5000@vip.sohu.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Xu Lei, E-mail: leixu2001@hotmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Ma Qin, E-mail: tel1367@gmail.com [Department of Emergency, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); He Yi, E-mail: heyi139@sina.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Lu Dongxu, E-mail: larry.hi@163.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Yu Wei, E-mail: yuwei02@gmail.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China); Fan Zhanming, E-mail: fanzm120@tom.com [Department of Radiology, Beijing Anzhen Hospital, Capital Medical University, 100029 Beijing (China)

    2011-11-15

    Purpose: To determine whether prospective electrocardiogram (ECG)-gated delayed contrast-enhanced dual-source computed tomography (DCE-DSCT) can accurately delineate the extension of myocardial infarction (MI) compared with delayed enhanced cardiac MR (DE-MR). Material and methods: Eleven patients were examined using dual-source CT and cardiac MR in 2 weeks after a first reperfused MI. DCE-DSCT scan protocol was performed with prospective ECG-gating sequential scan model 7 min after contrast administration. In a 17-model, infarcted myocardium detected by DE-MR was categorized as transmural and subendocardial extension. Segment of infarcted location and graded transmurality were compared between DCE-MDCT and DE-MR. Results: In all eleven patients, diagnostic quality was obtained for depicting delayed enhanced myocardium. Agreement between DCE-DSCT and MR was good on myocardial segment based comparison (kappa = 0.85, p < 0.001), and on transmural and subendocardial infarction type comparison (kappa = 0.82, p < 0.001, kappa = 0.52, p < 0.001, respectively). CT value was higher on infarcted region than that of normal region (100.02 {+-} 9.57 HU vs. 72.63 {+-} 7.32 HU, p < 0.001). Radiation dose of prospectively ECG-gating protocol were 0.99 {+-} 0.08 mSv (0.82-1.19 mSv). Conclusions: Prospective ECG-gated DCE-DSCT can accurately assess the extension and the patterns of myocardial infarction with low radiation dose.

  19. Dual-source computed tomography. Effect on regional and global left ventricular function assessment compared to magnetic resonance imaging; Untersuchung der regionalen und globalen linksventrikulaeren Funktion mit der Dual-Source-Computertomografie im Vergleich zur Magnetresonanztomografie

    Energy Technology Data Exchange (ETDEWEB)

    Lueders, F.; Seifarth, H.; Wessling, J.; Heindel, W.; Juergens, Kai Uwe [Inst. fuer Klinische Radiologie, Universitaetsklinikum Muenster (Germany); Fischbach, R. [Klinik fuer Radiologie, Nuklearmedizin und Neuroradiologie, Asklepios Klinik Altona (Germany)

    2009-10-15

    Purpose: to determine regional and global left ventricular (LV) functional parameters and to perform segmental wall thickness (SWT) and motion (WM) analysis of dual source CT (DSCT) with optimized temporal resolution versus MRI. Materials and Methods: 30 patients with known or suspected CAD, non-obstructive HCM, DCM, ARVCM, Fallot Tetralogy, cardiac sarcoidosis and cardiac metastasis underwent DSCT and MRI. The DSCT and MR images were evaluated: end-systolic (ESV), end-diastolic LV (EDV) volumes, stroke volume (SV), ejection fraction (EF), and myocardial mass (MM) as well as LV wall thickening and segmental WM applying the AHA model were obtained and statistically analyzed. Results: The mean LV-EDV (r = 0.96) and ESV (r = 0.98) as well as LV-EF (r = 0.97), SV (r = 0.83), and MM (r = 0.95) correlated well. Bland Altman analysis revealed little systematic underestimation of LV-EF (-1.1 {+-} 7.8%), EDV (-0.3 {+-} 18.2 ml), SV (-1.3 {+-} 16.7 ml) and little overestimation of ESV (1.1 {+-} 7.8 ml) and MM (12.8 {+-} 14.4 g) determined by DSCT. Systolic reconstruction time points correlated well (DSCT 32.2 {+-} 6.7 vs. MRI 35.6 {+-} 4.4% RR-interval). The LV wall thickness obtained by DSCT and MRI showed close correlation in all segments (diameter diff 0.42 {+-} 1 mm). In 413 segments (89%) WM abnormalities were equally rated, whereas DSCT tended to underestimate the degree of wall motion impairment. Conclusion: DSCT with optimized temporal resolution enables regional and global LV function analysis as well as segmental WM analysis in good correlation with MRI. However, the degree of WM impairment is slightly underestimated by DSCT. (orig.)

  20. 46 CFR 182.620 - Auxiliary means of steering.

    Science.gov (United States)

    2010-10-01

    ... TONS) MACHINERY INSTALLATION Steering Systems § 182.620 Auxiliary means of steering. (a) Except as... personnel hazards during normal or heavy weather operation. (b) A suitable hand tiller may be acceptable as...

  1. Effects of Auxiliary-Source Connection in Multichip Power Module

    DEFF Research Database (Denmark)

    Li, Helong; Munk-Nielsen, Stig; Wang, Xiongfei

    2017-01-01

    the power loop and the gate loop like how the Kelvin-source connection does, owing to their involvement in the loop of the power source current. Three effects of the auxiliary-source connections are then analyzed, which are 1) the common source stray inductance reduction, 2) the transient drain......Auxiliary-source bond wires and connections are widely used in power modules with paralleled MOSFETs or IGBTs. This paper investigates the operation mechanism of the auxiliary-source connections in multichip power modules. It reveals that the auxiliary-source connections cannot fully decouple......-source current imbalance mitigation, and 3) the influence on the steady-state current distribution. Lastly, simulations and experimental results validate the theoretical analysis....

  2. New set of auxiliary fields for supergravity theories

    International Nuclear Information System (INIS)

    Oliveira Rivelles, V. de.

    1983-02-01

    A brief introduction on supersymmetry is given. The problems with the obtainment of the auxiliary fields in supergravity theories are discussed, after a short presentation of the supersymmetry algebra representations. (L.C.) [pt

  3. The installation of helium auxiliary systems in HTGR

    International Nuclear Information System (INIS)

    Qin Zhenya; Fu Xiaodong

    1993-01-01

    The inert gas Helium was chosen as reactor coolant in high temperature gas coolant reactor, therefore a set of Special and uncomplex helium auxiliary systems will be installed, the safe operation of HTR-10 can be safeguarded. It does not effect the inherent safety of HTR-10 MW if any one of all those systems were damaged during operation condition. This article introduces the design function and the system principle of all helium auxiliary systems to be installed in HTR-10. Those systems include: helium purification and its regeneration system, helium supply and storage system, pressure control and release system of primary system, dump system for helium auxiliary system and fuel handling, gaseous waste storage system, water extraction system for helium auxiliary systems and evacuation system for primary system

  4. Auxiliary fields for super Yang-Mills from division algebras

    CERN Document Server

    Evans, Jonathan M.

    1994-01-01

    Division algebras are used to explain the existence and symmetries of various sets of auxiliary fields for super Yang-Mills in dimensions d=3,4,6,10. (Contribution to G\\"ursey Memorial Conference I: Strings and Symmetries)

  5. Parallel Auxiliary Space AMG Solver for $H(div)$ Problems

    Energy Technology Data Exchange (ETDEWEB)

    Kolev, Tzanio V. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vassilevski, Panayot S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2012-12-18

    We present a family of scalable preconditioners for matrices arising in the discretization of $H(div)$ problems using the lowest order Raviart--Thomas finite elements. Our approach belongs to the class of “auxiliary space''--based methods and requires only the finite element stiffness matrix plus some minimal additional discretization information about the topology and orientation of mesh entities. Also, we provide a detailed algebraic description of the theory, parallel implementation, and different variants of this parallel auxiliary space divergence solver (ADS) and discuss its relations to the Hiptmair--Xu (HX) auxiliary space decomposition of $H(div)$ [SIAM J. Numer. Anal., 45 (2007), pp. 2483--2509] and to the auxiliary space Maxwell solver AMS [J. Comput. Math., 27 (2009), pp. 604--623]. Finally, an extensive set of numerical experiments demonstrates the robustness and scalability of our implementation on large-scale $H(div)$ problems with large jumps in the material coefficients.

  6. Progress on radio frequency auxiliary heating system designs in ITER

    International Nuclear Information System (INIS)

    Makowski, M.; Bosia, G.; Elio, F.

    1996-09-01

    ITER will require over 100 MW of auxiliary power for heating, on- and off-axis current drive, accessing the H-mode, and plasma shut-down. The Electron Cyclotron Range of Frequencies (ECRF) and Ion Cyclotron Range of Frequencies (ICRF) are two forms of Radio Frequency (RF) auxiliary power being developed for these applications. Design concepts for both the ECRF and ICRF systems are presented, key features and critical design issues are discussed, and projected performances outlined

  7. An auxiliary differential equation FDTD method for anisotropic magnetized plasmas

    International Nuclear Information System (INIS)

    Liu Shaobin; Mo Jinjun; Yuan Naichang

    2004-01-01

    An auxiliary differential equation finite-difference time-domain (ADE-FDTD) methodology for anisotropic magnetized plasmas is derived. The method is based on a difference approximation of the auxiliary differential equation. A comparison with the JEC method is included. The CPU time saving by several times and accuracy of the method are confirmed by computing the reflection and transmission through a magnetized plasma layer with the direction of propagation parallel to the direction of the biasing field

  8. Operating experiences and degradation detection for auxiliary feedwater systems

    International Nuclear Information System (INIS)

    Casada, D.; Farmer, W.S.

    1992-01-01

    A study of Pressurized Water Reactor Auxiliary Feedwater (AFW) Systems has been conducted by Oak Ridge National Laboratory (ORNL) under the auspices of the Nuclear Regulatory Commission's Nuclear Plant Aging Research Program. The results of the study are documented in NUREG/CR-5404, Vol. 1, Auxiliary Feedwater System Aging Study. The study reviewed historical failure experience and current monitoring practices for the AFW System. This paper provides an overview of the study approach and results

  9. Study on 3D printer production of auxiliary device for upper limb for medical imaging test

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyeong Gyun [Dept. of Radiological Science, Far East University, Eumsung (Korea, Republic of); Yoon, Jae Ho [Jukwang Precision Co., Ltd., Gumi (Korea, Republic of); Choi, Seong Dae [Dept. of Mechanical system engineering, Kumoh Institute of Technology, Gumi (Korea, Republic of)

    2015-12-15

    There is a progressive development in the medical imaging technology, especially of descriptive capability for anatomical structure of human body thanks to advancement of information technology and medical devices. But however maintenance of correct posture is essential for the medical imaging checkup on the shoulder joint requiring rotation of the upper limb due to the complexity of human body. In the cases of MRI examination, long duration and fixed posture are critical, as failure to comply with them leads to minimal possibility of reproducibility only with the efforts of the examiner and will of the patient. Thus, this study aimed to develop an auxiliary device that enables rotation of the upper limb as well as fixing it at quantitative angles for medical imaging examination capable of providing diagnostic values. An auxiliary device has been developed based on the results of precedent studies, by designing a 3D model with the CATIA software, an engineering application, and producing it with the 3D printer. The printer is Objet350 Connex from Stratasys, and acrylonitrile- butadiene-styrene(ABS) is used as the material of the device. Dimensions are 120 X 150 X 190 mm, with the inner diameter of the handle being 125.9 mm. The auxiliary device has 4 components including the body (outside), handle (inside), fixture terminal and the connection part. The body and handle have the gap of 2.1 mm for smooth rotation, while the 360 degree of scales have been etched on the handle so that the angle required for observation may be recorded per patient for traceability and dual examination.

  10. Study on 3D printer production of auxiliary device for upper limb for medical imaging test

    International Nuclear Information System (INIS)

    Kim, Hyeong Gyun; Yoon, Jae Ho; Choi, Seong Dae

    2015-01-01

    There is a progressive development in the medical imaging technology, especially of descriptive capability for anatomical structure of human body thanks to advancement of information technology and medical devices. But however maintenance of correct posture is essential for the medical imaging checkup on the shoulder joint requiring rotation of the upper limb due to the complexity of human body. In the cases of MRI examination, long duration and fixed posture are critical, as failure to comply with them leads to minimal possibility of reproducibility only with the efforts of the examiner and will of the patient. Thus, this study aimed to develop an auxiliary device that enables rotation of the upper limb as well as fixing it at quantitative angles for medical imaging examination capable of providing diagnostic values. An auxiliary device has been developed based on the results of precedent studies, by designing a 3D model with the CATIA software, an engineering application, and producing it with the 3D printer. The printer is Objet350 Connex from Stratasys, and acrylonitrile- butadiene-styrene(ABS) is used as the material of the device. Dimensions are 120 X 150 X 190 mm, with the inner diameter of the handle being 125.9 mm. The auxiliary device has 4 components including the body (outside), handle (inside), fixture terminal and the connection part. The body and handle have the gap of 2.1 mm for smooth rotation, while the 360 degree of scales have been etched on the handle so that the angle required for observation may be recorded per patient for traceability and dual examination

  11. Three-dimensional visualization and analysis of a dual-disk resonator with dielectric misalignment and surface anomaly using edge finite elements

    Science.gov (United States)

    Villalva, Gustavo Jose

    The search for life in other planets and solar systems by scientists and engineers brings about an effort to design and develop equipment of high standards which extend the capability to listen for signals which have been traveling in space many light years. In this study the purpose was to provide a more realistic and illustrative scientific understanding of one such piece of precision equipment, the dielectric resonator, which designers seek to extend its frequency stability below 10-15. At such tolerances special cryogenic cooling procedures are required. Due to its accuracy it can be used to set short term time and frequency standards to correct the atomic clock. A theoretical means of studying this type of resonant device is necessary. One contribution made in extending the current understanding of such a device is the scientific tool developed specifically for this dissertation. It applies the Minimum Theorem from variational calculus using edge finite elements for numerical modeling. The use of quasi-linear vector basis functions allowed an implementation of Helmholtz's three-dimensional equation without a penalty term. Furthermore, the intermixing of spurious solutions with the true ones due to a nodal basis was eliminated. Calculation of the average edge electric fields was made possible by applying the Rayleigh-Ritz criterion. Model enclosure was provided by a cylindrical metal shield situated in a rectangular coordinate system. Linear, homogeneous, nonmagnetic, lossless, uniaxial, and anisotropic media were considered. Integration of NASA's Unix Lanczos eigensolver permitted the accurate estimation of the smaller eigenvalues and associated vectors for large matrices on workstations and personal computers in relatively short computational times. Calculation of the lower frequency modes demonstrated the ability to address device imperfections for two selected cases. Both were influenced by problems encountered in the use of crystals constrained by cost, or

  12. Speed-up of ab initio hybrid Monte Carlo and ab initio path integral hybrid Monte Carlo simulations by using an auxiliary potential energy surface

    International Nuclear Information System (INIS)

    Nakayama, Akira; Taketsugu, Tetsuya; Shiga, Motoyuki

    2009-01-01

    Efficiency of the ab initio hybrid Monte Carlo and ab initio path integral hybrid Monte Carlo methods is enhanced by employing an auxiliary potential energy surface that is used to update the system configuration via molecular dynamics scheme. As a simple illustration of this method, a dual-level approach is introduced where potential energy gradients are evaluated by computationally less expensive ab initio electronic structure methods. (author)

  13. 46 CFR 58.25-10 - Main and auxiliary steering gear.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Main and auxiliary steering gear. 58.25-10 Section 58.25... AUXILIARY MACHINERY AND RELATED SYSTEMS Steering Gear § 58.25-10 Main and auxiliary steering gear. (a) Power-operated main and auxiliary steering gear must be separate systems that are independent throughout their...

  14. Measurement of vertebral bone marrow lipid profile at 1.5-T proton magnetic resonance spectroscopy and bone mineral density at dual-energy X-ray absorptiometry: correlation in a swine model

    Energy Technology Data Exchange (ETDEWEB)

    Di Leo, Giovanni; Fina, Laura [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Bandirali, Michele; Messina, Carmelo [Universita degli Studi di Milano, Scuola di Specializzazione in Radiodiagnostica, Milan (Italy); Sardanelli, Francesco [IRCCS Policlinico San Donato, Unita di Radiologia, San Donato Milanese (Italy); Universita degli Studi di Milano, Dipartimento di Scienze Biomediche per la Salute, San Donato Milanese (Italy)

    2014-08-15

    Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.

  15. Carboxymethyl cellulose (CMC)-loaded Co-Cu doped manganese ferrite nanorods as a new dual-modal simultaneous contrast agent for magnetic resonance imaging and nanocarrier for drug delivery system

    Science.gov (United States)

    Abbasi Pour, Sajjad; Shaterian, Hamid Reza; Afradi, Mojgan; Yazdani-Elah-Abadi, Afshin

    2017-09-01

    We synthesized Co0.25Cu0.25Mn0.5Fe2O4@CMC (CCMFe2O4@CMC) nanorods as a new dual-modal simultaneous for magnetic resonance imaging contrast agent and nanocarrier for drug delivery system. Impact of CCMFe2O4@CMC nanorods were investigated on the longitudinal (T1), transverse (T2) and transverse (T2∗) relaxation times for in vitro MRI contrast agent in water and also for drug delivery system, L-dopa was coated on CCMFe2O4@CMC nanorods and then in vitro drug release test was carried out at three PHs values and different temperatures. In vitro MR imaging demonstrated that r2 value of CCMFe2O4@CMC nanorods is 138.33 mM-1 s-1, CCMFe2O4@CMC is useful as T2 contrast agent relative to other T2 contrast agants. In vitro drug release test shows the amount of released L-dopa from CCMFe2O4@CMC nanorods at medium with pH = 1.2 is more than pH = 5.3 and 7.4.

  16. Measurement of vertebral bone marrow lipid profile at 1.5-T proton magnetic resonance spectroscopy and bone mineral density at dual-energy X-ray absorptiometry: correlation in a swine model

    International Nuclear Information System (INIS)

    Di Leo, Giovanni; Fina, Laura; Bandirali, Michele; Messina, Carmelo; Sardanelli, Francesco

    2014-01-01

    Bone marrow is mainly composed of red (hematopoietic) and yellow (fatty) components. Soon after the birth there is a physiological conversion of the bone marrow from red to yellow, so that the percentage of hematopoietic cells and adipocytes changes with aging. Although bone marrow adipogenesis is a physiologic process involving all mammals, recent studies showed an accelerated marrow adipogenesis associated with several chronic conditions, including osteoporosis [4] and diabetes mellitus. Moreover, this increased marrow fat is accompanied by a decrease in bone density. Marrow fat is therefore increasingly believed to influence the bone microenvironment. Diagnostic tools for quantitative measurement of bone marrow fat and bone mineral density (BMD) include proton magnetic resonance spectroscopy (MRS) and dual-energy Xray absorptiometry (DXA), respectively. Using MRS, an inverse relationship between vertebral bone marrow fat content and lumbar BMD has been demonstrated in patients affected with osteoporosis or with diabetes mellitus. In most studies, a quite standard MRS sequence has been used, with short echo times (TE) for the measurement of the bulk methylene. In this study we sought to optimize the MRS sequence in order to try to measure other fat components of the vertebral bone marrow at 1.5 T. For this purpose, we used an animal model that allowed long acquisition times and repeated measures. Moreover, we aimed at estimating in this model the relationship between vertebral bone marrow fat content at proton MRS and BMD at DXA.

  17. Probabilistic cloning with supplementary information contained in the quantum states of two auxiliary systems

    International Nuclear Information System (INIS)

    Li, Lvjun; Qiu, Daowen

    2007-01-01

    In probabilistic cloning with two auxiliary systems, we consider and compare three different protocols for the success probabilities of cloning. We show that, in certain circumstances, it may increase the success probability to add an auxiliary system to the probabilistic cloning machine having one auxiliary system, but we always can find another cloning machine with one auxiliary system having the same success probability as that with two auxiliary systems

  18. The Explicit Determinations Of Dual Plane Curves And Dual Helices In Terms Of Its Dual Curvature And Dual Torsion

    OpenAIRE

    Lee Jae Won; Choi Jin Ho; Jin Dae Ho

    2014-01-01

    In this paper, we give the explicit determinations of dual plane curves, general dual helices and dual slant helices in terms of its dual curvature and dual torsion as a fundamental theory of dual curves in a dual 3-space

  19. Auxiliary bearing design considerations for gas cooled reactors

    International Nuclear Information System (INIS)

    Penfield, S.R. Jr.; Rodwell, E.

    2001-01-01

    The need to avoid contamination of the primary system, along with other perceived advantages, has led to the selection of electromagnetic bearings (EMBs) in most ongoing commercial-scale gas cooled reactor (GCR) designs. However, one implication of magnetic bearings is the requirement to provide backup support to mitigate the effects of failures or overload conditions. The demands on these auxiliary or 'catcher' bearings have been substantially escalated by the recent development of direct Brayton cycle GCR concepts. Conversely, there has been only limited directed research in the area of auxiliary bearings, particularly for vertically oriented turbomachines. This paper explores the current state-of-the-art for auxiliary bearings and the implications for current GCR designs. (author)

  20. Electrospinning of aligned fibers with adjustable orientation using auxiliary electrodes

    International Nuclear Information System (INIS)

    Arras, Matthias M L; Grasl, Christian; Schima, Heinrich; Bergmeister, Helga

    2012-01-01

    A conventional electrospinning setup was upgraded by two turnable plate-like auxiliary high-voltage electrodes that allowed aligned fiber deposition in adjustable directions. Fiber morphology was analyzed by scanning electron microscopy and attenuated total reflection Fourier transform infrared spectroscopy (FTIR-ATR). The auxiliary electric field constrained the jet bending instability and the fiber deposition became controllable. At target speeds of 0.9 m s −1 90% of the fibers had aligned within 2°, whereas the angular spread was 70° without the use of auxiliary electrodes. It was even possible to orient fibers perpendicular to the rotational direction of the target. The fiber diameter became smaller and its distribution narrower, while according to the FTIR-ATR measurement the molecular orientation of the polymer was unaltered. This study comprehensively documents the feasibility of directed fiber deposition and offers an easy upgrade to existing electrospinning setups. (paper)

  1. Extensions of the auxiliary field method to solve Schroedinger equations

    International Nuclear Information System (INIS)

    Silvestre-Brac, Bernard; Semay, Claude; Buisseret, Fabien

    2008-01-01

    It has recently been shown that the auxiliary field method is an interesting tool to compute approximate analytical solutions of the Schroedinger equation. This technique can generate the spectrum associated with an arbitrary potential V(r) starting from the analytically known spectrum of a particular potential P(r). In the present work, general important properties of the auxiliary field method are proved, such as scaling laws and independence of the results on the choice of P(r). The method is extended in order to find accurate analytical energy formulae for radial potentials of the form aP(r) + V(r), and several explicit examples are studied. Connections existing between the perturbation theory and the auxiliary field method are also discussed

  2. Extensions of the auxiliary field method to solve Schroedinger equations

    Energy Technology Data Exchange (ETDEWEB)

    Silvestre-Brac, Bernard [LPSC Universite Joseph Fourier, Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, Avenue des Martyrs 53, F-38026 Grenoble-Cedex (France); Semay, Claude; Buisseret, Fabien [Groupe de Physique Nucleaire Theorique, Universite de Mons-Hainaut, Academie universitaire Wallonie-Bruxelles, Place du Parc 20, B-7000 Mons (Belgium)], E-mail: silvestre@lpsc.in2p3.fr, E-mail: claude.semay@umh.ac.be, E-mail: fabien.buisseret@umh.ac.be

    2008-10-24

    It has recently been shown that the auxiliary field method is an interesting tool to compute approximate analytical solutions of the Schroedinger equation. This technique can generate the spectrum associated with an arbitrary potential V(r) starting from the analytically known spectrum of a particular potential P(r). In the present work, general important properties of the auxiliary field method are proved, such as scaling laws and independence of the results on the choice of P(r). The method is extended in order to find accurate analytical energy formulae for radial potentials of the form aP(r) + V(r), and several explicit examples are studied. Connections existing between the perturbation theory and the auxiliary field method are also discussed.

  3. Reactor auxiliary cooling facility and coolant supplying method therefor

    Energy Technology Data Exchange (ETDEWEB)

    Ando, Koji; Kinoshita, Shoichiro

    1996-06-07

    A reactor auxiliary cooling facility of the present invention comprises a coolant recycling line for recycling coolants by way of a reactor auxiliary coolant pump and a cooling load, a gravitational surge tank for supplying coolants to the coolant recycling line and a supplemental water supplying line for supplying a supply the supplemental water to the tank. Then, a pressurization-type supply water surge tank is disposed for operating the coolant recycling line upon performing an initial system performance test in parallel with the gravitational surge tank. With such a constitution, the period of time required from the start of the installation of reactor auxiliary cooling facilities to the completion of the system performance test can be shortened at a reduced cost without enlarging the scale of the facility. (T.M.)

  4. Linearized curvatures for auxiliary fields in the de Sitter space

    Energy Technology Data Exchange (ETDEWEB)

    Vasiliev, M A

    1988-09-19

    New consistent linearized curvatures in the de Sitter space are constructed. The sequence of actions, describing bosonic and fermionic gauge auxiliary fields, is found based on these curvatures. The proposed actions are parametrized by two integer parameters, n greater than or equal to 0 and m greater than or equal to 0. The simplest case n=m=0 corresponds in the flat limit to the auxiliary fields of 'new minimal' supergravity. The hamiltonian formulation is developed for the auxiliary fields suggested; hamiltonians and first- and second-class constraints are constructed. Using these results, it is shown that the systems of fields proposed possess no dynamical degrees of freedom in de Sitter and flat spaces. In addition the hamiltonian formalism is analysed for some free dynamical systems based on linearized higher-spin curvatures introduced previously.

  5. Reactor auxiliary cooling facility and coolant supplying method therefor

    International Nuclear Information System (INIS)

    Ando, Koji; Kinoshita, Shoichiro.

    1996-01-01

    A reactor auxiliary cooling facility of the present invention comprises a coolant recycling line for recycling coolants by way of a reactor auxiliary coolant pump and a cooling load, a gravitational surge tank for supplying coolants to the coolant recycling line and a supplemental water supplying line for supplying a supply the supplemental water to the tank. Then, a pressurization-type supply water surge tank is disposed for operating the coolant recycling line upon performing an initial system performance test in parallel with the gravitational surge tank. With such a constitution, the period of time required from the start of the installation of reactor auxiliary cooling facilities to the completion of the system performance test can be shortened at a reduced cost without enlarging the scale of the facility. (T.M.)

  6. Improving Semi-Supervised Learning with Auxiliary Deep Generative Models

    DEFF Research Database (Denmark)

    Maaløe, Lars; Sønderby, Casper Kaae; Sønderby, Søren Kaae

    Deep generative models based upon continuous variational distributions parameterized by deep networks give state-of-the-art performance. In this paper we propose a framework for extending the latent representation with extra auxiliary variables in order to make the variational distribution more...... expressive for semi-supervised learning. By utilizing the stochasticity of the auxiliary variable we demonstrate how to train discriminative classifiers resulting in state-of-the-art performance within semi-supervised learning exemplified by an 0.96% error on MNIST using 100 labeled data points. Furthermore...

  7. TMI-2 auxiliary building elevator shaft and pit decontamination

    Energy Technology Data Exchange (ETDEWEB)

    Bengel, T.G.

    1986-01-01

    Decontamination of the elevator pit and shaft in the auxiliary building at Three Mile Island Unit 2 (TMI-2) was performed to remove high radiation and contamination levels which prevented personnel from utilizing the elevator. The radiation and contamination levels in the TMI-2 auxiliary building elevator shaft have been reduced to the point where plant personnel are again permitted to ride in the elevator without a radiation work permit, with the exception of access to the 281-ft (basement) level. Based on the declassification and expanded use of the elevator, the task goal has been met. The tax expended 16.16 man-rem and 621 man-hours.

  8. Intrinsically safe electrical installations, auxiliary circuits and electric communication equipment

    Energy Technology Data Exchange (ETDEWEB)

    Herms, C D

    1981-11-19

    Technical progress has not stopped short of electrical systems in mining, so that three new chapters are new included in the VDE regulations leaflet No. 0118 on 'Installation of electrical systems in underground coal mining'. The regulations on intrinsically safe electric systems, auxiliary circuits and communication systems are briefly described, and grounds for the regulations are presented. The regulations already take account of European regulations on intrinsic safety which will soon be published in a European Regulation on Mine Explosions. In the chapters on auxiliary circuits and communication systems, protection against direct contact, fires, and explosions is discussed as well as the further goal of reliable signal transmission.

  9. Direction of Impurity Pinch and Auxiliary Heating in Tokamak Plasmas

    International Nuclear Information System (INIS)

    Angioni, C.; Peeters, A.G.

    2006-01-01

    A mechanism of particle pinch for trace impurities in tokamak plasmas, arising from the effect of parallel velocity fluctuations in the presence of a turbulent electrostatic potential, is identified analytically by means of a reduced fluid model and verified numerically with a gyrokinetic code for the first time. The direction of such a pinch reverses as a function of the direction of rotation of the turbulence in agreement with the impurity pinch reversal observed in some experiments when moving from dominant auxiliary ion heating to dominant auxiliary electron heating

  10. Analysis and Measurement of NOx Emissions in Port Auxiliary Vessels

    Directory of Open Access Journals (Sweden)

    German de Melo Rodriguez

    2013-09-01

    Full Text Available This paper is made NOx pollution emitted by port auxiliary vessels, specifically by harbour tugs, due to its unique operating characteristics of operation, require a large propulsion power changes discontinuously, also possess some peculiar technical characteristics, large tonnage and high propulsive power, that differentiate them from other auxiliary vessels of the port. Taking into account all the above features, there are no studies of the NOx emission engines caused by different working regimes of power because engine manufacturers have not measured these emissions across the range of operating power, but usually we only report the pollution produced by its engines to a maximum continuous power.

  11. QCD Dual

    DEFF Research Database (Denmark)

    Sannino, Francesco

    2009-01-01

    We uncover a novel solution of the 't Hooft anomaly matching conditions for QCD. Interestingly in the perturbative regime the new gauge theory, if interpreted as a possible QCD dual, predicts the critical number of flavors above which QCD in the nonperturbative regime, develops an infrared stable...

  12. Optimized auxiliary representation of non-Markovian impurity problems by a Lindblad equation

    International Nuclear Information System (INIS)

    Dorda, A; Sorantin, M; Linden, W von der; Arrigoni, E

    2017-01-01

    We present a general scheme to address correlated nonequilibrium quantum impurity problems based on a mapping onto an auxiliary open quantum system of small size. The infinite fermionic reservoirs of the original system are thereby replaced by a small number N B of noninteracting auxiliary bath sites whose dynamics are described by a Lindblad equation, which can then be exactly solved by numerical methods such as Lanczos or matrix-product states. The mapping becomes exponentially exact with increasing N B , and is already quite accurate for small N B . Due to the presence of the intermediate bath sites, the overall dynamics acting on the impurity site is non-Markovian. While in previous work we put the focus on the manybody solution of the associated Lindblad problem, here we discuss the mapping scheme itself, which is an essential part of the overall approach. On the one hand, we provide technical details together with an in-depth discussion of the employed algorithms, and on the other hand, we present a detailed convergence study. The latter clearly demonstrates the above-mentioned exponential convergence of the procedure with increasing N B . Furthermore, the influence of temperature and an external bias voltage on the reservoirs is investigated. The knowledge of the particular convergence behavior is of great value to assess the applicability of the scheme to certain physical situations. Moreover, we study different geometries for the auxiliary system. On the one hand, this is of importance for advanced manybody solution techniques such as matrix product states which work well for short-ranged couplings, and on the other hand, it allows us to gain more insights into the underlying mechanisms when mapping non-Markovian reservoirs onto Lindblad-type impurity problems. Finally, we present results for the spectral function of the Anderson impurity model in and out of equilibrium and discuss the accuracy obtained with the different geometries of the auxiliary system

  13. Non-invasive methods for the determination of body and carcass composition in livestock: dual-energy X-ray absorptiometry, computed tomography, magnetic resonance imaging and ultrasound: invited review.

    Science.gov (United States)

    Scholz, A M; Bünger, L; Kongsro, J; Baulain, U; Mitchell, A D

    2015-07-01

    The ability to accurately measure body or carcass composition is important for performance testing, grading and finally selection or payment of meat-producing animals. Advances especially in non-invasive techniques are mainly based on the development of electronic and computer-driven methods in order to provide objective phenotypic data. The preference for a specific technique depends on the target animal species or carcass, combined with technical and practical aspects such as accuracy, reliability, cost, portability, speed, ease of use, safety and for in vivo measurements the need for fixation or sedation. The techniques rely on specific device-driven signals, which interact with tissues in the body or carcass at the atomic or molecular level, resulting in secondary or attenuated signals detected by the instruments and analyzed quantitatively. The electromagnetic signal produced by the instrument may originate from mechanical energy such as sound waves (ultrasound - US), 'photon' radiation (X-ray-computed tomography - CT, dual-energy X-ray absorptiometry - DXA) or radio frequency waves (magnetic resonance imaging - MRI). The signals detected by the corresponding instruments are processed to measure, for example, tissue depths, areas, volumes or distributions of fat, muscle (water, protein) and partly bone or bone mineral. Among the above techniques, CT is the most accurate one followed by MRI and DXA, whereas US can be used for all sizes of farm animal species even under field conditions. CT, MRI and US can provide volume data, whereas only DXA delivers immediate whole-body composition results without (2D) image manipulation. A combination of simple US and more expensive CT, MRI or DXA might be applied for farm animal selection programs in a stepwise approach.

  14. Folding of the natural hammerhead ribozyme is enhanced by interaction of auxiliary elements

    Science.gov (United States)

    PENEDO, J. CARLOS; WILSON, TIMOTHY J.; JAYASENA, SUMEDHA D.; KHVOROVA, ANASTASIA; LILLEY, DAVID M.J.

    2004-01-01

    It has been shown that the activity of the hammerhead ribozyme at μM magnesium ion concentrations is markedly increased by the inclusion of loops in helices I and II. We have studied the effect of such loops on the magnesium ion-induced folding of the ribozyme, using fluorescence resonance energy transfer. We find that with the loops in place, folding into the active conformation occurs in a single step, in the μM range of magnesium ion concentration. Disruption of the loop–loop interaction leads to a reversion to two-step folding, with the second stage requiring mM concentrations of magnesium ion. Sodium ions also promote the folding of the natural form of the ribozyme at high concentrations, but the folding occurs as a two-stage process. The loops clearly act as important auxiliary elements in the function of the ribozyme, permitting folding to occur efficiently under physiological conditions. PMID:15100442

  15. Development of KALIMER auxiliary sodium and cover gas management system

    International Nuclear Information System (INIS)

    Kwon, Sang Woon; Hwang, Sung Tae

    1996-11-01

    The objectives of this report are to develop and to describe the auxiliary liquid metal and cover gas management systems of KALIMER. the system includes following system: (1) Auxiliary liquid metal system (2) Inert gas receiving and processing system (3) Impurity monitoring and analysis system. Auxiliary liquid metal and cover gas management system of KALIMER was developed. Functions of each systems and design basis were describes. The auxiliary liquid metal system receives, transfers, and purifies all sodium used in the plant. The system furnishes the required sodium quantity at the pressure, temperature, flow rate, and purity specified by the interfacing system. The intermediated sodium processing subsystem (ISPS) provides continuous purification of IHTS sodium, as well as performs the initial fill operation for both the IHTS and reactor vessel. The primary sodium processing subsystem provides purification (cold trapping) for sodium used in the reactor vessel. The inert gas receiving and processing (IGRP) system provides liquefied and ambient gas storage, delivers inert gases of specified composition and purity at regulated flow rates and pressures to points of usage throughout the KALIMER, and accepts the contaminated gases through its vacuum facilities for storage and transfer to the gas radwaste system. Three gases are used in the KALIMER: helium, argon, and nitrogen. 11 tabs., 12 figs. (Author)

  16. Auxiliary services for petrochemistry. Cogeneration, thermocompression, steam distribution networks

    International Nuclear Information System (INIS)

    Vergerio, G.; Bruzzi, V.

    1999-01-01

    The article gives some guidelines for the choice of the most suitable energy vectors distributed in petrochemical plants and refineries for auxiliary services and for processes (mainly distillation). Conclusions are summed up in a diagram showing the most suitable heat sources and sinks for the various temperature ranges [it

  17. Auxiliary controller for time-to-digital converter module readout

    International Nuclear Information System (INIS)

    Ermolin, Yu.V.

    1992-01-01

    The KD-225 auxiliary controller for time-to-digital converter module readout in the SUMMA crate is described. After readout and preliminary processing the data are written in the P-140 buffer memory module. The controller is used in the FODS-2 experimental setup data acquisition system. 12 refs.; 1 fig

  18. Auxiliary equation method for solving nonlinear partial differential equations

    International Nuclear Information System (INIS)

    Sirendaoreji,; Jiong, Sun

    2003-01-01

    By using the solutions of an auxiliary ordinary differential equation, a direct algebraic method is described to construct several kinds of exact travelling wave solutions for some nonlinear partial differential equations. By this method some physically important nonlinear equations are investigated and new exact travelling wave solutions are explicitly obtained with the aid of symbolic computation

  19. 76 FR 22295 - National Poultry Improvement Plan and Auxiliary Provisions

    Science.gov (United States)

    2011-04-21

    ... DEPARTMENT OF AGRICULTURE Animal and Plant Health Inspection 9 CFR Part 145 [Docket No. APHIS-2009-0031] RIN 0579-AD21 National Poultry Improvement Plan and Auxiliary Provisions Correction In rule document 2011-6539 appearing on pages 15791-15798 in the issue of Tuesday, March 22, 2011, make the...

  20. Development of KALIMER auxiliary sodium and cover gas management system

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Sang Woon; Hwang, Sung Tae [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

    1996-11-01

    The objectives of this report are to develop and to describe the auxiliary liquid metal and cover gas management systems of KALIMER. the system includes following system: (1) Auxiliary liquid metal system (2) Inert gas receiving and processing system (3) Impurity monitoring and analysis system. Auxiliary liquid metal and cover gas management system of KALIMER was developed. Functions of each systems and design basis were describes. The auxiliary liquid metal system receives, transfers, and purifies all sodium used in the plant. The system furnishes the required sodium quantity at the pressure, temperature, flow rate, and purity specified by the interfacing system. The intermediated sodium processing subsystem (ISPS) provides continuous purification of IHTS sodium, as well as performs the initial fill operation for both the IHTS and reactor vessel. The primary sodium processing subsystem provides purification (cold trapping) for sodium used in the reactor vessel. The inert gas receiving and processing (IGRP) system provides liquefied and ambient gas storage, delivers inert gases of specified composition and purity at regulated flow rates and pressures to points of usage throughout the KALIMER, and accepts the contaminated gases through its vacuum facilities for storage and transfer to the gas radwaste system. Three gases are used in the KALIMER: helium, argon, and nitrogen. 11 tabs., 12 figs. (Author).

  1. Auxiliary basis expansions for large-scale electronic structure calculations.

    Science.gov (United States)

    Jung, Yousung; Sodt, Alex; Gill, Peter M W; Head-Gordon, Martin

    2005-05-10

    One way to reduce the computational cost of electronic structure calculations is to use auxiliary basis expansions to approximate four-center integrals in terms of two- and three-center integrals, usually by using the variationally optimum Coulomb metric to determine the expansion coefficients. However, the long-range decay behavior of the auxiliary basis expansion coefficients has not been characterized. We find that this decay can be surprisingly slow. Numerical experiments on linear alkanes and a toy model both show that the decay can be as slow as 1/r in the distance between the auxiliary function and the fitted charge distribution. The Coulomb metric fitting equations also involve divergent matrix elements for extended systems treated with periodic boundary conditions. An attenuated Coulomb metric that is short-range can eliminate these oddities without substantially degrading calculated relative energies. The sparsity of the fit coefficients is assessed on simple hydrocarbon molecules and shows quite early onset of linear growth in the number of significant coefficients with system size using the attenuated Coulomb metric. Hence it is possible to design linear scaling auxiliary basis methods without additional approximations to treat large systems.

  2. Specific features of auxiliary water supply at underground NPPs

    International Nuclear Information System (INIS)

    Pergamenshchik, B.K.; Pavlov, A.S.

    1991-01-01

    Specific features of auxiliary water supply systems for underground NPPs related to peculiarities of NPP basis equipment arrangement, are considered. Circulation water supply scheme, in which water cooling storage basin (cooling towers) with operational area corresponding to NPP power is on the surface and has traditional design, is proposed. Sufficiently high efficiency of the arrangement proposed is proved

  3. Verb and auxiliary movement in agrammatic Broca's aphasia

    NARCIS (Netherlands)

    Bastiaanse, Y.R.M.; Thompson, C.K.

    Verb production in agrammatic Broca's aphasia has repeatedly been shown to be impaired by a number of investigators. Not only is the number of verbs produced often significantly reduced, but verb inflections and auxiliaries are often omitted as well (e.g., Bastiaanse, Jonkers, & Moltmaker-Osinga,

  4. PWR auxiliary systems, safety and emergency systems, accident analysis, operation

    International Nuclear Information System (INIS)

    Meyer, P.J.

    1976-01-01

    The author presents a description of PWR auxiliary systems like volume control, boric acid control, coolant purification, -degassing, -storage and -treatment system and waste processing systems. Residual heat removal systems, emergency systems and containment designs are discussed. As an accident analysis the author gives a survey over malfunctions and disturbances in the field of reactor operations. (TK) [de

  5. Dual Entwining Structures and Dual Entwined Modules

    OpenAIRE

    Abuhlail, Jawad Y.

    2003-01-01

    In this note we introduce and investigate the concepts of dual entwining structures and dual entwined modules. This generalizes the concepts of dual Doi-Koppinen structures and dual Doi-Koppinen modules introduced (in the infinite case over rings) by the author is his dissertation.

  6. Development of 8 MW Power Supply Based on Pulse Step Modulation Technique for Auxiliary Heating System on HL-2A

    International Nuclear Information System (INIS)

    Xu Weidong; Xuan Weimin; Yao Lieying; Wang Yingqiao

    2012-01-01

    The high voltage power supply (HVPS) based on pulse step modulation (PSM) has already been developed for the auxiliary heating system on HL-2A. This power supply consists of many switch power supplies, and its output voltage can be obtained by modulating their delay time and pulse widths. The PSM topology and control principle are presented in this paper. The simple algorithms for the control system are explained clearly. The switch power supply (SPS) module has been built and the test results show it can meet the requirements of the auxiliary heating system. Now, 112 SPS modules and the whole system have already been developed. Its maximum output is about 72 kV/93 A. The protection time is less than 5 μs. The different outputs of this power supply are used for the electron cyclotron resonant heating (ECRH) system with different duty ratios. The experimental results of the entire system are presented. The results indicate that the whole system can meet the requirements of the auxiliary heating system on HL-2A.

  7. [Dual pathology].

    Science.gov (United States)

    Rougier, A

    2008-05-01

    Dual pathology is defined as the association of two potentially epileptogenic lesions, hippocampal (sclerosis, neuronal loss) and extrahippocampal (temporal or extratemporal). Epileptic activity may be generated by either lesion and the relative importance of every lesion's epileptogenicity conditions the surgical strategy adopted. Most frequently associated with hippocampal sclerosis are cortical dysplasias. The common physiopathology of the two lesions is not clearly established. Extrahippocampal lesions may be undetectable on MRI (microdysgenesis, for example) and ictal discharge patterns may vary among dual pathology patients. The surgical strategy depends on the location of the extrahippocampal lesion and its relative role in seizure generation; however, reported surgical results suggest that simultaneous resection of mesial temporal structures along with the extrahippocampal lesion should be performed.

  8. An Analytical Method of Auxiliary Sources Solution for Plane Wave Scattering by Impedance Cylinders

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2004-01-01

    Analytical Method of Auxiliary Sources solutions for plane wave scattering by circular impedance cylinders are derived by transformation of the exact eigenfunction series solutions employing the Hankel function wave transformation. The analytical Method of Auxiliary Sources solution thus obtained...

  9. Minimal set of auxiliary fields and S-matrix for extended supergravity

    Energy Technology Data Exchange (ETDEWEB)

    Fradkin, E S; Vasiliev, M A [Physical Lebedev Institute - Moscow

    1979-05-19

    Minimal set of auxiliary fields for linearized SO(2) supergravity and one-parameter extension of the minimal auxiliary fields in the SO(1) supergravity are constructed. The expression for the S-matrix in SO(2) supergravity are given.

  10. 47 CFR 74.601 - Classes of TV broadcast auxiliary stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Classes of TV broadcast auxiliary stations. 74... Television Broadcast Auxiliary Stations § 74.601 Classes of TV broadcast auxiliary stations. (a) TV pickup stations. A land mobile station used for the transmission of TV program material and related communications...

  11. BE, DO, and Modal Auxiliaries of 3-Year-Old African American English Speakers

    Science.gov (United States)

    Newkirk-Turner, Brandi L.; Oetting, Janna B.; Stockman, Ida J.

    2014-01-01

    Purpose: This study examined African American English--speaking children's use of BE, DO, and modal auxiliaries. Method: The data were based on language samples obtained from 48 three-year-olds. Analyses examined rates of marking by auxiliary type, auxiliary surface form, succeeding element, and syntactic construction and by a number of child…

  12. 30 CFR 57.22209 - Auxiliary fans (I-C mines).

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-C mines). 57.22209 Section 57... Standards for Methane in Metal and Nonmetal Mines Ventilation § 57.22209 Auxiliary fans (I-C mines). Electric auxiliary fans shall be approved by MSHA under the applicable requirements of 30 CFR part 18...

  13. 30 CFR 57.8534 - Shutdown or failure of auxiliary fans.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Shutdown or failure of auxiliary fans. 57.8534... Ventilation Underground Only § 57.8534 Shutdown or failure of auxiliary fans. (a) Auxiliary fans installed and... fan maintenance or fan adjustments where air quality is maintained in compliance with the applicable...

  14. Versatile Auxiliary Orthodontic Spring for Orthodontic Correction of Impacted Teeth

    Directory of Open Access Journals (Sweden)

    Pavankumar Janardan Vibhute

    2011-01-01

    Full Text Available Malocclusion such as impacted tooth is not uncommon. Many approaches with various auxiliary springs have been reported in literature till date for correction of such malocclusions. They had biomechanical, retentive and stability drawbacks inherent in their designs. This article presents the innovative approach for orthodontic correction of impacted tooth, especially with light force appliance, i.e. Begg′s appliance, where round wires in round molar tubes are used throughout treatment. A versatile auxiliary orthodontic spring (VAOS is fabricated in the 0.018 inch Australian stainless steel round wire, which may be anchored on round molar buccal tube, and desirable force vector may be applied in any of the three dimensions. Fabrication and its clinical application are discussed.

  15. Cooling system for auxiliary systems of a nuclear power plant

    International Nuclear Information System (INIS)

    Maerker, W.; Mueller, K.; Roller, W.

    1981-01-01

    From the reactor auxiliary and ancillary systems of a nuclear facility heat has to be removed without the hazard arising that radioactive liquids or gases may escape from the safe area of the nuclear facility. A cooling system is described allowing at every moment to make available cooling fluid at a temperature sufficiently low for heat exchangers to be able to remove the heat from such auxiliary systems without needing fresh water supply or water reservoirs. For this purpose a dry cooling tower is connected in series with a heat exchanger that is cooled on the secondary side by means of a refrigerating machine. The cooling pipes are filled with a nonfreezable fluid. By means of a bypass a minimum temperature is guaranteed at cold weather. (orig.) [de

  16. Vanishing auxiliary variables in PPS sampling - with applications in microscopy

    DEFF Research Database (Denmark)

    Andersen, Ina Trolle; Hahn, Ute; Jensen, Eva B. Vedel

    Recently, non-uniform sampling has been suggested in microscopy to increase efficiency. More precisely, sampling proportional to size (PPS) has been introduced where the probability of sampling a unit in the population is proportional to the value of an auxiliary variable. Unfortunately, vanishing...... auxiliary variables are a common phenomenon in microscopy and, accordingly, part of the population is not accessible, using PPS sampling. We propose a modification of the design, for which an optimal solution can be found, using a model assisted approach. The optimal design has independent interest...... in sampling theory. We verify robustness of the new approach by numerical results, and we use real data to illustrate the applicability....

  17. Renormalization of supersymmetric models without using auxiliary fields

    International Nuclear Information System (INIS)

    Urbanek, P.

    1986-01-01

    Previously a linear representation of supersymmetry (Ss) was used in investigations of renormalizability. There auxiliary fields have been introduced in order that the Ss-algebra closes 'off-shell'. When the auxiliary fields are eliminated by their equations of motion, the Ss representation becomes nonlinear and Ss closes only 'on-shell'. Following O.Piguet and K.Sibold 1984 Ss is expressed through Ward identities which are formulated as functional variations of the generating functional of the Green functions. These functional operators form a closed algebra, a fact essential for the proof of renormalizability, which is given. It is not necessary to use a specific subtraction scheme in the Green functions. The procedure is applied to the Wess-Zumino model and the supersymmetric extension of the quantum electrodynamics. 15 refs. (qui)

  18. Aging assessment of PWR [Pressurized Water Reactor] Auxiliary Feedwater Systems

    International Nuclear Information System (INIS)

    Casada, D.A.

    1988-01-01

    In support of the Nuclear Regulatory Commission's Nuclear Plant Aging Research (NPAR) Program, Oak Ridge National Laboratory is conducting a review of Pressurized Water Reactor Auxiliary Feedwater Systems. Two of the objectives of the NPAR Program are to identify failure modes and causes and identify methods to detect and track degradation. In Phase I of the Auxiliary Feedwater System study, a detailed review of system design and operating and surveillance practices at a reference plant is being conducted to determine failure modes and to provide an indication of the ability of current monitoring methods to detect system degradation. The extent to which current practices are contributing to aging and service wear related degradation is also being assessed. This paper provides a description of the study approach, examples of results, and some interim observations and conclusions. 1 fig., 1 tab

  19. Component Data Base for Space Station Resistojet Auxiliary Propulsion

    Science.gov (United States)

    Bader, Clayton H.

    1988-01-01

    The resistojet was baselined for Space Station auxiliary propulsion because of its operational versatility, efficiency, and durability. This report was conceived as a guide to designers and planners of the Space Station auxiliary propulsion system. It is directed to the low thrust resistojet concept, though it should have application to other station concepts or systems such as the Environmental Control and Life Support System (ECLSS), Manufacturing and Technology Laboratory (MTL), and the Waste Fluid Management System (WFMS). The information will likely be quite useful in the same capacity for other non-Space Station systems including satellite, freeflyers, explorers, and maneuvering vehicles. The report is a catalog of the most useful information for the most significant feed system components and is organized for the greatest convenience of the user.

  20. Auxiliary representations of Lie algebras and the BRST constructions

    International Nuclear Information System (INIS)

    Burdik, C.; Pashnev, A.I.; Tsulaya, M.M.

    2000-01-01

    The method of construction of auxiliary representations for a given Lie algebra is discussed in the framework of the BRST approach. The corresponding BRST charge turns out to be nonhermitian. This problem is solved by the introduction of the additional kernel operator in the definition of the scalar product in the Fock space. The existence of the kernel operator is proved for any Lie algebra

  1. Surgical nurse: his leadership style with nursing auxiliary personnel

    OpenAIRE

    Galvão, Cristina Maria; Trevizan, Maria Auxiliadora; Okino Sawada, Namie

    2008-01-01

    This investigation as carried out in order to promote follow-up in the studies concerning nurse`s leadership in the hospital context. Emphasys is given to the nurses that works in surgical ward unities. As a theoretical framework, authors utilized the model of leadership proposed by Hersey na Blanchard, named Situational Leadership. The objective was to analyze the correspondence of opinion between nurses and nursing auxiliary personnel about the leadership style of nurse should adopt in acco...

  2. Restarting Automata with Auxiliary Symbols and Small Lookahead

    DEFF Research Database (Denmark)

    Schluter, Natalie Elaine

    2012-01-01

    We present a study on lookahead hierarchies for restarting automata with auxiliary symbols and small lookahead. In particular, we show that there are just two different classes of languages recognised by RRWW automata, through the restriction of lookahead size. We also show that the respective...... (left-) monotone restarting automaton models characterise the context-free languages and that the respective right-left-monotone restarting automata characterise the linear languages both with just lookahead length 2....

  3. Tube Model Predictive Control with an Auxiliary Sliding Mode Controller

    Directory of Open Access Journals (Sweden)

    Miodrag Spasic

    2016-07-01

    Full Text Available This paper studies Tube Model Predictive Control (MPC with a Sliding Mode Controller (SMC as an auxiliary controller. It is shown how to calculate the tube widths under SMC control, and thus how much the constraints of the nominal MPC have to be tightened in order to achieve robust stability and constraint fulfillment. The analysis avoids the assumption of infinitely fast switching in the SMC controller.

  4. Exact fluctuations of nonequilibrium steady states from approximate auxiliary dynamics

    OpenAIRE

    Ray, Ushnish; Chan, Garnet Kin-Lic; Limmer, David T.

    2017-01-01

    We describe a framework to significantly reduce the computational effort to evaluate large deviation functions of time integrated observables within nonequilibrium steady states. We do this by incorporating an auxiliary dynamics into trajectory based Monte Carlo calculations, through a transformation of the system's propagator using an approximate guiding function. This procedure importance samples the trajectories that most contribute to the large deviation function, mitigating the exponenti...

  5. Bayesian Analysis of Geostatistical Models With an Auxiliary Lattice

    KAUST Repository

    Park, Jincheol

    2012-04-01

    The Gaussian geostatistical model has been widely used for modeling spatial data. However, this model suffers from a severe difficulty in computation: it requires users to invert a large covariance matrix. This is infeasible when the number of observations is large. In this article, we propose an auxiliary lattice-based approach for tackling this difficulty. By introducing an auxiliary lattice to the space of observations and defining a Gaussian Markov random field on the auxiliary lattice, our model completely avoids the requirement of matrix inversion. It is remarkable that the computational complexity of our method is only O(n), where n is the number of observations. Hence, our method can be applied to very large datasets with reasonable computational (CPU) times. The numerical results indicate that our model can approximate Gaussian random fields very well in terms of predictions, even for those with long correlation lengths. For real data examples, our model can generally outperform conventional Gaussian random field models in both prediction errors and CPU times. Supplemental materials for the article are available online. © 2012 American Statistical Association, Institute of Mathematical Statistics, and Interface Foundation of North America.

  6. Auxiliary/Master microprocessor CAMAC Crate Controller applications

    International Nuclear Information System (INIS)

    Barsotti, E.

    1975-01-01

    The need for further sophistication of an already complex serial CAMAC control system at Fermilab led to the development of an Auxilary/Master CAMAC Crate Controller. The controller contains a Motorola 6800 microprocessor, 2K bytes of RAM, and 8K bytes of PROM memory. Bussed dataway lines are time shared with CAMAC signals to provide memory expansion and direct addressing of peripheral devices without the need of external cabling. The Auxiliary/Master Crate Controller (A/MCC) can function as either a Master, i.e., stand alone, crate controller or as an Auxiliary controller to Fermilab's Serial Crate Controller (SCC). Two modules, one single- and one double-width, make up an A/MCC. The microprocessor has one nonmaskable and one maskable vectored interrupt. Time sharing the dataway between SCC programmed and block transfer generated dataway cycles and A/MCC operations still allows a 99 percent microprocessor CPU busy time. Since the conception of the A/MCC, there has been an increasing number of control system-related projects proposed which would not have been possible or would have been very difficult to implement without such a device. The first such application now in use at Fermilab is a stand-alone control system for a mass spectrometer experiment in the Main Ring Internal Target Area. This application in addition to other proposed A/MCC applications, both stand-alone and auxiliary, is discussed

  7. Generating Selected Color using RGB, Auxiliary Lights, and Simplex Search

    Directory of Open Access Journals (Sweden)

    Kim HyungTae

    2015-01-01

    Full Text Available A mixed light source generates various colors, with the potential to adjust intensities of multiple LEDs, which makes it possible to generate arbitrary colors. Currently, PCs and OSs provide color selection windows that can obtain the RGB or HSL color coordinates of a user’s selection. Mixed light sources are usually composed of LEDs in the primary colors, with LEDs in auxiliary colors such as white and yellow used in a few cases. When using auxiliary color LEDs, the number of LED inputs, the dimming levels, is larger than the number of elements in the color coordinate, which causes an under-determined problem. This study proposed how to determine the dimming levels of LEDs based on the selected color. Commercial LEDs have di_erent optical power values and impure color coordinates, even if they are RGB. Hence, the characteristics of the LEDs were described using a linear model derived from the tri-stimulus values (an XYZ color coordinate model and dimming levels. Color mixing models were derived for the arbitrary number of auxiliary color LEDs. The under-determined problem was solved using a simplex search method without an inverse matrix operation. The proposed method can be applied to a machine vision system and an RGBW light mixer for semiconductor inspection. The dimming levels, obtained using the proposed method were better than derived using other methods.

  8. Neoclassical offset toroidal velocity and auxiliary ion heating in tokamaks

    Energy Technology Data Exchange (ETDEWEB)

    Lazzaro, E., E-mail: lazzaro@ifp.cnr.it [Istituto di Fisica del Plasma CNR (Italy)

    2016-05-15

    In conditions of ideal axisymmetry, for a magnetized plasma in a generic bounded domain, necessarily toroidal, the uniform absorption of external energy (e.g., RF or any isotropic auxiliary heating) cannot give rise to net forces or torques. Experimental evidence on contemporary tokamaks shows that the near central absorption of RF heating power (ICH and ECH) and current drive in presence of MHD activity drives a bulk plasma rotation in the co-I{sub p} direction, opposite to the initial one. Also the appearance of classical or neoclassical tearing modes provides a nonlinear magnetic braking that tends to clamp the rotation profile at the q-rational surfaces. The physical origin of the torque associated with P{sub RF} absorption could be due the effects of asymmetry in the equilibrium configuration or in power deposition, but here we point out also an effect of the response of the so-called neoclassical offset velocity to the power dependent heat flow increment. The neoclassical toroidal viscosity due to internal magnetic kink or tearing modes tends to relax the plasma rotation to this asymptotic speed, which in absence of auxiliary heating is of the order of the ion diamagnetic velocity. It can be shown by kinetic and fluid calculations, that the absorption of auxiliary power by ions modifies this offset proportionally to the injected power thereby forcing the plasma rotation in a direction opposite to the initial, to large values. The problem is discussed in the frame of the theoretical models of neoclassical toroidal viscosity.

  9. ADAPTIVE SELECTION OF AUXILIARY OBJECTIVES IN MULTIOBJECTIVE EVOLUTIONARY ALGORITHMS

    Directory of Open Access Journals (Sweden)

    I. A. Petrova

    2016-05-01

    Full Text Available Subject of Research.We propose to modify the EA+RL method, which increases efficiency of evolutionary algorithms by means of auxiliary objectives. The proposed modification is compared to the existing objective selection methods on the example of travelling salesman problem. Method. In the EA+RL method a reinforcement learning algorithm is used to select an objective – the target objective or one of the auxiliary objectives – at each iteration of the single-objective evolutionary algorithm.The proposed modification of the EA+RL method adopts this approach for the usage with a multiobjective evolutionary algorithm. As opposed to theEA+RL method, in this modification one of the auxiliary objectives is selected by reinforcement learning and optimized together with the target objective at each step of the multiobjective evolutionary algorithm. Main Results.The proposed modification of the EA+RL method was compared to the existing objective selection methods on the example of travelling salesman problem. In the EA+RL method and its proposed modification reinforcement learning algorithms for stationary and non-stationary environment were used. The proposed modification of the EA+RL method applied with reinforcement learning for non-stationary environment outperformed the considered objective selection algorithms on the most problem instances. Practical Significance. The proposed approach increases efficiency of evolutionary algorithms, which may be used for solving discrete NP-hard optimization problems. They are, in particular, combinatorial path search problems and scheduling problems.

  10. Dual Diagnosis - Multiple Languages

    Science.gov (United States)

    ... National Library of Medicine Comorbidity or dual diagnosis - Opioid addiction, part 9 - English PDF Comorbidity or dual diagnosis - Opioid addiction, part 9 - español (Spanish) PDF Comorbidity or dual ...

  11. Moment approach to neoclassical flows, currents and transport in auxiliary heated tokamaks

    International Nuclear Information System (INIS)

    Kim, Yil Bong.

    1988-02-01

    The moment approach is utilized to derive the full complement of neoclassical transport processes in auxiliary heated tokamaks. The effects of auxiliary heating [neutral beam injection (NBI) and ion cyclotron resonance heating (ICRH)] considered arise from the collisional interaction between the background plasma species and the fast-ion-tail species. From a known fast ion distribution function we evaluate the parallel (to the magnetic field) momentum and heat flow inputs to the background plasma. Then, through the momentum and heat flow balance equations, we can determine the induced parallel flows (and current) and radial transpot fluxes in ''equilibrium'' (on the time scale much longer than the collisional relaxation time, i.e., t >> 1ν/sub ii/). In addition to the fast-ion-induced current, the total neoclassical current includes the boostap current, which is driven by the pressure and temperature gradients, the Pfirsch-Schlueter current which is required for charge neutrality, and the neoclassical (including trapped particle effects) Spitzer current due to the parallel electric field. The radial transport fluxes also include off-diagonal compnents in the transport matrix which correspond to the Ware (neoclassical) pinch due to the inductive applied electric field an the fast-ion-induced radial fluxes, in addition to the usual pressure- and temperature-gradient-driven fluxes (particle diffusion and heat conduction). Once the tranport coefficient are completely determined, the radial fluxes and the heat fluxes can be substituted into the density and energy evolution equations to provide a complete description of ''equilibrium'' (δδt << ν/sub ii/) neoclassical transport processes in a plasma. 47 refs., 14 figs

  12. Some properties of dual and approximate dual of fusion frames

    OpenAIRE

    Arefijamaal, Ali Akbar; Neyshaburi, Fahimeh Arabyani

    2016-01-01

    In this paper we extend the notion of approximate dual to fusion frames and present some approaches to obtain dual and approximate alternate dual fusion frames. Also, we study the stability of dual and approximate alternate dual fusion frames.

  13. S-matrix for the theories that admit closure of the algebra with the aid of auxiliary fields. Auxiliary fields in supergravity. [Word identities

    Energy Technology Data Exchange (ETDEWEB)

    Fradkin, E S; Vasiliev, M A [AN SSSR, Moscow. Fizicheskij Inst.

    1978-08-19

    A minimal set of auxiliary fields (scalarpseudoscalar and pseudovector) providing the closed algebra in supergravity is constructed. A compact scheme for the generating functional with closed gauge algebra is proposed. The S-matrix and the Ward identities for arbitrary theory that admits the closing of the algebra by introducing auxiliary fields is obtained.

  14. Seismic Qualification of Auxiliary Feed Water Control Valve

    International Nuclear Information System (INIS)

    Hwang, K. M.; Jang, J. B.; Kim, J. K.; Suh, Y. P.

    2006-01-01

    Although domestic nuclear power industry has almost accomplished technical independence, Auxiliary Feed Water Control Valve (AFWCV) is still depending on import. In order to jump to advanced nation in nuclear power industry, it is very important to achieve technical independence in designing and manufacturing AFWCV. At last, AFWCV is self-manufactured using the domestic technology under the financial support of the government. Therefore, the seismic qualification is carried out to verify the safety and operability of AFWCV against the earthquake in this study

  15. Sampling general N-body interactions with auxiliary fields

    Science.gov (United States)

    Körber, C.; Berkowitz, E.; Luu, T.

    2017-09-01

    We present a general auxiliary field transformation which generates effective interactions containing all possible N-body contact terms. The strength of the induced terms can analytically be described in terms of general coefficients associated with the transformation and thus are controllable. This transformation provides a novel way for sampling 3- and 4-body (and higher) contact interactions non-perturbatively in lattice quantum Monte Carlo simulations. As a proof of principle, we show that our method reproduces the exact solution for a two-site quantum mechanical problem.

  16. Nuclear Reactor RA Safety Report, Vol. 8, Auxiliary system

    International Nuclear Information System (INIS)

    1986-11-01

    This volume describes RA reactor auxiliary systems, as follows: special ventilation system, special drainage system, hot cells, systems for internal transport. Ventilation system is considered as part of the reactor safety and protection system. Its role is eliminate possible radioactive particles dispersion in the environment. Special drainage system includes pipes and reservoirs with the safety role, meaning absorption or storage of possible radioactive waste water from the reactor building. Hot cells existing in the RA reactor building are designed for production of sealed radioactive sources, including packaging and transport [sr

  17. Sandia Laboratories technical capabilities. Auxiliary capabilities: environmental health information science

    International Nuclear Information System (INIS)

    1975-09-01

    Sandia Laboratories is an engineering laboratory in which research, development, testing, and evaluation capabilities are integrated by program management for the generation of advanced designs. In fulfilling its primary responsibility to ERDA, Sandia Laboratories has acquired extensive research and development capabilities. The purpose of this series of documents is to catalog the many technical capabilities of the Laboratories. After the listing of capabilities, supporting information is provided in the form of highlights, which show applications. This document deals with auxiliary capabilities, in particular, environmental health and information science. (11 figures, 1 table) (RWR)

  18. Electromagnetic Form Factors of Hadrons in Dual-Large Nc QCD

    International Nuclear Information System (INIS)

    Dominguez, C. A.

    2011-01-01

    In this talk, results are presented of determinations of electromagnetic form factors of hadrons (pion, proton, and Δ(1236)) in the framework of Dual-Large N c QCD (Dual-QCD ∞ ). This framework improves considerably tree-level VMD results by incorporating an infinite number of zero-width resonances, with masses and couplings fixed by the dual-resonance (Veneziano-type) model.

  19. Vacuum transitions in dual models

    International Nuclear Information System (INIS)

    Pashnev, A.I.; Volkov, D.V.; Zheltukhin, A.A.

    1976-01-01

    The investigation is continued of the spontaneous vacuum transition problem in the Neview-Schwartz dual model (NSDM). It is shown that vacuum transitions allow disclosing of supplementary degeneration in the resonance state spectrum. The dual amplitudes possess an internal structure corresponding to the presence of an infinite number of quarks with increasing masses and retained charges. The Adler principle holds. Analytic continuation on the constant of induced vacuum transitions makes it possible to establish the existence of spontaneous vacuum transitions in the NSDM. The consequence of this fact is the exact SU(2) symmetry of π, rho meson trajectories and the Higgs mechanism in the model. In this case the ratios of masses of particles leading trajectories are analogous to those obtained in the current algebra. It is shown that in the NSDM there arises chiral SU(2) x SU(2) x U(1) x U(1) x ... symmetry resulting from spontaneous vacuum transitions

  20. Aging and low-flow degradation of auxiliary feedwater pumps

    International Nuclear Information System (INIS)

    Adams, M.L.

    1991-01-01

    This paper documents the results of research done under the auspices of the Nuclear Regulatory Commission Nuclear Plant Aging Research Program. It examines the degradation imparted to safety Auxiliary Feedwater System pumps at nuclear plants due to the low flow operation. The Auxiliary Feedwater (AFW) System is normally a stand-by system. As such it is operated most often in the test mode. Since few plants are equipped with full flow test loops, most testing is accomplished at minimum flow conditions in pump by-pass lines. It is the vibration and hydraulic forces generated at low flow conditions that have been shown to be the major causes of AFW pump aging and degradation. The wear can be manifested in a number of ways, such as impeller or diffuser breakage, thrust bearing and/or balance device failure due to excessive loading, cavitation damage on such stage impellers, increase seal leakage or failure, sear injection piping failure, shaft or coupling breakage, and rotating element seizure

  1. On the Auxiliary Status of Dare in Old English

    Directory of Open Access Journals (Sweden)

    Tomaszewska Magdalena

    2014-12-01

    Full Text Available OE *durran ‘dare’ belongs to a group of the so-called preterite-present verbs which developed weak past tense forms replacing the originally strong forms throughout the paradigm. The present study hypothesizes that the potential sources of this development are related to the decay of the subjunctive mood in Old English. Further, this corpus-based study analyses the status of DARE in Old English, with the findings showing that the verb displayed both lexical and auxiliary verb characteristics. These results are juxtaposed and compared with the verb's developments in Middle English. The databases examined are the corpus of The Dictionary of Old English in Electronic Form (A-G and the Innsbruck Computer Archive of Machine-Readable English Texts. In both cases, a search of potential forms was performed on all the files of the corpora, the raw results were then analysed in order to eliminate irrelevant instances (adjectives, nouns, foreign words, etc.. The relevant forms were examined with the aim to check the properties of DARE as a lexical and an auxiliary verb, and compare the findings with Molencki’s (2002, 2005 observations.

  2. Ignition and burn propagation with suprathermal electron auxiliary heating

    International Nuclear Information System (INIS)

    Han Shensheng; Wu Yanqing

    2000-01-01

    The rapid development in ultrahigh-intensity lasers has allowed the exploration of applying an auxiliary heating technique in inertial confinement fusion (ICF) research. It is hoped that, compared with the 'standard fast ignition' scheme, raising the temperature of a hot-spot over the ignition threshold based on the shock-heated temperature will greatly reduce the required output energy of an ignition ultrahigh-intensity pulse. One of the key issues in ICF auxiliary heating is: how can we transport the exogenous energy efficiently into the hot-spot of compressed DT fuel? A scheme is proposed with three phases. First, a partial-spherical-shell capsule, such as double-conical target, is imploded as in the conventional approach to inertial fusion to assemble a high-density fuel configuration with a hot-spot of temperature lower than the ignition threshold. Second, a hole is bored through the shell outside the hot-spot by suprathermal electron explosion boring. Finally, the fuel is ignited by suprathermal electrons produced in the high-intensity ignition laser-plasma interactions. Calculations with a simple hybrid model show that the new scheme can possibly lead to ignition and burn propagation with a total drive energy of a few tens of kilojoules and an output energy as low as hundreds of joules for a single ignition ultrahigh-intensity pulse. (author)

  3. VLTI auxiliary telescopes: a full object-oriented approach

    Science.gov (United States)

    Chiozzi, Gianluca; Duhoux, Philippe; Karban, Robert

    2000-06-01

    The Very Large Telescope (VLT) Telescope Control Software (TCS) is a portable system. It is now in use or will be used in a whole family of ESO telescopes VLT Unit Telescopes, VLTI Auxiliary Telescopes, NTT, La Silla 3.6, VLT Survey Telescope and Astronomical Site Monitors in Paranal and La Silla). Although it has been developed making extensive usage of Object Oriented (OO) methodologies, the overall development process chosen at the beginning of the project used traditional methods. In order to warranty a longer lifetime to the system (improving documentation and maintainability) and to prepare for future projects, we have introduced a full OO process. We have taken as a basis the United Software Development Process with the Unified Modeling Language (UML) and we have adapted the process to our specific needs. This paper describes how the process has been applied to the VLTI Auxiliary Telescopes Control Software (ATCS). The ATCS is based on the portable VLT TCS, but some subsystems are new or have specific characteristics. The complete process has been applied to the new subsystems, while reused code has been integrated in the UML models. We have used the ATCS on one side to tune the process and train the team members and on the other side to provide a UML and WWW based documentation for the portable VLT TCS.

  4. Dynamic analysis of auxiliary buildings in nuclear power plants

    International Nuclear Information System (INIS)

    Subramanian, K.V.; Madhava Rao, A.S.; Warudkar, A.S.

    1989-01-01

    All nuclear power plants have a large number of auxiliary buildings housing various services and control systems required for the operation of the plant. Illustrative examples are turbine building, control building, service building etc. These buildings are seismically qualified as Class I or Class II structures. Usually, these auxiliary buildings are of low rise type with two or three floors and floor heights varying from five to eight meters and of framed construction in steel or concrete or a combination of both the materials. The floors are usually staggered with large cutouts and may not extend over the full area in plan. Some of the bays are often of double story height with the columns continuous over a story in order to accommodate cranes and other equipment. The structural elements supporting the roof may consist of steel roof trusses instead of beams. The seismic analysis of these structures involves the formulation of the analytical model that can simulate the physical behavior of the structure as close as possible taking into consideration the practical aspects. The criteria adopted to formulate the mathematical model has an important bearing on the evaluated dynamic characteristics and seismic response

  5. Inundation Mapping for Heterogeneous Land Covers with Synthetic Aperture Radar and Auxiliary Data

    Science.gov (United States)

    Aristizabal, F.; Judge, J.

    2017-12-01

    Synthetic Aperture Radar (SAR) has been widely used to detect surface water inundation and provides an advantage over multi-spectral instruments due to cloud penetration and higher spatial resolutions. However, detecting inundation for densely vegetated and urban areas with SAR remains a challenge due to corner reflection and diffuse scattering. Additionally, flat urban surfaces such as roads exhibit similar backscatter coefficients as urban surface water. Differences between inundated and non-inundated backscatter over vegetated land covers of static spatial domains have been demonstrated in previous studies. However, these backscatter differences are sensitive to changes in water depth, soil moisture, SAR sensor parameters, terrain, and vegetation properties. These factors tend to make accurate inundation mapping of heterogeneous regions across varying spatial and temporal extents difficult with exclusive use of SAR. This study investigates the utility of auxiliary data specifically high-resolution (10m) terrain information in conjunction with SAR (10m) for detecting inundated areas. Digital elevation models provide an absolute elevation which could enhance inundation mapping given a limited study extent with similar topography. To counter this limitation, a hydrologically relevant terrain index is proposed known as the Height Above Nearest Drainage (HAND) which normalizes topography to the local relative elevation of the nearest point along the relevant drainage line. HAND has been used for assisting remote sensing inundation mapping in the pre-processing stage as a terrain correction tool and as a post-processing mask that eliminates areas of low inundation risk. While the latter technique is useful for reduction of commission errors, it does not employ HAND for reducing omission errors that can occur from dense vegetation, spectral noise, and urban features. Sentinel-1 dual-pol SAR as well as auxiliary HAND will be used as predictors by various supervised and

  6. Stereoselective conjugate radical additions: application of a fluorous oxazolidinone chiral auxiliary for efficient tin removal.

    Science.gov (United States)

    Hein, Jason E; Zimmerman, Jake; Sibi, Mukund P; Hultin, Philip G

    2005-06-23

    [reaction: see text] A series of asymmetric free-radical-mediated intermolecular conjugate additions using a fluorous oxazolidinone chiral auxiliary has been completed. The fluorous auxiliary facilitated product isolation using fluorous solid phase extractions (FSPE), effectively removing excess organic and organometallic reagents. Parallel reactions carried out with a similar but nonfluorous norephedrine-derived oxazolidinone demonstrated the superior stereoselectivity and purification obtainable with the fluorous chiral auxiliary.

  7. Energy confinement scaling in tokamaks: some implications of recent experiments with ohmic and strong auxiliary heating

    International Nuclear Information System (INIS)

    Goldston, R.J.

    1984-02-01

    Recent results from confinement scaling experiments on tokamaks with ohmic and strong auxiliary heating are reviewed. An attempt is made to draw these results together into a low-density ohmic confinement scaling law, and a scaling law for confinement with auxiliary heating. The auxiliary heating confinement law may also serve to explain the saturation in tau/sub E/ vs anti n/sub e/ observed in some ohmic heating density scaling experiments

  8. Entanglement Capacity of Two-Qubit Unitary Operator with the Help of Auxiliary System

    International Nuclear Information System (INIS)

    Hu Baolin; Di Yaomin

    2007-01-01

    The entanglement capacity of general two-qubit unitary operators is studied when auxiliary systems are allowed, and the analytical results based on linear entropy when input states are disentangled are given. From the results the condition for perfect entangler, α 1 = α 2 = π/4, is obtained. Contrary to the case without auxiliary system, the parameter α 3 may play active role to the entanglement capacity when auxiliary systems are allowed.

  9. The relationship among the solutions of two auxiliary ordinary differential equations

    International Nuclear Information System (INIS)

    Liu Xiaoping; Liu Chunping

    2009-01-01

    In a recent article [Phys. Lett. A 356 (2006) 124], Sirendaoreji extended their auxiliary equation method by introducing a new auxiliary ordinary differential equation (NAODE) and its 14 solutions. Then the author studied some nonlinear evolution equations (NLEEs) and got more exact travelling wave solutions. In this paper, we will show that the 14 solutions of the NAODE are actually the same as the solutions obtained by original auxiliary equation method, and they are only different in the form.

  10. The Future Mission Tasking and Resourcing of the U.S. Coast Guard Auxiliary

    Science.gov (United States)

    2012-09-01

    the years. Therefore, this study cannot present what the demographic makeup of the Auxiliary was at any past point, and cannot identify if there were...Auxiliary, and the Nation’s projected demographic composition. The demographic makeup of the country, the country’s future volunteers, is changing...command in the spring of 2010.104 This one-page document broad- brushes three prioritized overarching Auxiliary missions: 1) to promote and improve

  11. Experimental fast reactor JOYO MK-III functional test. Primary auxiliary cooling system test

    International Nuclear Information System (INIS)

    Karube, Koji; Akagi, Shinji; Terano, Toshihiro; Onuki, Osamu; Ito, Hideaki; Aoki, Hiroshi; Odo, Toshihiro

    2004-03-01

    This paper describes the results of primary auxiliary cooling system, which were done as a part of JOYO MK-III function test. The aim of the tests was to confirm the operational performance of primary auxiliary EMP and the protection system including siphon breaker of primary auxiliary cooling system. The items of the tests were: (Test No.): (Test item). 1) SKS-117: EMP start up test. 2) SKS-118-1: EMP start up test when pony motor running. 3) SKS-121: Function test of siphon breaker. The results of the tests satisfied the required performance, and demonstrated successful operation of primary auxiliary cooling system. (author)

  12. Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

    Directory of Open Access Journals (Sweden)

    Devender Singh

    2016-12-01

    Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

  13. Coupling technology for dual-purpose nuclear-desalting plants

    International Nuclear Information System (INIS)

    Jones, J.E. Jr.; Anderson, T.D.; Reed, S.A.

    1976-11-01

    Although the basic technology for the various components of nuclear dual-purpose plants is reasonably well developed, the techniques of coupling the elements together to form a reliable, economical system that will satisfy the diverse operating requirements are not well established. The purpose of the study reported is to examine the technical, economic, and safety considerations in coupling nuclear power plants with distillation units to form a dual-purpose power and water distillation plant. The basic coupling arrangement required to provide a large-scale dual-purpose water plant is to supply steam to the water plant from the exhaust of a back-pressure turbine. The principal component at the interface that may require major research and development is the back-pressure turbine. To satisfy the operational requirements, two major auxiliary systems will be needed. These are: (1) a prime-steam bypass system, and (2) auxiliary condensers. These systems will provide a degree of independence between water and power production and can be justified economically

  14. Design of auxiliary shield for remote controlled metallographic microscope

    International Nuclear Information System (INIS)

    Matsui, Hiroki; Okamoto, Hisato

    2014-06-01

    The remote controlled optical microscope installed in the lead cell at the Reactor Fuel Examination Facility (RFEF) in Japan Atomic Energy Agency (JAEA) has been upgraded to a higher performance unit to study the effect of the microstructural evolution in clad material on the high burn-up fuel behavior under the accident condition. The optical pass of the new microscope requires a new through hole in the shielding lead wall of the cell. To meet safety regulations, auxiliary lead shieldings were designed to cover the lost shielding function of the cell wall. Particle and Heavy Ion Transport Code System (PHITS) was used to calculate and determine the shape and setting positions of the shielding unit. Seismic assessments of the unit were also performed. (author)

  15. LOX/LH2 vane pump for auxiliary propulsion systems

    Science.gov (United States)

    Hemminger, J. A.; Ulbricht, T. E.

    1985-01-01

    Positive displacement pumps offer potential efficiency advantages over centrifugal pumps for future low thrust space missions. Low flow rate applications, such as space station auxiliary propulsion or dedicated low thrust orbiter transfer vehicles, are typical of missions where low flow and high head rise challenge centrifugal pumps. The positive displacement vane pump for pumping of LOX and LH2 is investigated. This effort has included: (1) a testing program in which pump performance was investigated for differing pump clearances and for differing pump materials while pumping LN2, LOX, and LH2; and (2) an analysis effort, in which a comprehensive pump performance analysis computer code was developed and exercised. An overview of the theoretical framework of the performance analysis computer code is presented, along with a summary of analysis results. Experimental results are presented for pump operating in liquid nitrogen. Included are data on the effects on pump performance of pump clearance, speed, and pressure rise. Pump suction performance is also presented.

  16. Development of the APR+ Auxiliary Building General Arrangement (GA)

    International Nuclear Information System (INIS)

    Moon, Hyung Keun; Park, Young Sheop; Kang, Yong Chul

    2011-01-01

    The general arrangement (GA) drawing of a nuclear power plant is the most basic drawing which contains all of the plant equipment, systems, and rooms. Therefore, it should be issued at an early design stage to provide the contours of the overall plant structure. This type of drawing is typically used widely throughout the design stages. The development project of APR+ (Advanced Power Reactor+), as a succeeding model of the APR1400 (Advanced Power Reactor 1400) design, has its own GA that encompasses all of its power buildings. This was developed starting in October of 2009. Among several of the buildings in this design, the Auxiliary Building (AB) is one of the most important buildings to produce electricity, and to protect against undesirable radiation emissions. This paper focuses on the design characteristics of the general arrangement of the AB

  17. Auxiliary fields in the geometrical relativistic particle dynamics

    International Nuclear Information System (INIS)

    Amador, A; Bagatella, N; Rojas, E; Cordero, R

    2008-01-01

    We describe how to construct the dynamics of relativistic particles, following either timelike or null curves, by means of an auxiliary variables method instead of the standard theory of deformations for curves. There are interesting physical particle models governed by actions that involve higher order derivatives of the embedding functions of the worldline. We point out that the mechanical content of such models can be extracted wisely from a lower order action, which can be performed by implementing in the action a finite number of constraints that involve the geometrical relationship structures inherent to a curve and by using a covariant formalism. We emphasize our approach for null curves. For such systems, the natural time parameter is a pseudo-arclength whose properties resemble those of the standard proper time. We illustrate the formalism by applying it to some models for relativistic particles

  18. Auxiliary fields in the geometrical relativistic particle dynamics

    Energy Technology Data Exchange (ETDEWEB)

    Amador, A; Bagatella, N; Rojas, E [Departamento de Fisica, Facultad de Fisica e Inteligencia Artificial, Universidad Veracruzana, 91000 Xalapa, Veracruz (Mexico); Cordero, R [Departamento de Fisica, Escuela Superior de Fisica y Matematicas del I.P.N, Edificio 9, 07738 Mexico D.F (Mexico)], E-mail: aramador@gmail.com, E-mail: nbagatella@uv.mx, E-mail: cordero@esfm.ipn.mx, E-mail: efrojas@uv.mx

    2008-03-21

    We describe how to construct the dynamics of relativistic particles, following either timelike or null curves, by means of an auxiliary variables method instead of the standard theory of deformations for curves. There are interesting physical particle models governed by actions that involve higher order derivatives of the embedding functions of the worldline. We point out that the mechanical content of such models can be extracted wisely from a lower order action, which can be performed by implementing in the action a finite number of constraints that involve the geometrical relationship structures inherent to a curve and by using a covariant formalism. We emphasize our approach for null curves. For such systems, the natural time parameter is a pseudo-arclength whose properties resemble those of the standard proper time. We illustrate the formalism by applying it to some models for relativistic particles.

  19. STARTER-GENERATOR SYSTEM FOR AUXILIARY POWER UNIT

    Directory of Open Access Journals (Sweden)

    A. V. Levin

    2017-01-01

    Full Text Available The article presents a starter-generator system for an auxiliary power unit of an aircraft. A feature of the presented system is the use of a synchronous generator with excitation from permanent magnets and a semiconductor converter. The main problem of the system is the generation of electric energy of an aircraft on the basis of a synchronous generator with excitation from permanent magnets is the absence of the possibility of regulating the voltage and frequency of electrical energy, in this connection, a semiconductor converter that ensures the conversion of generated electric energy with significant mass-dimensions characteristics.The article proposes an approach to designing a starter-generator system with a parallel connection of a synchronous generator with excitation from permanent magnets and a semiconductor converter. This approach makes it possible to significantly reduce the part of the electrical energy that needs to be converted, as a consequence, the semiconductor converter has significantly smaller mass-and-batch characteristics.In the article the modes of generation of electric energy and the starter mode of operation of the starter-generator system are considered in detail, the circuit realization of the semiconductor converter is shown. A scheme for replacing one phase of the system for generating electric energy and calculating electric parameters is presented.The possibility of creating a highly efficient starter-generator system based on a synchronous generator with excitation from permanent magnets and a semiconductor converter for an auxiliary power plant of aircrafts is shown. Structural and basic schemes for constructing a system for generating electrical energy are proposed. The approach to the choice of rational circuit solutions is substantiated, basic estimates of the electrical parameters of the system are obtained. The possibility of achieving a specific mass of a semiconductor converter for synchronous

  20. Dual Youla parameterization

    DEFF Research Database (Denmark)

    Niemann, Hans Henrik

    2003-01-01

    A different aspect of using the parameterisation of all systems stabilised by a given controller, i.e. the dual Youla parameterisation, is considered. The relation between system change and the dual Youla parameter is derived in explicit form. A number of standard uncertain model descriptions...... are considered and the relation with the dual Youla parameter given. Some applications of the dual Youla parameterisation are considered in connection with the design of controllers and model/performance validation....

  1. Modal Auxiliaries and Their Semantic Functions Used by Advanced EFL Learners

    Science.gov (United States)

    Torabiardakani, Najmeh; Khojasteh, Laleh; Shokrpour, Nasrin

    2015-01-01

    Since modal auxiliary verbs have been proved to be one of the most troublesome grammatical structures in English, the researchers of this study decided to do an analysis on the ways in which advanced EFL Iranian students use modal auxiliaries focusing specially on nine modals' semantic functions. Consequently, was conducted based on the following…

  2. Auxiliary Armed Forces and Innovations in Security Governance in Mozambique’s Civil War

    NARCIS (Netherlands)

    Jentzsch, C.

    2017-01-01

    Who rules during the civil war? This article argues that the concept of armed group governance must be expanded to include auxiliary armed forces linked to rebels or the government. Comparing the organization of rebel and government auxiliaries, the article demonstrates that security governance

  3. 14 CFR 33.96 - Engine tests in auxiliary power unit (APU) mode.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Engine tests in auxiliary power unit (APU... TRANSPORTATION AIRCRAFT AIRWORTHINESS STANDARDS: AIRCRAFT ENGINES Block Tests; Turbine Aircraft Engines § 33.96 Engine tests in auxiliary power unit (APU) mode. If the engine is designed with a propeller brake which...

  4. Auxiliary bearing design and rotor dynamics analysis of blower fan for HTR-10

    International Nuclear Information System (INIS)

    Gao Mingshan; Yang Guojun; Xu Yang; Zhao Lei; Yu Suyuan

    2005-01-01

    The electromagnetic bearing instead of ordinary mechanical bearing was chosen to support the rotor in the blower fan system with helium of 10 MW high temperature gas-cooled test reactor (HTR-10), and the auxiliary bearing was applied in the HTR-10 as the backup protector. When the electromagnetic bearing doesn't work suddenly for the power broken, the auxiliary bearing is used to support the falling rotor with high rotating speed. The rotor system will be protected by the auxiliary bearing. The design of auxiliary bearing is the ultimate safeguard for the system. This rotor is vertically mounted to hold the blower fan. The rotor's length is about 1.5 m, its weight is about 240 kg and the rotating speed is about 5400 r/min. Auxiliary bearing design and rotor dynamics analysis are very important for the design of blower fan to make success. The research status of the auxiliary bearing was summarized in the paper. A sort of auxiliary bearing scheme was proposed. MSC.Marc was selected to analyze the vibration mode and the natural frequency of the rotor. The scheme design of auxiliary bearing and analysis result of rotor dynamics offer the important theoretical base for the protector design and control system of electromagnetic bearing of the blower fan. (authors)

  5. How Does Dissociation between Written and Oral Forms Affect Reading: Evidence from Auxiliary Verbs in Arabic

    Science.gov (United States)

    Ibrahim, Raphiq

    2011-01-01

    In Arabic, auxiliary verbs are necessary in the written language, but absent from the oral language. This is contrary to languages such as English and French in which auxiliary verbs are mandatory in both written and oral languages. This fact was exploited to examine if dissociation between written and oral forms affects reading measures like…

  6. Dummy auxiliaries in child and adult second language acquisition of Dutch

    NARCIS (Netherlands)

    Blom, W.B.T.; de Korte, S.

    2011-01-01

    In previous research it has been observed that second language (L2) learners of Dutch and German use analytic verbs in contexts where the target language requires synthetic verbs. These analytic verbs consist of a semantically empty auxiliary (dummy auxiliary) that selects a lexical infinitive. In

  7. 46 CFR 52.01-35 - Auxiliary, donkey, fired thermal fluid heater, and heating boilers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Auxiliary, donkey, fired thermal fluid heater, and... (CONTINUED) MARINE ENGINEERING POWER BOILERS General Requirements § 52.01-35 Auxiliary, donkey, fired thermal... requirements for miscellaneous boiler types, such as donkey, fired thermal fluid heater, heating boiler, etc...

  8. A probabilistic evaluation of the Shearon Harris Nuclear Power Plant auxiliary feedwater isolation system

    International Nuclear Information System (INIS)

    Anoba, R.C.

    1989-01-01

    This paper reports on a fault tree approach that was used to evaluate the safety significance of modifying the Shearon Harris Auxiliary Feedwater Isolation System. The design modification was a result of on-site reviews which identified a single failure in the Auxiliary Feedwater Isolation circuitry

  9. 29 CFR Appendix II to Part 1918 - Tables for Selected Miscellaneous Auxiliary Gear (Mandatory)

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Tables for Selected Miscellaneous Auxiliary Gear (Mandatory) II Appendix II to Part 1918 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND.... 1918, App. II Appendix II to Part 1918—Tables for Selected Miscellaneous Auxiliary Gear (Mandatory...

  10. Dual affine isoperimetric inequalities

    Directory of Open Access Journals (Sweden)

    Bin Xiong

    2006-01-01

    Full Text Available We establish some inequalities for the dual -centroid bodies which are the dual forms of the results by Lutwak, Yang, and Zhang. Further, we establish a Brunn-Minkowski-type inequality for the polar of dual -centroid bodies.

  11. Goal programming for cyclical auxiliary police scheduling at UiTM Cawangan Perlis

    Science.gov (United States)

    Mustapar, Wasilatul Effah; Nasir, Diana Sirmayunie Mohd; Nor, Nor Azriani Mohamad; Abas, Sharifah Fhahriyah Syed

    2017-11-01

    Constructing a good and fair schedule for shift workers poses a great challenge as it requires a lot of time and effort. In this study, goal programming has been applied on scheduling to achieve the hard and soft constraints for a cyclical schedule that would ease the head of auxiliary police at building new schedules. To accomplish this goal, shift types were assigned in order to provide a fair schedule that takes into account the auxiliary police's policies and preferences. The model was run using Lingo software. Three out of four goals set for the study were achieved. In addition, the results considered an equal allocation for every auxiliary police, namely 70% for total duty and 30% for the day. Furthermore, the schedule was able to cyclically generate another 10 sets schedule. More importantly, the model has provided unbiased scheduling of auxiliary policies which led to high satisfaction in auxiliary police management.

  12. DUAL TIMELIKE NORMAL AND DUAL TIMELIKE SPHERICAL CURVES IN DUAL MINKOWSKI SPACE

    OpenAIRE

    ÖNDER, Mehmet

    2009-01-01

    Abstract: In this paper, we give characterizations of dual timelike normal and dual timelike spherical curves in the dual Minkowski 3-space and we show that every dual timelike normal curve is also a dual timelike spherical curve. Keywords: Normal curves, Dual Minkowski 3-Space, Dual Timelike curves. Mathematics Subject Classifications (2000): 53C50, 53C40. DUAL MINKOWSKI UZAYINDA DUAL TIMELIKE NORMAL VE DUAL TIMELIKE KÜRESEL EĞRİLER Özet: Bu çalışmada, dual Minkowski 3-...

  13. VLTI First Fringes with Two Auxiliary Telescopes at Paranal

    Science.gov (United States)

    2005-03-01

    World's Largest Interferometer with Moving Optical Telescopes on Track Summary The Very Large Telescope Interferometer (VLTI) at Paranal Observatory has just seen another extension of its already impressive capabilities by combining interferometrically the light from two relocatable 1.8-m Auxiliary Telescopes. Following the installation of the first Auxiliary Telescope (AT) in January 2004 (see ESO PR 01/04), the second AT arrived at the VLT platform by the end of 2004. Shortly thereafter, during the night of February 2 to 3, 2005, the two high-tech telescopes teamed up and quickly succeeded in performing interferometric observations. This achievement heralds an era of new scientific discoveries. Both Auxiliary Telescopes will be offered from October 1, 2005 to the community of astronomers for routine observations, together with the MIDI instrument. By the end of 2006, Paranal will be home to four operational ATs that may be placed at 30 different positions and thus be combined in a very large number of ways ("baselines"). This will enable the VLTI to operate with enormous flexibility and, in particular, to obtain extremely detailed (sharp) images of celestial objects - ultimately with a resolution that corresponds to detecting an astronaut on the Moon. PR Photo 07a/05: Paranal Observing Platform with AT1 and AT2 PR Photo 07b/05: AT1 and AT2 with Open Domes PR Photo 07c/05: Evening at Paranal with AT1 and AT2 PR Photo 07d/05: AT1 and AT2 under the Southern Sky PR Photo 07e/05: First Fringes with AT1 and AT2 PR Video Clip 01/05: Two ATs at Paranal (Extract from ESO Newsreel 15) A Most Advanced Device ESO PR Video 01/05 ESO PR Video 01/05 Two Auxiliary Telescopes at Paranal [QuickTime: 160 x 120 pix - 37Mb - 4:30 min] [QuickTime: 320 x 240 pix - 64Mb - 4:30 min] ESO PR Photo 07a/05 ESO PR Photo 07a/05 [Preview - JPEG: 493 x400 pix - 44k] [Normal - JPEG: 985 x 800 pix - 727k] [HiRes - JPEG: 5000 x 4060 pix - 13.8M] Captions: ESO PR Video Clip 01/05 is an extract from

  14. Multiphoton resonances

    International Nuclear Information System (INIS)

    Shore, B.W.

    1977-01-01

    The long-time average of level populations in a coherently-excited anharmonic sequence of energy levels (e.g., an anharmonic oscillator) exhibits sharp resonances as a function of laser frequency. For simple linearly-increasing anharmonicity, each resonance is a superposition of various multiphoton resonances (e.g., a superposition of 3, 5, 7, . . . photon resonances), each having its own characteristic width predictable from perturbation theory

  15. Properties of quasi-elastic processes due to exchange of one dual pomeron

    International Nuclear Information System (INIS)

    Gedalin, Eh.V.; Gurvich, E.G.

    1975-01-01

    The asymptotic (at S tending to infinity) characteristics of four-particle amplitudes of diffraction scattering of resonance states in the dual-resonance model is considered in the lower order of the dual theory of perturbations. It is shown that for transverse transferred momentum K→0, at least for part of the spectrum of states of the dual resonance model - i.e. of the transverse states -, the scattering amplitudes are zero, except for the elastically scattered ones, which are all identical. (author)

  16. On a gauge theory of the self-dual field and its quantization

    International Nuclear Information System (INIS)

    Srivastava, P.P.

    1990-01-01

    A gauge theory of self-dual fields is constructed by adding a Wess-Zumino term to the recently studied formulation based on a second-order scalar field lagrangian carrying with it an auxiliary vector field to take care of the self-duality constraint in a linear fashion. The two versions are quantized using the BRST formulation following the BFV procedure. No violation of microcausality occurs and the action of the ordinary scalar field may not be written as the sum of the actions of the self- and anti-self-dual fields. (orig.)

  17. On-chip dual comb source for spectroscopy

    OpenAIRE

    Dutt, Avik; Joshi, Chaitanya; Ji, Xingchen; Cardenas, Jaime; Okawachi, Yoshitomo; Luke, Kevin; Gaeta, Alexander L.; Lipson, Michal

    2016-01-01

    Dual-comb spectroscopy is a powerful technique for real-time, broadband optical sampling of molecular spectra which requires no moving components. Recent developments with microresonator-based platforms have enabled frequency combs at the chip scale. However, the need to precisely match the resonance wavelengths of distinct high-quality-factor microcavities has hindered the development of an on-chip dual comb source. Here, we report the first simultaneous generation of two microresonator comb...

  18. Heat removal performance of auxiliary cooling system for the high temperature engineering test reactor during scrams

    International Nuclear Information System (INIS)

    Takeda, Takeshi; Tachibana, Yukio; Iyoku, Tatsuo; Takenaka, Satsuki

    2003-01-01

    The auxiliary cooling system of the high temperature engineering test reactor (HTTR) is employed for heat removal as an engineered safety feature when the reactor scrams in an accident when forced circulation can cool the core. The HTTR is the first high temperature gas-cooled reactor in Japan with reactor outlet gas temperature of 950 degree sign C and thermal power of 30 MW. The auxiliary cooling system should cool the core continuously avoiding excessive cold shock to core graphite components and water boiling of itself. Simulation tests on manual trip from 9 MW operation and on loss of off-site electric power from 15 MW operation were carried out in the rise-to-power test up to 20 MW of the HTTR. Heat removal characteristics of the auxiliary cooling system were examined by the tests. Empirical correlations of overall heat transfer coefficients were acquired for a helium/water heat exchanger and air cooler for the auxiliary cooling system. Temperatures of fluids in the auxiliary cooling system were predicted on a scram event from 30 MW operation at 950 degree sign C of the reactor outlet coolant temperature. Under the predicted helium condition of the auxiliary cooling system, integrity of fuel blocks among the core graphite components was investigated by stress analysis. Evaluation results showed that overcooling to the core graphite components and boiling of water in the auxiliary cooling system should be prevented where open area condition of louvers in the air cooler is the full open

  19. Practical auxiliary basis implementation of Rung 3.5 functionals

    International Nuclear Information System (INIS)

    Janesko, Benjamin G.; Scalmani, Giovanni; Frisch, Michael J.

    2014-01-01

    Approximate exchange-correlation functionals for Kohn-Sham density functional theory often benefit from incorporating exact exchange. Exact exchange is constructed from the noninteracting reference system's nonlocal one-particle density matrix γ(r -vector ,r -vector ′). Rung 3.5 functionals attempt to balance the strengths and limitations of exact exchange using a new ingredient, a projection of γ(r -vector ,r -vector ′) onto a semilocal model density matrix γ SL (ρ(r -vector ),∇ρ(r -vector ),r -vector −r -vector ′). γ SL depends on the electron density ρ(r -vector ) at reference point r -vector , and is closely related to semilocal model exchange holes. We present a practical implementation of Rung 3.5 functionals, expanding the r -vector −r -vector ′ dependence of γ SL in an auxiliary basis set. Energies and energy derivatives are obtained from 3D numerical integration as in standard semilocal functionals. We also present numerical tests of a range of properties, including molecular thermochemistry and kinetics, geometries and vibrational frequencies, and bandgaps and excitation energies. Rung 3.5 functionals typically provide accuracy intermediate between semilocal and hybrid approximations. Nonlocal potential contributions from γ SL yield interesting successes and failures for band structures and excitation energies. The results enable and motivate continued exploration of Rung 3.5 functional forms

  20. Radiological conditions and experiences in the TMI-2 Auxiliary Building

    International Nuclear Information System (INIS)

    Ruhter, P.E.; Zurliene, W.G.

    1988-01-01

    Although the radiological conditions following the TMI-2 accident were extraordinary, those that had a potential impact on personnel were largely confined to the Auxiliary and Fuel Handling Building. The most significant pathway was the Letdown and Make-Up and Purification System. Dose rates in some locations in the Aux/Fuel Handling Buildings were in excess of 3 mSv/s (1000 R/h) during the first few days following the accident. They decreased after three to four days and stabilized after about one week. Airborne radioactivity levels were initially due to the release of noble gases, and subsequently due to resuspension of surface contamination. During the first month, the mixture of fission products in the reactor coolant change from one of largely cesium to where the strontium and cesium were about equal in radiological importance. This created some very high beta radiation levels. The significant strontium levels caused the contamination control limit to be reduced to one-half of the pre-accident limit. 5 refs., 6 figs

  1. Seismic qualification of PWR plant auxiliary feedwater systems

    International Nuclear Information System (INIS)

    Lu, S.C.; Tsai, N.C.

    1983-08-01

    The NRC Standard Review Plan specifies that the auxiliary feedwater (AFW) system of a pressurized water reactor (PWR) is a safeguard system that functions in the event of a Safe Shutdown Earthquake (SSE) to remove the decay heat via the steam generator. Only recently licensed PWR plants have an AFW system designed to the current Standard Review Plan specifications. The NRC devised the Multiplant Action Plan C-14 in order to make a survey of the seismic capability of the AFW systems of operating PWR plants. The purpose of this survey is to enable the NRC to make decisions regarding the need of requiring the licensees to upgrade the AFW systems to an SSE level of seismic capability. To implement the first phase of the C-14 plan, the NRC issued a Generic Letter (GL) 81-14 to all operating PWR licensees requesting information on the seismic capability of their AFW systems. This report summarizes Lawrence Livermore National Laboratory's efforts to assist the NRC in evaluating the status of seismic qualification of the AFW systems in 40 PWR plants, by reviewing the licensees' responses to GL 81-14

  2. Auxiliary controllers for data acquisition from scintillation detector electronic equipment

    Energy Technology Data Exchange (ETDEWEB)

    Leonenko, D A; Rybakov, V G; Sen' ko, V A [Gosudarstvennyj Komitet po Ispol' zovaniyu Atomnoj Ehnergii SSSR, Serpukhov. Inst. Fiziki Vysokikh Ehnergij

    1983-01-01

    Structural schemes of auxiliary controllers of three types ensuring compression, filtration and record in buffer storage of data from scintillation detectors electronic equipment are described. The electronics is made according to the CAMAC ideology. The KD-85 controller exercises data readout from analog-to-digital converters (ADC), subtraction of pedestal values, discrimination by the bottom level and record into the buffer storage module. The KD-86 controller summarizes data from all the ADC channels in a crate dicscriminates the summarized data by the upper and bottom levels, and rejects data classified as useless. The KD-90 controller ensures data reading from different modules of the crate according to preset code and records information in the buffer storage module. The considered controllers employ integral microcircuits of the K 155 series. At present the controllers are under experimental operation. Their utilization would permit to adopt new arrangement of data acquisition from experimental facilities in the nearest future and essentially increase the operating efficiency of these facilities.

  3. A magnetorheological clutch for efficient automotive auxiliary device actuation

    Directory of Open Access Journals (Sweden)

    F. Bucchi

    2013-01-01

    Full Text Available In this paper the results of a project funded by Regione Toscana aimed at reducing the power absorption of auxiliary devices in vehicles are presented. In particular the design, testing and application of a magnetorheological clutch (MR is proposed, aimed at disengaging the vacuum pump, which draws in air from the power-brake booster chamber, in order to reduce the device power absorption. Several clutch preliminary studies done to choose the clutch geometry and the magnetic field supply are illustrated. The final choice consisted in an MR clutch with permanent magnet, which satisfied size, torque and fail-safe specifications. The clutch characteristics, in terms of torque versus slip, were obtained experimentally for three different clutch prototypes on an ad-hoc developed test bench.As result of a preliminary simulation, a comparison between the power absorption of a current production vacuum pump, an innovative vacuum pump and both vacuum pumps coupled with the MR clutch is presented. The New European Driving Cycle is considered for simulating the vacuum pump operation both in urban and highway driving. Results show that the use of the innovative vacuum pump reduces the device consumption of about 35%, whereas the use of MR clutch coupled with the innovative vacuum pump reduces it up to about 44% in urban driving and 50% in highway driving.

  4. Auxiliary water supply device for BWR type reactor

    International Nuclear Information System (INIS)

    Sasagawa, Hiroshi.

    1994-01-01

    In the device of the present invention, a cooling condensation means is disposed to a steam discharge channel of a turbine for driving pumps to directly return condensates to the reactor, so that the temperature of the suppression pool water is not elevated. Namely, the cooling condensation means for discharged steams is disposed to the discharge channel of the turbine. The condensate channel from the cooling condensation means is connected to a sucking side of the turbine driving pump. With such a constitution, when the reactor is isolated from a main steam system, reactor scram is conducted. Although the reactor water level is lowered by the reactor scram, the lowering of the reactor water level is prevented by supplementing cooling water by the turbine driving pump using steams generated in the reactor as a power source. The discharged steams after driving the turbine are cooled and condensated by the cooling condensation means by way of the discharge channel and returned to the reactor again by way of the condensate channel. With such procedures, since the temperature of suppression pool water is not elevated, there is no need to operate other cooling systems. In addition, auxiliary water can be supplied for a long period of time. (I.S.)

  5. Simulation of a passive auxiliary feedwater system with TRACE5

    Energy Technology Data Exchange (ETDEWEB)

    Lorduy, María; Gallardo, Sergio; Verdú, Gumersindo, E-mail: maloral@upv.es, E-mail: sergalbe@iqn.upv.es, E-mail: gverdu@iqn.upv.es [Instituto Universitario de Seguridad Industrial, Radiofísica y Medioambiental (ISIRYM), València (Spain)

    2017-07-01

    The study of the nuclear power plant accidents occurred in recent decades, as well as the probabilistic risk assessment carried out for this type of facility, present human error as one of the main contingency factors. For this reason, the design and development of generation III, III+ and IV reactors, which include inherent and passive safety systems, have been promoted. In this work, a TRACE5 model of ATLAS (Advanced Thermal- Hydraulic Test Loop for Accident Simulation) is used to reproduce an accidental scenario consisting in a prolonged Station BlackOut (SBO). In particular, the A1.2 test of the OECD-ATLAS project is analyzed, whose purpose is to study the primary system cooling by means of the water supply to one of the steam generators from a Passive Auxiliary Feedwater System (PAFS). This safety feature prevents the loss of secondary system inventory by means of the steam condensation and its recirculation. Thus, the conservation of a heat sink allows the natural circulation flow rate until restoring stable conditions. For the reproduction of the test, an ATLAS model has been adapted to the experiment conditions, and a PAFS has been incorporated. >From the simulation test results, the main thermal-hydraulic variables (pressure, flow rates, collapsed water level and temperature) are analyzed in the different circuits, contrasting them with experimental data series. As a conclusion, the work shows the TRACE5 code capability to correctly simulate the behavior of a passive feedwater system. (author)

  6. Ion engine auxiliary propulsion applications and integration study

    Science.gov (United States)

    Zafran, S. (Editor)

    1977-01-01

    The benefits derived from application of the 8-cm mercury electron bombardment ion thruster were assessed. Two specific spacecraft missions were studied. A thruster was tested to provide additional needed information on its efflux characteristics and interactive effects. A Users Manual was then prepared describing how to integrate the thruster for auxiliary propulsion on geosynchronous satellites. By incorporating ion engines on an advanced communications mission, the weight available for added payload increases by about 82 kg (181 lb) for a 100 kg (2200 lb) satellite which otherwise uses electrothermal hydrazine. Ion engines can be integrated into a high performance propulsion module that is compatible with the multimission modular spacecraft and can be used for both geosynchronous and low earth orbit applications. The low disturbance torques introduced by the ion engines permit accurate spacecraft pointing with the payload in operation during thrusting periods. The feasibility of using the thruster's neutralizer assembly for neutralization of differentially charged spacecraft surfaces at geosynchronous altitude was demonstrated during the testing program.

  7. A Corpus-Based Study on the Use of Past Tense Auxiliary "Be" in Argumentative Essays of Malaysian ESL Learners

    Science.gov (United States)

    Manokaran, Janaki; Ramalingam, Chithra; Adriana, Karen

    2013-01-01

    This research is a corpus-based study of secondary and college ESL Malaysian learner's written work by identifying and classifying the types of errors in the Past Tense Auxiliary "Be". This research studied the past tense auxiliary "be", types of past tense auxiliary "be" errors and frequency of past tense auxiliary…

  8. 76 FR 28795 - Privacy Act of 1974; Department of Homeland Security United States Coast Guard-024 Auxiliary...

    Science.gov (United States)

    2011-05-18

    ... 1974; Department of Homeland Security United States Coast Guard-024 Auxiliary Database System of... Security/United States Coast Guard-024 Auxiliary Database (AUXDATA) System of Records.'' This system of...: United States Coast Guard Auxiliary Database (AUXDATA). Security classification: Unclassified. System...

  9. Auxiliary System Load Schemes in Large Thermal and Nuclear Power Plants

    International Nuclear Information System (INIS)

    Kuzle, I.; Bosnjak, D.; Pandzic, H.

    2010-01-01

    Uninterrupted auxiliary system power supply in large power plants is a key factor for normal operation, transient states, start-ups and shutdowns and particularly during fault conditions. Therefore, there are many challenges in designing the main electrical system as well as the auxiliary systems power supply. Depending upon the type of fuel used and the environmental control system required, a thermal power plant may consume as much as 10% of its total generation for auxiliary power, while a nuclear power plant may require only 4 - 6% auxiliaries. In general, the larger the power generating plant, the higher the voltage selected for the AC auxiliary electric system. Most stations in the 75 to 500 MW range utilize 4,2 kV as the base auxiliary system voltage. Large generating stations 500 - 1000 MW and more use voltage levels of 6,9 kV and more. Some single dedicated loads such as electric driven boiler feed pumps are supplied ba a 13,8 kV bus. While designing the auxiliary electric system, the following areas must be considered: motor starting requirements, voltage regulation requirements, short-circuit duty requirements, economic considerations, reliability and alternate sources. Auxiliary power supply can't be completely generalized and each situation should be studied on its own merits to determine the optimal solution. Naturally, nuclear power plants have more reliability requirements and safety design criteria. Main coolant-pump power supply and continuity of service to other vital loads deserve special attention. This paper presents an overview of some up-to-date power plant auxiliary load system concepts. The main types of auxiliary loads are described and the electric diagrams of the modern auxiliary system supply concepts are given. Various alternative sources of auxiliary electrical supply are considered, the advantages and disadvantages of these are compared and proposals are made for high voltage distribution systems around the thermal and nuclear plant

  10. An Auxiliary Equation for the Bellman Equation in a One-Dimensional Ergodic Control

    International Nuclear Information System (INIS)

    Fujita, Y.

    2001-01-01

    In this paper we consider the Bellman equation in a one-dimensional ergodic control. Our aim is to show the existence and the uniqueness of its solution under general assumptions. For this purpose we introduce an auxiliary equation whose solution gives the invariant measure of the diffusion corresponding to an optimal control. Using this solution, we construct a solution to the Bellman equation. Our method of using this auxiliary equation has two advantages in the one-dimensional case. First, we can solve the Bellman equation under general assumptions. Second, this auxiliary equation gives an optimal Markov control explicitly in many examples

  11. Capacitance of circular patch resonator

    International Nuclear Information System (INIS)

    Miano, G.; Verolino, L.; Naples Univ.; Panariello, G.; Vaccaro, V.G.; Naples Univ.

    1995-11-01

    In this paper the capacitance of the circular microstrip patch resonator is computed. It is shown that the electrostatic problem can be formulated as a system of dual integral equations, and the most interesting techniques of solutions of these systems are reviewed. Some useful approximated formulas for the capacitance are derived and plots of the capacitance are finally given in a wide range of dielectric constants

  12. Dual Income Taxes

    DEFF Research Database (Denmark)

    Sørensen, Peter Birch

    This paper discusses the principles and practices of dual income taxation in the Nordic countries. The first part of the paper explains the rationale and the historical background for the introduction of the dual income tax and describes the current Nordic tax practices. The second part...... of the paper focuses on the problems of taxing income from small businesses and the issue of corporate-personal tax integration under the dual income tax, considering alternative ways of dealing with these challenges. In the third and final part of the paper, I briefly discuss whether introducing a dual income...

  13. Perceived oral health status and treatment needs of dental auxiliaries.

    Science.gov (United States)

    Azodo, Clement C; Ehizele, Adebola O; Umoh, Agnes; Ojehanon, Patrick I; Akhionbare, Osagie; Okechukwu, Robinson; Igbinosa, Lawrence

    2010-03-15

    To determine the perceived oral health status and treatment needs of Nigerian dental therapists in training and dental technology students. A descriptive cross-sectional study of students from Federal School of Dental Therapy and Technology Enugu, Nigeria was conducted using self-administered questionnaire to obtain information on demography, self-reported oral health status, knowledge of impact of oral health on daily life activity, dental attendance and perceived dental need. The perception of oral health status and treatment need of the two groups of dental auxiliaries was the same. Fewer respondents (27.3%) rated their oral health as excellent, while 50.4% rated their oral health as good. Majority (95.5%) agreed that oral health is a part of general health and 94.6% agreed that oral health has a role in daily life. Out of 81.4% that had previous dental treatment, scaling and polishing accounted for 66.1%. Presently, 48.8% think they need dental treatment ranging from scaling and polishing (33.9%), tooth restoration (10.3%), to extraction (1.2%). This survey revealed that most of the students are aware that oral health is a component of general health and that it has an impact on an individual's daily life. More than half of the students perceived their oral health as good, but only a few knew that there is a need for a preventive approach to oral health as evident by the percentage that perceived scaling and polishing as a treatment need.

  14. Perceived oral health status and treatment needs of dental auxiliaries

    Directory of Open Access Journals (Sweden)

    Clement C. Azodo

    2010-03-01

    Full Text Available Objective: To determine the perceived oral health status and treatment needs of Nigerian dental therapists in training and dental technology students. Methods: A descriptive cross-sectional study of students from Federal School of Dental Therapy and Technology Enugu, Nigeria was conducted using self-administered questionnaire to obtain information on demography, self-reported oral health status, knowledge of impact of oral health on daily life activity, dental attendance and perceived dental need. Results: The perception of oral health status and treatment need of the two groups of dental auxiliaries was the same. Fewer respondents (27.3% rated their oral health as excellent, while 50.4% rated their oral health as good. Majority (95.5% agreed that oral health is a part of general health and 94.6% agreed that oral health has a role in daily life.Out of 81.4% that had previous dental treatment, scaling and polishing accounted for 66.1%. Presently, 48.8% think they need dental treatment ranging from scaling and polishing (33.9%, tooth restoration (10.3%, to extraction (1.2%. Conclusion: This survey revealed that most of the students are aware that oral health is a component of general health and that it has an impact on an individual's daily life. More than half of the students perceived their oral health as good, but only a few knew that there is a need for a preventive approach to oral health as evident by the percentage that perceived scaling and polishing as a treatment need.

  15. A ZVT–ZCT PWM synchronous buck converter with a simple passive auxiliary circuit for reduction of losses and efficiency enhancement

    Directory of Open Access Journals (Sweden)

    S. Shiva Kumar

    2015-06-01

    Full Text Available In this paper, a Zero-Voltage-Transition (ZVT–Zero-Current Transition (ZCT Pulse-width Modulated (PWM synchronous buck converter (SBC, with a simple passive auxiliary circuit is proposed, which reduces the stresses and improves the efficiency by pacifying the conduction losses compared to a traditional PWM converter, typically suitable for photovoltaic applications. The important design feature of ZVT–ZCT PWM SBC converters is placement of resonant components that mollifies the conduction losses. Due to the ZVT–ZCT, the resonant components with low values are used, thereby resulting in the increase of switching frequency. The ZVT–ZCT operation of the proposed converter is presented through theoretical analysis. The characteristics of the proposed converter are verified with the simulation in the PSIM co-simulated with MATLAB/SIMULINK environment and implemented experimentally.

  16. 49 CFR 393.24 - Requirements for head lamps, auxiliary driving lamps and front fog lamps.

    Science.gov (United States)

    2010-10-01

    ... Devices, and Electrical Wiring § 393.24 Requirements for head lamps, auxiliary driving lamps and front fog lamps. (a) Headlamps. Every bus, truck and truck tractor shall be equipped with headlamps as required by...

  17. Derived Requirements for Double Shell Tank (DST) High Level Waste (HLW) Auxiliary Solids Mobilization

    Energy Technology Data Exchange (ETDEWEB)

    TEDESCHI, A.R.

    2000-02-28

    The potential need for auxiliary double-shell tank waste mixing and solids mobilization requires an evaluation of optional technologies. This document formalizes those operating and design requirements needed for further engineering evaluations.

  18. The Impact Of Dental Auxiliaries In Oral Health Delivery In Cameroon

    African Journals Online (AJOL)

    treat 6-10 patients per day while 13 (29.5%) of respondents work without any direct supervision. Out of ... the training and job description of dental auxiliaries in Cameroon. Introduction .... A Textbook for Preventive and. Community Dentistry.

  19. Ocean Surface Topography Mission (OSTM) /Jason-2: Auxiliary Files (NODC Accession 0044983)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains the data descriptions for the OSTM/Jason-2 Auxiliary data files, which is served through the NOAA/NESDIS Comprehensive Large Array-data...

  20. Numerical analysis of magnetically suspended rotor in HTR-10 helium circulator being dropped into auxiliary bearings

    International Nuclear Information System (INIS)

    Zhao Jingxiong; Yang Guojun; Li Yue; Yu Suyuan

    2012-01-01

    Active magnetic bearings (AMB) have been selected to support the rotor of primary helium circulator in commercial 10 Mega-Walt High Temperature Gas-cooled Reactor (HTR-10). In an AMB system, the auxiliary bearings are necessary to protect the AMB components in case of losing power. This paper performs the impact simulation of Magnetically Suspended Rotor in HTR-10 Helium Circulator being dropped into the auxiliary bearings using the finite element program ABAQUS. The dynamic response and the strain field of auxiliary bearings are analyzed. The results achieved by the numerical analysis are in agreement with the experiment results. Therefore, the feasibility of the design of auxiliary bearing and the possibility of using the AMB system in the HTR are proved. (authors)

  1. Derived Requirements for Double-Shell Tank (DST) High Level Waste (HLW) Auxiliary Solids Mobilization

    International Nuclear Information System (INIS)

    TEDESCHI, A.R.

    2000-01-01

    The potential need for auxiliary double-shell tank waste mixing and solids mobilization requires an evaluation of optional technologies. This document formalizes those operating and design requirements needed for further engineering evaluations

  2. [Evaluating work intensity in major and auxiliary occupations of by-product coke industry].

    Science.gov (United States)

    Smagulov, N K; Alpysbayeva, Zh T

    2015-01-01

    The article covers evaluation of work strain in major and auxiliary occupations of by-product coke industry. The study results conclude that occupational activity of by-product coke industry workers, under exposure to occupational hazards, affects the workers' performance. Major occupations workers demonstrate higher level of functional strain of CNS, poor concentration of attention and lower ability to switch over, decreased general performance, vs. the auxiliary occupations workers who demonstrated increased cardiovascular and neuro-muscular strain due to occupational activity.

  3. A Method of Auxiliary Sources Approach for Modelling the Impact of Ground Planes on Antenna

    DEFF Research Database (Denmark)

    Larsen, Niels Vesterdal; Breinbjerg, Olav

    2006-01-01

    The Method of Auxiliary Sources (MAS) is employed to model the impact of finite ground planes on the radiation from antennas. Two different antenna test cases are shown and the calculated results agree well with reference measurements......The Method of Auxiliary Sources (MAS) is employed to model the impact of finite ground planes on the radiation from antennas. Two different antenna test cases are shown and the calculated results agree well with reference measurements...

  4. Synchrobetatron resonances

    International Nuclear Information System (INIS)

    1977-03-01

    At the 1975 Particle Accelerator Conference it was reported that a class of resonances were observed in SPEAR II that had not appeared before in SPEAR I. While the existence of sideband resonances of the main betatron oscillation frequencies has been previously observed and analyzed, the resonances observed in SPEAR do not appear to be of the same variety. Experiments were performed at SPEAR to identify the mechanism believed to be the most likely explanation. Some of the current experimental knowledge and theoretical views on the source of these resonances are presented

  5. Snake resonances

    International Nuclear Information System (INIS)

    Tepikian, S.

    1988-01-01

    Siberian Snakes provide a practical means of obtaining polarized proton beams in large accelerators. The effect of snakes can be understood by studying the dynamics of spin precession in an accelerator with snakes and a single spin resonance. This leads to a new class of energy independent spin depolarizing resonances, called snake resonances. In designing a large accelerator with snakes to preserve the spin polarization, there is an added constraint on the choice of the vertical betatron tune due to the snake resonances. 11 refs., 4 figs

  6. Improvement of stability of sinusoidally driven atmospheric pressure plasma jet using auxiliary bias voltage

    Directory of Open Access Journals (Sweden)

    Hyun-Jin Kim

    2015-12-01

    Full Text Available In this study, we have proposed the auxiliary bias pulse scheme to improve the stability of atmospheric pressure plasma jets driven by an AC sinusoidal waveform excitation source. The stability of discharges can be significantly improved by the compensation of irregular variation in memory voltage due to the effect of auxiliary bias pulse. From the parametric study, such as the width, voltage, and onset time of auxiliary bias pulse, it has been demonstrated that the auxiliary bias pulse plays a significant role in suppressing the irregular discharges caused by the irregular variation in memory voltage and stable discharge can be initiated with the termination of the auxiliary bias pulse. As a result of further investigating the effects of the auxiliary pulse scheme on the jet stability under various process conditions such as the distance between the jet head and the counter electrode, and carrier gas flow, the jet stability can be improved by adjusting the amplitude and number of the bias pulse depending on the variations in the process conditions.

  7. Intrinsically radiolabelled [59Fe]-SPIONs for dual MRI/radionuclide detection

    OpenAIRE

    Hoffman, David; Sun, Minghao; Yang, Likun; McDonagh, Philip R; Corwin, Frank; Sundaresan, Gobalakrishnan; Wang, Li; Vijayaragavan, Vimalan; Thadigiri, Celina; Lamichhane, Narottam; Zweit, Jamal

    2014-01-01

    Towards the development of iron oxide nanoparticles with intrinsically incorporated radionuclides for dual Positron Emission Tomography/Magnetic Resonance Imaging (PET/MRI) and more recently of Single Photon Emission Computed Tomography/Magnetic Resonance Imaging (SPECT/MRI), we have developed intrinsically radiolabeled [59Fe]-superparamagnetic iron oxide nanoparticles ([59Fe]-SPIONs) as a proof of concept for an intrinsic dual probe strategy. 59Fe was incorporated into Fe3O4 nanoparticle cry...

  8. Dual Enrollment Academy Programs

    Science.gov (United States)

    Gonzalez, Nicolas; Chavez, Guadalupe

    2009-01-01

    Dual Enrollment Engineering (DEEA) and Medical Science (DEMSA) Academies are two-year dual enrollment programs for high school students. Students explore engineering and medical careers through college coursework. Students prepare for higher education in engineering and medical fields while completing associate degrees in biology or engineering…

  9. A Dual Egalitarian Solution

    NARCIS (Netherlands)

    Klijn, F.; Slikker, M.; Tijs, S.H.

    2000-01-01

    In this note we introduce an egalitarian solution, called the dual egalitarian solution, that is the natural counterpart of the egalitarian solution of Dutta and Ray (1989).We prove, among others, that for a convex game the egalitarian solution coincides with the dual egalitarian solution for its

  10. Dual Credit Report

    Science.gov (United States)

    Light, Noreen

    2016-01-01

    In 2015, legislation to improve access to dual-credit programs and to reduce disparities in access and completion--particularly for low income and underrepresented students--was enacted. The new law focused on expanding access to College in the High School but acknowledged issues in other dual-credit programs and reinforced the notion that cost…

  11. Improvement of Equipment reliability for Auxiliary Feed Water System

    Energy Technology Data Exchange (ETDEWEB)

    Deok, Lee Sang; Kwan, Lee Yong [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

    2013-10-15

    According to AP913 ER) of INPO, Number of the event related to equipment is higher than others like external or human performance. In the top 25 systems, Auxiliary feed water system is the seventh highest among systems. AWFS consists of many component and complex system and Main Function of AFWS is to supply feedwater to the steam generators for the removal of heat from the RCS(Reactor Coolant System) in event the main feedwater system is unavailable following a transient or accident. Reliability of component means how well operate on demands and monitoring is necessary to keep track of condition of component. If component performance is lower than the required value, corrective action for failure mode should be done. The objective of this study is focused to improve of AF pump by adding the tasks of SHR(System Health Report) into the task of system engineer walkdown of PMT(Preventive Maintenance Template). Increasing the reliability of AF pump will contribute to improvement of reliability of AFWS. Based on operating history, there was high vibration of AF pump during performance test. In that case, there were a lot of maintenance works for normal operation of AF pump. Vibration problem related pump can't be detected by tasks of SE walkdown because it's not running during normal operation except for surveillance test. CHR(Component Health Report) of AF pump in AFWS can be made from necessary part which means monitoring and functional failure because problem of Stand-by pump can be covered by conducting monitoring and analysis of functional failure. To improve reliability of AF pump, walkdown of PMT and SHR should be conducted both in accordance with surveillance test frequency. Health of AF pump based on operation history can be verified first and then can find out which parts of pump are weak. Finally, weak part can be managed intensively and failure can be reduced according to SE walkdown. But this work can be risky and burdensome because all parts of

  12. Role stress among auxiliary nurses midwives in Gujarat, India.

    Science.gov (United States)

    Purohit, Bhaskar; Vasava, Paul

    2017-01-23

    Understanding Role Stress is important as health service providers, especially nurses experience high levels of Role Stress which is linked to burnout, poor quality of care and high turnover. The current study explicates the concept of Role Stress and assesses the Role Stress experienced by the Auxiliary Nurse Midwives (ANMs) working with rural government health centres from Gujarat, India. The study included 84 ANMs working with government health centres from one district in India. A structured instrument with established reliability and validity was used to measure 10 dimensions of Role Stress namely: Inter-role distance, role stagnation, role expectation conflict, role erosion: role overload, role isolation, personal inadequacy, self-role distance, role ambiguity and resource inadequacy. The study instrument was based on 5 point Likert rating scale that contained 50 unidirectional negative statements, 5 for each dimension. Kolmogorov-Smirnov and Shapiro-Wilk test were carried out to assess if the data were normally distributed. Cronbach's alpha test was carried out to assess reliability of the instrument. The study data was analyzed using descriptive statistics mainly using mean scores with higher scores indicating higher Role Stress and vice versa. The data was analyzed using SPSS version 19. Kolmogorov-Smirnov and Shapiro-Wilk test indicated that the data were normally distributed. Cronbach's alpha test indicated values of 0.852 suggesting high reliability of the tool. The highest Role Stress among ANMs was experienced for resource inadequacy. Role overload, role stagnation and inter-role distance were among the other important role stressors for ANMs. The study results suggests that ANMs frequently feel that: they do not have adequate amount of resources, facilities and financial support from the high levels authorities; people have too many expectations from their roles and as result they are overloaded with work and have very limited opportunities for

  13. Nonlinear resonances

    CERN Document Server

    Rajasekar, Shanmuganathan

    2016-01-01

    This introductory text presents the basic aspects and most important features of various types of resonances and anti-resonances in dynamical systems. In particular, for each resonance, it covers the theoretical concepts, illustrates them with case studies, and reviews the available information on mechanisms, characterization, numerical simulations, experimental realizations, possible quantum analogues, applications and significant advances made over the years. Resonances are one of the most fundamental phenomena exhibited by nonlinear systems and refer to specific realizations of maximum response of a system due to the ability of that system to store and transfer energy received from an external forcing source. Resonances are of particular importance in physical, engineering and biological systems - they can prove to be advantageous in many applications, while leading to instability and even disasters in others. The book is self-contained, providing the details of mathematical derivations and techniques invo...

  14. LCC Resonant Multilevel Converter for X-ray Applications

    Directory of Open Access Journals (Sweden)

    A. M. Pernía

    2017-10-01

    Full Text Available Medical X-ray appliances use high-voltage power supplies that must be able to work with very different energy requirements. Two techniques can be distinguished in X-ray medical imaging: fluoroscopy and radioscopy. The former involves low power radiation with a long exposure time, while radioscopy requires large power during short radiographic exposure times. Since the converter has to be designed by taking into account the maximum power specification, it will exhibit a poor efficiency when operating at low power levels. Such a problem can be solved by using a new multilevel LCC topology. This topology is based on a classical series-parallel resonant topology, but includes an additional low-voltage auxiliary transformer whose function depends on the X-ray technique considered. When radioscopy operation is selected, the transformer will allow the power to be shared between two full-bridges. If fluoroscopy mode is activated, the auxiliary full bridge is disconnected and the magnetizing inductance of the auxiliary transformer is used to increase the resonant inductor in order to reduce the resonant currents, thus improving the efficiency of the converter.

  15. Loss Model and Efficiency Analysis of Tram Auxiliary Converter Based on a SiC Device

    Directory of Open Access Journals (Sweden)

    Hao Liu

    2017-12-01

    Full Text Available Currently, the auxiliary converter in the auxiliary power supply system of a modern tram adopts Si IGBT as its switching device and with the 1700 V/225 A SiC MOSFET module commercially available from Cree, an auxiliary converter using all SiC devices is now possible. A SiC auxiliary converter prototype is developed during this study. The author(s derive the loss calculation formula of the SiC auxiliary converter according to the system topology and principle and each part loss in this system can be calculated based on the device datasheet. Then, the static and dynamic characteristics of the SiC MOSFET module used in the system are tested, which aids in fully understanding the performance of the SiC devices and provides data support for the establishment of the PLECS loss simulation model. Additionally, according to the actual circuit parameters, the PLECS loss simulation model is set up. This simulation model can simulate the actual operating conditions of the auxiliary converter system and calculate the loss of each switching device. Finally, the loss of the SiC auxiliary converter prototype is measured and through comparison it is found that the loss calculation theory and PLECS loss simulation model is valuable. Furthermore, the thermal images of the system can prove the conclusion about loss distribution to some extent. Moreover, these two methods have the advantages of less variables and fast calculation for high power applications. The loss models may aid in optimizing the switching frequency and improving the efficiency of the system.

  16. Dual Credit/Dual Enrollment and Data Driven Policy Implementation

    Science.gov (United States)

    Lichtenberger, Eric; Witt, M. Allison; Blankenberger, Bob; Franklin, Doug

    2014-01-01

    The use of dual credit has been expanding rapidly. Dual credit is a college course taken by a high school student for which both college and high school credit is given. Previous studies provided limited quantitative evidence that dual credit/dual enrollment is directly connected to positive student outcomes. In this study, predictive statistics…

  17. Dual thyroid ectopia

    International Nuclear Information System (INIS)

    Al-Akeely, Mohammed H.

    2003-01-01

    Ectopic thyroid gland is a rare embryological fault of thyroid development .Dual ectopic thyroid is more rare and only 8 cases have been reported in the literature. The author presents a case of dual ectopic thyroid in a 16 year old boy with an anterior red neck mass, which is gradually growing in size particularly in last 2 years. The initial diagnosis was thyroglossal duct cyst. Thyroid function test revealed elevated thyroid-stimulating hormone. Ultrasound of the neck did not show thyroid gland in its normal pre tracheal position. Thyroid scan (Technetium 99)revealed the diagnosis of dual thyroid ectopia(lingual and subhyoid). (author)

  18. Dual energy CT

    DEFF Research Database (Denmark)

    Al-Najami, Issam; Drue, Henrik Christian; Steele, Robert

    2017-01-01

    and inaccurate with existing methods. Dual Energy Computed Tomography (DECT) enables qualitative tissue differentiation by simultaneous scanning with different levels of energy. We aimed to assess the feasibility of DECT in quantifying tumor response to neoadjuvant therapy in loco-advanced rectal cancer. METHODS...... to determine the average quantitative parameters; effective-Z, water- and iodine-concentration, Dual Energy Index (DEI), and Dual Energy Ratio (DER). These parameters were compared to the regression in the resection specimen as measured by the pathologist. RESULTS: Changes in the quantitative parameters...

  19. Dual coil ignition system

    Energy Technology Data Exchange (ETDEWEB)

    Huberts, Garlan J.; Qu, Qiuping; Czekala, Michael Damian

    2017-03-28

    A dual coil ignition system is provided. The dual coil ignition system includes a first inductive ignition coil including a first primary winding and a first secondary winding, and a second inductive ignition coil including a second primary winding and a second secondary winding, the second secondary winding connected in series to the first secondary winding. The dual coil ignition system further includes a diode network including a first diode and a second diode connected between the first secondary winding and the second secondary winding.

  20. A Superconducting Dual-Channel Photonic Switch.

    Science.gov (United States)

    Srivastava, Yogesh Kumar; Manjappa, Manukumara; Cong, Longqing; Krishnamoorthy, Harish N S; Savinov, Vassili; Pitchappa, Prakash; Singh, Ranjan

    2018-06-05

    The mechanism of Cooper pair formation and its underlying physics has long occupied the investigation into high temperature (high-T c ) cuprate superconductors. One of the ways to unravel this is to observe the ultrafast response present in the charge carrier dynamics of a photoexcited specimen. This results in an interesting approach to exploit the dissipation-less dynamic features of superconductors to be utilized for designing high-performance active subwavelength photonic devices with extremely low-loss operation. Here, dual-channel, ultrafast, all-optical switching and modulation between the resistive and the superconducting quantum mechanical phase is experimentally demonstrated. The ultrafast phase switching is demonstrated via modulation of sharp Fano resonance of a high-T c yttrium barium copper oxide (YBCO) superconducting metamaterial device. Upon photoexcitation by femtosecond light pulses, the ultrasensitive cuprate superconductor undergoes dual dissociation-relaxation dynamics, with restoration of superconductivity within a cycle, and thereby establishes the existence of dual switching windows within a timescale of 80 ps. Pathways are explored to engineer the secondary dissociation channel which provides unprecedented control over the switching speed. Most importantly, the results envision new ways to accomplish low-loss, ultrafast, and ultrasensitive dual-channel switching applications that are inaccessible through conventional metallic and dielectric based metamaterials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  1. Awareness of biomedical waste management among dental professionals and auxiliary staff in Amritsar, India.

    Science.gov (United States)

    Narang, Ramandeep S; Manchanda, Adesh; Singh, Simarpreet; Verma, Nitin; Padda, Sarfaraz

    2012-12-01

    The aim of this study was to determine awareness of biomedical waste (BMW) management policies and practices among dental professionals and auxiliary staff in a dental hospital/clinics in Amritsar, India, to inform the development of future policies for effective implementation of BMW rules. The study involved 160 staff members at the Amritsar hospital/clinics (80 dentists and 80 auxiliary staff) to whom a questionnaire was distributed regarding policies, practices and awareness relating to BMW. The questionnaire was first piloted. Completed questionnaires were returned anonymously. The resulting data were statistically tested using the chi-square test for differences between the dentists and auxiliary staff. In respect of BMW management policies, there was a highly significant difference in the responses of the dentists, whose answers suggested far greater knowledge than that of the auxiliaries (Pmanagement practices, the dentists were significantly more aware (Pwaste collection in the hospital and the disposal of various items into different colour-coded bags. As for employee education/awareness, there was a significant difference (Pmanagement among dental auxiliary staff in the dental hospital/clinics in Amritsar and a lack of awareness of some aspects among dentists who work in the hospital/clinics. The results provide the hospital authorities with data upon which they can develop a strategy for improving BMW management.

  2. Environmental practices of the auxiliary companies to the Spanish automobile industry

    Science.gov (United States)

    González-Torre, Pilar L.; González, Beatriz A.; Gupta, Surendra M.

    2005-11-01

    The automobile manufacturing industry plays a very important role in a country's economy. The importance of automobile manufacturing industry lies in its sheer size and complexity in terms of the direct and indirect influence it commands across many other industries. While millions of people are employed in the automobile manufacturing industry, it is estimated that more than two and half times that number are employed in the auxiliary companies that supply parts to the automobile manufacturing companies. The auxiliary companies represent a group of businesses of various sizes, types, and geographical locations, producing a vast variety of products ranging from the very simple to the extremely intricate. In this study, the current environmental practices of management in the core Spanish auxiliary companies that do business with the automobile manufacturing industry (and thus form a large part of the automobile manufacturing industry's supply chain) are investigated. We show that while automobile manufacturing companies are under scrutiny to become more and more environmentally friendly, not only at their manufacturing stage but also at their products' useful and EOL stages, there appears to be no such burden on the auxiliary companies. Our conclusion is based on an elaborate survey conducted during the fall of 2004 of Spanish auxiliary companies with questions about the characteristics, environmental practices and reverse logistics related activities carried out by the companies.

  3. Design and Experiment of Auxiliary Bearing for Helium Blower of HTR-PM

    International Nuclear Information System (INIS)

    Yang Guojun; Shi Zhengang; Liu Xingnan; Zhao Jingjing

    2014-01-01

    The helium blower is the important equipment for HTR-PM. Active magnetic bearing (AMB) instead of mechanical bearing is selected to support the rotor of the helium blower. However, one implication of AMB is the requirement to provide the auxiliary bearing to mitigate the effects of failures or overload conditions. The auxiliary bearing is used to support the rotor when the AMB fails to work. It must support the dropping rotor and bear the great impact force and friction heat. The design of the auxiliary bearing is one of the challenging problems in the whole system. It is very important for the helium blower with AMB of HTR-PM to make success. The rotor’s length of helium blower of HTR-PM is about 3.3 m, its weight is about 4000 kg and the rotating speed is 4000 r/min. The axial load is 4500kg, and the radial load is 1950kg. The angular contact ball bearing was selected as the auxiliary bearing. The test rig has been finished. It is difficult to analyze the falling course of the rotor. The preliminary analysis of the dropping rotor was done in the special condition. The impact force of auxiliary bearing was computed for the axial and radial load. And the dropping test of the blower rotor for HTR-10 will be introduced also in this paper. Results offer the important theoretical base for the protector design of the helium blower with AMB for HTR-PM. (author)

  4. Reduction of residual gas in a sputtering system by auxiliary sputter of rare-earth metal

    International Nuclear Information System (INIS)

    Li Dejie

    2002-01-01

    In film deposition by sputtering, the oxidation and nitrification of the sputtered material lead to degradation of film quality, particularly with respect to metal sulfide films. We propose to use auxiliary sputtering as a method to produce a fresh film of rare-earth metal, usually dysprosium (Dy), that absorbs the active gases in a sputtering system, greatly reducing the background pressure and protecting the film from oxidation and nitrification effectively. The influence of the auxiliary sputtering power consumption, sputtering time, and medium gas pressure on the background pressure in the vacuum chamber is investigated in detail. If the auxiliary sputtering power exceeds 120 W and the sputtering time is more than 4 min, the background pressure is only one fourth of the ultimate pressure pumped by an oil diffusion pump. The absorption activity of the sputtered Dy film continues at least an hour after completion of the auxiliary sputter. Applied to film deposition of Ti and ZnS, this technique has been proven to be effective. For the Ti film, the total content of N and O is reduced from 45% to 20% when the auxiliary sputtering power of Dy is 120 W, and the sputtering time is 20 min. In the case of ZnS, the content of O is reduced from 8% to 2%

  5. Total synthesis of cytochrome b562 by native chemical ligation using a removable auxiliary

    Science.gov (United States)

    Low, Donald W.; Hill, Michael G.; Carrasco, Michael R.; Kent, Stephen B. H.; Botti, Paolo

    2001-01-01

    We have completed the total chemical synthesis of cytochrome b562 and an axial ligand analogue, [SeMet7]cyt b562, by thioester-mediated chemical ligation of unprotected peptide segments. A novel auxiliary-mediated native chemical ligation that enables peptide ligation to be applied to protein sequences lacking cysteine was used. A cleavable thiol-containing auxiliary group, 1-phenyl-2-mercaptoethyl, was added to the α-amino group of one peptide segment to facilitate amide bond-forming ligation. The amine-linked 1-phenyl-2-mercaptoethyl auxiliary was stable to anhydrous hydrogen fluoride used to cleave and deprotect peptides after solid-phase peptide synthesis. Following native chemical ligation with a thioester-containing segment, the auxiliary group was cleanly removed from the newly formed amide bond by treatment with anhydrous hydrogen fluoride, yielding a full-length unmodified polypeptide product. The resulting polypeptide was reconstituted with heme and folded to form the functional protein molecule. Synthetic wild-type cyt b562 exhibited spectroscopic and electrochemical properties identical to the recombinant protein, whereas the engineered [SeMet7]cyt b562 analogue protein was spectroscopically and functionally distinct, with a reduction potential shifted by ≈45 mV. The use of the 1-phenyl-2-mercaptoethyl removable auxiliary reported here will greatly expand the applicability of total protein synthesis by native chemical ligation of unprotected peptide segments. PMID:11390992

  6. Simplified technique for auxiliary orthotopic liver transplantation using a whole graft

    Science.gov (United States)

    ROCHA-SANTOS, Vinicius; NACIF, Lucas Souto; PINHEIRO, Rafael Soares; DUCATTI, Liliana; ANDRAUS, Wellington; D'ALBURQUERQUE, Luiz Carneiro

    2015-01-01

    Background Acute liver failure is associated with a high mortality rate and the main purposes of treatment are to prevent cerebral edema and infections, which often are responsible for patient death. The orthotopic liver transplantation is the gold standard treatment and improves the 1-year survival. Aim To describe an alternative technique to auxiliary liver transplant on acute liver failure. Method Was performed whole auxiliary liver transplantation as an alternative technique for a partial auxiliary liver transplantation using a whole liver graft from a child removing the native right liver performed a right hepatectomy. The patient met the O´Grady´s criteria and the rational to indicate an auxiliary orthotopic liver transplantation was the acute classification without hemodynamic instability or renal failure in a patient with deterioration in consciousness. Results The procedure improved liver function and decreased intracranial hypertension in the postoperative period. Conclusion This technique can overcome some postoperative complications that are associated with partial grafts. As far as is known, this is the first case of auxiliary orthotopic liver transplantation in Brazil. PMID:26176253

  7. Dual Dynamic Programming - DDP

    International Nuclear Information System (INIS)

    Velasquez Bermudez, Jesus M

    1998-01-01

    Objections are presented to the mathematical formulation of the denominated Dual Dynamic programming-PDD that is the theoretical base of several computational model available for the optimal formulation of interconnected hydrothermal systems

  8. 30 CFR 57.22208 - Auxiliary fans (I-A, II-A, III, and V-A mines).

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Auxiliary fans (I-A, II-A, III, and V-A mines... fans (I-A, II-A, III, and V-A mines). (a) Auxiliary fans, except fans used in shops and other areas... applicable requirements of 30 CFR part 18, and be operated so that recirculation is minimized. Auxiliary fans...

  9. Sources, compositions, and optical properties of humic-like substances in Beijing during the 2014 APEC summit: Results from dual carbon isotope and Fourier-transform ion cyclotron resonance mass spectrometry analyses.

    Science.gov (United States)

    Mo, Yangzhi; Li, Jun; Jiang, Bin; Su, Tao; Geng, Xiaofei; Liu, Junwen; Jiang, Haoyu; Shen, Chengde; Ding, Ping; Zhong, Guangcai; Cheng, Zhineng; Liao, Yuhong; Tian, Chongguo; Chen, Yingjun; Zhang, Gan

    2018-08-01

    Humic-like substances (HULIS) are a class of high molecular weight, light-absorbing compounds that are highly related to brown carbon (BrC). In this study, the sources and compositions of HULIS isolated from fine particles collected in Beijing, China during the 2014 Asia-Pacific Economic Cooperation (APEC) summit were characterized based on carbon isotope ( 13 C and 14 C) and Fourier-transform ion cyclotron resonance mass spectrometry (FT-ICR MS) analyses, respectively. HULIS were the main light-absorbing components of water-soluble organic carbon (WSOC), accounting for 80.2 ± 6.1% of the WSOC absorption capacity at 365 nm. The carbon isotope data showed that HULIS had a lower non-fossil contribution (53 ± 4%) and were less enriched with 13 C (-24.2 ± 0.6‰) relative to non-HULIS (62 ± 8% and -20.8 ± 0.3‰, respectively). The higher relative intensity fraction of sulfur-containing compounds in HULIS before and after APEC was attributed to higher sulfur dioxide levels emitted from fossil fuel combustion, whereas the higher fraction of nitrogen-containing compounds during APEC may have been due to the relatively greater contribution of non-fossil compounds or the influence of nitrate radical chemistry. The results of investigating the relationships among the sources, elemental compositions, and optical properties of HULIS demonstrated that the light absorption of HULIS appeared to increase with increasing unsaturation degree, but decrease with increasing oxidation level. The unsaturation of HULIS was affected by both sources and aging level. Copyright © 2018 Elsevier Ltd. All rights reserved.

  10. On adjustment for auxiliary covariates in additive hazard models for the analysis of randomized experiments

    DEFF Research Database (Denmark)

    Vansteelandt, S.; Martinussen, Torben; Tchetgen, E. J Tchetgen

    2014-01-01

    We consider additive hazard models (Aalen, 1989) for the effect of a randomized treatment on a survival outcome, adjusting for auxiliary baseline covariates. We demonstrate that the Aalen least-squares estimator of the treatment effect parameter is asymptotically unbiased, even when the hazard...... that, in view of its robustness against model misspecification, Aalen least-squares estimation is attractive for evaluating treatment effects on a survival outcome in randomized experiments, and the primary reasons to consider baseline covariate adjustment in such settings could be interest in subgroup......'s dependence on time or on the auxiliary covariates is misspecified, and even away from the null hypothesis of no treatment effect. We furthermore show that adjustment for auxiliary baseline covariates does not change the asymptotic variance of the estimator of the effect of a randomized treatment. We conclude...

  11. Treatment for chronic daily headache by using auxiliary and alternative methods

    Directory of Open Access Journals (Sweden)

    V. A. Golovacheva

    2015-01-01

    Full Text Available Chronic daily headache (CDH is one of the top 10 causes of adult disability and one of the 5 most common causes of female disability. To treat patients with CDH is one of the most difficult tasks in neurological practice. Difficulties in managing patients with CHD are associated with the high prevalence of comorbid mental disorders, analgesic abuse, pain syndromes at another site, and misconceptions of a patient about his/her disease. A combination of drug and non-drug therapies is the mainstay of the current approach to treating patients with CDH. Standard, alternative, and auxiliary therapies are identified. The paper describes different types of current auxiliary and alternative therapy used in the world’s leading headache centers and clinics. It describes experience with cerebrolysin used as auxiliary and alternative pharmacotherapies for CDH.

  12. Theoretical and numerical analysis of auxiliary heating for cryogenic target fabrication

    International Nuclear Information System (INIS)

    Yang Xiaohu; Tian Chenglin; Yin Yan; Xu Han; Zhuo Hongbin

    2008-01-01

    In order to compensate for the nonspherical-symmetric heat flux in the hohlraum, auxiliary heating is usually applied to the outside wall of the hohlraum during the cooling process. A one-dimensional heat exchange theoretical model has been proposed in the indirect-drive target, to analyze the required auxiliary heat flux. With a two dimensional axisymmetric model, the auxiliary heating mechanism has been simulated by FLUENT code. The optimum heat flux which is 635 W/m 2 has been obtained as the heaters around the outside of the hohlraum about 1.3 mm above and below the mid-plane. The result is in good agreement with the theoretical model. (authors)

  13. Pressurizer /Auxiliary Spray Piping Stress Analysis For Determination Of Lead Shielding Maximum Allow Able Load

    International Nuclear Information System (INIS)

    Setjo, Renaningsih

    2000-01-01

    Piping stress analysis for PZR/Auxiliary Spray Lines Nuclear Power Plant AV Unit I(PWR Type) has been carried out. The purpose of this analysis is to establish a maximum allowable load that is permitted at the time of need by placing lead shielding on the piping system on class 1 pipe, Pressurizer/Auxiliary Spray Lines (PZR/Aux.) Reactor Coolant Loop 1 and 4 for NPP AV Unit one in the mode 5 and 6 during outage. This analysis is intended to reduce the maximum amount of radiation dose for the operator during ISI ( In service Inspection) period.The result shown that the maximum allowable loads for 4 inches lines for PZR/Auxiliary Spray Lines is 123 lbs/feet

  14. Terminal Sliding Mode Control with Unidirectional Auxiliary Surfaces for Hypersonic Vehicles Based on Adaptive Disturbance Observer

    Directory of Open Access Journals (Sweden)

    Naibao He

    2015-01-01

    Full Text Available A novel flight control scheme is proposed using the terminal sliding mode technique, unidirectional auxiliary surfaces and the disturbance observer model. These proposed dynamic attitude control systems can improve control performance of hypersonic vehicles despite uncertainties and external disturbances. The terminal attractor is employed to improve the convergence rate associated with the critical damping characteristics problem noted in short-period motions of hypersonic vehicles. The proposed robust attitude control scheme uses a dynamic terminal sliding mode with unidirectional auxiliary surfaces. The nonlinear disturbance observer is designed to estimate system uncertainties and external disturbances. The output of the disturbance observer aids the robust adaptive control scheme and improves robust attitude control performance. Finally, simulation results are presented to illustrate the effectiveness of the proposed terminal sliding mode with unidirectional auxiliary surfaces.

  15. Aiming of Kirkpatrick-Baez microscope based on auxiliary optical system

    International Nuclear Information System (INIS)

    Huang Shengling; Mu Baozhong; Yi Shengzhen; Wang Xin; Wang Zhanshan; Ding Yongkun; Miao Wenyong; Dong Jianjun

    2009-01-01

    An auxiliary optical system has been designed, which can provide precise positioning for aiming Kirkpatrick-Baez (KB) microscope object location. An 8 keV X-ray imaging system by KB microscope with periodic multilayer films has been designed. The field of view and depth of field in the resolution of 5 μm are got, and then the corresponding point and depth of field in diagnostic experiments are calculated. Based on the object-image relations and precision of the KB microscope, an auxiliary visible light imaging system is designed and X-ray imaging experiments are performed, which can achieve equivalent aiming between the visible imaging system and the KB microscope. The results show that ±20 μm vertical axis plane and ±300 μm axial accuracy are achieved through the auxiliary optical path, which can meet the object point positioning requirements of the KB microscope. (authors)

  16. Dual-Mode Dual-Band Microstrip Bandpass Filter Based on Fourth Iteration T-Square Fractal and Shorting Pin

    Directory of Open Access Journals (Sweden)

    E. S. Ahmed

    2012-06-01

    Full Text Available A new class of dual mode microstrip fractal resonator is proposed and developed for miniaturization of the dual band bandpass filter. The perimeter of the proposed resonator is increased by employing fourth iteration T-square fractal shape. Consequently the lower resonant frequency of the filter is decreased without increasing the usable space. The self similarity of the usable structure enables it to produce the two degenerate modes which are coupled using the proper perturbation technique. The shorting pin is placed at the null in the surface current distribution at the center of the resonator. This shorting pin is coactively coupled to the resonant circuit of the resonator, effectively coupled to the lower degenerate mode and reduces the lower edge band resonant frequency. By adjusting the resonator dimensions and the size of the shorting pin, the resonant frequency and the out-of-band rejection around the transmission bands can be controlled to meet the design requirements. The simulated response of the designed filter has two transmission bands, the first band is from 2.34-3.65 GHz with resonant frequencies at 2.47GHz and 3.55GHz, the second band is from 4.37-5.324GHz with resonant frequencies at 4.5GHz and 5.13GHz. In the pass bands, the group delay is less than 0.65 ns. The proposed filter can be applied to WLAN (2.4 GHz and 5.2 GHz and WiMAX (3.5 GHz and Bluetooth and ZigBee (4.9 GHz.

  17. Solar combisystems with forecast control to increase the solar fraction and lower the auxiliary energy cost

    DEFF Research Database (Denmark)

    Perers, Bengt; Furbo, Simon; Fan, Jianhua

    2011-01-01

    Solar Combi systems still need quite a lot of auxiliary energy especially in small systems without seasonal storage possibilities. The control of the auxiliary energy input both in time and power is important to utilize as much as possible of the solar energy available from the collectors and also...... energy sources. It can be either direct electric heating elements or a heat pump upgrading ambient energy in the air, ground, solar collector or waste heat from the house. The paper describes system modeling and simulation results. Advanced laboratory experiments are also starting now with three...

  18. A new auxiliary equation and exact travelling wave solutions of nonlinear equations

    International Nuclear Information System (INIS)

    Sirendaoreji

    2006-01-01

    A new auxiliary ordinary differential equation and its solutions are used for constructing exact travelling wave solutions of nonlinear partial differential equations in a unified way. The main idea of this method is to take full advantage of the auxiliary equation which has more new exact solutions. More new exact travelling wave solutions are obtained for the quadratic nonlinear Klein-Gordon equation, the combined KdV and mKdV equation, the sine-Gordon equation and the Whitham-Broer-Kaup equations

  19. Generic description of facilities at the shaft head (auxiliary entrance installations) of deep geological repositories

    International Nuclear Information System (INIS)

    2016-10-01

    In a deep geological repository, the access structures function as the link between the surface and the installations and structures at the disposal level. In the planned implementation scenarios, at least two access structures will be in operation up to the time of closure of the repository. The radioactive waste will be transported via the main access from the surface to the disposal level during emplacement operations. For the construction and operation of a deep geological repository, additional access structures are required. These auxiliary accesses and the associated surface infrastructure (e.g. shaft head installations) form the subject of this report. To provide as broad and comprehensive a description as possible, seven types of auxiliary access facilities are defined; these are characterised in line with the current status of planning and their functions and impacts are described. During construction, operation and dismantling of auxiliary access facilities, the usual conventional safety measures (inter alia) have to be observed (e.g. groundwater protection, fire prevention, facility security, accident prevention). Regarding the 'Ordinance on Protection against Major Accidents' no large quantities of hazardous materials, i.e. above the corresponding threshold quantities, are to be expected in the auxiliary access facilities. Proper handling and compliance with applicable regulations in all phases will ensure no hazard to humans and the environment. As no handling of radioactive materials is foreseen in the auxiliary access facilities, and because exhaust air and waste water from the controlled zones of a repository will, in principle, be removed via the main access and not the auxiliary accesses, a safety-relevant emission of radioactive substances and transport of contaminated material can be ruled out for the auxiliary access facilities during both normal operation and also in the case of an accident. Based on the information presented in

  20. The auxiliary field method and approximate analytical solutions of the Schroedinger equation with exponential potentials

    Energy Technology Data Exchange (ETDEWEB)

    Silvestre-Brac, Bernard [LPSC Universite Joseph Fourier, Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, Avenue des Martyrs 53, F-38026 Grenoble-Cedex (France); Semay, Claude; Buisseret, Fabien [Groupe de Physique Nucleaire Theorique, Universite de Mons-Hainaut, Academie universitaire Wallonie-Bruxelles, Place du Parc 20, B-7000 Mons (Belgium)], E-mail: silvestre@lpsc.in2p3.fr, E-mail: claude.semay@umh.ac.be, E-mail: fabien.buisseret@umh.ac.be

    2009-06-19

    The auxiliary field method is a new and efficient way to compute approximate analytical eigenenergies of the Schroedinger equation. This method has already been successfully applied to the case of central potentials of power-law and logarithmic forms. In the present work, we show that the Schroedinger equation with exponential potentials of the form -{alpha}r{sup {lambda}}exp(-{beta}r) can also be analytically solved by using the auxiliary field method. Closed formulae giving the critical heights and the energy levels of these potentials are presented. Special attention is drawn to the Yukawa potential and the pure exponential potential.

  1. The auxiliary field method and approximate analytical solutions of the Schroedinger equation with exponential potentials

    International Nuclear Information System (INIS)

    Silvestre-Brac, Bernard; Semay, Claude; Buisseret, Fabien

    2009-01-01

    The auxiliary field method is a new and efficient way to compute approximate analytical eigenenergies of the Schroedinger equation. This method has already been successfully applied to the case of central potentials of power-law and logarithmic forms. In the present work, we show that the Schroedinger equation with exponential potentials of the form -αr λ exp(-βr) can also be analytically solved by using the auxiliary field method. Closed formulae giving the critical heights and the energy levels of these potentials are presented. Special attention is drawn to the Yukawa potential and the pure exponential potential

  2. Research on vibration properties of auxiliary bearing cage used in HTR-10 GT project

    International Nuclear Information System (INIS)

    Qin Qingquan; Yang Guojun; Shi Zhengang; Yu Suyuan

    2009-01-01

    Auxiliary Bearings (ABs) is one of the most important parts in Active Magnetic Bearing (AMB) system, which was used in HTR-10 GT project. This paper uses finite element method to analyze the centrifugal stress and free vibration properties of the cage according to its work condition. And different geometric parameters of the cage that has effects on its vibration performance are discussed. The results show that the highest centrifugal stress is in the middle of the cage side sill. The low odder vibration modes of the cage can be induced when the auxiliary bearings are working. Proper geometric parameters and ball pocket number can enhance the performance of the cage. (authors)

  3. Review of the Shearon Harris Unit 1 auxiliary feedwater system reliability analysis

    International Nuclear Information System (INIS)

    Fresco, A.; Youngblood, R.; Papazoglou, I.A.

    1986-02-01

    This report presents the results of a review of the Auxiliary Feedwater System Reliability Analysis for the Shearon Harris Nuclear Power Plant (SHNPP) Unit 1. The objective of this report is to estimate the probability that the Auxiliary Feedwater System will fail to perform its mission for each of three different initiators: (1) loss of main feedwater with offsite power available, (2) loss of offsite power, (3) loss of all ac power except vital instrumentation and control 125-V dc/120-V ac power. The scope, methodology, and failure data are prescribed by NUREG-0611 for other Westinghouse plants

  4. Pure spinors as auxiliary fields in the ten-dimensional supersymmetric Yang-Mills theory

    International Nuclear Information System (INIS)

    Nilsson, B.E.W.

    1986-01-01

    A new way of introducing auxiliary fields into the ten-dimensional supersymmetric Yang-Mills theory is proposed. The auxiliary fields are commuting 'pure spinors' and constitute a non-linear realisation of the Lorentz group. This invalidates previous no-go theorems concerning the possibility of going off-shell in this theory. There seems to be a close relation between pure spinors and the concepts usually used in twistor theory. The non-Abelian theory can be constructed for all groups having pseudo-real representations. (author)

  5. A multi-scale permafrost investigation along the Alaska Highway Corridor based on airborne electromagnetic and auxiliary geophysical data

    Science.gov (United States)

    Minsley, B. J.; Kass, M. A.; Bloss, B.; Pastick, N.; Panda, S. K.; Smith, B. D.; Abraham, J. D.; Burns, L. E.

    2012-12-01

    More than 8000 square kilometers of airborne electromagnetic (AEM) data were acquired along the Alaska Highway Corridor in 2005-2006 by the Alaska Department of Natural Resources Division of Geological and Geophysical Surveys. Because this large AEM dataset covers diverse geologic and permafrost settings, it is an excellent testbed for studying the electrical geophysical response from a wide range of subsurface conditions. These data have been used in several recent investigations of geology, permafrost, and infrastructure along the highway corridor. In this study, we build on existing interpretations of permafrost features by re-inverting the AEM data using traditional least squares inversion techniques as well as recently developed stochastic methods aimed at quantifying uncertainty in geophysical data. Ground-based geophysical measurements, including time-domain electromagnetic soundings, surface nuclear magnetic resonance soundings, and shallow frequency-domain electromagnetic profiles, have also been acquired to help validate and extend the AEM interpretations. Here, we focus on the integration of different types of data to yield an improved characterization of permafrost, including: methods to discriminate between geologic and thermal controls on resistivity; identifying relationships between shallow resistivity and active layer thickness by incorporating auxiliary remote sensing data and ground-based measurements; quantifying apparent slope-aspect-resistivity relationships, where south-facing slopes appear less resistive than north-facing slopes within similar geologic settings; and investigating an observed decrease in resistivity beneath several areas associated with recent fires.

  6. Brain activations during bimodal dual tasks depend on the nature and combination of component tasks

    Directory of Open Access Journals (Sweden)

    Emma eSalo

    2015-02-01

    Full Text Available We used functional magnetic resonance imaging to investigate brain activations during nine different dual tasks in which the participants were required to simultaneously attend to concurrent streams of spoken syllables and written letters. They performed a phonological, spatial or simple (speaker-gender or font-shade discrimination task within each modality. We expected to find activations associated specifically with dual tasking especially in the frontal and parietal cortices. However, no brain areas showed systematic dual task enhancements common for all dual tasks. Further analysis revealed that dual tasks including component tasks that were according to Baddeley’s model modality atypical, that is, the auditory spatial task or the visual phonological task, were not associated with enhanced frontal activity. In contrast, for other dual tasks, activity specifically associated with dual tasking was found in the left or bilateral frontal cortices. Enhanced activation in parietal areas, however, appeared not to be specifically associated with dual tasking per se, but rather with intermodal attention switching. We also expected effects of dual tasking in left frontal supramodal phonological processing areas when both component tasks required phonological processing and in right parietal supramodal spatial processing areas when both tasks required spatial processing. However, no such effects were found during these dual tasks compared with their component tasks performed separately. Taken together, the current results indicate that activations during dual tasks depend in a complex manner on specific demands of component tasks.

  7. Multiquark Resonances

    CERN Document Server

    Esposito, A.; Polosa, A.D.

    2016-01-01

    Multiquark resonances are undoubtedly experimentally observed. The number of states and the amount of details on their properties has been growing over the years. It is very recent the discovery of two pentaquarks and the confirmation of four tetraquarks, two of which had not been observed before. We mainly review the theoretical understanding of this sector of particle physics phenomenology and present some considerations attempting a coherent description of the so called X and Z resonances. The prominent problems plaguing theoretical models, like the absence of selection rules limiting the number of states predicted, motivate new directions in model building. Data are reviewed going through all of the observed resonances with particular attention to their common features and the purpose of providing a starting point to further research.

  8. Neuroaesthetic Resonance

    DEFF Research Database (Denmark)

    Brooks, Anthony Lewis

    2013-01-01

    Neuroaesthetic Resonance emerged from a mature body of patient- centered gesture-control research investigating non-formal rehabilitation via ICT-enhanced-Art to question ‘Aesthetic Resonance’. Motivating participation, ludic engagement, and augmenting physical motion in non-formal (fun) treatment...... sessions are achieved via adaptive action-analyzed activities. These interactive virtual environments are designed to empower patients’ creative and/or playful expressions via digital feedback stimuli. Unconscious self- pushing of limits result from innate distractive mechanisms offered by the alternative...... the unencumbered motion-to-computer-generated activities - ‘Music Making’, ‘Painting’, ‘Robotic’ and ‘Video Game’ control. A focus of this position paper is to highlight how Aesthetic Resonance, in this context, relates to the growing body of research on Neuroaesthetics to evolve Neuroaesthetic Resonance....

  9. Baryon Resonances

    International Nuclear Information System (INIS)

    Oset, E.; Sarkar, S.; Sun Baoxi; Vicente Vacas, M.J.; Ramos, A.; Gonzalez, P.; Vijande, J.; Martinez Torres, A.; Khemchandani, K.

    2010-01-01

    In this talk I show recent results on how many excited baryon resonances appear as systems of one meson and one baryon, or two mesons and one baryon, with the mesons being either pseudoscalar or vectors. Connection with experiment is made including a discussion on old predictions and recent results for the photoproduction of the Λ(1405) resonance, as well as the prediction of one 1/2 + baryon state around 1920 MeV which might have been seen in the γp→K + Λ reaction.

  10. Self-dual Hopf quivers

    International Nuclear Information System (INIS)

    Huang Hualin; Li Libin; Ye Yu

    2004-07-01

    We study pointed graded self-dual Hopf algebras with a help of the dual Gabriel theorem for pointed Hopf algebras. Quivers of such Hopf algebras are said to be self-dual. An explicit classification of self-dual Hopf quivers is obtained. We also prove that finite dimensional coradically graded pointed self-dual Hopf algebras are generated by group-like and skew-primitive elements as associative algebras. This partially justifies a conjecture of Andruskiewitsch and Schneider and may help to classify finite dimensional self-dual pointed Hopf algebras

  11. 996 RESONANCE November 2013

    Indian Academy of Sciences (India)

    IAS Admin

    996. RESONANCE. November 2013. Page 2. 997. RESONANCE. November 2013. Page 3. 998. RESONANCE. November 2013. Page 4. 999. RESONANCE. November 2013. Page 5. 1000. RESONANCE. November 2013. Page 6. 1001. RESONANCE. November 2013. Page 7. 1002. RESONANCE. November 2013 ...

  12. 817 RESONANCE September 2013

    Indian Academy of Sciences (India)

    IAS Admin

    817. RESONANCE ⎜ September 2013. Page 2. 818. RESONANCE ⎜ September 2013. Page 3. 819. RESONANCE ⎜ September 2013. Page 4. 820. RESONANCE ⎜ September 2013. Page 5. 821. RESONANCE ⎜ September 2013. Page 6. 822. RESONANCE ⎜ September 2013. Page 7. 823. RESONANCE ⎜ September ...

  13. 369 RESONANCE April 2016

    Indian Academy of Sciences (India)

    IAS Admin

    369. RESONANCE ⎜ April 2016. Page 2. 370. RESONANCE ⎜ April 2016. Page 3. 371. RESONANCE ⎜ April 2016. Page 4. 372. RESONANCE ⎜ April 2016. Page 5. 373. RESONANCE ⎜ April 2016. Page 6. 374. RESONANCE ⎜ April 2016. Page 7. 375. RESONANCE ⎜ April 2016.

  14. Verb Placement in Second Language Acquisition: Experimental Evidence for the Different Behavior of Auxiliary and Lexical Verbs

    Science.gov (United States)

    Verhagen, Josje

    2011-01-01

    This study investigates the acquisition of verb placement by Moroccan and Turkish second language (L2) learners of Dutch. Elicited production data corroborate earlier findings from L2 German that learners who do not produce auxiliaries do not raise lexical verbs over negation, whereas learners who produce auxiliaries do. Data from elicited…

  15. 75 FR 3639 - Revisions to Rules Authorizing the Operation of Low Power Auxiliary Stations in the 698-806 MHz...

    Science.gov (United States)

    2010-01-22

    .... 10-24; DA 10-92] Revisions to Rules Authorizing the Operation of Low Power Auxiliary Stations in the... Auxiliary Stations, Including Wireless Microphones, and the Digital Television Transition AGENCY: Federal... language that must be used in the consumer disclosure that is required by Section 15.216 of Appendix B in...

  16. Teaching Grammar: The Use of The English Auxiliary "BE" Present Tense Verb among Malaysian Form 4 and Form 5 Students

    Science.gov (United States)

    Jishvithaa, Joanna M.; Tabitha, M.; Kalajahi, Seyed Ali Rezvani

    2013-01-01

    This research paper aims to explore the usage of the English Auxiliary "Be" Present Tense Verb, using corpus based method among Malaysian form 4 and form 5 students. This study is conducted by identifying and classifying the types of errors in the Auxiliary "Be" Present Tense verb in students' compositions from the MCSAW corpus…

  17. Acylation, Diastereoselective Alkylation, and Cleavage of an Oxazolidinone Chiral Auxiliary: A Multistep Asymmetric Synthesis Experiment for Advanced Undergraduates

    Science.gov (United States)

    Smith, Thomas E.; Richardson, David P.; Truran, George A.; Belecki, Katherine; Onishi, Megumi

    2008-01-01

    An introduction to the concepts and experimental techniques of diastereoselective synthesis using a chiral auxiliary is described. The 4-benzyl-2-oxazolidinone chiral auxiliary developed by Evans is acylated with propionic anhydride under mild conditions using DMAP as an acyl transfer catalyst. Deprotonation with NaN(TMS)[subscript 2] at -78…

  18. Dual source CT imaging

    International Nuclear Information System (INIS)

    Seidensticker, Peter R.; Hofmann, Lars K.

    2008-01-01

    The introduction of Dual Source Computed Tomography (DSCT) in 2005 was an evolutionary leap in the field of CT imaging. Two x-ray sources operated simultaneously enable heart-rate independent temporal resolution and routine spiral dual energy imaging. The precise delivery of contrast media is a critical part of the contrast-enhanced CT procedure. This book provides an introduction to DSCT technology and to the basics of contrast media administration followed by 25 in-depth clinical scan and contrast media injection protocols. All were developed in consensus by selected physicians on the Dual Source CT Expert Panel. Each protocol is complemented by individual considerations, tricks and pitfalls, and by clinical examples from several of the world's best radiologists and cardiologists. This extensive CME-accredited manual is intended to help readers to achieve consistently high image quality, optimal patient care, and a solid starting point for the development of their own unique protocols. (orig.)

  19. Synchrobetatron resonances

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    At the 1975 Particle Accelerator Conference it was reported that a class of resonances were observed in SPEAR II that had not appeared before in SPEAR I. These resonances occur when the betatron oscillation wave numbers ν/sub x/ or ν/sub y/ and the synchrotron wave number ν/sub s/ satisfy the relation (ν/sub x,y/ - mν/sub s/) = 5, with m an integer denoting the m/sup th/ satellite. The main difference between SPEAR II and SPEAR I is the value of ν/sub s/, which in SPEAR II is approximately 0.04, an order of magnitude larger than in SPEAR I. An ad hoc meeting was held at the 1975 Particle Accelerator Conference, where details of the SPEAR II results were presented and various possible mechanisms for producing these resonances were discussed. Later, experiments were performed at SPEAR to identify the mechanism believed to be the most likely explanation. Some of the current experimental knowledge and theoretical views on the source of these resonances are presented

  20. Autostereogram resonators

    Science.gov (United States)

    Leavey, Sean; Rae, Katherine; Murray, Adam; Courtial, Johannes

    2012-09-01

    Autostereograms, or "Magic Eye" pictures, are repeating patterns designed to give the illusion of depth. Here we discuss optical resonators that create light patterns which, when viewed from a suitable position by a monocular observer, are autostereograms of the three-dimensional shape of one of the mirror surfaces.

  1. From Root Infinitive to Finite Sentence : The acquisition of verbal inflections and auxiliaries

    NARCIS (Netherlands)

    Blom, W.B.T.

    2003-01-01

    Across languages, children in the earliest stages of syntactic development tend to omit overt markings of finiteness, such as verbal inflections and auxiliaries: when children use a verb, they use an infinitival form (e.g. Dutch) or a bare stem (e.g. English). From Root Infinitive to Finite Sentence

  2. Compact driver, notably for a light emitting diode, having an auxiliary output

    NARCIS (Netherlands)

    2015-01-01

    The current invention relates to a driver(10,20) for driving at least one main load and one auxiliary load comprising: ä power converter(101) adapted to convert an input voltage(Vin) into at least one main output voltage provided through a main output(1011) for driving said main load, and at least

  3. Development of Intelligent Auxiliary System for Customized Physical Fitness and Healthcare

    Directory of Open Access Journals (Sweden)

    Huang Chung-Chi

    2016-01-01

    Full Text Available With the advent of global high-tech industry and commerce era, the sedentary reduces opportunities of physical activity. And physical fitness and health of people is getting worse and worse. At present, the shortage of physical fitness instructors greatly affected the effectiveness of health promotion. Therefore, it is necessary to develop an auxiliary system which can reduce the workload of instructors and enhance physical fitness and health for people. But current general physical fitness and healthcare system is hard to meet individualized needs. The main purpose of this research is to develop an intelligent auxiliary system for customized physical fitness and healthcare. It records all processes of physical fitness and healthcare system by wireless sensors network. The results of intelligent auxiliary systems for customized physical fitness and healthcare will be generated by fuzzy logic Inference. It will improve individualized physical fitness and healthcare. Finally, we will demonstrate the advantages of the intelligent auxiliary system for customized physical fitness and healthcare.

  4. Harmonic Analysis and Mitigation of Low- Frequency Switching Voltage Source Inverter with Auxiliary VSI

    DEFF Research Database (Denmark)

    Bai, Haofeng; Wang, Xiongfei; Blaabjerg, Frede

    2018-01-01

    The output currents of high-power Voltage Source Inverters (VSIs) are distorted by the switching harmonics and the background harmonics in the grid voltage. This paper presents an active harmonic filtering scheme for high-power, low-frequency switching VSIs with an additional auxiliary VSI. In th...

  5. Auxiliary Verbs, Dictionaries and the Late Evolution of the Italian Language

    Science.gov (United States)

    Kinder, John J.

    2004-01-01

    The use of BE as an auxiliary verb with intransitive verbs has declined in all the Romance languages over the past five centuries. Today, Spanish and Portuguese use only HAVE, in Catalan and Romanian BE occurs in marginal contexts, and in French, BE is used with approximately 40 verbs. Italian is a notable exception, since BE is still used as the…

  6. Meaningful questions: The acquisition of auxiliary inversion in a connectionist model of sentence production.

    Science.gov (United States)

    Fitz, Hartmut; Chang, Franklin

    2017-09-01

    Nativist theories have argued that language involves syntactic principles which are unlearnable from the input children receive. A paradigm case of these innate principles is the structure dependence of auxiliary inversion in complex polar questions (Chomsky, 1968, 1975, 1980). Computational approaches have focused on the properties of the input in explaining how children acquire these questions. In contrast, we argue that messages are structured in a way that supports structure dependence in syntax. We demonstrate this approach within a connectionist model of sentence production (Chang, 2009) which learned to generate a range of complex polar questions from a structured message without positive exemplars in the input. The model also generated different types of error in development that were similar in magnitude to those in children (e.g., auxiliary doubling, Ambridge, Rowland, & Pine, 2008; Crain & Nakayama, 1987). Through model comparisons we trace how meaning constraints and linguistic experience interact during the acquisition of auxiliary inversion. Our results suggest that auxiliary inversion rules in English can be acquired without innate syntactic principles, as long as it is assumed that speakers who ask complex questions express messages that are structured into multiple propositions. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. A Polyethylene Moderator Design for Auxiliary Ex-core Neutron Detector

    International Nuclear Information System (INIS)

    Lee, Hwan Soo; Shin, Ho Cheol; Bae, Seong Man

    2012-01-01

    The moderator of detector assembly in ENFMS (Excore Neutron Flux Monitoring System) plays a key role for slowing down from fast neutron to thermal neutron at outside of reactor vessel. Since neutron monitoring detector such as BF3, fission chamber detectors mostly responds to thermal neutron, moderator should be included to neutron detector assembly to detect more efficiently. Generally, resin has been used for moderator of detector in ENFMS of OPR1000 and APR1400, because resin has stable thermal resistance, availability and high neutron moderation characteristics due to the light atomic materials. In case of an auxiliary ex-core neutron detector, the polyethylene is suggested that polyethylene has a better moderator rather than resin, then, the amounts of moderator are reduced. This is important thing for auxiliary ex-core detector equipment at reactor, because the auxiliary equipment should affect minimally to another system. In this study, polyethylene moderator is designed for auxiliary ex-core neutron detector. To find out the optimal thickness of polyethylene moderator, preliminary simulation and experiments are performed. And sensitivity simulation for detector moderator at actual reactor is performed by DORT code

  8. Computer determination of event maps with application to auxiliary supply systems

    International Nuclear Information System (INIS)

    Wredenberg, L.; Billinton, R.

    1975-01-01

    A method of evaluating the reliability of sequential operations in systems containing standby and alternate supply facilities is presented. The method is based upon the use of a digital computer for automatic development of event maps. The technique is illustrated by application to a nuclear power plant auxiliary supply system. (author)

  9. Are Modal Auxiliaries in Malaysian English Language Textbooks in Line with Their Usage in Real Language?

    Science.gov (United States)

    Khojasteh, Laleh; Kafipour, Reza

    2012-01-01

    Based on the discrepancies found in many Malaysian English language textbooks, a detailed analysis on the way modal auxiliary verb forms and their semantic functions were introduced and presented in texts and exercises in five Malaysian textbooks was done. For that to be achieved, a qualitative page-by-page content analysis was applied. From the…

  10. Effect of subject types on the production of auxiliary is in young English-speaking children.

    Science.gov (United States)

    Guo, Ling-Yu; Owen, Amanda J; Tomblin, J Bruce

    2010-12-01

    In this study, the authors tested the unique checking constraint (UCC) hypothesis and the usage-based approach concerning why young children variably use tense and agreement morphemes in obligatory contexts by examining the effect of subject types on the production of auxiliary is. Twenty typically developing 3-year-olds were included in this study. The children's production of auxiliary is was elicited in sentences with pronominal subjects, high-frequency lexical noun phrase (NP) subjects (e.g., the dog), and low-frequency lexical NP subjects (e.g., the deer). As a group, children did not use auxiliary is more accurately with pronominal subjects than with lexical NP subjects. Furthermore, individual data revealed that although some children used auxiliary is more accurately with pronominal subjects than with lexical NP subjects, the majority of children did not show this trend. The symmetry observed between lexical and pronominal subjects supports the predictions of the UCC hypothesis, although additional mechanisms may be needed to account for the asymmetry between subject types in some individual children. Discrepant results between the present study and previous studies were attributed to differences in task formats and children's developmental levels.

  11. Words without Grammar: Linguists and the International Auxiliary Language Movements in the United States.

    Science.gov (United States)

    Falk, Julia S.

    1995-01-01

    Discusses movements in the United States during the first half of the 20th century to develop an international language, focusing on proponents of the reestablishment of Latin as an international language and the work of the International Auxiliary Language Association to develop an entirely new language. (72 references) (MDM)

  12. The Status of the Auxiliary "Do" in L1 and L2 English Negative Clauses

    Science.gov (United States)

    Perales, Susana

    2010-01-01

    This paper addresses the issue of whether negative sentences containing auxiliary "do" in L1 and L2 English share the same underlying syntactic representation. To this end, I compare the negative sentences produced by 77 bilingual (Spanish/Basque) L2 learners of English with the corresponding data available for L1 acquirers reported on in Schutze…

  13. Effect of Subject Types on the Production of Auxiliary "Is" in Young English-Speaking Children

    Science.gov (United States)

    Guo, Ling-Yu; Owen, Amanda J.; Tomblin, J. Bruce

    2010-01-01

    Purpose: In this study, the authors tested the unique checking constraint (UCC) hypothesis and the usage-based approach concerning why young children variably use tense and agreement morphemes in obligatory contexts by examining the effect of subject types on the production of auxiliary "is". Method: Twenty typically developing 3-year-olds were…

  14. Dummy Auxiliaries in the Second Language Acquisition of Moroccan Learners of Dutch: Form and Function

    Science.gov (United States)

    van de Craats, Ineke; van Hout, Roeland

    2010-01-01

    This study examines an interlanguage in which Moroccan learners of Dutch use non-thematic verbs in combination with thematic verbs that can be inflected as well. These non-thematic verbs are real dummy auxiliaries because they are deprived of semantic content and primarily have a syntactic function. Whereas in earlier second language (L2) research…

  15. Auxiliary BE Production by African American English-Speaking Children with and without Specific Language Impairment

    Science.gov (United States)

    Garrity, April W.; Oetting, Janna B.

    2010-01-01

    Purpose: To examine 3 forms ("am," "is," "are") of auxiliary BE production by African American English (AAE)-speaking children with and without specific language impairment (SLI). Method: Thirty AAE speakers participated: 10 six-year-olds with SLI, 10 age-matched controls, and 10 language-matched controls. BE production was examined through…

  16. Natural convection in an asymmetrically heated vertical channel with an adiabatic auxiliary plate

    International Nuclear Information System (INIS)

    Taieb, Soumaya; Hatem, Laatar Ali; Balti, Jalloul

    2013-01-01

    The effect of an auxiliary plate on natural convection in an asymmetrically heated channel is studied numerically in laminar regime. The computational procedure is made by solving the unsteady two dimensional Navier-Stokes and energy equations. This nonlinear system is integrated by a finite volume approach and then solved in time using the projection method, allowing the decoupling pressure from velocity. More than hundred simulations are performed to determine the best positions of the auxiliary plate that enhance the induced mass flow and the heat transfer rate for modified Rayleigh numbers ranging from Ra m = 10 2 to Ra m = 10 5 . Contour maps are plotted and then used to precise the enhancement rates of the mass flow and the heat transfer for any position of the auxiliary plate in the channel. The numerical results (velocity, pressure and temperature fields) provide detailed information about the evolution of the flow structure according to the geometry considered in this study. In addition, they permit to explain why the mass flow rate and Nusselt number are enhanced for certain positions of the auxiliary plate and are on the contrary deteriorated for others. (authors)

  17. Progress in the integration of the ITER plant systems in auxiliary buildings

    International Nuclear Information System (INIS)

    Kotamäki, M.; Cordier, J.-J.; Kuehn, I.; Perrin, J.-L.; Sweeney, S.; Villedary, B.

    2016-01-01

    Highlights: • Usage of 3D CAD model in ITER configuration management presented. • 3D CAD models efficient in configuration and interface management. • Costly and schedule delaying changes avoided with proper interface management. • ITER buildings construction progressing. - Abstract: The ITER Tokamak machine is located in the center of Tokamak complex buildings consisting of Tokamak, Diagnostic, and Tritium buildings. Around the Tokamak complex there are over 30 auxiliary buildings housing various plant systems serving the Tokamak machine either directly or indirectly. The layout and space allocation of each auxiliary building and plant systems housed by the building are represented in the so-called Configuration Management Models (CMM). These are light 3D CAD models that define the required space envelope and the physical interfaces between the systems and the buildings and in-between the systems. The paper describes the CMM and interface management processes of the ITER auxiliary buildings and plant systems, and discusses the preparations for the plant installation phase. In addition, the current baseline configuration of the ITER plant systems in auxiliary buildings is described together with the recent developments in the configuration of different systems, as well as the current status of the construction of the buildings.

  18. Introduction to deaerator in auxiliary water supply system of nuclear power plant

    International Nuclear Information System (INIS)

    Dong Jianguo; Zhou Xia; Lei Yongxia

    2015-01-01

    The paper introduces the operation theory and thermal calculation and verification requirements for the deaerator in the auxiliary water supply system of nuclear power plant. In addition, it describes the key factors in terms of function, structure, design and fabrication of equipment. (authors)

  19. (S)-1-Aminoindane : synthesis by chirality transfer using (R)-phenylglycine amide as chiral auxiliary

    NARCIS (Netherlands)

    Uiterweerd, Patrick G.H.; Sluis, Marcel van der; Kaptein, Bernard; Lange, Ben de; Kellogg, Richard M.; Broxterman, Quirinus B.

    2003-01-01

    A practical asymmetric synthesis of nearly enantiomerically pure (S)-1-aminoindane has been developed. The key step involves the diastereoselective heterogeneous metal-catalyzed reduction of the ketimine of 1-indanone with the chiral auxiliary (R)-phenylglycine amide. The selectivity of the

  20. Preliminary report on the development of rf auxiliary heating systems for TEPR-1

    International Nuclear Information System (INIS)

    Reed, B.W.; Bowen, O.N.; Hill, H.M.; Lawson, J.Q.; Newman, W.G.; Sivo, A.J.

    1977-12-01

    Conceptual designs for 50 MW (expandable to 100 MW) ICRF and LHRF heating systems suitable for auxiliary heating of the TEPR-1 plasma to ignition temperatures are presented. Engineering milestones are enumerated and the extensions of current technology required for successful completion of the project are identified

  1. Vehicle energy management for on/off controlled auxiliaries : fuel economy vs. switching frequency

    NARCIS (Netherlands)

    Chen, H.; Kessels, J.T.B.A.; Weiland, S.

    2015-01-01

    In this paper, an integrated approach for designing energy management strategies concerning vehicle auxiliaries with on/off control is proposed. This approach provides the possibility of making different trade-offs between fuel economy and switching frequency. In this paper, we demonstrate the

  2. Speckle Interferometry with the McMath-Pierce East Auxiliary Telescope

    Science.gov (United States)

    Harshaw, Richard; Ray, Jimmy; Douglass, David; Prause, Lori; Genet, Russell

    2015-09-01

    Engineering runs and tests on the McMath-Pierce 0.8 meter East Auxiliary telescope successfully configured the telescope for speckle interferometry observations of close visual double stars. This paper reports the procedure and results of the speckle analysis of four double stars.

  3. Application of the Method of Auxiliary Sources for the Analysis of Electromagnetic Scattering by Impedance Spheres

    DEFF Research Database (Denmark)

    Karamehmedovic, Mirza; Breinbjerg, Olav

    2002-01-01

    The Method of Auxiliary Sources (MAS) is applied to 3D scattering problems involving spherical impedance scatterers. The MAS results are compared with the reference spherical wave expansion (SWE) solution. It is demonstrated that good agreement is achieved between the MAS and SWE results....

  4. The auxiliary elliptic-like equation and the exp-function method

    Indian Academy of Sciences (India)

    exact solutions of the nonlinear evolution equations are derived with the aid of auxiliary elliptic-like equation. ... (NEE) have been paid attention by many researchers, especially the investigations of exact solutions for ... elliptic-like equation with the aid of the travelling wave reduction are introduced. The exact solutions of ...

  5. Reliability analysis of the auxiliary feedwater system; Analiza zanesljivosti sistema pomozne napajalne vode

    Energy Technology Data Exchange (ETDEWEB)

    Susnik, J; Dusic, M [Institut Jozef Stefan, Ljubljana (Yugoslavia)

    1984-07-01

    The reliability of a NPP auxiliary feedwater system is evaluated using the fault tree analysis. The system is analyzed during the time interval 0 to 6 hours with the computer package program PREP/KITT which is described in more detail. (author)

  6. Progress in the integration of the ITER plant systems in auxiliary buildings

    Energy Technology Data Exchange (ETDEWEB)

    Kotamäki, M., E-mail: miikka.kotamaki@iter.org; Cordier, J.-J.; Kuehn, I.; Perrin, J.-L.; Sweeney, S.; Villedary, B.

    2016-11-01

    Highlights: • Usage of 3D CAD model in ITER configuration management presented. • 3D CAD models efficient in configuration and interface management. • Costly and schedule delaying changes avoided with proper interface management. • ITER buildings construction progressing. - Abstract: The ITER Tokamak machine is located in the center of Tokamak complex buildings consisting of Tokamak, Diagnostic, and Tritium buildings. Around the Tokamak complex there are over 30 auxiliary buildings housing various plant systems serving the Tokamak machine either directly or indirectly. The layout and space allocation of each auxiliary building and plant systems housed by the building are represented in the so-called Configuration Management Models (CMM). These are light 3D CAD models that define the required space envelope and the physical interfaces between the systems and the buildings and in-between the systems. The paper describes the CMM and interface management processes of the ITER auxiliary buildings and plant systems, and discusses the preparations for the plant installation phase. In addition, the current baseline configuration of the ITER plant systems in auxiliary buildings is described together with the recent developments in the configuration of different systems, as well as the current status of the construction of the buildings.

  7. Auxiliary VHF transmitter to aid recovery of solar Argos/GPS PTTs

    Science.gov (United States)

    Christopher P. Hansen; Mark A. Rumble; R. Scott Gamo; Joshua J. Millspaugh

    2014-01-01

    While conducting greater sage-grouse (Centrocercus urophasianus) research, we found that solar-powered global positioning systems platform transmitter terminals (GPS PTTs) can be lost if the solar panel does not receive adequate sunlight. Thus, we developed 5-g (mortality sensor included; Prototype A) and 9.8-g (no mortality sensor; Prototype B) auxiliary very high...

  8. 30 CFR 18.22 - Boring-type machines equipped for auxiliary face ventilation.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Boring-type machines equipped for auxiliary..., DEPARTMENT OF LABOR TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS ELECTRIC MOTOR-DRIVEN MINE EQUIPMENT AND ACCESSORIES Construction and Design Requirements § 18.22 Boring-type machines equipped for...

  9. Harbingers of Artin's Reciprocity Law. I. The Continuing Story of Auxiliary Primes

    OpenAIRE

    Lemmermeyer, Franz

    2011-01-01

    In this article we present the history of auxiliary primes used in proofs of reciprocity laws from the quadratic to Artin's reciprocity law. We also show that the gap in Legendre's proof can be closed with a simple application of Gauss's genus theory.

  10. Catalytic Reforming of Higher Hydrocarbon Fuels to Hydrogen: Process Investigations with Regard to Auxiliary Power Units

    OpenAIRE

    Kaltschmitt, Torsten

    2012-01-01

    This thesis discusses the investigation of the catalytic partial oxidation on rhodium-coated honeycomb catalysts with respect to the conversion of a model surrogate fuel and commercial diesel fuel into hydrogen for the use in auxiliary power units. Furthermore, the influence of simulated tail-gas recycling was investigated.

  11. Histochemical demonstration of creatine kinase activity using polyvinyl alcohol and auxiliary enzymes

    NARCIS (Netherlands)

    Frederiks, W. M.; Marx, F.; van Noorden, C. J.

    1987-01-01

    Creatine kinase activity (EC 2.7.3.2.) has been demonstrated in myocardium and skeletal muscle from rats by a method based on the incubation of cryostat sections with a polyvinyl alcohol-containing medium and the use of auxiliary enzymes. Hexokinase and glucose-6-phosphate dehydrogenase were spread

  12. Dual Pathology of Mandible.

    Science.gov (United States)

    Rajurkar, Suday G; Deshpande, Mohan D; Kazi, Noaman; Jadhav, Dhanashree; Ranadive, Pallavi; Ingole, Snehal

    2017-01-01

    Aneurysmal Bone cyst (ABC)is a rare benign lesion of the bone which is infrequent in craniofacial region (12%). Rapid growth pattern causing bone expansion and facial asymmetry is a characteristic feature of ABC. Giant cell lesion is another distinct pathological entity. Here we present to you a rare case of dual pathology in an 11 year old female patient who presented with a large expansile lesion in the left hemimandible. All radiographic investigations were suggestive of ABC, aspiration of the lesion resulted in blood aspirate. However only after a histologic examination the dual nature of the lesion was revealed.

  13. Dual phase evolution

    CERN Document Server

    Green, David G; Abbass, Hussein A

    2014-01-01

    This book explains how dual phase evolution operates in all these settings and provides a detailed treatment of the subject. The authors discuss the theoretical foundations for the theory, how it relates to other phase transition phenomena and its advantages in evolutionary computation and complex adaptive systems. The book provides methods and techniques to use this concept for problem solving. Dual phase evolution concerns systems that evolve via repeated phase shifts in the connectivity of their elements. It occurs in vast range of settings, including natural systems (species evolution, landscape ecology, geomorphology), socio-economic systems (social networks) and in artificial systems (annealing, evolutionary computing).

  14. Dual-Mode Combustor

    Science.gov (United States)

    Trefny, Charles J (Inventor); Dippold, Vance F (Inventor)

    2013-01-01

    A new dual-mode ramjet combustor used for operation over a wide flight Mach number range is described. Subsonic combustion mode is usable to lower flight Mach numbers than current dual-mode scramjets. High speed mode is characterized by supersonic combustion in a free-jet that traverses the subsonic combustion chamber to a variable nozzle throat. Although a variable combustor exit aperture is required, the need for fuel staging to accommodate the combustion process is eliminated. Local heating from shock-boundary-layer interactions on combustor walls is also eliminated.

  15. Performance assessment of auxiliary bearing in HTR-10 AMB helium circulator on the event of rotor drop

    International Nuclear Information System (INIS)

    Xiao Zhen; Yang Guojun; Li Yue; Shi Zhengang; Yu Suyuan

    2014-01-01

    In this paper, a model for analyzing internal contact stress arid external load of ball bearing from rotor displacement was developed based on the Hertz contact theory and applied to the analysis of the rotor drop test in HTR-10 helium circulator equipped with AMB (Active Magnetic Bearing) to gain a better understanding of auxiliary bearing performance at different stages after the rotor drop. It was shown that the auxiliary bearing can well resist axial impact produced by rotor drop, avoiding of internal severe plastic deformation and damage to the performance of the auxiliary bearing. Rotor's rotary motion and the heat accumulation of the inner ring resulted from the initial acute acceleration are the main contributor of radial load during the rotor idling and may cause the failure of auxiliary bearing. This paper analyzed the influence of this load and confirmed that the auxiliary bearing can still work in its loading limits. (authors)

  16. Dual-anticipating, dual and dual-lag synchronization in modulated time-delayed systems

    International Nuclear Information System (INIS)

    Ghosh, Dibakar; Chowdhury, A. Roy

    2010-01-01

    In this Letter, dual synchronization in modulated time delay system using delay feedback controller is proposed. Based on Lyapunov stability theory, we suggest a general method to achieve the dual-anticipating, dual, dual-lag synchronization of time-delayed chaotic systems and we find both its existing and sufficient stability conditions. Numerically it is shown that the dual synchronization is also possible when driving system contain two completely different systems. Effect of parameter mismatch on dual synchronization is also discussed. As an example, numerical simulations for the Mackey-Glass and Ikeda systems are conducted, which is in good agreement with the theoretical analysis.

  17. Multireference Density Functional Theory with Generalized Auxiliary Systems for Ground and Excited States.

    Science.gov (United States)

    Chen, Zehua; Zhang, Du; Jin, Ye; Yang, Yang; Su, Neil Qiang; Yang, Weitao

    2017-09-21

    To describe static correlation, we develop a new approach to density functional theory (DFT), which uses a generalized auxiliary system that is of a different symmetry, such as particle number or spin, from that of the physical system. The total energy of the physical system consists of two parts: the energy of the auxiliary system, which is determined with a chosen density functional approximation (DFA), and the excitation energy from an approximate linear response theory that restores the symmetry to that of the physical system, thus rigorously leading to a multideterminant description of the physical system. The electron density of the physical system is different from that of the auxiliary system and is uniquely determined from the functional derivative of the total energy with respect to the external potential. Our energy functional is thus an implicit functional of the physical system density, but an explicit functional of the auxiliary system density. We show that the total energy minimum and stationary states, describing the ground and excited states of the physical system, can be obtained by a self-consistent optimization with respect to the explicit variable, the generalized Kohn-Sham noninteracting density matrix. We have developed the generalized optimized effective potential method for the self-consistent optimization. Among options of the auxiliary system and the associated linear response theory, reformulated versions of the particle-particle random phase approximation (pp-RPA) and the spin-flip time-dependent density functional theory (SF-TDDFT) are selected for illustration of principle. Numerical results show that our multireference DFT successfully describes static correlation in bond dissociation and double bond rotation.

  18. ASCERTAINMENT OF ELECTRIC-SUPPLY SCHEMES RELIABILITY FOR THE ATOMIC POWER PLANT AUXILIARIES

    Directory of Open Access Journals (Sweden)

    A. L. Starzhinskij

    2015-01-01

    Full Text Available The paper completes ascertainment of electrical-supply scheme reliability for the auxiliaries of a nuclear power plant. Thereat the author considers the system behavior during the block normal operation, carrying out current maintenance, and capital repairs in combination with initiating events. The initiating events for reactors include complete blackout, i.e. the loss of outside power supply (normal and reserve; emergency switching one of the working turbogenerators; momentary dumping the normal rating to the level of auxiliaries with seating the cutout valve of one turbo-generator. The combination of any initiating event with the repairing mode in case of one of the system elements failure should not lead to blackout occurrence of more than one system of the reliable power supply. This requirement rests content with the help of the reliable power supply system self-dependence (electrical and functional and the emergency power-supply operational autonomy (diesel generator and accumulator batteries.The reliability indicators of the power supply system for the nuclear power plant auxiliaries are the conditional probabilities of conjoined blackout of one, two, and three sections of the reliable power supply conditional upon an initiating event emerging and the blackout of one, two, and three reliable power-supply sections under the normal operational mode. Furthermore, they also are the blackout periodicity of one and conjointly two, three, and four sections of normal operation under the block normal operational mode. It is established that the blackout of one bus section of normal operation and one section of reliable power-supply system of the auxiliaries that does not lead to complete blackout of the plant auxiliaries may occur once in three years. The probability of simultaneous power failure of two or three normal-operation sections and of two reliable power-supply sections during the power plant service life is unlikely.

  19. spinning self-dual particles

    International Nuclear Information System (INIS)

    Gamboa, J.; Rivelles, V.O.

    1989-01-01

    Self-dual particles in two-dimensions are presented. They were obtained from chiral boson particle by square root technique. The propagator of spinning self-dual particle is calculated using the BFV formalism. (M.C.K.)

  20. Dual Smarandache Curves and Smarandache Ruled Surfaces

    OpenAIRE

    Tanju KAHRAMAN; Mehmet ÖNDER; H. Hüseyin UGURLU

    2013-01-01

    In this paper, by considering dual geodesic trihedron (dual Darboux frame) we define dual Smarandache curves lying fully on dual unit sphere S^2 and corresponding to ruled surfaces. We obtain the relationships between the elements of curvature of dual spherical curve (ruled surface) x(s) and its dual Smarandache curve (Smarandache ruled surface) x1(s) and we give an example for dual Smarandache curves of a dual spherical curve.

  1. Dual Coding in Children.

    Science.gov (United States)

    Burton, John K.; Wildman, Terry M.

    The purpose of this study was to test the applicability of the dual coding hypothesis to children's recall performance. The hypothesis predicts that visual interference will have a small effect on the recall of visually presented words or pictures, but that acoustic interference will cause a decline in recall of visually presented words and…

  2. Dual beam vidicon digitizer

    International Nuclear Information System (INIS)

    Evans, T.L.

    1976-01-01

    A vidicon waveform digitizer which can simultaneously digitize two independent signals has been developed. Either transient or repetitive waveforms can be digitized with this system. A dual beam oscilloscope is used as the signal input device. The light from the oscilloscope traces is optically coupled to a television camera, where the signals are temporarily stored prior to digitizing

  3. Dual QCD: A review

    International Nuclear Information System (INIS)

    Baker, M.; Ball, J.S.; Zachariasen, F.

    1991-01-01

    We review the attempts to use dual (electric) vector potentials rather than the standard magnetic vector potentials to describe QCD, particularly in the infrared regime. The use of dual potentials is motivated by the fact that in classical electrodynamics, in a medium with a dielectric constant vanishing at small momenta (as is believed to be the case in QCD), electric potentials provide a far more convenient language than do magnetic potentials. To begin with, we outline attempts to construct the QCD Lagrangian in terms of dual potentials and describe the various possibilities, their shortcomings and advantages, which so far exist. We then proceed to use the most attractive (albeit consistent as a field theory only at the tree level) of these Lagrangians in a number of applications. We show that it describes a non-Abelian dual superconductor (so that it automatically confines color), derive the static quark-antiquark potential, and various temperature dependent effects, such as deconfinement and chiral symmetry breaking. (orig.)

  4. Dual completion method

    Energy Technology Data Exchange (ETDEWEB)

    Mamedov, N Ya; Kadymova, K S; Dzhafarov, Sh T

    1963-10-28

    One type of dual completion method utilizes a single tubing string. Through the use of the proper tubing equipment, the fluid from the low-productive upper formation is lifted by utilizing the surplus energy of a submerged pump, which handles the production from the lower stratum.

  5. Dual ionization chamber

    International Nuclear Information System (INIS)

    Mallory, J.; Turlej, Z.

    1981-01-01

    Dual ionization chambers are provided for use with an electronic smoke detector. The chambers are separated by electrically-conductive partition. A single radiation source extends through the partition into both chambers, ionizing the air in each. The mid-point current of the device may be balanced by adjusting the position of the source

  6. Resonating Statements

    DEFF Research Database (Denmark)

    Hjelholt, Morten; Jensen, Tina Blegind

    2015-01-01

    IT projects are often complex arrangements of technological components, social actions, and organizational transformation that are difficult to manage in practice. This paper takes an analytical discourse perspective to explore the process of legitimizing IT projects. We introduce the concept...... of resonating statements to highlight how central actors navigate in various discourses over time. Particularly, the statements and actions of an IT project manager are portrayed to show how individuals can legitimize actions by connecting statements to historically produced discourses. The case study...... as part of a feedback loop to re-attach the localized IT project to the broader national discourse. The paper concludes with reflections on how to actively build on resonating statements as a strategic resource for legitimizing IT projects...

  7. Gravitoelectromagnetic resonances

    International Nuclear Information System (INIS)

    Tsagas, Christos G.

    2011-01-01

    The interaction between gravitational and electromagnetic radiation has a rather long research history. It is well known, in particular, that gravity-wave distortions can drive propagating electromagnetic signals. Since forced oscillations provide the natural stage for resonances to occur, gravitoelectromagnetic resonances have been investigated as a means of more efficient gravity-wave detection methods. In this report, we consider the coupling between the Weyl and the Maxwell fields on a Minkowski background, which also applies to astrophysical environments where gravity is weak, at the second perturbative level. We use covariant methods that describe gravitational waves via the transverse component of the shear, instead of pure-tensor metric perturbations. The aim is to calculate the properties of the electromagnetic signal, which emerges from the interaction of its linear counterpart with an incoming gravitational wave. Our analysis shows how the wavelength and the amplitude of the gravitationally driven electromagnetic wave vary with the initial conditions. More specifically, for certain initial data, the amplitude of the induced electromagnetic signal is found to diverge. Analogous, diverging, gravitoelectromagnetic resonances were also reported in cosmology. Given that, we extend our Minkowski space study to cosmology and discuss analogies and differences in the physics and in the phenomenology of the Weyl-Maxwell coupling between the aforementioned two physical environments.

  8. Magnetic resonance annual 1986

    International Nuclear Information System (INIS)

    Kressel, H.Y.

    1986-01-01

    This book contains papers written on magnetic resonance during 1986. Topics include: musculosketetal magnetic resonance imaging; imaging of the spine; magnetic resonance chemical shift imaging; magnetic resonance imaging in the central nervous system; comparison to computed tomography; high resolution magnetic resonance imaging using surface coils; magnetic resonance imaging of the chest; magnetic resonance imaging of the breast; magnetic resonance imaging of the liver; magnetic resonance spectroscopy of neoplasms; blood flow effects in magnetic resonance imaging; and current and potential applications of clinical sodium magnetic resonance imaging

  9. Dual Orlicz geominimal surface area

    Directory of Open Access Journals (Sweden)

    Tongyi Ma

    2016-02-01

    Full Text Available Abstract The L p $L_{p}$ -geominimal surface area was introduced by Lutwak in 1996, which extended the important concept of the geominimal surface area. Recently, Wang and Qi defined the p-dual geominimal surface area, which belongs to the dual Brunn-Minkowski theory. In this paper, based on the concept of the dual Orlicz mixed volume, we extend the dual geominimal surface area to the Orlicz version and give its properties. In addition, the isoperimetric inequality, a Blaschke-Santaló type inequality, and the monotonicity inequality for the dual Orlicz geominimal surface areas are established.

  10. 1004 RESONANCE November 2013

    Indian Academy of Sciences (India)

    IAS Admin

    1004. RESONANCE │ November 2013. Page 2. 1005. RESONANCE │ November 2013. Page 3. 1006. RESONANCE │ November 2013. Page 4. 1007. RESONANCE │ November 2013. Page 5. 1008. RESONANCE │ November 2013. Page 6. 1009. RESONANCE │ November 2013. Page 7. 1010. RESONANCE ...

  11. Even order snake resonances

    International Nuclear Information System (INIS)

    Lee, S.Y.

    1993-01-01

    We found that the perturbed spin tune due to the imperfection resonance plays an important role in beam depolarization at snake resonances. We also found that even order snake resonances exist in the overlapping intrinsic and imperfection resonances. Due to the perturbed spin tune shift of imperfection resonances, each snake resonance splits into two

  12. Quantum damped oscillator I: Dissipation and resonances

    International Nuclear Information System (INIS)

    Chruscinski, Dariusz; Jurkowski, Jacek

    2006-01-01

    Quantization of a damped harmonic oscillator leads to so called Bateman's dual system. The corresponding Bateman's Hamiltonian, being a self-adjoint operator, displays the discrete family of complex eigenvalues. We show that they correspond to the poles of energy eigenvectors and the corresponding resolvent operator when continued to the complex energy plane. Therefore, the corresponding generalized eigenvectors may be interpreted as resonant states which are responsible for the irreversible quantum dynamics of a damped harmonic oscillator

  13. Dual-temperature acoustic levitation and sample transport apparatus

    Science.gov (United States)

    Trinh, E.; Robey, J.; Jacobi, N.; Wang, T.

    1986-01-01

    The properties of a dual-temperature resonant chamber to be used for acoustical levitation and positioning have been theoretically and experimentally studied. The predictions of a first-order dissipationless treatment of the generalized wave equation for an inhomogeneous medium are in close agreement with experimental results for the temperature dependence of the resonant mode spectrum and the acoustic pressure distribution, although the measured magnitude of the pressure variations does not correlate well with the calculated one. Ground-based levitation of low-density samples has been demonstrated at 800 C, where steady-state forces up to 700 dyn were generated.

  14. Test system design for Hardware-in-Loop evaluation of PEM fuel cells and auxiliaries

    Energy Technology Data Exchange (ETDEWEB)

    Randolf, Guenter; Moore, Robert M. [Hawaii Natural Energy Institute, University of Hawaii, Honolulu, HI (United States)

    2006-07-14

    In order to evaluate the dynamic behavior of proton exchange membrane (PEM) fuel cells and their auxiliaries, the dynamic capability of the test system must exceed the dynamics of the fastest component within the fuel cell or auxiliary component under test. This criterion is even more critical when a simulated component of the fuel cell system (e.g., the fuel cell stack) is replaced by hardware and Hardware-in-Loop (HiL) methodology is employed. This paper describes the design of a very fast dynamic test system for fuel cell transient research and HiL evaluation. The integration of the real time target (which runs the simulation), the test stand PC (that controls the operation of the test stand), and the programmable logic controller (PLC), for safety and low-level control tasks, into one single integrated unit is successfully completed. (author)

  15. Energy Recovery for the Main and Auxiliary Sources of Electric Vehicles

    Directory of Open Access Journals (Sweden)

    Binggang Cao

    2010-10-01

    Full Text Available Based on the traditional regenerative braking electrical circuit, a novel energy recovery system for the main and auxiliary sources of electric vehicles (EVs has been developed to improve their energy efficiency. The electrical circuit topology is presented in detail. During regenerative braking, the recovered mechanical energy is stored in both the main source and the auxiliary source at the same time. The mathematical model of the proposed system is derived step by step. Combining the merits and defects of H2 optimal control and H∞ robust control, a H2/H∞ controller is designed to guarantee both the system performance and robust stability. The perfect match between the simulated and experimental results validates the notion that the proposed novel energy recovery system is both feasible and effective, as more energy is recovered than that with the traditional energy recovery systems, in which recovered energy is stored only in the main source.

  16. National Ignition Facility subsystem design requirements target area auxiliary subsystem SSDR 1.8.6

    International Nuclear Information System (INIS)

    Reitz, T.

    1996-01-01

    This Subsystem Design Requirement (SSDR) establishes the performance, design, development, and test requirements for the Target Area Auxiliary Subsystems (WBS 1.8.6), which is part of the NIF Target Experimental System (WBS 1.8). This document responds directly to the requirements detailed in NIF Target Experimental System SDR 003 document. Key elements of the Target Area Auxiliary Subsystems include: WBS 1.8.6.1 Local Utility Services; WBS 1.8.6.2 Cable Trays; WBS 1.8.6.3 Personnel, Safety, and Occupational Access; WBS 1.8.6.4 Assembly, Installation, and Maintenance Equipment; WBS 1.8.6.4.1 Target Chamber Service System; WBS 1.8.6.4.2 Target Bay Service Systems

  17. Biased divertor performance under auxiliary heating conditions on the TdeV tokamak

    International Nuclear Information System (INIS)

    Decoste, R.; Lachambre, J.L.; Demers, Y.

    1994-01-01

    Plasma biasing has been shown on TdeV in the ohmic regime to be very promising for divertor applications. Negative biasing, with shortened SOL density gradients, improves the divertor performance, whereas positive biasing, with longer gradients, does not do much for the divertor. The next objectives were to extrapolate those results to auxiliary heated plasmas and optimize/simplify the biasing geometry for future upgrades. New results are now available with an improved divertor geometry and auxiliary heating/current drive provided by a new lower hybrid (LH) system. The new geometry, optimized for positive biasing with predictably acceptable negative biasing performances, allows for a fair comparison between the two polarities. (author) 4 refs., 5 figs

  18. Analysis of design of auxiliary system of Booshehr Nuclear Power Plant

    International Nuclear Information System (INIS)

    Naseh Hasanzadeh, M.

    1999-01-01

    Power plant's internal auxiliary system has an important role in its safety operation. Because of the decay heat and safety aspects in the nuclear power plants, this role is more important. In this thesis, operation of the nuclear power plant with PWR reactor is studied and deferent nuclear systems described. In the next section all electrical loads in the Booshehr Nuclear Power Plant identified and feeding methods of each load is determined. by use of the single line diagram of the internal auxiliary system, the nominal rating of all electrical devices as transformers, inverters, Ups, diesel generators and etc. is determined. In the following, short circuit calculations performed and by above conclusion, rating values of circuit breakers is determined. At last the starting problems of electrical motors is studied and the results of motor's behavior at starting moment is discussed

  19. Design of an increase in the CNAAA unit I South auxiliary building

    International Nuclear Information System (INIS)

    Lorentz, R.G.; Loyola Benedicto Ottoni, I. de; Roech, J.L.

    1990-01-01

    In this work it is presented the description of the model adopted in the structural calculations for a modification in the CNAAA Unit I South Auxiliary Building. This modification intended to increase the facilities destinated to keeping and changing of special clothing for access to the controlled area. The design basically constitutes of a slab at the Elevation 5,15m, for which a tridimensional frame model was adopted, in reinforced adopted concrete, fixed in the South Auxiliary Building foundation slab and structurally independent on the building, at the slab level. It was demonstrated in this study that the introduction, in the existing structure, of the masses of this enlarged area does not considerably change the dynamic behaviour of the building, which allowed proceeding the analysis of the new structure independently of the existing one. (author)

  20. Energy Recovery for the Main and Auxiliary Sources of Electric Vehicles

    Energy Technology Data Exchange (ETDEWEB)

    Min Ye [Key Laboratory for Highway Construction Technology and Equipment of Ministry of Education, Chang’an University, Xi’an (China); Sengjie Jiao [Key Laboratory for Highway Construction Technology and Equipment of Ministry of Education, Chang’an University, Xi’an (China); Binggang Cao [School of Mechanical Engineering, Xi’an Jiaotong University, Xi’an (China)

    2010-09-15

    Based on the traditional regenerative braking electrical circuit, a novel energy recovery system for the main and auxiliary sources of electric vehicles (EVs) has been developed to improve their energy efficiency. The electrical circuit topology is presented in detail. During regenerative braking, the recovered mechanical energy is stored in both the main source and the auxiliary source at the same time. The mathematical model of the proposed system is derived step by step. Combining the merits and defects of H2 optimal control and H-infinity robust control, a H2/H-infinity controller is designed to guarantee both the system performance and robust stability. The perfect match between the simulated and experimental results validates the notion that the proposed novel energy recovery system is both feasible and effective, as more energy is recovered than that with the traditional energy recovery systems, in which recovered energy is stored only in the main source.

  1. Energy Recovery for the Main and Auxiliary Sources of Electric Vehicles

    Energy Technology Data Exchange (ETDEWEB)

    Ye, M.; Jiao, S. [Key Laboratory for Highway Construction Technology and Equipment of Ministry of Education, Chang' an University, Xi' an 710064 (China); Cao, B. [School of Mechanical Engineering, Xi' an Jiaotong University, Xi' an 710049 (China)

    2010-10-15

    Based on the traditional regenerative braking electrical circuit, a novel energy recovery system for the main and auxiliary sources of electric vehicles (EVs) has been developed to improve their energy efficiency. The electrical circuit topology is presented in detail. During regenerative braking, the recovered mechanical energy is stored in both the main source and the auxiliary source at the same time. The mathematical model of the proposed system is derived step by step. Combining the merits and defects of H{sub 2} optimal control and H{sub {infinity}} robust control, a H{sub 2}/H{sub {infinity}} controller is designed to guarantee both the system performance and robust stability. The perfect match between the simulated and experimental results validates the notion that the proposed novel energy recovery system is both feasible and effective, as more energy is recovered than that with the traditional energy recovery systems, in which recovered energy is stored only in the main source. (authors)

  2. [The surgical nurse: his/her leadership of auxiliary nursing personnel].

    Science.gov (United States)

    Galvão, C M; Trevizan, M A; Sawada, N O; Mendes, I A

    1997-01-01

    This investigation as carried out in order to promote follow-up in the studies concerning nurse's leadership in the hospital context. Emphasys is given to the nurses that works in surgical ward unities. As a theoretical framework, authors utilized the model of leadership proposed by Hersey and Blanchard, named Situational Leadership. The objective was to analyze the correspondence of opinion between nurses and nursing auxiliary personnel about the leadership style of nurse should adopt in accordance with the maturity level of an element of the auxiliary personnel based on six categories of activities that were studied. Authors found out that nurses should adopt the styles of participant leadership, such as E3 (participating) and/or E4 (delegating).

  3. Modeling and stability analysis for the upper atmosphere research satellite auxiliary array switch component

    Science.gov (United States)

    Wolfgang, R.; Natarajan, T.; Day, J.

    1987-01-01

    A feedback control system, called an auxiliary array switch, was designed to connect or disconnect auxiliary solar panel segments from a spacecraft electrical bus to meet fluctuating demand for power. A simulation of the control system was used to carry out a number of design and analysis tasks that could not economically be performed with a breadboard of the hardware. These tasks included: (1) the diagnosis of a stability problem, (2) identification of parameters to which the performance of the control system was particularly sensitive, (3) verification that the response of the control system to anticipated fluctuations in the electrical load of the spacecraft was satisfactory, and (4) specification of limitations on the frequency and amplitude of the load fluctuations.

  4. Dual-energy contrast-enhanced spectral mammography (CESM).

    Science.gov (United States)

    Daniaux, Martin; De Zordo, Tobias; Santner, Wolfram; Amort, Birgit; Koppelstätter, Florian; Jaschke, Werner; Dromain, Clarisse; Oberaigner, Willi; Hubalek, Michael; Marth, Christian

    2015-10-01

    Dual-energy contrast-enhanced mammography is one of the latest developments in breast care. Imaging with contrast agents in breast cancer was already known from previous magnetic resonance imaging and computed tomography studies. However, high costs, limited availability-or high radiation dose-led to the development of contrast-enhanced spectral mammography (CESM). We reviewed the current literature, present our experience, discuss the advantages and drawbacks of CESM and look at the future of this innovative technique.

  5. Note on Nahm's partition function of the dual spectrum II

    CERN Document Server

    Minimi, M

    1977-01-01

    For pt.I see CERN publication TH2240. In part I, in considering the Nahm dual resonance mass spectra theory, it was noticed that there is another modular form; a generating function that transforms automorphically under T:w to -1/w and would realize the Veneziano dualism. The group structure associated with this form is studied since it appears, to the authors, to be more natural than Nahm's original. (6 refs).

  6. Dual Campus High School

    Directory of Open Access Journals (Sweden)

    Carmen P. Mombourquette

    2013-04-01

    Full Text Available September 2010 witnessed the opening of the first complete dual campus high school in Alberta. Catholic Central High School, which had been in existence since 1967 in one building, now offered courses to students on two campuses. The “dual campus” philosophy was adopted so as to ensure maximum program flexibility for students. The philosophy, however, was destined to affect student engagement and staff efficacy as the change in organizational structure, campus locations, and course availability was dramatic. Changing school organizational structure also had the potential of affecting student achievement. A mixed-methods study utilizing engagement surveys, efficacy scales, and interviews with students and teachers was used to ascertain the degree of impact. The results of the study showed that minimal impact occurred to levels of student engagement, minor negative impact to staff efficacy, and a slight increase to student achievement results.

  7. IAEA's dual function

    International Nuclear Information System (INIS)

    1967-01-01

    'A factor of paramount importance is the dual nature of atomic energy, which is reflected in the dual function of the Agency; not only to promote, but also to safeguard the peaceful uses of atomic energy'. In taking the above statement as a theme in his address to the 1474th Plenary Meeting of the United Nations General Assembly (22nd November), the Director General, Dr. Sigvard Eklund, went on to speak of a few of the many areas in which society was feeling the impact of atomic energy. During the discussion which followed his report on the Agency's work nearly all speakers referred to the importance of the safeguards system as well as to positive achievements in developing nuclear potential for peaceful purposes

  8. Dual double field theory

    Energy Technology Data Exchange (ETDEWEB)

    Bergshoeff, Eric A. [Centre for Theoretical Physics, University of Groningen,Nijenborgh 4, 9747 AG Groningen (Netherlands); Hohm, Olaf [Simons Center for Geometry and Physics, Stony Brook University,Stony Brook, NY 11794-3636 (United States); Penas, Victor A. [Centre for Theoretical Physics, University of Groningen,Nijenborgh 4, 9747 AG Groningen (Netherlands); Riccioni, Fabio [INFN - Sezione di Roma, Dipartimento di Fisica, Università di Roma “La Sapienza”,Piazzale Aldo Moro 2, 00185 Roma (Italy)

    2016-06-06

    We present the dual formulation of double field theory at the linearized level. This is a classically equivalent theory describing the duals of the dilaton, the Kalb-Ramond field and the graviton in a T-duality or O(D,D) covariant way. In agreement with previous proposals, the resulting theory encodes fields in mixed Young-tableau representations, combining them into an antisymmetric 4-tensor under O(D,D). In contrast to previous proposals, the theory also requires an antisymmetric 2-tensor and a singlet, which are not all pure gauge. The need for these additional fields is analogous to a similar phenomenon for “exotic' dualizations, and we clarify this by comparing with the dualizations of the component fields. We close with some speculative remarks on the significance of these observations for the full non-linear theory yet to be constructed.

  9. The application of 99Tcm-phytate scintigraphy in pig auxiliary liver transplantation

    International Nuclear Information System (INIS)

    Lin Jianhua; Li Xiaoping; Li Chaolong; He Xu; Lin Zhiqi; Zhu Weibing

    2001-01-01

    Objective: To affirm the application value of 99 Tc m -phytate scintigraphy in pig auxiliary liver transplantation. Methods: The graft was transplanted in the right subhepatic space of recipient to establish pig auxiliary liver transplantation model. The artery blood supplies were the very same in all grafts and the portal vein (PV) blood flows were differently controlled by trussing the host PV at the site neared host liver. According to the constriction degree, PV blood supplies were divided into three groups including A (constricted by 1/3), B (constricted by 1/2) and C(not constricted). The blood flows of the graft liver and the host liver were measured by 99 Tc m -phytate scintigraphy and livers functions were estimated after auxiliary liver transplantation. Contrasted with its histological findings the reflection of graft survival with 99 Tc m -phytate scintigraphy was investigated. Results: It was detected by 99 Tc m -phytate scintigraphy that the blood flows were almost equilibrated and abundant in grafts and host liver' in group A, and were abundant in grafts of group B and host livers of group C and were significantly decreased in host livers of group B and grafts of group C. Histological work-up demonstrated that the liver was not atrophic while the blood flow was abundant and the liver was atrophic while the blood flow was decreased. Conclusion: 99 Tc m -phytate scintigraphy could accurately reflect the survival and function of grafts and host livers after auxiliary liver transplantation and it is a reliable technique which can be used to estimate the survival and function of the grafts and host livers

  10. Reducing Auxiliary Energy Consumption of Heavy Trucks by Onboard Prediction and Real-time Optimization

    OpenAIRE

    Khodabakhshian, Mohammad; Feng, Lei; Börjesson, Stefan; Lindgärde, Olof; Wikander, Jan

    2017-01-01

    The electric engine cooling system, where the coolant pump and the radiator fan are driven by electric motors, admits advanced control methods to decrease auxiliary energy consumption. Recent publications show the fuel saving potential of optimal control strategies for the electric cooling system through offline simulations. These strategies often assume full knowledge of the drive cycle and compute the optimal control sequence by expensive global optimization methods. In reality, the full dr...

  11. Experimental simulation of a light aircraft crash on to a nuclear power plant auxiliary building roof

    International Nuclear Information System (INIS)

    Barnes, D.; Barr, P.; Garton, G.; Howe, W.D.; Neilson, A.J.

    1984-08-01

    The experiments described were conducted at a reduced scale with geometric dimensions of prototype structures of one-fifth full size. The target was based on the auxiliary buildings for the proposed Sizewell PWR. Descriptions of the simulated aircraft model and the test panels are given, together with the instrumentation. Details are given of the test programme and the results are summarized and discussed. Comparison is made of the model aircraft tests with an equivalent hard missile impact. (U.K.)

  12. Direct enantioselective conjugate addition of carboxylic acids with chiral lithium amides as traceless auxiliaries.

    Science.gov (United States)

    Lu, Ping; Jackson, Jeffrey J; Eickhoff, John A; Zakarian, Armen

    2015-01-21

    Michael addition is a premier synthetic method for carbon-carbon and carbon-heteroatom bond formation. Using chiral dilithium amides as traceless auxiliaries, we report the direct enantioselective Michael addition of carboxylic acids. A free carboxyl group in the product provides versatility for further functionalization, and the chiral reagent can be readily recovered by extraction with aqueous acid. The method has been applied in the enantioselective total synthesis of the purported structure of pulveraven B.

  13. Auxiliary collimating device for obtaining irradiation fields of any shape for high energy radiotherapy apparatus

    International Nuclear Information System (INIS)

    Piret, P.; Fraikin, H.; Hubert, A.

    1976-01-01

    An auxiliary collimator is added to the main collimator of a radiotherapy apparatus and comprises a master-container filled with mercury and a localizing container containing a block of nonabsorbent material having a predetermined shape; means being provided for automatically positioning these containers with respect to the main collimator and for allowing the mercury to enter the localizing container when once it has taken its working position

  14. Sodium--NaK engineering handbook. Volume IV. Sodium pumps, valves, piping, and auxiliary equipment

    International Nuclear Information System (INIS)

    Foust, O.J.

    1978-01-01

    The handbook is useful for designers in the Liquid Metals Fast Breeder Reactor (LMFBR) program and by the engineering and scientific community performing investigation and experimentation requiring high-temperature Na and NaK technology. Data are presented for pumps, bearings and seals, valves, vessels and piping, and auxiliary equipment including vapor traps, freeze plugs, fuel-channel flow regulators, antivortexing devices, and miscellaneous mechanical elements. Reactor materials are also discussed

  15. Think different: applying the old macintosh mantra to the computability of the SUSY auxiliary field problem

    Energy Technology Data Exchange (ETDEWEB)

    Calkins, Mathew; Gates, D.E.A.; Gates, S. James Jr. [Center for String and Particle Theory, Department of Physics, University of Maryland,College Park, MD 20742-4111 (United States); Golding, William M. [Sensors and Electron Devices Directorate, US Army Research Laboratory,Adelphi, Maryland 20783 (United States)

    2015-04-13

    Starting with valise supermultiplets obtained from 0-branes plus field redefinitions, valise adinkra networks, and the “Garden Algebra,” we discuss an architecture for algorithms that (starting from on-shell theories and, through a well-defined computation procedure), search for off-shell completions. We show in one dimension how to directly attack the notorious “off-shell auxiliary field” problem of supersymmetry with algorithms in the adinkra network-world formulation.

  16. Common-cause failure analysis of McGuire Unit 2 auxiliary feedwater system

    International Nuclear Information System (INIS)

    Rasmuson, D.M.; Shepherd, J.C.; Fowler, R.D.; Summitt, R.L.; Logan, B.W.

    1982-01-01

    A powerful method for qualitative common cause failure analysis (CCFA) of nuclear power plant systems was developed by EG and G Idaho at the Idaho National Engineering Laboratory. As a cooperative project to demonstrate and evaluate the usefulness of the method, the Duke Power Company agreed to allow a CCFA of the auxiliary feedwater system (AFWS) in their McGuire Nuclear Station Unit 2. The results of the CCFA are the subject of this discussion

  17. The Quantum N-Body Problem and the Auxiliary Field Method

    International Nuclear Information System (INIS)

    Semay, C.; Buisseret, F.; Silvestre-Brac, B.

    2011-01-01

    Approximate analytical energy formulas for N-body semirelativistic Hamiltonians with one- and two-body interactions are obtained within the framework of the auxiliary field method. We first review the method in the case of nonrelativistic two-body problems. A general procedure is then given for N-body systems and applied to the case of baryons in the large-N c limit. (author)

  18. Civil engineering in nuclear power stations: design of the turbine building and nuclear auxiliary building

    International Nuclear Information System (INIS)

    Lacroix, R.

    1985-01-01

    After enumerating the specific features of civil engineering in nuclear power stations. One goes on to examine the principal deliberations undertaken with the aim of optimising projects for transition from the P4 to P'4 and then N4 generations of nuclear power stations. The courses of action decided with respect to the design of the machine room and auxiliary equipment building are described [fr

  19. Utilization of Lavandula angustifolia Miller extracts as naturalrepellents, pharmaceutical and industrial auxiliaries

    Directory of Open Access Journals (Sweden)

    AYOE YUSUFOGLU

    2004-01-01

    Full Text Available Essential oils, absolutes and concretes were prepared from the flowers and leaves of the plant Lavandula angustifolia Miller cultivated in the Bosphorus region of Istanbul, Turkey. The difference in the chemical composition of the mentioned extracts was investigated and compared by using a combination of capillary GC-MS with the aim of offering them as repellent, pharmaceutical and industrial auxiliaries. The IR-spectra, the yields and the physico-chemical data of the extracts were also analysed.

  20. Arm-length stabilisation for interferometric gravitational-wave detectors using frequency-doubled auxiliary lasers

    OpenAIRE

    Mullavey, Adam J.; Slagmolen, Bram J. J.; Miller, John; Evans, Matthew; Fritschel, Peter; Sigg, Daniel; Waldman, Sam J.; Shaddock, Daniel A.; McClelland, David E.

    2011-01-01

    Residual motion of the arm cavity mirrors is expected to prove one of the principal impediments to systematic lock acquisition in advanced gravitational-wave interferometers. We present a technique which overcomes this problem by employing auxiliary lasers at twice the fundamental measurement frequency to pre-stabilise the arm cavities’ lengths. Applying this approach, we reduce the apparent length noise of a 1.3 m long, independently suspended Fabry-Perot cavity to 30 pm rms and successfully...