WorldWideScience

Sample records for aurochs bos primigenius

  1. Complete mitochondrial genome of wild aurochs (Bos primigenius) reconstructed from ancient DNA.

    Science.gov (United States)

    Zeyland, J; Wolko, L; Bocianowski, J; Szalata, M; Słomski, R; Dzieduszycki, A M; Ryba, M; Przystałowska, H; Lipiński, D

    2013-01-01

    Extinct aurochs (Bos primigenius), accepted as the ancestor of domestic cattle, was one of the largest wild animals inhabiting Europe, Asia and North Africa. The gradual process of aurochs extinction finished in Poland in 1627, were the last recorded aurochs, a female, died. Some aspects of cattle domestication history and the distribution of aurochs genetic material among modern cattle breeds still remain unclear. Analyses of ancient DNA (aDNA) from bone sample deliver new genetic information about extinct wild aurochs as well as modern cattle phylogeny. DNA was extracted from a fragment of aurochs fossil bone found in the Pisz Forest, Poland. The sample was radiocarbon-dated to about 1500 yBP. The aDNA was used for Whole Genome Amplification in order to form a DNA bank. Auroch mitochondrial DNA sequences were amplified using sets of 41 primers overlapping the whole mtDNA, cloned and sequenced. The sequence of the whole mitochondrial genome was reconstructed and deposed in GenBank [GenBank:JQ437479]. Based on the phylogenetic analyses of the Bovine mitochondrial genomes, a phylogenetic tree was created. As expected, the tree clearly shows that the mtDNA sequence of the analyzed PWA (Polish Wild Aurochs) individual belongs to haplogroup P. In the course of the comparative mtDNA analysis we identified 30 nucleotide marker positions for haplogroup P and nine unique PWA differences compared to the two remaining haplotype P representatives. Our analysis provides the next step to the reconstruction of the demographic history of this extinct but still exciting species.

  2. Ancient DNA extracted from Danish aurochs (Bos primigenius)

    DEFF Research Database (Denmark)

    Nielsen, Peter Gravlund; Aaris-Sørensen, Kim; Hofreiter, Michael;

    2012-01-01

    We extracted DNA from 39 Danish aurochs specimens and successfully amplified and sequenced a 252 base pair long fragment of the multivariable region I of the mitochondrial control region from 11 specimens. The sequences from these specimens dated back to 9830-2865 14C yr BP and represent the first...... study of genetic variation of Danish aurochs. In addition, for all specimens we address correlations between the ability to obtain DNA sequences and various parameters such as the age of the sample, the collagen content, the museum storage period, Danish geography and whether the specimens were found...

  3. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  4. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

    Directory of Open Access Journals (Sweden)

    Ceiridwen J Edwards

    Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

  5. Bos primigenius in Ancient Egyptian art – historical evidence for the continuity of occurrence and ecology of an extinct key species

    Directory of Open Access Journals (Sweden)

    Carl Beierkuhnlein

    2015-11-01

    Full Text Available Knowledge of the habitat requirements and temporal stability of populations of extinct aurochs (Bos primigenius is surprisingly scarce. Reliable reports of this species, which by its domestication remains tremendously important for humans, are rare. As the species became extinct about 400 years ago and regionally disappeared much earlier, its behaviour and morphology are also under debate. Aurochs is also a crucial component of the mega-herbivore theory in nature conservation, but in fact its natural habitat and behaviour are unknown. Here, I report records of aurochs for the time period of Ancient Egypt. They are found in archaeological sites and literature, and in collections. Records of the species continue through all the periods of Ancient Egypt. In particular, hunting scenes illustrating the merits of high-ranking persons, in their graves (mastabas and temples, provide insights into the behaviour and ecology of the depicted game. Here, special attention is given to one outstanding hunting scene that is documented in a relief at the mortuary temple of Ramesses III (1175 BC, Medinet Habu, Egypt. Assisted by a group of hunters, the pharaoh kills three specimens of aurochs. The whole scene is stunningly realistic.  The adult specimen is fleeing towards the reed belt of the River Nile, suggesting that the species’ habitat was probably in large valley bottoms, where open grassland is regularly created by flooding. Endemic species of fish and game confirm that this scene took place in Lower Egypt. The regional populations of the North-African subspecies of aurochs probably went extinct shortly after this piece of art was produced. Records of species in ancient art can be very informative in terms of ecology and behaviour of species, especially when extinct species are addressed. In addition, the dating of old pieces of art containing biological information can be very precise, for instance when these refer to a historic personage. 

  6. Incorporation of aurochs into a cattle herd in Neolithic Europe: single event or breeding?

    Science.gov (United States)

    Schibler, Jörg; Elsner, Julia; Schlumbaum, Angela

    2014-07-01

    Domestication is an ongoing process continuously changing the lives of animals and humans and the environment. For the majority of European cattle (Bos taurus) genetic and archaeozoological evidence support initial domestication ca. 11'000 BP in the Near East from few founder aurochs (Bos primigenius) belonging to the mitochondrial DNA T macro-haplogroup. Gene flow between wild European aurochs of P haplogroup and domestic cattle of T haplogroup, coexisting over thousands of years, appears to have been sporadic. We report archaeozoological and ancient DNA evidence for the incorporation of wild stock into a domestic cattle herd from a Neolithic lake-dwelling in Switzerland. A complete metacarpus of a small and compact adult bovid is morphologically and genetically a female. With withers height of ca. 112 cm, it is comparable in size with small domestic cattle from contemporaneous sites in the area. The bone is directly dated to 3360-3090 cal BC and associated to the Horgen culture, a period of the secondary products revolution. The cow possessed a novel mtDNA P haplotype variant of the European aurochs. We argue this is either a single event or, based on osteological characteristics of the Horgen cattle, a rare instance of intentional breeding with female aurochs.

  7. Revisiting AFLP fingerprinting for an unbiased assessment of genetic structure and differentiation of taurine and zebu cattle

    NARCIS (Netherlands)

    Utsunomiya, Yuri T.; Bomba, Lorenzo; Lucente, Giordana; Colli, Licia; Negrini, Riccardo; Lenstra, Johannes A.; Erhardt, Georg; Garcia, José F.; Ajmone-Marsan, Paolo; Moazami-Goudarzi, K.; Williams, J.; Wiener, P.; Olsaker, I.; Kantanen, J.; Dunner, S.; Cañón, J.; Rodellar, C.; Martín-Burriel, I.; Valentini, A.; Zanotti, M.; Holm, L. E.; Eythorsdottir, E.; Mommens, G.; Polygen, Van Haeringen; Nijman, I. J.; Dolf, G.; Bradley, D. G.

    2014-01-01

    Background: Descendants from the extinct aurochs (Bos primigenius), taurine (Bos taurus) and zebu cattle (Bos indicus) were domesticated 10,000 years ago in Southwestern and Southern Asia, respectively, and colonized the world undergoing complex events of admixture and selection. Molecular data, in

  8. History and economic importance of cattle (Bos taurus L.) in Switzerland from neolithic to early middle ages

    OpenAIRE

    Schibler, J.; Schlumbaum, A.

    2007-01-01

    In Switzerland domestic cattle (Bos primigenius f. taurus resp. Bos taurus L.) first appear with the earliest Neolithic settlements (similar to 5000 BC). With the gradual deforestation of the landscape caused by human exploitation of the environment, cattle were used more intensive and in many ways. There is evidence that cattle were used as draught animal since ca. 3400 BC, probably even earlier milk was regularly used. The size of domestic cattle gradually decreased from Early Neolithic unt...

  9. Complete mitochondrial genome and phylogeny of Pleistocene mammoth Mammuthus primigenius.

    Directory of Open Access Journals (Sweden)

    Evgeny I Rogaev

    2006-03-01

    Full Text Available Phylogenetic relationships between the extinct woolly mammoth (Mammuthus primigenius, and the Asian (Elephas maximus and African savanna (Loxodonta africana elephants remain unresolved. Here, we report the sequence of the complete mitochondrial genome (16,842 base pairs of a woolly mammoth extracted from permafrost-preserved remains from the Pleistocene epoch--the oldest mitochondrial genome sequence determined to date. We demonstrate that well-preserved mitochondrial genome fragments, as long as approximately 1,600-1700 base pairs, can be retrieved from pre-Holocene remains of an extinct species. Phylogenetic reconstruction of the Elephantinae clade suggests that M. primigenius and E. maximus are sister species that diverged soon after their common ancestor split from the L. africana lineage. Low nucleotide diversity found between independently determined mitochondrial genomic sequences of woolly mammoths separated geographically and in time suggests that north-eastern Siberia was occupied by a relatively homogeneous population of M. primigenius throughout the late Pleistocene.

  10. Comparison of Skin Characterizes Between Pure Breed and Crossbred Azeri Zebu (Bos primigenius indicus or Bos indicus

    Directory of Open Access Journals (Sweden)

    Alireza Lotfi

    2011-02-01

    Full Text Available For investigation of crossbreeding efficiency in some skin characterizes in pure and crossbred cattle with Azeri Zebu, 100 head Azeri Zebu and pure breeds were divided into 4 group in 4 treatments, randomly. After cross breeding between zebu and pure cattle breeds, the diameters of skin in different parts of body were significantly increased in hybrids (offspring. Zebu hybrids, because of their strength epidemic layer on slat and legs had deep skin in compare with parents. Skin area were measured at two different parts, that more than 60% of skin were include 5 mm diameter in hybrids. As conclusion; in this investigation it has been cleared that cross-breeding in Azeri zebu (with pure cattle breeds can cause deep diameter of skin that also it can produce high quality skin for leather and shoe Industry.

  11. The Muirkirk Mammoth : A Late Pleistocene woolly mammoth (Mammuthus primigenius) skeleton from southern Ontario, Canada

    NARCIS (Netherlands)

    Harington, C. R.; Mol, Dick; van der Plicht, Johannes

    2012-01-01

    The Muirkirk Mammoth, found in 1895 2.4 km northeast of the village of Muirkirk in southern Ontario, is the most complete woolly mammoth (Mammuthus primigenius) skeleton known from Canada. Approximate tusk measurements and extreme wear on the sixth molars indicate it is best referred to an old male.

  12. Juridica; Bos, bouw en gemeenten

    NARCIS (Netherlands)

    Kistenkas, F.H.

    2011-01-01

    Bouwen in het bos van de ecologische hoofdstructuur. Geen probleem als niemand bezwaar maakt.... Uiteindelijk is de gemeente vergunningverlener aan zichzelf, is wetgever in eigen zaak en maakt voor zichzelf een lucratief bestemmingsplan. Aldus de analyse van wetskenner Fred Kistenkas

  13. Definition of the Cattle Killer Cell Ig–like Receptor Gene Family: Comparison with Aurochs and Human Counterparts

    Science.gov (United States)

    Sanderson, Nicholas D.; Norman, Paul J.; Guethlein, Lisbeth A.; Ellis, Shirley A.; Williams, Christina; Breen, Matthew; Park, Steven D. E.; Magee, David A.; Babrzadeh, Farbod; Warry, Andrew; Watson, Mick; Bradley, Daniel G.; MacHugh, David E.; Parham, Peter

    2014-01-01

    Under selection pressure from pathogens, variable NK cell receptors that recognize polymorphic MHC class I evolved convergently in different species of placental mammal. Unexpectedly, diversified killer cell Ig–like receptors (KIRs) are shared by simian primates, including humans, and cattle, but not by other species. Whereas much is known of human KIR genetics and genomics, knowledge of cattle KIR is limited to nine cDNA sequences. To facilitate comparison of the cattle and human KIR gene families, we determined the genomic location, structure, and sequence of two cattle KIR haplotypes and defined KIR sequences of aurochs, the extinct wild ancestor of domestic cattle. Larger than its human counterpart, the cattle KIR locus evolved through successive duplications of a block containing ancestral KIR3DL and KIR3DX genes that existed before placental mammals. Comparison of two cattle KIR haplotypes and aurochs KIR show the KIR are polymorphic and the gene organization and content appear conserved. Of 18 genes, 8 are functional and 10 were inactivated by point mutation. Selective inactivation of KIR3DL and activating receptor genes leaves a functional cohort of one inhibitory KIR3DL, one activating KIR3DX, and six inhibitory KIR3DX. Functional KIR diversity evolved from KIR3DX in cattle and from KIR3DL in simian primates. Although independently evolved, cattle and human KIR gene families share important function-related properties, indicating that cattle KIR are NK cell receptors for cattle MHC class I. Combinations of KIR and MHC class I are the major genetic factors associated with human disease and merit investigation in cattle. PMID:25398326

  14. New ancient DNA sequences suggest high genetic diversity for the woolly mammoth (Mammuthus primigenius )

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Partial DNA sequences of cytochrome b gene (mtDNA) were successfully retrieved from Late Pleistocene fossil bone of Mammuthus primigenius collected from the Xiguitu County (Yakeshi), Inner Mongolia Autonomous Region and from Zhaodong, Harbin of Heilongjiang Province in northern China. Two ancient DNA fragments ( 109 bp and 124 bp) were authenticated by reproducible experiments in two different laboratories and by phylogenetic analysis with other Elephantidae taxa. Phylogenetic analysis using these sequences and published data in either separate or combined datasets indicate unstable relationship among the woolly mammoth and the two living elephants, Elephas and Loxodonta. In addition to the short sequences used to attempt the long independent evolution of Elephantidae terminal taxa, we suggest that a high intra-specific diversity existed in Mammuthus primigenius crossing both spatial and temporal ranges, resulting in a complex and divergent genetic background for DNA sequences so far recovered. The high genetic diversity in the extinct woolly mammoth can explain the apparent instability of Elephantidae taxa on the molecular phylogenetic trees and can reconcile the apparent paradox regarding the unresolved Elephantidae trichotomy.

  15. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  16. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  17. Het Nederlandse bos als vorm van bodemgebruik

    NARCIS (Netherlands)

    Slangen, L.H.G.; Boven, van B.

    1983-01-01

    Behandeling van de oppervlakte en verdeling van het bos en de veranderingen die hierin zijn opgetreden, met de bedrijfsgrootte-struktuur als belangrijke invalshoek daarbij; de rol van de overheid: doeleinden, instrumenten en effekten van het beleid

  18. Pilot meetnet functievervulling bos, natuur en landschap

    NARCIS (Netherlands)

    Dirkse, G.M.; Daamen, W.P.

    2000-01-01

    Alterra en Bosdata voerden in opdracht van het Expertisecentrum LNV een proef uit voor het meetnet functievervulling bos, natuur en landschap. Het meetnet schat periodiek met een geografische steekproef de oppervlakte land met een zekere kwaliteit voor recreatie, natuur, milieu en economie. De steek

  19. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    OpenAIRE

    Moreira Fernanda Barros; Souza Nilson Evelázio de; Matsushita Makoto; Prado Ivanor Nunes do; Nascimento Willian Gonçalves do

    2003-01-01

    The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour) and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol) of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L.) or star grass (Cynodon plectostachyus Pilger) pasture systems, with mineral or mineral prot...

  20. Is the American Zebu really Bos indicus?

    Directory of Open Access Journals (Sweden)

    Meirelles Flávio V.

    1999-01-01

    Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

  1. Le Flaubert de Charles Du Bos

    Directory of Open Access Journals (Sweden)

    Jacques Neefs

    2009-01-01

    Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

  2. Van 't bos los?; een verkennende studie naar de interactie tussen recreatieve gebruikers en beheerders van het Nederlandse bos

    NARCIS (Netherlands)

    Moerdijk, L.J.; Molenaar, de H.G.; Verbij, E.E.M.

    2000-01-01

    In 1998 is op een inductieve wijze onderzoek gedaan naar de vervreemding die plaatsvindt tussen bosgebruikers en bosbeheerders. Door allerlei ontwikkelingen in de samenleving is de afhankelijkheid van het bos enorm afgenomen en heeft bos vooral een functie van ontspanning en rust. In dit onderzoek i

  3. Bos in water, water in bos; kansenkaarten voor multifunctionele natte bossen met meerwaarde voor waterbeheer, natuur en recreatie

    NARCIS (Netherlands)

    Hommel, P.W.F.M.; Rooij, van S.A.M.; Waal, de R.W.; Vries, de F.; Goossen, C.M.

    2005-01-01

    Uit eerder onderzoek is gebleken dat de combinatie van water en bos gunstig kan zijn voor natuur, waterbeheer en recreatie. Dit vervolg onderzoek heeft tot doel in beeld te brengen wáár in Nederland de meest kansrijke plekken voor deze combinatie liggen. De volgende hoofdtypen 'nat bos' worden onder

  4. Superovulation and embryo production in tropical adapted Bos taurus (Caracu and Bos indicus (Nelore cows

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2011-01-01

    Full Text Available The aim of this study was to compare ovarian response and embryo production of superovulated Bos indicus and Bos taurus cows adapted to the environmental conditions from São Paulo State, Brazil. Ninety non-lactating cows from Caracu ( Bos taurus, n=40 and Nelore (Bos indicus, n=50 were treated with an intravaginal device containing progesterone (1.38 mg; CIDRB ®, Pfizer Animal Health, Montreal, Québec, Canada and 2.5 mg, intramuscularly (IM, of estradiol benzoate (Estrogin®, Farmavet, São Paulo, Brazil. Four days later, all animals were treated with multiple IM injections of 400 IU of FSH (Pluset®, Calier, Spain in decreasing doses (75–75; 75–50; 50–25, and 25–25 IU at 12-h intervals over 4 days. On the seventh day, CIDR-B device was removed and cows received, IM, 150 ìg of cloprostenol (Veteglan®, Calier, Spain. Cows were then inseminated 48 and 62 h after cloprostenol treatment and embryos were recovered non-surgically seven days after first insemination. Differences in the number of corpora lutea (CL number, total number of structures (ova/embryos, and number of transferable embryos were analyzed by Student t test. There was no difference (P > 0.05 in the average number of CL, total ova/embryos and transferable embryos of Caracu (11.4 ± 3.3; 8.6 ± 2.6 e 6.0 ± 2.4 and Nelore (12.0 ± 4.1; 9.0 ± 4.3 e 5.1 ± 2.9 cows, respectively. These results suggest that Caracu and Nelore cows superovulated in tropical climate had similar ovarian responses and embryo production.

  5. Ganancia diaria y peso al destete en terneros de cruces Bos taurus con Bos indicus en trópico húmedo

    OpenAIRE

    Córdova, Alejandro; Rodriguez, Gustavo; Córdova, Mary; Córdova, Cristian; Pérez., José

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatro meses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para lo cual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgian blue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Los resultados se analizaron mediante estadística descri...

  6. Ganancia diaria y peso al destete en becerros de cruzas Bos taurus con Bos indicus en trópico húmedo.

    OpenAIRE

    Alejandro Córdova; Gustavo Rodríguez; Mary Córdova; Cristian Córdova; José Pérez

    2005-01-01

    El objetivo del trabajo fue evaluar la ganancia diaria de peso desde el nacimiento hasta el destete a los cuatromeses de edad de terneros de la cruza Bos taurus con Bos indicus, manejados en pastoreo convencional, para locual se utilizaron los registros de 302 terneros. Las razas Bos taurus utilizadas para las cruzas fueron Belgianblue, Charolais, Limousine y Beef master; las Bos indicus, fueron Brahman, Nelore, Indobrasil y Simbrah. Losresultados se analizaron mediante estadística descriptiv...

  7. Application of Background Oriented Schlieren (BOS) in Underground Mine Ventilation

    OpenAIRE

    Jong, Edmund Chime

    2011-01-01

    The schlieren technique describes an optical analysis method designed to enhance light distortions caused by air movement. The ability to visualize gas flows has significant implications for analyzing underground mine ventilation systems. Currently, the widely utilized traditional schlieren methods are impractical underground due to complex equipment and design requirements. Background oriented schlieren (BOS) provides a solution to this problem. BOS requires two primary components, a pro...

  8. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    Directory of Open Access Journals (Sweden)

    Fernanda Barros Moreira

    2003-12-01

    Full Text Available The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L. or star grass (Cynodon plectostachyus Pilger pasture systems, with mineral or mineral protein supplementation. Animals were slaughtered with an average body weight of 450 kg (Bos indicus or 470 kg (Bos indicus x Bos taurus crossbreed. There was no treatments effect on carcass characteristics and meat chemical composition of cut without fat thickness. The cuts with fat thickness of steers fed millet presented the highest fat deposition. Bos indicus steers presented higher carcass yield (57.23% and fat thickness (4.88 mm compared with crossbreed (53.40% and 3.05 mm. There was no breed effect on chemical composition of meat. The mean levels of cholesterol concentration were 31.41 mg/100 and 37.55 mg/100g of meat with and without fat thickness.O objetivo deste trabalho foi avaliar as características de carcaça (peso de carcaça, rendimento de carcaça, espessura de gordura de cobertura, área de olho de lombo, marmoreio e coloração e composição química do músculo Longissimus dorsi (umidade, cinzas, proteína bruta, gordura e colesterol de cortes, com ou sem gordura de cobertura, de novilhos Bos indicus e mestiços Bos indicus x Bos taurus terminados em sistemas em pastagem de milheto (Pennisetum americanum L. ou grama estrela (Cynodon plectostachyus Pilger, com suplementação mineral ou protéica e mineral. Os animais foram abatidos com peso médio de 450 kg (Bos indicus ou 470 kg (mestiços. Não houve efeito de tratamento sobre as características de carcaça e composição da carne com ou sem gordura de cobertura. Os cortes com gordura de

  9. Genome wide scan for quantitative trait loci affecting tick resistance in cattle (Bos taurus × Bos indicus)

    OpenAIRE

    Machado, Marco Antonio; S Azevedo, Ana Luisa; Teodoro, Roberto L; Pires, Maria A; CD Peixoto, Maria Gabriela; de Freitas, Célio; Prata, Márcia Cristina A; Furlong, John; da Silva, Marcos Vinicius GB; Guimarães, Simone EF; Regitano, Luciana CA; Coutinho, Luiz L.; Gasparin, Gustavo; Verneque, Rui S

    2010-01-01

    Background In tropical countries, losses caused by bovine tick Rhipicephalus (Boophilus) microplus infestation have a tremendous economic impact on cattle production systems. Genetic variation between Bos taurus and Bos indicus to tick resistance and molecular biology tools might allow for the identification of molecular markers linked to resistance traits that could be used as an auxiliary tool in selection programs. The objective of this work was to identify QTL associated with tick resista...

  10. Immunological Profiles of Bos taurus and Bos indicus Cattle Infested with the Cattle Tick, Rhipicephalus (Boophilus) microplus▿ †

    OpenAIRE

    Piper, Emily K.; Jonsson, Nicholas N.; Gondro, Cedric; Lew-Tabor, Ala E.; Moolhuijzen, Paula; Vance, Megan E.; Jackson, Louise A.

    2009-01-01

    The cattle tick, Rhipicephalus (Boophilus) microplus, is a major threat to the improvement of cattle production in tropical and subtropical countries worldwide. Bos indicus cattle are naturally more resistant to infestation with the cattle tick than are Bos taurus breeds, although considerable variation in resistance occurs within and between breeds. It is not known which genes contribute to the resistant phenotype, nor have immune parameters involved in resistance to R. microplus been fully ...

  11. Identification of genes involved with tick infestation in Bos taurus and Bos indicus.

    Science.gov (United States)

    Kongsuwan, K; Piper, E K; Bagnall, N H; Ryan, K; Moolhuijzen, P; Bellgard, M; Lew, A; Jackson, L; Jonsson, N N

    2008-01-01

    Tick resistant cattle could provide a potentially sustainable and environmentally sound method of controlling cattle ticks. Advances in genomics and the availability of the bovine genome sequence open up opportunities to identify useful and selectable genes controlling cattle tick resistance. Using quantitative real-time PCR and theAffymetrix bovine array platform, differences in gene expression of skin biopsies from tick resistant Bos indicus (Brahman) and tick susceptible Bos taurus (Holstein-Friesian) cattle following tick challenge were examined. We identified 138 significant differentially-expressed genes, including several immunologicallhost defence genes, extracellularmatrix proteins, and transcription factors as well as genes involved in lipid metabolism. Three key pathways, represented by genes differentially expressed in resistant Brahmans, were identified; the development of the cell-mediated immune response, structural integrity of the dermis and intracellular Ca2+ levels. Ca2+, which is implicated in host responses to microbial stimuli, may be required for the enhancement or fine-tuning of transcriptional activation of Ca2+ -dependant host defence signalling pathways. PMID:18817288

  12. The polled locus maps to BTA1 in a Bos indicus x Bos taurus cross.

    Science.gov (United States)

    Brenneman, R A; Davis, S K; Sanders, J O; Burns, B M; Wheeler, T C; Turner, J W; Taylor, J F

    1996-01-01

    Two hundred and nine reciprocal backcross and F2 progeny produced by embryo transfer from Angus (Bos taurus) and Brahman (Bos indicus) parents and their 60 parents and grandparents were utilized to localize the locus (POLL) responsible for the polled phenotype in a genetic map of bovine chromosome 1. Progeny were scored for polled, scurred, and horned phenotypes at 1 year of age and again following skull disection at slaughter at 20 months of age. Phenotype frequencies were independent of gender. One hundred and forty-two informative meioses for POLL and 13 microsatellite loci with an average of 267 informative meioses per locus contributed to a genetic map spanning 124.6 cM with an average interval of 9.6 cM. POLL mapped proximal to the centromere and 4.9 cM from TGLA49 supporting a previous study that employed two anonymous microsatellites. Difficulties in discriminating between scurred and horned phenotypes indicate that bracketing markers will be essential for refining the model for inheritance of the horned, scurred, and polled phenotypes and for effective marker assisted selection (MAS) for polled. PMID:8830095

  13. Membrane proteins associated with sperm-oocyte interaction: A proteomic comparison between Kedah Kelantan (Bos indicus) and Mafriwal (Bos taurus × Bos indicus) sperm

    Science.gov (United States)

    Ashrafzadeh, Ali; Nathan, Sheila; Othman, Iekhsan; Yee, Tee Ting; Karsani, Saiful Anuar

    2013-11-01

    Production performance of European cattle breeds has significantly improved through various breeding programs. However, European breeds are more susceptible to heat stress compared to zebu cattle (Bos indicus) as their conception rate can range between 20 to 30% in hot seasons compared to winter. To identify cattle sperm proteins associated with zebu cattle higher fertility and heat tolerance in tropical environments, we utilised a proteomics-based approach to compare sperm from the highly fertile Malaysian indigenous breed, Kedah Kelantan (Bos indicus), with sperm from the sub-fertile crossbreed, Mafriwal (Bos taurus × Bos indicus). Frozen semen of three high performance bulls from each breed was processed to obtain live and pure sperm. Proteins were separated and gel bands were processed by in-gel tryptic digestion. For each breed, mass spectrometry data was acquired over 11 replicates. The analyzed data identified peptides with different expression levels (99% confidence level) and protein identification was determined by targeted MS/MS. Among the identified proteins associated with sperm-oocyte interaction, two proteins were up-regulated in Kedah Kelantan sperm and 7 proteins were up-regulated in or specific to Mafriwal. Our results suggest that the higher fertility of zebu cattle in tropical areas may not be related to more efficient sperm-oocyte interaction. Further analysis of the other regulated proteins in these two breeds may contribute further knowledge on the physiological reason/s for higher fertility and heat tolerance of Zebu cattle in tropical areas.

  14. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment. PMID:1938641

  15. Life-cycle biological efficiency of Bos indicus x Bos taurus and Bos taurus crossbred cow-calf production to weaning.

    Science.gov (United States)

    Green, R D; Cundiff, L V; Dickerson, G E

    1991-09-01

    A deterministic model was developed that accounted for all biological inputs and outputs for a theoretical herd of F1 females at age equilibrium mated to produce three-way terminal-cross calves and for the required proportion of straightbred cows needed to produce replacements. Two Bos indicus x Bos taurus vs two Bos taurus x Bos taurus types of crossbred cows were compared in the production environment of south-central Nebraska. The four types of F1 females were from Hereford (H) or Angus (A) dams and by H or A (HA), Pinzgauer (Pz), Brahman (Bm), or Sahiwal (Sw) sires. The crossbred females were assumed mated to Red Poll (R) sires for their first calving and to Simmental (S) sires thereafter. Two evaluations of efficiency for each of the four breeding systems were total cow and calf feed energy input 1) per unit of only weaned calf weight output (CALFEFF, Mcal/kg) and 2) per unit of weaned calf plus .55 x cull cow weight output (TVALEFF, Mcal/kg). Results for a terminal age of 7 yr in systems using HA, Pz, Bm, and Sw crossbred cows, respectively, were 64.9, 64.5, 60.9, and 59.3 Mcal/kg for CALFEFF and 45.7, 46.4, 44.1, and 43.7 Mcal/kg for TVALEFF. Changing terminal age to 11 yr reduced CALFEFF about 6% but increased TVALEFF about 7%, because total inputs increased more than output value (10 vs 3%) from 7 to 11 yr terminal ages. These results suggest differences in efficiency among these breed crosses favoring the Bos indicus crossbred cows by over 4% in this particular environment.

  16. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus Genetic Introgression of Bos indicus (Bovidae in Colombian Creole Cattle Bos taurus

    Directory of Open Access Journals (Sweden)

    CARLOS ARTURO SÁNCHEZ ISAZA

    Full Text Available El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.This work evidenced, using a cytogenetics approach, that Bos indicus exerted a genetic introgression of paternal origin on Creole Colombian cattle descendent from Bos taurus. Analysis of chromosome Y morphology was carried out in heparinized blood samples of 67 bulls belonging to seven Colombian breeds. We report 4 sires belonging to the Romosinuano breed (40% and 10 bulls of the Casanareño breed (100% with acrocentric Y chromosome which is characteristic of Bos taurus. This finding indicates a high degree of genetic introgression in these two breeds probably caused by the continuous input of zebu stallions in the Colombian Creole breeds. In other five Creole breeds (Blanco Orejinegro -BON-, Chino Santandereano, Costeño con Cuernos, Hartón del Valle and Sanmartinero, the bulls had a submetacentric Y chromosome characteristic of Bos taurus.

  17. In Memoriam Dr Lute Bos (1928-2010)

    NARCIS (Netherlands)

    Vlugt, van der R.A.A.

    2010-01-01

    Tuesday July 6, 2010 we were shocked by the news that that day our former colleague Lute Bos had died unexpectedly at the age of 82. Lute was a world-famous plant virologist. From the start of his career in 1957 until his retirement from the Institute for Plant Protection (IPO-DLO) in Wageningen in

  18. Combining ART and FBP for improved fidelity of tomographic BOS

    Science.gov (United States)

    Hartmann, Ulrich; Seume, Joerg R.

    2016-09-01

    Engine component defects along the hot-gas path (HGP) of jet engines influence the density distribution of the flow, and thus result in characteristic patterns in the exhaust jet. These characteristic patterns can be reconstructed with the optical background-oriented schlieren (BOS) method in a tomographic set-up, which in turn allows the identification of defects inside the engine through an exhaust jet analysis. The quality of the tomographic reconstruction strongly influences how easily defects can be detected inside the jet engine. In particular, the presence of high gradients in the reconstruction area has a strong impact on the reconstruction quality. An algebraic reconstruction algorithm (ART) is implemented and compared to a filtered-back projection (FBP) algorithm in terms of the capability of performing high-gradient tomographic BOS reconstructions. A combination of both algorithms is presented which significantly improves the reconstruction quality of high-gradient tomographic BOS in terms of artifact reduction. The combination of both algorithms is applied to both synthetic and real measurement data in this paper, in order to show possible applications and the achievable improvement of high-gradient tomographic BOS reconstructions.

  19. Dating North European mammoths (Mammuthus primigenius Blum.): a nearly continuous record from 53 ka to 11 ka

    Science.gov (United States)

    Ukkonen, P.; Aaris-Sørensen, K.; Arppe, L.; Clark, P. U.; Daugnora, L.; Lister, A.; Lõugas, L.; Seppä, H. A.; Stuart, A. J.; Wojtal, P.; Zupins, I.

    2010-05-01

    Remains of the woolly mammoth (Mammuthus primigenius Blumenbach) are found all over Eurasia except in mountainous areas of Scandinavia and in western Iberian Peninsula. In the core area of the Scandinavian Ice Sheet, they are the only group of animal remains to have survived until today in abundant numbers, and so are an important source of information about the past fauna, their environment, and the climate. Our data include mammoth remains found in Sweden, Denmark, Lithuania, Latvia, Estonia and Finland. Mammoth finds from northern Germany are not included in this study, but some dates have been published elsewhere. We lack data from northern Poland, but we include finds from southern Poland, approximately 500 km directly south of the main study area, as a point of comparison. Approximately 300 localities with mammoth molars, tusks and bones are known from the study area. Most of the finds (90%) are isolated skeletal elements. In marginal areas of the SIS, in Denmark and Lithuania, associated elements are also found together at some localities, but whole or partial skeletons are found only in southern Poland. The mammoth data were collected by the authors from published papers and reports as well as by direct survey of museum collections. A total of 104 radiocarbon dates were documented: 78 from the circum-Baltic area and 26 from southern Poland. From the dates, 73 were previously published by the authors, and eight by other researchers. A total of 23 dates are new. Most of the specimens (93) were dated using AMS, and 11 using conventional radiocarbon dating. Finite dates were calibrated using the download version of CalPal-2007 (Weninger et al., 2008) with calibration data set CalPal-2007Hulu (Weninger and Jöris, 2007). The spatio-temporal distribution of mammoth remains around the Baltic Sea suggests that the species was widely spread in north-eastern Europe during ice-free intervals of the Weichselian glaciation. Mammoths were present in north-eastern Europe

  20. Genome wide scan for quantitative trait loci affecting tick resistance in cattle (Bos taurus × Bos indicus

    Directory of Open Access Journals (Sweden)

    Guimarães Simone EF

    2010-04-01

    Full Text Available Abstract Background In tropical countries, losses caused by bovine tick Rhipicephalus (Boophilus microplus infestation have a tremendous economic impact on cattle production systems. Genetic variation between Bos taurus and Bos indicus to tick resistance and molecular biology tools might allow for the identification of molecular markers linked to resistance traits that could be used as an auxiliary tool in selection programs. The objective of this work was to identify QTL associated with tick resistance/susceptibility in a bovine F2 population derived from the Gyr (Bos indicus × Holstein (Bos taurus cross. Results Through a whole genome scan with microsatellite markers, we were able to map six genomic regions associated with bovine tick resistance. For most QTL, we have found that depending on the tick evaluation season (dry and rainy different sets of genes could be involved in the resistance mechanism. We identified dry season specific QTL on BTA 2 and 10, rainy season specific QTL on BTA 5, 11 and 27. We also found a highly significant genome wide QTL for both dry and rainy seasons in the central region of BTA 23. Conclusions The experimental F2 population derived from Gyr × Holstein cross successfully allowed the identification of six highly significant QTL associated with tick resistance in cattle. QTL located on BTA 23 might be related with the bovine histocompatibility complex. Further investigation of these QTL will help to isolate candidate genes involved with tick resistance in cattle.

  1. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus

    Directory of Open Access Journals (Sweden)

    JIMÉNEZ ROBAYO LIGIA MERCEDES

    2008-04-01

    Full Text Available

    El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.

  2. High environmental temperature and humidity decrease oocyte quality in Bos taurus but not in Bos indicus cows.

    Science.gov (United States)

    Rocha, A; Randel, R D; Broussard, J R; Lim, J M; Blair, R M; Roussel, J D; Godke, R A; Hansel, W

    1998-02-01

    Two experiments were conducted to assess the effects of environmental temperature and humidity on the quality and developmental capabilities of bovine oocytes. In Experiment 1, Bos taurus (Holstein and crossbred Angus) cows were subjected to 5 weekly sessions of ultrasound-guided follicle aspiration from February 16 through March 23 (cool season) and 5 sessions from May 22 through June 20 (hot season). In Experiment 2, Bos taurus (Holstein) and Bos indicus (Brahman) cows were superstimulated (Super-Ov) during the months of August (hot season) or January (cool season), and each cow was subjected to a single oocyte aspiration session. In each experiment, oocytes were classified as normal or abnormal based on ooplasm morphology and cumulus cell layers. In Experiment 1, oocytes classified as normal were in vitro matured and fertilized (IVM/IVF), and the resulting embryos cultured for 8 d. All oocytes recovered from superstimulated cows in Experiment 2 were matured and fertilized in vitro and the subsequent embryos cultured for 8 d, regardless of their morphological appearance. In Experiment 1, Bos taurus cows produced a higher (P = 0.02) percentage of normal oocytes during the cool season (75.9 +/- 8.0) than during the hot season (41.0 +/- 9.5). The percentage of fertilized oocytes developing to the 2-cell (82.4), 8-cell (65.4) and morula (46.6) stages were also greater (P Holstein) had a lower (P = 0.01) percentage of normal oocytes in the hot season (24.5 vs 80.0) and a lower (P or = 0.57) in the percentage of normal oocytes or in embryo development was detected between seasons in Bos indicus (Brahman) cows. In conclusion, high environmental temperature and humidity resulted in a marked decline in the quality of oocytes retrieved from Bos taurus cows and markedly decreased their in vitro developmental capabilities. In contrast, a high percentage of oocytes retrieved from Bos indicus cows exhibited normal morphology and yielded a high proportion of blastocysts

  3. MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    Directory of Open Access Journals (Sweden)

    Roger Alonso Cubero-Rojas

    2013-01-01

    Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

  4. Screening of biotechnical parameters for production of bovine inter-subspecies embryonic chimeras by the aggregation of tetraploid Bos indicus and diploid crossbred Bos taurus embryos.

    Science.gov (United States)

    Razza, Eduardo M; Satrapa, Rafael A; Emanuelli, Isabele P; Barros, Ciro M; Nogueira, Marcelo F G

    2016-03-01

    The aggregation of a tetraploid zebu embryo (Bos indicus, a thermotolerant breed) with a diploid taurine embryo (Bos taurus, a thermosensitive breed) should create a complete taurine fetus, whose extra-embryonic components, e.g., the chorion, is derived mainly from the zebu embryo. These zebu-derived extra-embryonic components may interact positively with the taurine embryo/fetus during pregnancy in a tropical environment. We tested different parameters for the production of tetraploid Nelore (Bos indicus) embryos to be combined via aggregation with crossbred Bos taurus (diploid) embryos in order to produce viable chimeric blastocysts. Bovine (Bos indicus or crossbred Bos taurus) embryos were produced in vitro according to standard procedures. Two-cell Bos indicus embryos were submitted to electrofusion with varying numbers of pulses (1 or 2), voltages (0.4, 0.5, 0.75, 1.0, 1.4 and 5.0 kV/cm) and time (20, 25, 50 and 60 μs) to produce tetraploid embryos. Electrofused embryos were cultured with crossbred non-fused embryos to form chimeras that developed until the blastocyst stage. The best fusion parameter was 0.75 kV/cm for 60 μs. Four chimeric blastocysts (tetraploid Nelore with diploid crossbred Holstein) were formed after 31 attempts in 4 replicates (13%). We established an optimal procedure for the production of tetraploid Bos indicus (4n) embryos and embryonic chimeras by aggregation of crossbred Bos taurus (2n) with Bos indicus (4n) embryos. This technique would be valid in applied research, by producing exclusively taurine calves, but with placental elements from the Bos indicus breed, following transfer of these chimeras into recipient cows.

  5. Effects of Anomalous Tensor Couplings in BOs -(B-)Os Mixing

    Institute of Scientific and Technical Information of China (English)

    CHANG Qin; HAN Lin; YANG Ya-Dong

    2012-01-01

    Motivated by the recently observed anomalous large dimuon charge asymmetry in neutral B decays,we study the effects of the anomalous tensor couplings to pursue a possible solution.With the constraints from the observables φJ/(φ)(φ,f0)s,aSsl and ΔMs,the new physics parameter spaces are severely restricted.We find that the contributions induced by the color-singlet or the color-octet tensor operators are helpful to moderate the anomaly in BOs - (B-)Osmixing.Numerically,the observable aSsl could be enhanced by about two orders of magnitude by the contributionsof color-singlet or color-octet tensor operators with their respective nontrivial new weak phase φT1 =41° ± 35° orφs =-47° ± 33° and relevant strength parameters |gT1| =(2.89 ± 1.40) × 10-2 or |gT8| =(0.79 ± 0.34) × 10-2.However,due to the fact that the NP contributions are severely suppressed by the recent LHCb measurement for φJ/φ(φ,f0)s,our theoretical result of aSsl is still much smaller than the central value of the experimental data.

  6. Mortality profiles of the large herbivores from the Lingjing Xuchang Man Site,Henan Province and the early emergence of the modern human behaviors in East Asia

    Institute of Scientific and Technical Information of China (English)

    ZHANG ShuangQuan; LI ZhanYang; ZHANG Yue; GAO Xing

    2009-01-01

    This paper presents the results of a detailed study of mortality profiles of the large herbivores from the Middle Palaeolithic (MP) bone assemblage of the Lingjing Xuchang Man Site,Henan Province.Based on the analysis of the crown heights of fossil teeth from this assemblage,we come to a conclusion that aurochs (Bos primigenius) and horse (Equus caballus) are the major prey species in this assemblage and the age structures of these animals can be best described as the "prime-dominated pattern".This study confirmed the well-established notions at many Middle and Upper Palaeolithic sites across Eurasia and Africa that MSA/MP foragers were fully effective in hunting aggressive prey species,particularly aurochs and horse.This find indicates that the hunting behaviors and subsistence strategies were not significantly different between MP and UP (the Upper Palaeolithic) humans in East Asia and hence suggests the early emergence of the modern human behaviors in this area.

  7. Calibration of a Background Oriented Schlieren (BOS) Set-up

    Science.gov (United States)

    Porta, David; Echeverría, Carlos; Cardoso, Hiroki; Aguayo, Alejandro; Stern, Catalina

    2014-11-01

    We use two materials with different known indexes of refraction to calibrate a Background Oriented Schlieren (BOS) experimental set-up, and to validate the Lorenz-Lorentz equation. BOS is used in our experiments to determine local changes of density in the shock pattern of an axisymmetric supersonic air jet. It is important to validate, in particular, the Gladstone Dale approximation (index of refraction close to one) in our experimental conditions and determine the uncertainty of our density measurements. In some cases, the index of refraction of the material is well known, but in others the density is measured and related to the displacement field. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  8. Accuracy of genomic predictions in Bos indicus (Nellore) cattle

    OpenAIRE

    Neves, Haroldo HR; Carvalheiro, Roberto; O’Brien, Ana M Pérez; Utsunomiya, Yuri T; do Carmo, Adriana S; Schenkel, Flávio S; Sölkner, Johann; McEwan, John C; Van Tassell, Curtis P.; Cole, John B; da Silva, Marcos VGB; Queiroz, Sandra A; Tad S. Sonstegard; Garcia, José Fernando

    2014-01-01

    Background Nellore cattle play an important role in beef production in tropical systems and there is great interest in determining if genomic selection can contribute to accelerate genetic improvement of production and fertility in this breed. We present the first results of the implementation of genomic prediction in a Bos indicus (Nellore) population. Methods Influential bulls were genotyped with the Illumina Bovine HD chip in order to assess genomic predictive ability for weight and carcas...

  9. Pengaruh Anggaran Bantuan Operasional Sekolah (BOS) Terhadap Peningkatan Prestasi Belajar Siswa SMP Di Kota Medan

    OpenAIRE

    Syafrida

    2014-01-01

    The objective of the research was to find out the correlation and the effectiveness of BOS (School Operation Assistance) fund with the improvement of SMP students' learning achievement in Medan. BOS program has started since July, 2005 which is aimed to ease people's burden in education cost by giving financial aid for supporting qualified nine-year learning compulsory. Although the government has distributed BOS fund to schools, there are still many poor children who drop out of school, and ...

  10. Staphylococcus via an interaction with the ELR+ CXC chemokine ENA-78 is associated with BOS.

    Science.gov (United States)

    Gregson, A L; Wang, X; Injean, P; Weigt, S S; Shino, M; Sayah, D; DerHovanessian, A; Lynch, J P; Ross, D J; Saggar, R; Ardehali, A; Li, G; Elashoff, R; Belperio, J A

    2015-03-01

    Staphylococcus aureus is the most commonly isolated gram-positive bacterium after lung transplantation (LT) and has been associated with poor posttransplant outcomes, but its effect on bronchiolitis obliterans syndrome (BOS) and death in the context of the allograft inflammatory environment has not been studied. A three-state Cox semi-Markovian model was used to determine the influence of allograft S. aureus and the ELR+ CXC chemokines on the survival rates and cause-specific hazards for movement from lung transplant (State 1) to BOS (State 2), from transplant (State 1) to death (State 3), and from BOS (State 2) to death (State 3). Acute rejection, pseudomonas pneumonia, bronchoalveolar lavage fluid (BALF) CXCL5 and its interaction with S. aureus all increased the likelihood of transition from transplant to BOS. Transition to death from transplant was facilitated by pseudomonas infection and single lung transplant. Movement from BOS to death was affected by the interaction between aspergillus, pseudomonas and CXCL5, but not S. aureus. S. aureus isolation had state specific effects after LT and only in concert with elevated BALF CXCL5 concentrations did it augment the risk of BOS. Pseudomonas and elevated BALF concentrations of CXCL5 continued as significant risk factors for BOS and death after BOS in lung transplantation.

  11. Seminal plasma proteome of electroejaculated Bos indicus bulls.

    Science.gov (United States)

    Rego, J P A; Crisp, J M; Moura, A A; Nouwens, A S; Li, Y; Venus, B; Corbet, N J; Corbet, D H; Burns, B M; Boe-Hansen, G B; McGowan, M R

    2014-07-01

    The present study describes the seminal plasma proteome of Bos indicus bulls. Fifty-six, 24-month old Australian Brahman sires were evaluated and subjected to electroejaculation. Seminal plasma proteins were separated by 2-D SDS-PAGE and identified by mass spectrometry. The percentage of progressively motile and morphologically normal sperm of the bulls were 70.4 ± 2.3 and 64 ± 3.2%, respectively. A total of 108 spots were identified in the 2-D maps, corresponding to 46 proteins. Binder of sperm proteins accounted for 55.8% of all spots detected in the maps and spermadhesins comprised the second most abundant constituents. Other proteins of the Bos indicus seminal plasma include clusterin, albumin, transferrin, metalloproteinase inhibitor 2, osteopontin, epididymal secretory protein E1, apolipoprotein A-1, heat shock 70 kDa protein, glutathione peroxidase 3, cathelicidins, alpha-enolase, tripeptidyl-peptidase 1, zinc-alpha-2-glycoprotein, plasma serine protease inhibitor, beta 2-microglobulin, proteasome subunit beta type-4, actin, cathepsins, nucleobinding-1, protein S100-A9, hemoglobin subunit alpha, cadherin-1, angiogenin-1, fibrinogen alpha and beta chain, ephirin-A1, protein DJ-1, serpin A3-7, alpha-2-macroglobulin, annexin A1, complement factor B, polymeric immunoglobulin receptor, seminal ribonuclease, ribonuclease-4, prostaglandin-H2 d-isomerase, platelet-activating factor acetylhydrolase, and phosphoglycerate kinase 1. In conclusion, this work uniquely portrays the Bos indicus seminal fluid proteome, based on samples from a large set of animals representing the Brahman cattle of the tropical Northern Australia. Based on putative biochemical attributes, seminal proteins act during sperm maturation, protection, capacitation and fertilization. PMID:24889044

  12. In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

  13. A disintegrin and metalloprotease-12 is type I myofiber specific in Bos taurus and Bos indicus cattle.

    Science.gov (United States)

    Coles, C A; Wadeson, J; Knight, M I; Cafe, L M; Johns, W H; White, J D; Greenwood, P L; McDonagh, M B

    2014-04-01

    A disintegrin and metalloproteinase-12 (ADAM12) is involved in the regulation of myogenesis and adipogenesis and is of interest as a potential target to manipulate skeletal muscle development and intramuscular fat (IMF) deposition in cattle to increase beef yield and improve meat quality. The longissimus thoracis muscle (LM) and semitendinosus muscle (STM) from 5 Bos taurus (Angus) and 5 Bos indicus (Brahman) cattle were collected for histological and ADAM12 gene and protein expression analysis. Myofiber typing was used to determine if ADAM12 expression patterns related to differences in muscling and IMF deposition, which are influenced by proportions of the different myofiber types. The STM was found to contain a higher proportion of glycolytic myofibers than the LM, which contained a greater proportion of oxidative myofibers (myofiber ratio of glycolytic to more oxidative types in LM and STM of 1.1 and 3.5, respectively; P < 0.05). ADAM12 gene expression, fluorescent immunohistochemical staining for ADAM12, and image analysis found ADAM12 to be greater in the LM (P < 0.05). Regression analysis found a strong, positive relationship for the distribution of ADAM12 against the proportion of type I myofibers (P < 0.05, r(2) = 0.86). These findings suggest ADAM12 is upregulated in muscles with more slow-oxidative myofibres, such as the LM, and is linked to type I myofibers in cattle. ADAM12 may be important in the regulation and maintenance slow myofibers in the LM muscle. PMID:24663211

  14. A randomised controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation

    OpenAIRE

    Corris, Paul A; Ryan, Victoria A; Small, Therese; Lordan, James; Fisher, Andrew J.; Meachery, Gerard; Johnson, Gail; Ward, Chris

    2015-01-01

    Background We conducted a placebo-controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation. Methods We compared azithromycin (250 mg alternate days, 12 weeks) with placebo. Primary outcome was FEV1 change at 12 weeks. Results 48 patients were randomised; (25 azithromycin, 23 placebo). It was established, post randomisation that two did not have BOS. 46 patients were analysed as intention to treat (ITT) with 33 ‘Completers’. ITT analysis inc...

  15. Gene expression in the skin of Bos taurus and Bos indicus cattle infested with the cattle tick, Rhipicephalus (Boophilus) microplus.

    Science.gov (United States)

    Piper, Emily K; Jackson, Louise A; Bagnall, Neil H; Kongsuwan, Kritaya K; Lew, Ala E; Jonsson, Nicholas N

    2008-11-15

    The cattle tick Rhipicephalus microplus (formerly Boophilus microplus) is responsible for severe production losses to the cattle industry worldwide. It has long been known that different breeds of cattle can resist tick infestation to varying degrees; however, the mechanisms by which resistant cattle prevent heavy infestation are largely unknown. The aim of this study was to determine whether gene expression varied significantly between skin sampling sites (neck, chest and tail region), and whether changes in gene expression could be detected in samples taken at tick attachment sites (tick attached to skin sample) compared with samples taken from non-attachment sites (no tick attachment). We present here the results of an experiment examining the expression of a panel of forty-four genes in skin sections taken from Bos indicus (Brahman) cattle of known high resistance, and Bos taurus (Holstein-Friesian) cattle of known low resistance to the cattle tick. The forty-four genes chosen for this study included genes known to be involved in several immune processes, some structural genes, and some genes previously suggested to be of importance in tick resistance by other researchers. The expression of fifteen gene transcripts increased significantly in Holstein-Friesian skin samples at tick attachment sites. The higher expression of many genes involved in innate inflammatory processes in the Holstein-Friesian animals at tick attachment sites suggests this breed is exhibiting a non-directed pathological response to infestation. Of the forty-four genes analysed, no transcripts were detected in higher abundance at tick attachment sites in the Brahman cattle compared with similar samples from the Holstein-Friesian group, nor difference between attachment site and non-attachment site samples within the Brahman group. The results presented here suggest that the means by which these two cattle breeds respond to tick infestation differ and warrant further investigation. PMID

  16. Growth traits and composition of two- and three-way-cross intact male progeny of Bos taurus and Bos indicus X Bos taurus dams.

    Science.gov (United States)

    Van Ornum, K M; Bailey, C M; Ringkob, T P; Koh, Y O

    1987-07-01

    Feedlot traits, carcass traits and distribution of commercial cuts of crossbred intact male progeny (n = 556) from young and mature Hereford, Red Poll, Hereford X Red Poll, Red Poll X Hereford, Angus X Hereford, Angus X Charolais, Brahman X Hereford and Brahman X Angus dams were evaluated. First-calf heifers were bred to Red Angus bulls; Santa Gertrudis sires were used for each cow's second and third breeding seasons. Calves from these young dams were slaughtered at 13 mo. Calves of mature dams were all sired by Limousin bulls and slaughtered at 12 mo. Dam breed was a major source of variation in most bull traits. Progeny of Brahman-cross dams were inferior (P less than .01) in daily gain, final weight, carcass weight and in edible cuts/day of age compared with progeny from Bos taurus dams. Intact male progeny of Angus X Charolais dams ranked highest in longissimus area, cutability, and edible cuts/day of age. The range of dam breed means in percentage of steak, roast, bone-in cuts (chuck short ribs and back ribs), short plate and thin cuts, and lean trim was just over 1%. Greater variation among dam breeds existed in fat measurements. Analyses in which Hereford-Red Poll diallel data for young dams and mature dams were combined showed positive maternal heterosis for dressing percentage (P less than .05), carcass weight (P less than .05), carcass weight/day of age (P less than .05), estimated carcass fat (P less than .05), fat thickness (P less than .01) and marbling score (P less than .01). Reciprocal effects were inconsequential. Results illustrate the importance of dam breed-type effects in formulating breeding strategies for commercial beef herds.

  17. Growth traits and composition of two- and three-way-cross intact male progeny of Bos taurus and Bos indicus X Bos taurus dams.

    Science.gov (United States)

    Van Ornum, K M; Bailey, C M; Ringkob, T P; Koh, Y O

    1987-07-01

    Feedlot traits, carcass traits and distribution of commercial cuts of crossbred intact male progeny (n = 556) from young and mature Hereford, Red Poll, Hereford X Red Poll, Red Poll X Hereford, Angus X Hereford, Angus X Charolais, Brahman X Hereford and Brahman X Angus dams were evaluated. First-calf heifers were bred to Red Angus bulls; Santa Gertrudis sires were used for each cow's second and third breeding seasons. Calves from these young dams were slaughtered at 13 mo. Calves of mature dams were all sired by Limousin bulls and slaughtered at 12 mo. Dam breed was a major source of variation in most bull traits. Progeny of Brahman-cross dams were inferior (P less than .01) in daily gain, final weight, carcass weight and in edible cuts/day of age compared with progeny from Bos taurus dams. Intact male progeny of Angus X Charolais dams ranked highest in longissimus area, cutability, and edible cuts/day of age. The range of dam breed means in percentage of steak, roast, bone-in cuts (chuck short ribs and back ribs), short plate and thin cuts, and lean trim was just over 1%. Greater variation among dam breeds existed in fat measurements. Analyses in which Hereford-Red Poll diallel data for young dams and mature dams were combined showed positive maternal heterosis for dressing percentage (P less than .05), carcass weight (P less than .05), carcass weight/day of age (P less than .05), estimated carcass fat (P less than .05), fat thickness (P less than .01) and marbling score (P less than .01). Reciprocal effects were inconsequential. Results illustrate the importance of dam breed-type effects in formulating breeding strategies for commercial beef herds. PMID:3610866

  18. Influence of calf genotype on colostral immunoglobulins in Bos taurus and Bos indicus cows and serum immunoglobulins in their calves.

    Science.gov (United States)

    Vann, R C; Holloway, J W; Carstens, G E; Boyd, M E; Randel, R D

    1995-10-01

    Purebred Bos indicus calves are documented to have lower survival rates than Bos taurus calves. Thus, this study was designed to investigate the possibility that this decreased survival rate may be attributed to dam colostral immunoglobulin (Ig) concentrations and subsequent calf serum Ig concentrations. The specific objective was to determine the effect of breed type of calf on colostrum production, immunoglobulin concentrations in colostrum and calf serum, and availability and absorption efficiency of Ig. Brahman (B) and Angus (A) cattle were reciprocally mated to produce calves of the following types: A x A (n = 8), A x B (n = 9), B x B (n = 11), and B x A (n = 11). At birth, calves were separated from their dams and a blood sample was collected before feeding pooled colostrum (30 mL/kg birth weight) at 1 and 6 h of age. From 6 to 12 h of age, each calf was placed in a box that allowed interaction with the dam but prevented suckling. At 12 h of age, each calf was fed its dam's colostrum and placed with the dam. Additional blood samples were collected at 12, 24, and 48 h after birth. Serum and colostrum samples were analyzed for IgG, IgG1, IgG2, IgM, and IgA using single radial immunodiffusion (RID) assay techniques. The cows were hand-milked after induction of milk letdown with oxytocin at 1 and 12 h after calving. Colostrum volume was recorded, and samples were collected. Brahman cows produced more (P x B and A x B breed types of calf. Brahman cows had more Ig available at 1 and 12 h than A cows due to increased production of colostrum. Breed type influenced colostral Ig in cattle. Serum concentrations of total Ig, IgG, IgG1, IgG2, IgM, and IgA in the calf and efficiency of absorption at 6 and 12 h were not affected by breed type, sex of calf, or any interaction. PMID:8617676

  19. Comparative microarray analysis of Rhipicephalus (Boophilus microplus expression profiles of larvae pre-attachment and feeding adult female stages on Bos indicus and Bos taurus cattle

    Directory of Open Access Journals (Sweden)

    Gondro Cedric

    2010-07-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus microplus is an obligate blood feeder which is host specific to cattle. Existing knowledge pertaining to the host or host breed effects on tick transcript expression profiles during the tick - host interaction is poor. Results Global analysis of gene expression changes in whole R. microplus ticks during larval, pre-attachment and early adult stages feeding on Bos indicus and Bos taurus cattle were compared using gene expression microarray analysis. Among the 13,601 R. microplus transcripts from BmiGI Version 2 we identified 297 high and 17 low expressed transcripts that were significantly differentially expressed between R. microplus feeding on tick resistant cattle [Bos indicus (Brahman] compared to R. microplus feeding on tick susceptible cattle [Bos taurus (Holstein-Friesian] (p ≤ 0.001. These include genes encoding enzymes involved in primary metabolism, and genes related to stress, defence, cell wall modification, cellular signaling, receptor, and cuticle formation. Microarrays were validated by qRT-PCR analysis of selected transcripts using three housekeeping genes as normalization controls. Conclusion The analysis of all tick stages under survey suggested a coordinated regulation of defence proteins, proteases and protease inhibitors to achieve successful attachment and survival of R. microplus on different host breeds, particularly Bos indicus cattle. R. microplus ticks demonstrate different transcript expression patterns when they encounter tick resistant and susceptible breeds of cattle. In this study we provide the first transcriptome evidence demonstrating the influence of tick resistant and susceptible cattle breeds on transcript expression patterns and the molecular physiology of ticks during host attachment and feeding. The microarray data used in this analysis have been submitted to NCBI GEO database under accession number GSE20605 http://www.ncbi

  20. An experimental study of aero-optical aberration and dithering of supersonic mixing layer via BOS

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The optical performance of supersonic mixing layer is heavily deteriorated by the aero-optical aberration and dithering of coherent structures, but current measuring methods limit the spatiotemporal resolution in relevant studies. A high resolution whole-field aero-optical aberration and dithering measuring method based on the Background Orient Schlieren (BOS) technique was studied. The systematic structure, sensitivity and resolution of BOS are analyzed in this paper. The aero-optical aberration and dithering of streamwise structures in supersonic mixing layers were quantificationally studied with BOS. The aberration field of spanwise structures revealed the ribbon-like aberration structures, which heavily restrict the optical performance of a mixing layer. The quantifications of aero-optical aberration and dithering are very important in studying aero-optical performance of supersonic mixing layer.

  1. A high dynamic radiation measurements instrument: the Bolometric Oscillation Sensor (BOS

    Directory of Open Access Journals (Sweden)

    P. Zhu

    2014-12-01

    Full Text Available The bolometric oscillation sensor (BOS is a broadband radiation measurement instrument onboard the PICARD satellite that has been active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radiation. In the present article, the measurement principle of BOS and its transfer function are presented. The performance of the instrument is discussed based on laboratory experiments and space observations from the PICARD satellite. The comparison of the short term variation of Total Solar Irradiance (TSI with absolute radiometers such as VIRGO/SOHO and TIM/SORCE over the same period of time, suggests that BOS is a relatively much simpler but very effective sensor to monitor electromagnetic radiation variations from visible to infrared wavelengths.

  2. ALGUNOS FACTORES RELACIONADOS CON LA DINÁMICA FOLICULAR EN BOS INDICUS SOME FACTORS RELATED TO FOLLICULAR DYNAMICS IN BOS INDICUS

    Directory of Open Access Journals (Sweden)

    Guillermo Henao Restrepo

    2010-12-01

    Full Text Available El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo un folículo se torna ovulatorio. El crecimiento folicular en forma de ondas también se produce durante el período prepuberal, puberal, primer tercio de la gestación y período de anestro posparto. Aunque existe mucha similitud en el patrón fundamental del desarrollo de ondas foliculares entre Bos taurus y Bos indicus, se han encontrado diferencias en la dinámica folicular que pueden afectar el comportamiento reproductivo y la aplicación de biotecnologías reproductivas. La dinámica folicular puede variar por efectos ambientales y estados fisiológicos de hembras Bos indicus que impiden establecer un patrón específico de dinámica folicular para cada raza y etapa fisiológica. El propósito de esta revisión es analizar la función reproductiva teniendo en cuenta las diferencias de la dinámica folicular entre estados fisiológicos y condiciones ambientales de hembras bovinas con énfasis en B. indicus.The bovine follicular development during a normal estrous cycle, is characterized by a growth in wave form with presence of two to five follicular cohorts by cycle, of which only one follicle ovulate. The follicular growth in wave form also occurs during the prepubertal and pubertal periods, first quarter of the gestation, and in the postpartum anestrous period. Although there is great similarity in the fundamental pattern of the development of follicular waves between Bos taurus and Bos indicus, differences of follicular dynamics has been detected, that can affect the reproductive behavior and the application of reproductive biotechnologies. Follicular dynamics can change by environmental effects and physiological states of Bos indicus females that impede to establish a specific pattern of follicular dynamics for each breed and physiological

  3. Imputation of Microsatellite Alleles from Dense SNP Genotypes for Parentage Verification Across Multiple Bos taurus and Bos indicus breeds

    Directory of Open Access Journals (Sweden)

    Matthew Charles Mcclure

    2013-09-01

    Full Text Available To assist cattle producers transition from microsatellite (MS to single nucleotide polymorphism (SNP genotyping for parental verification we previously devised an effective and inexpensive method to impute MS alleles from SNP haplotypes. While the reported method was verified with only a limited data set (N=479 from Brown Swiss, Guernsey, Holstein, and Jersey cattle, some of the MS-SNP haplotype associations were concordant across these phylogenetically diverse breeds. This implied that some haplotypes predate modern breed formation and remain in strong linkage disequilibrium. To expand the utility of MS allele imputation across breeds, MS and SNP data from more than 8,000 animals representing 39 breeds (Bos taurus and B. indicus were used to predict 9,410 SNP haplotypes, incorporating an average of 73 SNPs per haplotype, for which alleles for 12 MS markers could be accurately be imputed. Approximately 25% of the MS-SNP haplotypes were present in multiple breeds (N=2 to 36 breeds. These shared haplotypes allowed for MS imputation in breeds that were not represented in the reference population with only a small increase in Mendelian inheritance inconsistancies. Our reported reference haplotypes can be used for any cattle breed and the reported methods can be applied to any species to aid the transition from MS to SNP genetic markers. While ~91% of the animals with imputed alleles for 12 MS markers had <1 Mendelian inheritance conflicts with their parents’ reported MS genotypes, this figure was 96% for our reference animals, indicating potential errors in the reported MS genotypes. The workflow we suggest autocorrects for genotyping errors and rare haplotypes, by MS genotyping animals whose imputed MS alleles fail parentage verification, and then incorporating those animals into the reference dataset.

  4. A new single nucleotide polymorphism in CAPN1 extends the current tenderness marker test to include cattle of Bos indicus, Bos taurus, and crossbred descent.

    Science.gov (United States)

    White, S N; Casas, E; Wheeler, T L; Shackelford, S D; Koohmaraie, M; Riley, D G; Chase, C C; Johnson, D D; Keele, J W; Smith, T P L

    2005-09-01

    The three objectives of this study were to 1) test for the existence of beef tenderness markers in the CAPN1 gene segregating in Brahman cattle; 2) test existing CAPN1 tenderness markers in indicus-influenced crossbred cattle; and 3) produce a revised marker system for use in cattle of all subspecies backgrounds. Previously, two SNP in the CAPN1 gene have been described that could be used to guide selection in Bos taurus cattle (designated Markers 316 and 530), but neither marker segregates at high frequency in Brahman cattle. In this study, we examined three additional SNP in CAPN1 to determine whether variation in this gene could be associated with tenderness in a large, multisire American Brahman population. One marker (termed 4751) was associated with shear force on postmortem d 7 (P Brangus, Beefmaster, Bonsmara, Romosinuano, Hereford, and Angus referred to as the GPE Cycle 8 population). The highly significant association of Marker 4751 with shear force in this population (P < 0.001) confirms the usefulness of Marker 4751 in cattle of all subspecies backgrounds, including Bos taurus, Bos indicus, and crossbred descent. This wide applicability adds substantial value over previously released Markers 316 and 530. However, Marker 316, which had previously been shown to be associated with tenderness in the GPE Cycle 7 population, also was highly associated with shear force in the GPE Cycle 8 animals (P < 0.001). Thus, Marker 316 may continue to be useful in a variety of populations with a high percentage of Bos taurus backgrounds. An optimal marker strategy for CAPN1 in many cases will be to use both Markers 316 and 4751. PMID:16100054

  5. Impact of Balance Of System (BOS) costs on photovoltaic power systems

    Science.gov (United States)

    Hein, G. F.; Cusick, J. P.; Poley, W. A.

    1978-01-01

    The Department of Energy has developed a program to effect a large reduction in the price of photovoltaic modules, with significant progress already achieved toward the 1986 goal of 50 cents/watt (1975 dollars). Remaining elements of a P/V power system (structure, battery storage, regulation, control, and wiring) are also significant cost items. The costs of these remaining elements are commonly referred to as Balance-of-System (BOS) costs. The BOS costs are less well defined and documented than module costs. The Lewis Research Center (LeRC) in 1976/77 and with two village power experiments that will be installed in 1978. The costs were divided into five categories and analyzed. A regression analysis was performed to determine correlations of BOS Costs per peak watt, with power size for these photovoltaic systems. The statistical relationship may be used for flat-plate, DC systems ranging from 100 to 4,000 peak watts. A survey of suppliers was conducted for comparison with the predicted BOS cost relationship.

  6. ‘Lute Bos draagt nog altijd bij aan de virologie’ : fonds laat ecologische virologie herrijzen

    NARCIS (Netherlands)

    Vlugt, van der R.A.A.; Branderhorst, A.

    2014-01-01

    Met ecologische kennis van plantenvirussen in de tuin- en akkerbouw zijn opbrengstverliezen te voorkomen. René van der Vlugt gaat het onderzoek en onderwijs in dit vakgebied nieuw leven inblazen. Dat is mogelijk dankzij een legaat van de Wageningse plantenviroloog Lute Bos.

  7. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    NARCIS (Netherlands)

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthra

  8. The preliminary measurements from the Bolometer Oscillation System (BOS) on board PICARD

    Science.gov (United States)

    Zhu, P.; Ruymbeke, M. V.; Meftah, M.; Clette, F.; Dewitte, S.; Chevalier, A.; van Ruymbeke, F.; Noel, J.

    2010-12-01

    The PICARD is a French CNES micro-satellite mission which was successfully launched on June 15, 2010 by the Russian DNEPR launcher. Its objectives are the study of the origin of the solar variability and the relations between the Sun and the Earth’s climate. The duration of the mission is about two years with possibility to extend to three or more years. SOVAP/BOS (SOlar Variability for Picard - Bolometer Oscillation System) is one of the key instruments in the PICARD payload. The main goal of SOVAP/BOS consists in measuring the TSI (Total Solar Irradiance) with very high precision. SOVAP is a new improved version of the DIARAD absolute solar radiometer, which has been successfully installed and operated on several previous missions designed by the Royal Meteorological Institute of Belgium. BOS is a pioneering experiment or to say, a complementary part of SOVAP. It consists of a solar bolometer that measures the incident electromagnetic radiation power by converting this radiation energy in a thermal signal. The radiation is measured using a differential thermometer placed in a thermal shunt. By design, this bolometer is able to measure radiation integrated over all wavelengths and provide a broad dynamic range, with high precision and combined with a fast measuring cadence of 10s, instead of typ. 2-3 minutes in earlier TSI (total solar irradiance) measurements. We will show the preliminary results of measurements made by BOS. For instance, the solar eclipse records during 11, July 2010.

  9. Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

  10. A whole-genome assembly of the domestic cow, Bos taurus

    Science.gov (United States)

    Background: The genome of the domestic cow, Bos taurus, was sequenced using a mixture of hierarchical and whole-genome shotgun sequencing methods. Results: We have assembled the 35 million sequence reads and applied a variety of assembly improvement techniques, creating an assembly of 2.86 billion b...

  11. New World cattle show ancestry from multiple independent domestication events.

    Science.gov (United States)

    McTavish, Emily Jane; Decker, Jared E; Schnabel, Robert D; Taylor, Jeremy F; Hillis, David M

    2013-04-01

    Previous archeological and genetic research has shown that modern cattle breeds are descended from multiple independent domestication events of the wild aurochs (Bos primigenius) ∼10,000 y ago. Two primary areas of domestication in the Middle East/Europe and the Indian subcontinent resulted in taurine and indicine lines of cattle, respectively. American descendants of cattle brought by European explorers to the New World beginning in 1493 generally have been considered to belong to the taurine lineage. Our analyses of 47,506 single nucleotide polymorphisms show that these New World cattle breeds, as well as many related breeds of cattle in southern Europe, actually exhibit ancestry from both the taurine and indicine lineages. In this study, we show that, although European cattle are largely descended from the taurine lineage, gene flow from African cattle (partially of indicine origin) contributed substantial genomic components to both southern European cattle breeds and their New World descendants. New World cattle breeds, such as Texas Longhorns, provide an opportunity to study global population structure and domestication in cattle. Following their introduction into the Americas in the late 1400s, semiferal herds of cattle underwent between 80 and 200 generations of predominantly natural selection, as opposed to the human-mediated artificial selection of Old World breeding programs. Our analyses of global cattle breed population history show that the hybrid ancestry of New World breeds contributed genetic variation that likely facilitated the adaptation of these breeds to a novel environment. PMID:23530234

  12. Urinary excretion of purine derivatives as an index of microbial protein supply in cross-bred (Bos indicus x Bos taurus) cattle in tropical environment

    International Nuclear Information System (INIS)

    Four experiments were carried out to establish a response model between urinary excretion of purine derivatives (PD) and microbial production in Bos indicus x Bos taurus cross-bred cattle: LZ, MZ and HZ (3/8, 1/2 and 5/8 Bos indicus, respectively). The fasting PD excretion was considered as endogenous excretion and amounted to 268 (± 85.1), 294 (± 128.1) and 269 (± 68.4) μmol/kg W0.75 for LZ, MZ and HZ, respectively. Urinary recovery of absorbed purine bases (PB) was calculated as the urinary recovery of a single dose of intrajugular infused uric acid (1,3-15N). In HZ crossbred cattle 83% (± 20.3) of infused uric acid was recovered in the urinary PD. The relationship between duodenal purine absorption (X, mmol/d) and urinary PD excretion (Y, mmol/d) was defined in HZ crossbred cattle as Y = 0.83 X + 0.269W0.75 (± 85.1), assuming that the endogenous contribution was constant and independent of the exogenous PB supply. The activity of xanthine oxidase (EC 1.2.3.2.) was determined in HZ and MZ and was found to be higher in the liver (0.62 and 0.66 units/g, respectively) than in intestinal mucosa (0.09 and 0.03 units/g, respectively), whereas xanthine oxidase activity was practically absent in plasma of both cross breeds. The ratio PB:total N was determined in microbial extracts taken from rumen fluid of cows fed Bermuda grass (Cynodon dactylon) as the sole diet or supplemented (ratio of 80:20, grass: supplement) with gluten feed, soybean hulls or Gliricidia species and were found to range from 1.52-1.62 μmol PB/mg N. (author)

  13. Length and Straightness of the Tubes for the BOS Prototype Chamber

    CERN Document Server

    Lagouri, T

    1998-01-01

    We have measured length and straightness of 50 tubes of 3.8~m length, after cleaning, wiring and testing from a batch that was used in the construction of the BOS prototype chamber. The specifi ed length (aluminum tube only, without endplug) was 3800~mm with a tolerance of $\\pm$1~mm. We found a mean value of (3805$\\pm$2)~mm with a standard deviation of (0.3$\\pm$0.1)~mm. The measureme nts of the straightness of the 50 BOS MDT tubes gave a mean of the maximum deviation of 150~$\\mu$m for 10 measured points along the tubes at 0$^{\\circ}$, 90$^{\\circ}$, 180$^{\\circ}$ and 270$^{\\circ }$ around the tube diameter and a mean value of all deviations of 20~$\\mu$m with a measuring accuracy of 10~$\\mu$m.

  14. Bosreservaat Bos Ter Rijst (Heikruis): basisrapport:situering, standplaats, historiek en onderzoek

    OpenAIRE

    Baeté, Hans; Christiaens, Bart; De Keersmaeker, Luc; Esprit, Marc; Van de Kerckhove, Peter; Vandekerkhove, Kris; Walleyn, Ruben

    2006-01-01

    This report is a reference report linked to the monitoring of forest reserve Bos Ter Rijst in Heikruis/Hautecroix near Edingen/Enghien in central Belgium (bilingual region across a linguistic, regional and provincial frontier). It covers various topics:administrative situation and protective status of the reserveits location, soil characteristics and habitatshistorical ecology of the seignory Ter Rijst/Risoir, Ter Rijst/Risoir Wood and the Strijdhout/Strihoux Forestthe reserve's management hi...

  15. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    OpenAIRE

    M.S. Khairiah; I. Zawawi; H. Wahid; Hajarian, H.; Fahrul, F.J.; M.D. Hafiz; Hafiz, M.M.; Z.F. Ann; M.I. Iswadi; O.A. Mazni

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen w...

  16. Genome-Wide Detection and Characterization of Endogenous Retroviruses in Bos taurus ▿

    OpenAIRE

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-01-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A...

  17. Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis): An Anatomic Study

    OpenAIRE

    Moustafa Samy Sherif; Mohammed Attia; Hatem Bahgaat; Ahmed Kassab

    2014-01-01

    The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis) on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints) were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then ...

  18. A high dynamic radiation measurements instrument: the Bolometric Oscillation Sensor (BOS)

    OpenAIRE

    Zhu, P.; Ruymbeke, M. Van; Ö. Karatekin; J.-P. Noël; Thuillier, G.; S. Dewitte; Chevalier, A.; C. Conscience; Janssen, E.; M. Meftah; Irbah, A.

    2014-01-01

    The bolometric oscillation sensor (BOS) is a broadband radiation measurement instrument onboard the PICARD satellite that has been active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radi...

  19. A high dynamic radiation measurements instrument : the Bolometric Oscillation Sensor (BOS)

    OpenAIRE

    Zhu, P.; Ruymbeke, M. Van; Karatekin, Ö.; Noël, J.-P.; Thuillier, G.; S. Dewitte; Chevalier, A.; C. Conscience; Janssen, E.; M. Meftah; Irbah, A.

    2015-01-01

    The Bolometric Oscillation Sensor (BOS) is a broadband radiation measurement instrument onboard the PICARD satellite that was active between 2010 and 2014. The main detector is a thermistor attached black coated surface, which was permanently exposed to space without any optical and aperture accessories. The temperature measurements are used within a transfer function to determine variations in incoming solar irradiance as well as the terrestrial radiation. In the present ar...

  20. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55.

    OpenAIRE

    Kotterman, M.J.J.

    1998-01-01

    Outline of this thesisIn this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthracene and the ligninolytic indicator dye Poly R-478 by the white rot fungus, were studied. Two parameters were identified as the most important PAH oxidation rate-limiting factors: the hydrogen peroxide production r...

  1. Application of background-oriented schlieren (BOS) technique to a laser-induced underwater shock wave

    CERN Document Server

    Yamamoto, Shota; Kameda, Masaharu

    2015-01-01

    We build an ultra-high-speed imaging system based on the background-oriented schlieren (BOS) technique in order to capture a laser-induced underwater shock wave. This BOS technique is able to provide two-dimensional density-gradient field of fluid and requires a simple setup. The imaging system consists of an ultra-high speed video camera, a laser stroboscope, and a patterned background. This system takes images every 0.2 $\\mu$s. Furthermore, since the density change of water disturbed by the shock is exceedingly small, the system has high spatial resolution $\\sim$ 10 $\\mu$m/pixel. Using this BOS system, we examine temporal position of a shock wave. The position agrees well with that measured by conventional shadowgraph, which indicates that the high-speed imaging system can successfully capture the instantaneous position of the underwater shock wave that propagates with the speed of about 1500 m/s. The local density gradient can be determined up to $O$(10$^3$ kg/m$^4$), which is confirmed by the gradient est...

  2. Tick-susceptible Bos taurus cattle display an increased cellular response at the site of larval Rhipicephalus (Boophilus) microplus attachment, compared with tick-resistant Bos indicus cattle.

    Science.gov (United States)

    Piper, Emily K; Jackson, Louise A; Bielefeldt-Ohmann, Helle; Gondro, Cedric; Lew-Tabor, Ala E; Jonsson, Nicholas N

    2010-03-15

    Cattle demonstrate divergent and heritable phenotypes of resistance and susceptibility to infestation with the cattle tick Rhipicephalus (Boophilus) microplus. Bos indicus cattle are generally more resistant to tick infestation than Bos taurus breeds although large variations in resistance can occur within subspecies and within breed. Increased tick resistance has been previously associated with an intense hypersensitivity response in B. taurus breeds; however, the mechanism by which highly resistant B. indicus cattle acquire and sustain high levels of tick resistance remains to be elucidated. Using the commercially available Affymetrix microarray gene expression platform, together with histological examination of the larval attachment site, this study aimed to describe those processes responsible for high levels of tick resistance in Brahman (B. indicus) cattle that differ from those in low-resistance Holstein-Friesian (B. taurus) cattle. We found that genes involved in inflammatory processes and immune responsiveness to infestation by ticks, although up-regulated in tick-infested Holstein-Friesian cattle, were not up-regulated in Brahman cattle. In contrast, genes encoding constituents of the extracellular matrix were up-regulated in Brahmans. Furthermore, the susceptible Holstein-Friesian animals displayed a much greater cellular inflammatory response at the site of larval R. microplus attachment compared with the tick-resistant Brahman cattle. PMID:19852965

  3. Pregnancy rate and birth rate of calves from a large-scale IVF program using reverse-sorted semen in Bos indicus, Bos indicus-taurus, and Bos taurus cattle.

    Science.gov (United States)

    Morotti, F; Sanches, B V; Pontes, J H F; Basso, A C; Siqueira, E R; Lisboa, L A; Seneda, M M

    2014-03-15

    Obtaining sexed sperm from previously frozen doses (reverse-sorted semen [RSS]) provides an important advantage because of the possibility of using the semen of bulls with desired genetic attributes that have died or have become infertile but from whom frozen semen is available. We report the efficiency of RSS on the pregnancy rate and birth rate of calves in a large-scale program using ovum pick-up and in vitro embryo production (IVEP) from Bos indicus, Bos indicus-taurus, and Bos taurus cattle. From 645 ovum pick-up procedures (Holstein, Gir, and Nelore), 9438 viable oocytes were recovered. A dose of frozen semen (Holstein, Nelore, Brahman, Gir, and Braford) was thawed, and the sperm were sex-sorted and cooled for use in IVF. Additionally, IVF with sperm from three Holstein bulls with freeze-thawed, sex-sorted (RSS) or sex-sorted, freeze-thawed (control) was tested. A total of 2729 embryos were produced, exhibiting a mean blastocyst rate of 29%. Heifers and cows selected for adequate body condition, estrus, and health received 2404 embryos, and 60 days later, a 41% average pregnancy rate was observed. A total of 966 calves were born, and 910 were of a predetermined sex, with an average of 94% accuracy in determining the sex. Despite the lower blastocyst rate with freeze-thawed, sex-sorted semen compared with sex-sorted semen, (P 0.05) and sex-sorted efficiency (bull I, 93% vs. 98%; II, 96% vs. 94%; and III, 96% vs. 97% for RSS and control, respectively; P > 0.05) were similar for each of the three bulls regardless of the sperm type used in the IVF. The sexing of previously frozen semen, associated with IVEP, produces viable embryos with a pregnancy rate of up to 40%, and calves of the desired sex are born even if the paternal bull has acquired some infertility, died, or is located a long distance from the sexing laboratory. Furthermore, these data show the feasibility of the process even when used in a large-scale IVEP program. PMID:24412681

  4. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: I. Birth and weaning traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) and Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves, belonging to 28 full-sib families, were evaluated for differences in birth weight, gestation length, and weaning weight. Two methods were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished between the 2 types of F(1) parents (AB vs. BA corresponding to A x B vs. B x A, respectively). Bos indicus backcross calves had a 4.3 d longer (P x F(1) calves had a 5.2 d longer (P = 0.01) gestation length than F(1) x B calves (290.5 vs. 285.3, respectively). Under method II analysis, there was a consistent trend for gestation length, in which BA F(1) parents produced calves that ranked greater than calves from AB F(1) parents, as sires and dams. Crosses with a greater proportion of B in the sire in relation to the amount in the dam had a heavier (P x A and B x F(1); 38.1 and 38.4 kg, respectively) than their respective reciprocal crosses (A x F(1) and F(1) x B; 34.3 and 33.5 kg, respectively). The F(1) x A and B x F(1) crosses showed a large difference in birth weight between males and females (5.3 and 4.1 kg, respectively), whereas A x F(1) and F(1) x B crosses showed a small difference (P > 0.10) in birth weight between males and females (1.5 and 1.1 kg, respectively). Further examination within each sex showed a difference between male reciprocals that was generally much larger than that between female reciprocals. Calves with a greater percentage of B in the sire compared with the proportion in the dam ranked heavier for weaning weight as for birth weight, though these differences were not significant. In breeding systems involving B x Bos taurus crosses, even when using embryo transfer, not only does the breed composition of the calves affect their preweaning performance, but the particular cross that produces the calves also should be considered in making breeding decisions. PMID:17235021

  5. Variation in meat quality characteristics between Sanga (Bos taurus africanus) and Sanga-derived cattle breeds and between Sanga and Brahman (Bos indicus).

    Science.gov (United States)

    Strydom, P E; Frylinck, L; Smith, M F

    2011-03-01

    Cattle breeds indigenous to Africa (Sanga) compare favourably to Bos indicus breeds with regard to adaptation to harsh environments. This study compared the meat quality of three Sanga breeds (Nguni, Tuli and Drakensberger), a Sanga-related breed (Bonsmara) and a B. indicus breed (Brahman) and supported these results with biochemical and histological measurements on the M. longissimus lumborum. Twelve young grain-fed steers of each breed were slaughtered and carcasses were electrically stimulated. All Sanga (and related) breeds, with the exception of the Tuli, had lower Warner-Bratzler shear force (SF) values at 2 and 21 days post mortem compared with the BR (P meat than BR, mainly due to favourable calpain-to-calpastatin ratios. Small differences in colour, drip loss and cooking properties were found among breeds (P < 0.05). PMID:22445415

  6. Clínica e hematologia de Bos indicus, Bos taurus e Bubalus bubalis inoculados com oocistos de Toxoplasma gondii (Apicomplexa: Toxoplasmatinae

    Directory of Open Access Journals (Sweden)

    Oliveira Francisco Carlos Rodrigues de

    2001-01-01

    Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2,0 x 10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. As alterações clínicas surgidas a partir do 3º dia após inoculação (DAI foram: hipertermia, taquicardia, taquipnéia, anorexia, prostração, corrimento nasal e lacrimejamento. Estes sinais foram mais evidentes nos taurinos, espécie que apresentou, ainda, diarréia, fotofobia e conjuntivite. Foi possível isolar T. gondii da corrente sangüínea em todas as espécies. Nos taurinos, a partir do 5º DAI até o final do experimento, o parasito foi isolado de todas as amostras de sangue colhidas semanalmente, com exceção do 14º, 35º e 63º DAI. Os bubalinos apresentaram parasitemia no 7º, 14º, 35º e 70º DAI e os zebuínos apenas no 7º e 28º DAI, correspondendo aos picos de temperatura, em todas as espécies, sendo mais evidente em taurinos. Os parâmetros clínico-laboratoriais demonstraram que os taurinos foram mais sensíveis ao T. gondii do que os zebuínos e estes não diferiram significativamente dos bubalinos, que tiveram aparente normalidade clínico-laboratorial.

  7. Effect of single nucleotide polymorphisms of CAPN1 and CAST genes on meat traits in Nellore beef cattle (Bos indicus) and in their crosses with Bos taurus.

    Science.gov (United States)

    Curi, R A; Chardulo, L A L; Mason, M C; Arrigoni, M D B; Silveira, A C; de Oliveira, H N

    2009-08-01

    The objectives of this work were to study the segregation of single nucleotide polymorphisms of the calpain 1, large subunit (CAPN1) and calpastatin (CAST) genes in Nellore (Bos indicus) and Nellore xBos taurus beef cattle, as well as to evaluate their effects on meat traits. For this, 300 animals, including 114 Nellore, 67 Angus x Nellore, 44 Rubia Gallega x Nellore, 41 Canchim, 19 Brangus three-way crosses and 15 Braunvieh three-way crosses, were genotyped for the CAPN4751 [AF_248054.2:g.6545C>T (GenBank accession AF248054.2)] and CAST/DdeI [AF_159246.1:g.2959A>G (GenBank accession AF159246.1)] polymorphisms and phenotyped for Ribeye Area, Backfat Thickness, Intramuscular Fat, Shear Force (SF) and Myofibrillar Fragmentation Index (MFI). In relation to the CAPN4751 polymorphism, a frequency of 10.5% was observed for the C allele in the Nellore breed. In the total sample of studied animals, a significant association was found between genotypes and meat tenderness, assessed by SF (P = 0.005) and MFI (P = 0.008), with genotype CT being more favourable than TT. For the CAST/DdeI polymorphism, a frequency of 55.7% was found for the A allele in the Nellore breed. In the total sample, a significant association was observed between genotypes and meat tenderness - SF (P = 0.004) and MFI (P = 0.006), with genotype AA being more favourable than AG. The relationship between genotypes and aged meat tenderness in confluence with the distribution of favourable alleles shows great potential for application of the CAPN4751 and CAST/DdeI polymorphisms in the genetic improvement of the Nellore breed, whilst contributing to the validation, in this breed and in its crosses with B. taurus, of the association results previously described in the literature.

  8. Effect of single nucleotide polymorphisms of CAPN1 and CAST genes on meat traits in Nellore beef cattle (Bos indicus) and in their crosses with Bos taurus.

    Science.gov (United States)

    Curi, R A; Chardulo, L A L; Mason, M C; Arrigoni, M D B; Silveira, A C; de Oliveira, H N

    2009-08-01

    The objectives of this work were to study the segregation of single nucleotide polymorphisms of the calpain 1, large subunit (CAPN1) and calpastatin (CAST) genes in Nellore (Bos indicus) and Nellore xBos taurus beef cattle, as well as to evaluate their effects on meat traits. For this, 300 animals, including 114 Nellore, 67 Angus x Nellore, 44 Rubia Gallega x Nellore, 41 Canchim, 19 Brangus three-way crosses and 15 Braunvieh three-way crosses, were genotyped for the CAPN4751 [AF_248054.2:g.6545C>T (GenBank accession AF248054.2)] and CAST/DdeI [AF_159246.1:g.2959A>G (GenBank accession AF159246.1)] polymorphisms and phenotyped for Ribeye Area, Backfat Thickness, Intramuscular Fat, Shear Force (SF) and Myofibrillar Fragmentation Index (MFI). In relation to the CAPN4751 polymorphism, a frequency of 10.5% was observed for the C allele in the Nellore breed. In the total sample of studied animals, a significant association was found between genotypes and meat tenderness, assessed by SF (P = 0.005) and MFI (P = 0.008), with genotype CT being more favourable than TT. For the CAST/DdeI polymorphism, a frequency of 55.7% was found for the A allele in the Nellore breed. In the total sample, a significant association was observed between genotypes and meat tenderness - SF (P = 0.004) and MFI (P = 0.006), with genotype AA being more favourable than AG. The relationship between genotypes and aged meat tenderness in confluence with the distribution of favourable alleles shows great potential for application of the CAPN4751 and CAST/DdeI polymorphisms in the genetic improvement of the Nellore breed, whilst contributing to the validation, in this breed and in its crosses with B. taurus, of the association results previously described in the literature. PMID:19392828

  9. Foot-and-mouth disease virus carrier status in Bos grunniens yaks

    OpenAIRE

    Chang, Huiyun; Ma, Yanbin; Lin, Tong; Cong, Guozheng; Du, Junzheng; Ma, Jinling

    2013-01-01

    Background The carrier status of foot-and-mouth disease virus (FMDV) is complicated, and the role of carrier animals in virus transmission is controversial. To investigate the carrier status of FMDV in animals that live in high altitude, Bos grunniens yaks were infected experimentally with FMDV O/Akesu/58. Results All of the yaks showed clinical signs of foot-and-mouth disease (FMD). Total antibody levels against FMDV measured by liquid-phase blocking enzyme-linked immunosorbent assay (LPB-EL...

  10. The Effect of Myogenic Factor 5 Polymorphism on the Meat Quality in Chinese Bos Taurus

    Directory of Open Access Journals (Sweden)

    J. A. Ujan

    2011-12-01

    Full Text Available In the present study, we evaluated polymorphism of myogenic factor 5, involved in growth and meat quality traits. Based on PCR-SSCP technology, a novel missense substitution SNP (single-nucleotide polymorphism g.1142 A > G was identified in the intron1 region of the MyF-5 gene, it causes an amino acid substitution (1142Glutamine/ Glycine1142. Allele frequencies, gene heterozygosity, effective allele number and polymorphism information content of the bovine MyF-5 SNP in three population breeds were determined and evaluated by the χ2 test. Results showed that the polymorphism distribution was not similar in all of the three Bos taurus breeds, the genotype distributions of two cattle breeds Jia xian red and Nanyang did not agree with Hardy–Weinberg equilibrium (P 0.05. The A/G allelic frequencies in these breeds were 0.797/0.202, 0.770/0.229, 0.863/0.136 respectively. The genotype frequencies in Jia xian red and Nanyang cattle breeds showed moderate diversity (0.25< polymorphism information content <0.5. Furthermore, least squares analysis revealed significant effects of genotype on intramuscular fat, rib area and water holding capacity in 510 individuals (P < 0.05. Our result suggests that A1142G SNP can be used as an efficacious genetic marker for meat quality traits in native Chinese cattle breeds (Bos taurus but a much large number of animals are required for Marker assisted selection.

  11. Inhibition Effect of Antagonistic Fungal Strain BOS-013 against the Pathogen of Rice Blast ( Pyricularia oryzae)%拮抗真菌菌株BOS-013对稻瘟病菌的抑制作用

    Institute of Scientific and Technical Information of China (English)

    吕跃东; 王勇; 张文革; 谢程程; 宫立晶; 王雪

    2011-01-01

    [目的]为寻找对水稻稻瘟病的有防治作用的有益微生物及其代谢产物,研究放线菌BOS-013菌株发酵液对水稻稻瘟病菌的抑制作用.[方法]以水稻稻瘟病菌作为目标指示菌,采用杯碟法和滤纸片法测定BOS-13菌株发酵液及其不同溶剂提取物的抑菌活性.[结果]研究结果表明,含菌量为4×10cfu/ml的BOS-13菌株发酵液对水稻稻瘟病菌的抑制率为92.O%±0.5%;该发酵液经高温、高压灭活后对水稻稻瘟病菌仍有抑制作用,抑制率为60.0%±0.5%.发酵液经非极性CAD-5型大孔吸附树脂吸附、60%乙醇溶液洗脱后,其抑菌活性很高,抑菌圈直径达33.0 mm.[结论]BOS-13菌株发酵液水稻稻瘟病菌有显著的抑制作用;该研究结果为进一步明确BOS-13菌株发酵液时水稻稻瘟病菌的抑制作用机理及其实际应用奠定了基础.%[ Objective ] To search for the beneficial microorganisms and their metabolic products with control effect against rice blast, the paper studied the inhibition effect of the fermentation broth of actinomycetes BOS-013 strain against the pathogen of rice blast (Pyricularia oryzae). [ Method] With the pathogen of rice blast as the target indicator fungus, the inhibition effect of the fermentation broth of BOS-013 strain and its extracts from different solvents against the pathogen were determined using cylinder plate method and filter paper method. [ Resuit] The results showed that the inhibition rate of the fermentation broth of BOS-013 strain with fungus amount of 4 × l08 cfu/ml against the pathogen of rice blast was 92.0% ± 0.5%; the fermentation broth still had inhibition effect against the pathogen of rice blast after inactivation under high temperature and high pressure, and the inhibition rate was 60.0% ± 0.5%. After absorbed by non-polar CAD-45 type macroporous adsorption resin and eluted by 60% ethanol, the antifungal activity of the fermentation broth was still high, and the diameter of

  12. The major cow milk allergen Bos d 5 manipulates T-helper cells depending on its load with siderophore-bound iron.

    Directory of Open Access Journals (Sweden)

    Franziska Roth-Walter

    Full Text Available The mechanisms of allergic sensitization to milk are still elusive. The major allergen Bos d 5 belongs to the lipocalin-family and thus is able to transport numerous ligands. In this study we investigated its ability to bind to iron-siderophore complexes and tested the immune-modulatory properties of Bos d 5 in either forms. Structural and in silico docking analysis of Bos d 5 revealed that Bos d 5 is able to bind to iron via catechol-based flavonoids (quercetin, myricetin, luteolin that act as siderophores as confirmed by spectral-analysis and iron staining. Calculated dissociation constants of docking analyses were below 1 µM by virtual addition of iron. When incubated with human peripheral blood mononuclear cells (PBMCs, only the apo-form of Bos d 5 led to an increase of CD4+positive cells and significantly elevated IL13 and IFNγ-levels. In contrast, holo-Bos d 5 decreased numbers of CD4 expressing cells and induced apoptosis. Taken together, our data give evidence that Bos d 5 is capable of binding iron via siderophores. Moreover, our data support for the first time the notion that the form of application (apo- or holo-form is decisive for the subsequent immune response. The apo-form promotes Th2 cells and inflammation, whereas the holo-form appears to be immunosuppressive.

  13. Enterocytozoon bieneusi genotypes in yaks (Bos grunniens) and their public health potential.

    Science.gov (United States)

    Ma, Jingbo; Cai, Jinzhong; Ma, Jiawen; Feng, Yaoyu; Xiao, Lihua

    2015-01-01

    Enterocytozoon bieneusi, the most frequently diagnosed microsporidian species in humans, is also identified in a wide range of animals. To date, few data are available on E. bieneusi in yaks (Bos grunniens). In this study, we examined the occurrence and genotype identity of E. bieneusi in yaks in four counties in Qinghai Province of China. Of 327 fecal specimens examined by nested PCR analysis of the ribosomal internal transcribed spacer, 23 (7.0%) were E. bieneusi-positive. DNA sequence analysis of the PCR products revealed the presence of five distinct genotypes: three Group 2 genotypes previously reported in cattle as well as humans (BEB4, I and J) and two novel genotypes (CHN11 and CHN12) belonging to the large zoonotic group (Group 1). Data of the study suggest that these animals could be potential reservoirs for human E. bieneusi infection. PMID:25040451

  14. Study of interfaces in an Axisymmetric Supersonic Jet using Background Oriented Schlieren (BOS)

    Science.gov (United States)

    Echeverría, Carlos; Porta, David; Aguayo, Alejandro; Cardoso, Hiroki; Stern, Catalina

    2014-11-01

    We have used several techniques to study a small axisymmetric supersonic jet: Rayleigh scattering, Schlieren Toepler and PIV. Each technique gives different kind of information. In this paper, a BOS set-up is used to study the structure of the shock pattern. A shadowgraph of a dot matrix is obtained with and without a flow. The displacement field of the dots is related to changes in the index of refraction, which can be related, through the Gladstone-Dale equation, to changes in density. Previous results with this technique were not conclusive because of the relative size of the dots compared to the diameter of the nozzle. Measurements have been taken for three different exit speeds. We acknowledge support from UNAM through DGAPA PAPIIT IN117712 and the Graduate Program in Mechanical Engineering.

  15. Hormonal induction of estrous cycles in anestrous Bos taurus beef cows.

    Science.gov (United States)

    Day, M L

    2004-07-01

    A significant proportion of postpartum beef cows are anestrus at the onset of the breeding season. Much progress has been made in understanding anestrus and the changes that lead to spontaneous resumption of reproductive function. Likewise, knowledge regarding the impact of hormonal interventions on the endocrine and ovarian changes normally associated with spontaneous resumption of estrous cycles continue to accumulate. A wide range of hormonal treatment programs designed to induce estrous cycles in anestrous cows to coincide with the start of the breeding season have been developed. Programs structured to provide for increased progesterone, estradiol and LH concentrations at the appropriate times during the period leading to the first ovulation, and an induced preovulatory gonadotropin surge when the dominant ovarian follicle is of appropriate maturity have been demonstrated to induce estrous cycles of normal duration and acceptable fertility in a majority of anestrous, Bos taurus beef cows.

  16. Kappa-casein gene study in Iranian Sistani cattle breed (Bos indicus) using PCR-RFLP.

    Science.gov (United States)

    Rohallah, Alinaghizadeh; Mohammadreza, Mohammad Abadi; Shahin, Moradnasab Badrabadi

    2007-12-01

    In cattle, caseins are subdivided into four main groups: alphaS1-, alphaaS2-, beta- and kappa-caseins. kappa-caseins (CSN2) considerably differ from other caseins in structure and other properties. Testing the A and B alleles is of practical importance, because the milk of cows that carry the B allele of CSN3 has a better thermal resistance and shorter coagulation time, better curdles and contains micelles of different sizes. Iranian Sistani cattle (Bos indicus) are a heavy built breed and used as dual-purpose cattle breed in Eastern Iran. This breed is a genetic resource that shows special features of adaptation to rustic environments. One of the most distinctive features of Sistani cattle is its great capability to resist diseases which makes it a potential reservoir of germplasm useful for future crosses. Our main goal was to study DNA-polymorphism of the CSN3 gene in the Iranian Sistani native cattle (Bos indicus) and analyze the information value of CSN3 gene polymorphism as a genetic marker. We genotyped and analyzed 65 animals of this breed using PCR-RFLP. The frequencies of A and B alleles were 0.6385 and 0.3615 and those of AA, AB and BB genotypes were 0.4000, 0.4769 and 0.1231, respectively. In the Sistani Zebu breed, frequency of B allele is higher than other Zebu breeds, indicating that intensive selection for dairy production have been done and indirectly influenced CSN3 allele frequencies.

  17. Accuracy of prediction of genomic breeding values for residual feed intake and carcass and meat quality traits in Bos taurus, Bos indicus, and composite beef cattle.

    Science.gov (United States)

    Bolormaa, S; Pryce, J E; Kemper, K; Savin, K; Hayes, B J; Barendse, W; Zhang, Y; Reich, C M; Mason, B A; Bunch, R J; Harrison, B E; Reverter, A; Herd, R M; Tier, B; Graser, H-U; Goddard, M E

    2013-07-01

    The aim of this study was to assess the accuracy of genomic predictions for 19 traits including feed efficiency, growth, and carcass and meat quality traits in beef cattle. The 10,181 cattle in our study had real or imputed genotypes for 729,068 SNP although not all cattle were measured for all traits. Animals included Bos taurus, Brahman, composite, and crossbred animals. Genomic EBV (GEBV) were calculated using 2 methods of genomic prediction [BayesR and genomic BLUP (GBLUP)] either using a common training dataset for all breeds or using a training dataset comprising only animals of the same breed. Accuracies of GEBV were assessed using 5-fold cross-validation. The accuracy of genomic prediction varied by trait and by method. Traits with a large number of recorded and genotyped animals and with high heritability gave the greatest accuracy of GEBV. Using GBLUP, the average accuracy was 0.27 across traits and breeds, but the accuracies between breeds and between traits varied widely. When the training population was restricted to animals from the same breed as the validation population, GBLUP accuracies declined by an average of 0.04. The greatest decline in accuracy was found for the 4 composite breeds. The BayesR accuracies were greater by an average of 0.03 than GBLUP accuracies, particularly for traits with known genes of moderate to large effect mutations segregating. The accuracies of 0.43 to 0.48 for IGF-I traits were among the greatest in the study. Although accuracies are low compared with those observed in dairy cattle, genomic selection would still be beneficial for traits that are hard to improve by conventional selection, such as tenderness and residual feed intake. BayesR identified many of the same quantitative trait loci as a genomewide association study but appeared to map them more precisely. All traits appear to be highly polygenic with thousands of SNP independently associated with each trait. PMID:23658330

  18. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: II. Postweaning, carcass, and meat traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) x Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves belonging to 28 full-sib families were evaluated for differences in feedyard initial BW, feedyard final BW, carcass weight, LM area, adjusted fat thickness, intramuscular fat, and Warner-Bratzler shear force. Two methods of analysis were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished the 2 types of F(1) parents (AB vs. BA, corresponding to A x B vs. B x A, respectively). No significant reciprocal differences for these weight and carcass traits were detected under method I analyses, although the same trend existed for subsequent BW rankings as for birth weight and weaning weight. For each weight phase, the cross that involved a larger proportion of B in the sire in relation to the amount in the dam (F(1) x A and B x F(1)) ranked heavier than the respective reciprocal cross (A x F(1) and F(1) x B). As a whole, A backcross calves had larger (P carcass (P < 0.001), and had larger LM area (P < 0.05) with less adjusted fat (P < 0.001). No difference existed between the sexes for Warner-Bratzler shear force or marbling. No interactions involving sex, sire type, and dam type were observed for any of these traits. The results were similar under methods I and II analyses, with the exception that a significant sire type x dam type interaction was observed for initial feedyard BW. Results from this study suggest that for weight-related traits, both the breed constitution of the embryo transfer calf and the cross that produces the calf play an important role in its ultimate performance for B crossbred calves. For body composition and meat-related traits, it appears that the breed makeup of the embryo transfer calf itself is more important to animal performance than the specific cross used to produce the calf.

  19. Accuracy of prediction of genomic breeding values for residual feed intake and carcass and meat quality traits in Bos taurus, Bos indicus, and composite beef cattle.

    Science.gov (United States)

    Bolormaa, S; Pryce, J E; Kemper, K; Savin, K; Hayes, B J; Barendse, W; Zhang, Y; Reich, C M; Mason, B A; Bunch, R J; Harrison, B E; Reverter, A; Herd, R M; Tier, B; Graser, H-U; Goddard, M E

    2013-07-01

    The aim of this study was to assess the accuracy of genomic predictions for 19 traits including feed efficiency, growth, and carcass and meat quality traits in beef cattle. The 10,181 cattle in our study had real or imputed genotypes for 729,068 SNP although not all cattle were measured for all traits. Animals included Bos taurus, Brahman, composite, and crossbred animals. Genomic EBV (GEBV) were calculated using 2 methods of genomic prediction [BayesR and genomic BLUP (GBLUP)] either using a common training dataset for all breeds or using a training dataset comprising only animals of the same breed. Accuracies of GEBV were assessed using 5-fold cross-validation. The accuracy of genomic prediction varied by trait and by method. Traits with a large number of recorded and genotyped animals and with high heritability gave the greatest accuracy of GEBV. Using GBLUP, the average accuracy was 0.27 across traits and breeds, but the accuracies between breeds and between traits varied widely. When the training population was restricted to animals from the same breed as the validation population, GBLUP accuracies declined by an average of 0.04. The greatest decline in accuracy was found for the 4 composite breeds. The BayesR accuracies were greater by an average of 0.03 than GBLUP accuracies, particularly for traits with known genes of moderate to large effect mutations segregating. The accuracies of 0.43 to 0.48 for IGF-I traits were among the greatest in the study. Although accuracies are low compared with those observed in dairy cattle, genomic selection would still be beneficial for traits that are hard to improve by conventional selection, such as tenderness and residual feed intake. BayesR identified many of the same quantitative trait loci as a genomewide association study but appeared to map them more precisely. All traits appear to be highly polygenic with thousands of SNP independently associated with each trait.

  20. Evaluation of reciprocal differences in Bos indicus x Bos taurus backcross calves produced through embryo transfer: II. Postweaning, carcass, and meat traits.

    Science.gov (United States)

    Amen, T S; Herring, A D; Sanders, J O; Gill, C A

    2007-02-01

    Angus (A) x Bos indicus (B; Brahman or Nellore) reciprocal backcross, embryo transfer calves belonging to 28 full-sib families were evaluated for differences in feedyard initial BW, feedyard final BW, carcass weight, LM area, adjusted fat thickness, intramuscular fat, and Warner-Bratzler shear force. Two methods of analysis were investigated; method I made no distinction between how the F(1) parents were produced, whereas method II distinguished the 2 types of F(1) parents (AB vs. BA, corresponding to A x B vs. B x A, respectively). No significant reciprocal differences for these weight and carcass traits were detected under method I analyses, although the same trend existed for subsequent BW rankings as for birth weight and weaning weight. For each weight phase, the cross that involved a larger proportion of B in the sire in relation to the amount in the dam (F(1) x A and B x F(1)) ranked heavier than the respective reciprocal cross (A x F(1) and F(1) x B). As a whole, A backcross calves had larger (P x dam type interaction was observed for initial feedyard BW. Results from this study suggest that for weight-related traits, both the breed constitution of the embryo transfer calf and the cross that produces the calf play an important role in its ultimate performance for B crossbred calves. For body composition and meat-related traits, it appears that the breed makeup of the embryo transfer calf itself is more important to animal performance than the specific cross used to produce the calf. PMID:17235022

  1. Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

    DEFF Research Database (Denmark)

    Andersen, Hans Skifter

    Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikk...

  2. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes. PMID:27128674

  3. Embryonic development of the bovine pineal gland (Bos taurus) during prenatal life (30 to 135 days of gestation)

    OpenAIRE

    Regodón, S.; Roncero, V

    2005-01-01

    The ontogenesis of the pineal gland of 30 bovine embryos (Bos taurus) has been analysed from 30 until 135 days of gestation by means of optical microscopy and immunohistochemical techniques. For this study, the specimens were grouped into three stages in accordance with the most relevant histological characteristics: Stage 1 (30 to 64 days of prenatal development); Stage 2 (70 to 90 days) and Stage 3 (106 to 135 days). In the cow, it is from 30 days of gestatio...

  4. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes. PMID:27128674

  5. Managing bronchiolitis obliterans syndrome (BOS) and chronic lung allograft dysfunction (CLAD) in children: what does the future hold?

    Science.gov (United States)

    Snell, Gregory I; Paraskeva, Miranda; Westall, Glen P

    2013-08-01

    The success of pediatric lung transplantation continues to be limited by long-term graft dysfunction. Historically this has been characterized as an obstructive spirometric defect in the form of the bronchiolitis obliterans syndrome (BOS). It is recognized, however, that this does not reflect many of the other acknowledged etiologies of chronic lung dysfunction-noting it is the sum of the parts that contribute to respiratory morbidity and mortality after transplant. The term chronic lung allograft dysfunction (CLAD) has been coined to reflect these other entities and, in particular, a group of relatively recently described lung disorders called the restrictive allograft syndrome (RAS). RAS is characterized by a restrictive spirometric defect. Although these entities have not yet been studied in a pediatric setting their association with poor compliance, antibody-mediated rejection (AMR), and post-infectious lung damage (particularly viral) warrants attention by pediatric lung transplant teams. Current therapy for the BOS subset of CLAD is otherwise limited to changing immunosuppressants and avoiding excessive infectious risk by avoiding over-immunosuppression. Long-term macrolide therapy in lung transplantation is not of proven efficacy. Reviewing previous BOS studies to explore restrictive spirometric cases and joint projects via groups like the International Pediatric Lung Transplant Collaborative will be the way forward to solve this pressing problem.

  6. Effects of beta agonists in the diagnosis of fasciolosis in Bos indicus x Bos taurus in the state of Puebla, Mexico

    International Nuclear Information System (INIS)

    currently in Mexico about 30 million cattle of which about 15000.000 million are in areas at high risk of infestation and about 5,000,000 million fascioliosis animals are with, if we estimate the economic losses per year gives us an approximate price of 4,500,000,000 pesos are lost annually, on the other hand, the lack of good pasture especially in times of drought in the state are helping farmers are feeding their animals with food additives in this case the betaagonist (clenbuterol and the like ), At present there are several municipal traces at the state level are discarding the livers of cattle producing very large economic losses. been conducted on prevailing level of municipal trail Atlixco (zone endemic to the disease) in the year 2001-02 with a prevalence of 32-33 % While that in 2007 set a precedence of 7% over the same track municipal; this parasitic disease that affects the liver parenchyma and pipelines, affects the metabolic activity of the liver, this organ is one of the most important thing, because it participates in many metabolic pathways, as in the production and secretion of bile, regulates the metabolism of carbohydrates, lipids and proteins among others. This parasitic disease affects the production of meat and milk in ruminant animals in this very particular case Bos taurus x Bos indicus, the affected animals, these activities are depleted in previous studies have found that animals are fed with food additives such as beta -adrenergic-agonist, whose effect is to produce lipolysis, lipogenesis, are glucoliticos, and glycogen, affecting body composition, favouring neoformation tissue by the redistribution of power, also increasing the release of fatty acids into the blood, facilitating the synthesis of protein and retains the nitrogen fed into skeletal muscle, these components used as food additives are prohibited by federal law nationals (SAGARPA NOM-015-ZOO-2002), as the consumption of meat produced visceral primarily of clinical cases as tachycardia

  7. Distribution and extinction of ungulates during the Holocene of the southern Levant.

    Directory of Open Access Journals (Sweden)

    Ella Tsahar

    Full Text Available BACKGROUND: The southern Levant (Israel, Palestinian Authority and Jordan has been continuously and extensively populated by succeeding phases of human cultures for the past 15,000 years. The long human impact on the ancient landscape has had great ecological consequences, and has caused continuous and accelerating damage to the natural environment. The rich zooarchaeological data gathered at the area provide a unique opportunity to reconstruct spatial and temporal changes in wild species distribution, and correlate them with human demographic changes. METHODOLOGY: Zoo-archaeological data (382 animal bone assemblages from 190 archaeological sites from various time periods, habitats and landscapes were compared. The bone assemblages were sorted into 12 major cultural periods. Distribution maps showing the presence of each ungulate species were established for each period. CONCLUSIONS: The first major ungulate extinction occurred during the local Iron Age (1,200-586 BCE, a period characterized by significant human population growth. During that time the last of the largest wild ungulates, the hartebeest (Alcelaphus buselaphus, aurochs (Bos primigenius and the hippopotamus (Hippopotamus amphibius became extinct, followed by a shrinking distribution of forest-dwelling cervids. A second major wave of extinction occurred only in the 19th and 20th centuries CE. Furthermore, a negative relationship was found between the average body mass of ungulate species that became extinct during the Holocene and their extinction date. It is thus very likely that the intensified human activity through habitat destruction and uncontrolled hunting were responsible for the two major waves of ungulate extinction in the southern Levant during the late Holocene.

  8. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  9. Genome-wide detection and characterization of endogenous retroviruses in Bos taurus.

    Science.gov (United States)

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-10-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A BLAST-based method detected 928 possible ERVs, LTR_STRUC detected 4,487 elements flanked by long terminal repeats (LTRs), and Retrotector detected 9,698 ERVs. The ERVs were not homogeneously distributed across chromosomes; the number of ERVs was positively correlated with chromosomal size and negatively correlated with chromosomal GC content. The bovine ERVs (BoERVs) were classified into 24 putative families, with 20 of them not previously described. One of these new families, BoERV1, was the most abundant family and appeared to be specific to ruminants. An analysis of representatives of ERV families from rodents, primates, and ruminants showed a phylogenetic relationship following their hosts' relationships. This study demonstrates the importance of using multiple methods when trying to identify new ERVs and shows that the number of bovine ERV families is not as limited as previously thought. PMID:20686017

  10. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    Science.gov (United States)

    Iswadi, M.I.; Ann, Z.F.; Hafiz, M.M.; Hafiz, M.D.; Fahrul, F.J.; Hajarian, H.; Wahid, H.; Zawawi, I.; Khairiah, M.S.; Mazni, O.A.

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur. PMID:26623302

  11. DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

    Directory of Open Access Journals (Sweden)

    Mishra Bina

    2006-11-01

    Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

  12. Magnetic Resonance Imaging of the Normal Stifle Joint in Buffaloes (Bos Bubalis: An Anatomic Study

    Directory of Open Access Journals (Sweden)

    Moustafa Samy Sherif

    2014-12-01

    Full Text Available The aim of the present study was to describe the normal anatomy of the stifle joint in buffaloes (Bos bubalis on magnetic resonance images and related anatomical sectional slices to facilitate the interpretation of all these images, as well as to understand the basis for diseases diagnosis. The hind limbs of ten healthy adult buffaloes (Twenty stifle joints were used. After slaughtering, MR images were made in sagittal, transverse, and dorsal planes. The limbs then were frozen at -20° then correspondingly sectioned using an electric band saw. Clinically relevant anatomic structures were identified and labeled at each level in the corresponding images (MR and anatomic slices. MRI images were used to identify the bony and soft tissue structures of the stifle joint. The articular cartilage appeared with hyperintense signal and separated from the subcondral bone by gray line (moderate signal intensity. It is difficult to differentiate between the synovia, infrapatellar fat body and the articular cartilage because they appeared with hyperintense signal. The meniscial, femoropatellar and cruciate ligaments recognized as moderate signal intensity. However, the collateral and intermediate patellar ligaments, the common tendon of the Mm. extensor digitorum longus and peroneus tertius as well as the menisci and the medial patellar fibrocartilage appeared with hypointense signal. The knowledge of normal anatomy of the buffalo stifle joint would serve as initial reference to the evaluation of MR images in this species.

  13. Hábitos de amamantamiento del ganado bovino Chinampo (Bos taurus de México

    Directory of Open Access Journals (Sweden)

    José Espinoza V.

    2011-12-01

    Full Text Available Objetivo. Conocer los hábitos de amamantamiento de becerros Chinampos (Bos taurusen diferentes etapas de su lactancia. Materiales y métodos. Se utilizaron 20 vacas con su cría. A partir de los 30 hasta los 180 días de la lactancia los animales fueron observados durante 24 horas continuas cada mes registrando la frecuencia con la que los becerros mamaron y la duración de cada amamantamiento. Resultados. Los becerros mamaron con mayor frecuencia entre las 06:00 y las 07:00 hr, se observaron otros picos a las 10:00 y a las 19:00 hr. La frecuencia promedio de amamantamiento en 24 horas fue de 4.9±0.21utilizando un total de 66.9 ± 3.1 minutos. Los becerros de 180 días de edad mamaron menos veces comparados con los de edades inferiores a los 150 días; la duración del amamantamiento disminuyó a los 180 días de edad (p0.05. Conclusiones. La frecuencia de amamantamientos es mayor durante las primeras horas de la mañana y al final de la tarde. Hasta los 5 meses de edad la frecuencia y el tiempo de amamantamiento no variaron pero se redujeron a los180 días y las hembras mamaron con más periodicidad que los machos.

  14. The complete sequence of mitochondrial genome of polled yak (Bos grunniens).

    Science.gov (United States)

    Chu, Min; Wu, Xiaoyun; Liang, Chunnian; Pei, Jie; Ding, Xuezhi; Guo, Xian; Bao, Pengjia; Yan, Ping

    2016-05-01

    Generally speaking, the hornless trait is also known as polled. Although the POLL locus could be assigned to a 1.36-Mb interval in the centromeric region of BTA1 (Georges et al., 1993; Drögemüller et al., 2005)), and (Liu et al., 2014) reported a 147-kb segment that included three protein-coding genes was the most likely location of the POLL mutation in domestic yaks, the underlying genetic basis for the polled trait is still unknown. In this work, the complete mitochondrial genome sequence of polled yak was determined for the first time. The total length of the mitogenome is 16,324 bp long, with the base composition of 33.72% A, 27.25% T, 25.83% C, and 13.20% G. It contained 13 protein-coding genes, 22 tRNA genes, 2 rRNA genes and 1 non-coding region (D-loop region). The gene order of polled yak mitogenome is identical to that observed in most other vertebrates. The complete mitogenome sequence information of polled yak will provide useful data for further studies on protection of genetic resources and phylogenetic relationships within Bos grunniens. PMID:25347693

  15. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore) Cattle Are Modulators of Growth

    Science.gov (United States)

    Milanesi, Marco; Torrecilha, Rafaela B. P.; Carmo, Adriana S.; Neves, Haroldo H. R.; Carvalheiro, Roberto; Ajmone-Marsan, Paolo; Sonstegard, Tad S.; Sölkner, Johann; Contreras-Castillo, Carmen J.; Garcia, José F.

    2016-01-01

    Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS), were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore) cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV) for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1) as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1), IGF2 (insulin like growth factor 2), GH1 (growth hormone 1), IGF1R (insulin like growth factor 1 receptor) and GHR (growth hormone receptor), suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway. PMID:27410030

  16. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

    Directory of Open Access Journals (Sweden)

    M.S. Khairiah

    2012-10-01

    Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.

  17. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

    Directory of Open Access Journals (Sweden)

    Anirene G T Pereira

    Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

  18. Bovine Genome Database: new tools for gleaning function from the Bos taurus genome.

    Science.gov (United States)

    Elsik, Christine G; Unni, Deepak R; Diesh, Colin M; Tayal, Aditi; Emery, Marianne L; Nguyen, Hung N; Hagen, Darren E

    2016-01-01

    We report an update of the Bovine Genome Database (BGD) (http://BovineGenome.org). The goal of BGD is to support bovine genomics research by providing genome annotation and data mining tools. We have developed new genome and annotation browsers using JBrowse and WebApollo for two Bos taurus genome assemblies, the reference genome assembly (UMD3.1.1) and the alternate genome assembly (Btau_4.6.1). Annotation tools have been customized to highlight priority genes for annotation, and to aid annotators in selecting gene evidence tracks from 91 tissue specific RNAseq datasets. We have also developed BovineMine, based on the InterMine data warehousing system, to integrate the bovine genome, annotation, QTL, SNP and expression data with external sources of orthology, gene ontology, gene interaction and pathway information. BovineMine provides powerful query building tools, as well as customized query templates, and allows users to analyze and download genome-wide datasets. With BovineMine, bovine researchers can use orthology to leverage the curated gene pathways of model organisms, such as human, mouse and rat. BovineMine will be especially useful for gene ontology and pathway analyses in conjunction with GWAS and QTL studies.

  19. Contribution of stable isotopes (C,N,S) in collagen of late Pleistocene large mammal trophic ecology and landscape use: a case study in Goyet and Scladina cave (30-40,000 years BP)

    Science.gov (United States)

    Bocherens, Hervé; Germonpré, Mietje

    2010-05-01

    Two Belgian caves yielded very rich large mammal associations dating around 30 to 40,000 years ago: Goyet and Scladina cave (layer 1A). These sites are only 5 km apart but the cave entrances open on different valleys, in a quite diverse landscape ranging between open, unprotected uplands, steep cliffs and sheltered sun-exposed gorges, with the larger Meuse valley nearby. This mosaic scenery permitted during the Last Glacial a rich diversity of fossil flora and fauna. The faunal association includes a large diversity of taxa including Aurochs Bos primigenius, steppe bison Bison priscus, reindeer Rangifer tarandus, giant deer Megaloceros giganteus, horse Equus ferus, woolly rhinoceros Coelodonta antiquitatis, woolly mammoth Mammuthus primigenius, cave bear Ursus spelaeus, brown bear Ursus arctos, wolf Canis lupus, cave lion Panthera leo spelaea, and cave hyaena Crocuta crocuta spelaea. All the 90 studied bones and teeth yielded collagen with excellent collagen preservation, allowing reliable investigations of carbon, nitrogen and sulfur isotopic biogeochemistry. The combination of three different isotopic tracers allows to deciphering the effects of food selection and landscape use by different herbivorous and carnivorous taxa. This is the first study to include sulfur isotopic signatures in the study of late Quaternary large mammal palaeobiology. This new tracer yields evidence on mobility and differences in pasture areas, as different geological bedrock may exhibit various sulfur isotopic signatures that will pass on the herbivores and further on their predators. Using this feature in addition to the trophic information provided by carbon and nitrogen isotopic signatures, it appears that for some species present in both sites, such as horse and woolly rhinoceros, the individuals found in each site probably did not use the same pasture areas. This seems to also the case for the overwhelmingly vegetarian cave bears. In addition, individuals from the same species

  20. Genome-wide characterization of perfect microsatellites in yak (Bos grunniens).

    Science.gov (United States)

    Ma, Zhijie

    2015-08-01

    Microsatellites or simple sequence repeats (SSRs) constitute a significant portion of genomes and play an important role in gene function and genome organization. The availability of a complete genome sequence for yak (Bos grunniens) has made it possible to carry out genome-wide analysis of microsatellites in this species. We analyzed the abundance and density of perfect SSRs in the yak genome. We found a total of 723,172 SSRs with 1-6 bp nucleotide motifs, indicating that about 0.47 % of the yak whole genome sequence (2.66 Gb) comprises perfect SSRs, the average length of which was 17.34 bp/Mb. The average frequency and density of perfect SSRs was 272.18 loci/Mb and 4719.25 bp/Mb, respectively. The proportion of the six classes of perfect SSRs was not evenly distributed in the yak genome. Mononucleotide repeats (44.04 %) with a total number of 318,435 and a average length of 14.71 bp appeared to be the most abundant SSRs class, while the percentages of dinucleotide, trinucleotide, pentanucleotide, tetranucleotide and hexanucleotide repeats was 24.11 %, 15.80 %, 9.50 %, 6.40 % and 0.15 %, respectively. Different repeat classes of SSRs varied in their repeat number with the highest being 1206. Our results suggest that 15 motifs comprised the predominant categories with a frequency above 1 loci/Mb: A, AC, AT, AG, AGC, AAC, AAT, ACC, ATTT, GTTT, AATG, CTTT, ATGG, AACTG and ATCTG.

  1. Comparison of carfentanil-xylazine and thiafentanil-medetomidine in electroejaculation of captive gaur (Bos gaurus).

    Science.gov (United States)

    Napier, Julia E; Loskutoff, Naida M; Simmons, Lee G; Armstrong, Douglas L

    2011-09-01

    Carfentanil citrate and thiafentanil oxalate have been used successfully to immobilize captive and free-ranging ungulates. The objective of this study was to compare the efficacy and certain physiologic parameters of protocols by using the 2 opioids in gaur (Bos gaurus). Eight adult gaur bulls were immobilized for electroejaculation at Omaha's Henry Doorly Zoo (Omaha, Nebraska, USA). All the animals were immobilized twice, by using each of the following protocols one time: 10 mg carfentanil combined with 100 mg xylazine (CX), reversed with 1,000 mg naltrexone and 24 mg yohimbine; and 12 mg thiafentanil combined with 20 mg medetomidine (TM), reversed with 120 mg naltrexone and 100 mg atipamezole. Immobilization drugs were delivered intramuscularly into the shoulder area via pole syringe. Electroejaculation was carried out by a standardized protocol to duplicate procedural stimulation on each animal. Induction and recovery times, initial rectal temperature, heart rate, respiratory rate, anesthetic depth, oxygen saturation, indirect blood pressure, and arterial blood gases were recorded at the time of initial handling, before ejaculation, and after ejaculation. Antagonists were administered 1/4 i.v. and 3/4 s.q. Both protocols require a small volume of drug for a large ungulate, provide smooth induction, and adequate anesthesia. Both protocols produced a significant hypoxemia, although the animals on CX showed slightly better blood gas values (based on lower partial pressure of carbon dioxide) and numerically lower blood pressure values. Animals on TM had better muscle relaxation and smoother recoveries, with no renarcotization noted. The results of the present study indicate the TM and CX protocols used for immobilizing gaur result in similar quality ejaculates that can be used for fertility examination as well as for assisted reproduction such as artificial insemination. Additional immobilizations need to take place to further compare these 2 combinations in this

  2. A novel application of ecological analyses to assess transposable element distributions in the genome of the domestic cow, Bos taurus.

    Science.gov (United States)

    Saylor, Brent; Elliott, Tyler A; Linquist, Stefan; Kremer, Stefan C; Gregory, T Ryan; Cottenie, Karl

    2013-09-01

    Transposable elements (TEs) are among the most abundant components of many eukaryotic genomes. Efforts to explain TE abundance, as well as TE diversity among genomes, have led some researchers to draw an analogy between genomic and ecological processes. Adopting this perspective, we conducted an analysis of the cow (Bos taurus) genome using techniques developed by community ecologists to determine whether environmental factors influence community composition. Specifically, each chromosome within the Bos taurus genome was treated as a "linear transect", and a multivariate redundancy analysis (RDA) was used to identify large-scale spatial patterns in TE communities associated with 10 TE families. The position of each TE community on the chromosome accounted for ∼50% of the variation along the chromosome "transect". Multivariate analysis further revealed an effect of gene density on TE communities that is influenced by several other factors in the (genomic) environment, including chromosome length and TE density. The results of this analysis demonstrate that ecological methods can be applied successfully to help answer genomic questions.

  3. Effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females.

    Science.gov (United States)

    Cooke, R F; Bohnert, D W; Cappellozza, B I; Mueller, C J; Delcurto, T

    2012-10-01

    Two experiments evaluated the effects of temperament and acclimation to handling on reproductive performance of Bos taurus beef females. In Exp. 1, 433 multiparous, lactating Angus × Hereford cows were sampled for blood and evaluated for temperament before the breeding season. Cow temperament was assessed by chute score and exit velocity. Chute score was assessed on a 5-point scale according to behavioral responses during chute restraining. Exit score was calculated by dividing exit velocity into quintiles and assigning cows with a score from 1 to 5 (1 = slowest, 5 = fastest cows). Temperament score was calculated by averaging chute and exit scores. Cows were classified for temperament type according to temperament score (≤ 3 = adequate, > 3 = aggressive). Plasma cortisol concentrations were greater (P temperament. Cows with aggressive temperament had reduced (P ≤ 0.05) pregnancy and calving rate and tended to have reduced (P = 0.09) weaning rate compared with cows with adequate temperament. Hence, kilogram of calf born per cow was reduced (P = 0.05) and kilogram of calf weaned per cow tended to be reduced (P = 0.08) in aggressive cows. In Exp. 2, 88 Angus × Hereford heifers (initial age = 206 ± 2 d) were weighed (d 0 and 10) and evaluated for temperament score (d 10). On d 11, heifers were ranked by these variables and assigned to receive or not (control) an acclimation treatment. Acclimated heifers were processed through a handling facility 3 times weekly for 4 wk (d 11 to 39; Mondays, Wednesdays, and Fridays), whereas control heifers remained undisturbed on pasture. Heifer puberty status, evaluated via plasma progesterone concentrations, was assessed on d 0 and 10, d 40 and 50, 70 and 80, 100 and 110, 130 and 140, 160 and 170, and 190 and 200. Blood samples collected on d 10 and 40 were also analyzed for plasma concentrations of cortisol and haptoglobin. Temperament score was assessed again on d 40 and d 200. Acclimated heifers had reduced (P = 0

  4. Assessment of single nucleotide polymorphisms in genes residing on chromosomes 14 and 29 for association with carcass composition traits in Bos indicus cattle.

    Science.gov (United States)

    Casas, E; White, S N; Riley, D G; Smith, T P L; Brenneman, R A; Olson, T A; Johnson, D D; Coleman, S W; Bennett, G L; Chase, C C

    2005-01-01

    Objective of this study was to assess the association of SNP in the diacylglycerol O-acyltransferase 1 (DGAT1), thyroglobulin (TG), and micromolar calcium-activated neutral protease (CAPN1) genes with carcass composition and meat quality traits in Bos indicus cattle. A population of Brahman calves (n = 479) was developed in central Florida from 1996 to 2000. Traits analyzed were ADG, hip height, slaughter weight, fat thickness, HCW, marbling score, LM area, estimated KPH fat, yield grade, retail yield, sensory panel tenderness score, carcass hump height, and cooked meat tenderness measured as Warner-Bratzler shear force at 7, 14, and 21 d postmortem. Single nucleotide polymorphisms previously reported in the TG and DGAT1 genes were used as markers on chromosome 14. Two previously reported and two new SNP in the CAPN1 gene were used as markers on chromosome 29. One SNP in CAPN1 was uninformative, and another one was associated with tenderness score (P Brahman population than in reported allele frequencies in Bos taurus populations. The results suggest that the use of molecular marker information developed in Bos taurus populations to Bos indicus populations may require development of appropriate additional markers. PMID:15583037

  5. Assessment of single nucleotide polymorphisms in genes residing on chromosomes 14 and 29 for association with carcass composition traits in Bos indicus cattle.

    Science.gov (United States)

    Casas, E; White, S N; Riley, D G; Smith, T P L; Brenneman, R A; Olson, T A; Johnson, D D; Coleman, S W; Bennett, G L; Chase, C C

    2005-01-01

    Objective of this study was to assess the association of SNP in the diacylglycerol O-acyltransferase 1 (DGAT1), thyroglobulin (TG), and micromolar calcium-activated neutral protease (CAPN1) genes with carcass composition and meat quality traits in Bos indicus cattle. A population of Brahman calves (n = 479) was developed in central Florida from 1996 to 2000. Traits analyzed were ADG, hip height, slaughter weight, fat thickness, HCW, marbling score, LM area, estimated KPH fat, yield grade, retail yield, sensory panel tenderness score, carcass hump height, and cooked meat tenderness measured as Warner-Bratzler shear force at 7, 14, and 21 d postmortem. Single nucleotide polymorphisms previously reported in the TG and DGAT1 genes were used as markers on chromosome 14. Two previously reported and two new SNP in the CAPN1 gene were used as markers on chromosome 29. One SNP in CAPN1 was uninformative, and another one was associated with tenderness score (P Brahman population than in reported allele frequencies in Bos taurus populations. The results suggest that the use of molecular marker information developed in Bos taurus populations to Bos indicus populations may require development of appropriate additional markers.

  6. Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum

    Science.gov (United States)

    There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta...

  7. Verantwoordelijkheden bij risico- en crisisbeheersing van bos- en natuurbranden : taken en bevoegdheden bij risicoberheersing, bestrijding, nazorg en herstel en een overzicht van de hiaten in regelgeving en taakverdeling

    NARCIS (Netherlands)

    Raffe, van J.K.

    2011-01-01

    In 2007/2008 is gekeken welke partijen een rol spelen bij de risico- en crisisbeheersing van (grote) bos- en natuurbranden, wat hun rol precies is en welke taken en bevoegdheden ze hebben. Ook is geïnventariseerd welke hiaten er zijn in de bestaande taakverdeling en regelgeving. Hiaten die de oorzaa

  8. Impact of a trace element supplementation programme on health and performance of cross-breed (Bos indicus x Bos taurus) dairy cattle under tropical farming conditions: a double-blinded randomized field trial.

    Science.gov (United States)

    Dermauw, V; Dierenfeld, E; Du Laing, G; Buyse, J; Brochier, B; Van Gucht, S; Duchateau, L; Janssens, G P J

    2015-06-01

    Small-scale urban dairy farms (n = 16) in and around Jimma, Ethiopia with cross-bred (Bos indicus × Bos taurus) cows were enrolled in a double-blinded intervention study to investigate the effect of a trace element supplementation programme on trace element status and milk concentrations as well as performance [body condition score (BCS), milk yield, leptin], milk composition, antioxidant status (ferric-reducing ability of plasma (FRAP), thiobarbituric acid-reactive substances (TBARS)], blood biochemistry, serum proteins and immune response (antibody titre upon rabies vaccination). The farms were allocated to a (1) placebo or (2) Cu, Zn, Se, Co and I supplementation treatment for 150 d. On days 0 and 120, four lactating cows per farm were sampled for milk and plasma, and on day 150 for serum, following primo-vaccination. Cu deficiency was present in 17% and marginal Se deficiency in 30% of initially sampled cows, while no Zn shortage was detected. Over 120 days, trace element supplementation caused a bigger increase in plasma Se and Cu concentrations, but also a larger decrease of plasma Fe concentrations. A larger increase in milk Se concentrations was observed in the supplemented group, whereas none of the other elements were affected. BCS decreased more over time in the supplemented group. None of the other parameters of performance and antioxidant status nor milk composition or blood biochemistry was affected by treatment. Antibody response to rabies vaccination did not differ between groups, whereas α1-globulins tended to be lower and β-globulins tended to be higher in the supplemented group. In conclusion, despite improved Cu and Se status and Se concentrations in milk, cows on tropical urban dairy farms did not seem to benefit from trace element supplementation, with respect to the parameters investigated.

  9. Impact of a trace element supplementation programme on health and performance of cross-breed (Bos indicus x Bos taurus) dairy cattle under tropical farming conditions: a double-blinded randomized field trial.

    Science.gov (United States)

    Dermauw, V; Dierenfeld, E; Du Laing, G; Buyse, J; Brochier, B; Van Gucht, S; Duchateau, L; Janssens, G P J

    2015-06-01

    Small-scale urban dairy farms (n = 16) in and around Jimma, Ethiopia with cross-bred (Bos indicus × Bos taurus) cows were enrolled in a double-blinded intervention study to investigate the effect of a trace element supplementation programme on trace element status and milk concentrations as well as performance [body condition score (BCS), milk yield, leptin], milk composition, antioxidant status (ferric-reducing ability of plasma (FRAP), thiobarbituric acid-reactive substances (TBARS)], blood biochemistry, serum proteins and immune response (antibody titre upon rabies vaccination). The farms were allocated to a (1) placebo or (2) Cu, Zn, Se, Co and I supplementation treatment for 150 d. On days 0 and 120, four lactating cows per farm were sampled for milk and plasma, and on day 150 for serum, following primo-vaccination. Cu deficiency was present in 17% and marginal Se deficiency in 30% of initially sampled cows, while no Zn shortage was detected. Over 120 days, trace element supplementation caused a bigger increase in plasma Se and Cu concentrations, but also a larger decrease of plasma Fe concentrations. A larger increase in milk Se concentrations was observed in the supplemented group, whereas none of the other elements were affected. BCS decreased more over time in the supplemented group. None of the other parameters of performance and antioxidant status nor milk composition or blood biochemistry was affected by treatment. Antibody response to rabies vaccination did not differ between groups, whereas α1-globulins tended to be lower and β-globulins tended to be higher in the supplemented group. In conclusion, despite improved Cu and Se status and Se concentrations in milk, cows on tropical urban dairy farms did not seem to benefit from trace element supplementation, with respect to the parameters investigated. PMID:24990384

  10. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    DEFF Research Database (Denmark)

    Ali, A.; O'Neill, C.J.; Thomson, P.C.;

    2012-01-01

    Background: Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified...... species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods: Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also...... counts. Conclusions: Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick...

  11. Sequenciamento e análise dos genes das subunidades alfa e beta do hormônio folículo estimulante de bovino (Bos taurus indicus Sequencing and analysis of subunits alpha and beta of the follicle stimulating hormone from bovine (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Luci Sayori Murata

    2008-07-01

    Full Text Available

    Este trabalho relata uma clonagem e seqüenciamento das subunidades alfa e beta do hormônio folículo estimulante de Bos taurus indicus. Também apresenta os resultados de comparação realizada das seqüências gênicas dessas cadeias com as seqüências das cadeias alfa e beta do FSH de suínos e da cadeia beta de bovinos Bos taurus taurus já presentes no GenBank. Na comparação das seqüências de nucleotídeos e de aminoácidos predita da cadeia αFSH de Bos taurus indicus com as cadeias αFSH de outras espécies como suínos e búfalo (Bubalis bubalis, observou-se que as seqüências são bastante similares. A comparação da seqüência da subunidade αFSH de Bos taurus indicus com a de suíno demonstrou diferenças em três resíduos de aminoácidos. Na comparação com ßFSH, registrou-se modificação na primeira base do codon que levou à alteração no resíduo do aminóacido 83, que, em Bos taurus indicus, é uma glicina, ao invés da serina presente em Bos taurus taurus. Confirmaram-se essa modificação e todas as outras identificadas na seqüência dos cDNA das cadeias αFSH e βFSH em outra clonagem. A modificação Ser para Gly na posição 83 foi a única que alterou a identidade do resíduo de aminoácido na comparação entre as subunidades beta do FSH de Bos taurus indicus e Bos taurus taurus. Contudo, ela não deve alterar significativamente as propriedades fisiológicas do FSH, uma vez que o resíduo de glicina encontrado nessa posição também é encontrado na cadeia βFSH suína. Trata-se, portanto, de uma modificação particular que distingue as cadeias βFSH de B. taurus taurus e B. taurus indicus.

     

    PALAVRAS-CHAVES: Bovino, clonagem, FSH, hormônio.

    The aim this work was to promove the cloning and analysis sequencing

  12. Comparison of proximate chemical composition and texture of cupim, Rhomboideus m. and lombo, Longissimus dorsi m. of Nelore (Bos indicus

    Directory of Open Access Journals (Sweden)

    Mayka Reghiany Pedrão

    2009-06-01

    Full Text Available The proximate chemical composition of hump, known in Brazil as cupim, Rhomboideus m. (RB, of Nelore (Bos indicus aged 24 months revealed it to be a unique beef muscle. It presents a lipid fraction 14-fold as high as that of Longissimus dorsi m. (LD taken from the same animal (pA composição química percentual aproximada do cupim m. Rhomboideus (RB derivado de Nelore (Bos indicus de 24 meses de idade mostrou ser um músculo diferenciado. Há uma maior fração de material lipídico em RB chegando a ser 14 vezes proporcionalmente maior em comparação ao m. Longissimus dorsi (LD (p<0,05 a maior quantidade de gordura relatada em amostras de carne em literatura científica. Esse fato foi também observado pela avaliação histológica. Há proporcionalmente maior concentração da fração protéica e menor quantidade de umidade em RB. O teor de colágeno foi de 22,9% mais concentrado em RB enquanto que a quantidade da sua ligação cruzada, hidroxilisilpiridinolina (HP foi 14 vezes maior indicando que cupim seria mais rígido. Contrariando essa expectativa, a maciez da carne crua avaliada pelo texturômetro mostrou valores de 8.05 e 5.81 kg/F para LD e RB, respectivamente (p<0.05. Tais resultados mostram que em músculo contendo abundante gordura esta funciona como lubrificante para a lamina penetrar sem muita resistência através do cupim a despeito dar quantidade e qualidade das fibras de colágeno.

  13. Mitochondrial control region genetic diversity and maternal ancestry of a Brangus-Ibage cattle populations

    OpenAIRE

    Luiz Ernani Henkes; Wilson Araújo Silva Jr; José Carlos Ferrugem Moraes; Tania de Azevedo Weimer

    2005-01-01

    The genetic diversity of 277 nucleotides in the mitochondrial DNA control region (nt 15,964 to 16,240 in reference sequence) was analyzed in crossbreed beef cattle (Brangus-Ibage, 5/8 Bos primigenius taurus x 3/8 Bos primigenius indicus) as well as in some Nellore samples (B. p. indicus). Fifty-seven mutations were found in Brangus-Ibage comprising 18 haplotypes (haplotype diversity, h = 0.851 ± 0.041 and nucleotide diversity, ntd = 0.009 ± 0.006) and 66 in Nellore (h = 1.00 ± 0.27, ntd = 0.0...

  14. Bioanalytical methods for the metalloproteomics study of bovine longissimus thoracis muscle tissue with different grades of meat tenderness in the Nellore breed (Bos indicus).

    Science.gov (United States)

    Baldassini, Welder Angelo; Braga, Camila Pereira; Chardulo, Luis Artur Loyola; Vasconcelos Silva, Josineudson Augusto; Malheiros, Jessica Moraes; de Albuquerque, Lúcia Galvão; Fernandes, Talita Tanaka; Padilha, Pedro de Magalhães

    2015-02-15

    The work describes a metalloproteomics study of bovine muscle tissue with different grades of meat tenderness from animals of the Nellore breed (Bos indicus) based on protein separation by two-dimensional gel electrophoresis, the identification of calcium ions in protein spots by X-ray fluorescence (SR-XRF) and the characterisation of proteins by electrospray ionisation mass spectrometry. Forty (40) specimens were selected and divided into two experimental groups: animals with tough meat (TO) and animals with tender meat (TE). A third group (P) of Piedmontese breed animals (Bos taurus) was included to serve as a comparative model for the level of meat tenderness. The procedures were efficient and preserved the metal-protein structure, enabling calcium detection in protein spots by SR-XRF at a given molecular weight range of 14-97kDa. Two proteins (pyruvate kinase and albumin) were inferred to be related to the phenotypical differences in animals from the different groups.

  15. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East

    OpenAIRE

    Olivieri, Anna; Gandini, Francesca; Achilli, Alessandro; Fichera, Alessandro; Rizzi, Ermanno; Bonfiglio, Silvia; Battaglia, Vincenza; Brandini, Stefania; De Gaetano, Anna; El-Beltagi, Ahmed; Lancioni, Hovirag; Agha, Saif; Semino, Ornella; Ferretti, Luca; Torroni, Antonio

    2015-01-01

    Background Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky) ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near ...

  16. An Overview of the Antecedents and Consequences of Abandoned Residential Housing Projects in Malaysia – A solution from Blue Ocean Strategy (BOS) Perspective

    OpenAIRE

    Mohd Hasyim Hj. Mumin; Fakhrul Anwar Zainol

    2015-01-01

    The issue of abandoned residential housing projects in Malaysia is a matter that should be given more importance in the country. This study aims to identify what are the causes, examine how it affects affected home buyers, and to suggest the solutions from Blue Ocean Strategy (BOS) Perspective. To achieve the goals, this study focused on reviewing relevant literatures and observing the site of abandoned housing projects. From the review of the literatures, the main objective is to find out wh...

  17. Shiga toxin-producing Escherichia coli in yaks (Bos grunniens from the Qinghai-Tibetan Plateau, China.

    Directory of Open Access Journals (Sweden)

    Xiangning Bai

    Full Text Available Shiga toxin (Stx-producing Escherichia coli (STEC are recognized as important human pathogens of public health concern. Many animals are the sources of STEC. In this study we determined the occurrence and characteristics of the STEC in yaks (Bos grunniens from the Qinghai-Tibetan plateau, China. A total of 728 yak fecal samples was collected from June to August, 2012 and was screened for the presence of the stx 1 and stx 2 genes by TaqMan real-time PCR after the sample was enriched in modified Tryptone Soya Broth. Of the 138 (18.96% stx 1 and/or stx 2-positive samples, 85 (61.59% were confirmed to have at least 1 STEC isolate present by culture isolation, from which 128 STEC isolates were recovered. All STEC isolates were serotyped, genotyped by pulsed-field gel electrophoresis (PFGE and characterized for the presence of 16 known virulence factors. Fifteen different O serogroups and 36 different O:H serotypes were identified in the 128 STEC isolates with 21 and 4 untypable for the O and H antigens respectively. One stx 1 subtype (stx 1a and 5 stx 2 subtypes (stx 2a, stx 2b, stx 2c, stx 2d and stx 2g were present in these STEC isolates. Apart from lpfA O157/OI-141, lpfA O157/OI-154, lpfA O113, katP and toxB which were all absent, other virulence factors screened (eaeA, iha, efa1, saa, paa, cnf1, cnf2, astA, subA, exhA and espP were variably present in the 128 STEC isolates. PFGE were successful for all except 5 isolates and separated them into 67 different PFGE patterns. For the 18 serotypes with 2 or more isolates, isolates of the same serotypes had the same or closely related PFGE patterns, demonstrating clonality of these serotypes. This study was the first report on occurrence and characteristics of STEC isolated from yaks (Bos grunniens from the Qinghai-Tibetan plateau, China, and extended the genetic diversity and reservoir host range of STEC.

  18. REVIEW: The Characteristics of Genetic Resource of Bali Cattle (Bos-bibos banteng and the Alternative of It's Conservation Methods

    Directory of Open Access Journals (Sweden)

    ACHMAD NUR CHAMDI

    2005-01-01

    Full Text Available Bali cattle is an Indonesian native beef cattle, the result of domestication of Banteng (Bos-bibos banteng. The main problem faced in the development of Bali cattle is the low quality of breed, which is predicted as the effect of inbreeding or raising management. The affects of genetic and cross breeding which usually inflict a loss are the decreasing of cattle’s endurance, fertility and birth weight. Seeing the fact, the government effort to introduce a quality bull to the breed source areas, the determination of cattle release including the controll on the cutting of productive female cattle, and to exactly count the number of Bali cattle which can be released in order to do not disturb its population balance, so it is necessary to do conservation attempt by in-situ and ex-situ. The result of this study shows that the characteristics on genetic resource of Bali cattle which comprises documentation, evaluation on reproduction and production, and attempt in increasing Bali cattle’s genetic quality in Indonesia have been done, eventhough those are still limited.

  19. Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2012-02-01

    Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

  20. Comparison of F1 Bos indicus x Hereford cows in central Texas: II. Udder, mouth, longevity, and lifetime productivity.

    Science.gov (United States)

    Riley, D G; Sanders, J O; Knutson, R E; Lunt, D K

    2001-06-01

    Postpartum udder characteristics, aged mouth condition scores, and cow survival, longevity, and productivity were evaluated for 15 yr on F1 cows in central Texas (temperate winters and subtropical summers). The cows (n = 116) were progeny of Angus, Gray Brahman, Gir, Indu-Brazil, Nellore, and Red Brahman sires and Hereford dams. Crossbred cows sired by Nellore had smaller (P Brahman crossbreds. The Nellore crossbred cows had larger (P Brahman crossbreds. As 14-yr-old cows, Angus crossbreds had lower (P < 0.05) mouth scores (indicative of one or more missing incisors) than Bos indicus crossbreds. Under actual and artificial (records were removed) culling procedures, Nellore crossbreds had the highest cow survival to age 14 and the highest longevity. Indu-Brazil crossbreds tended to be the lowest for both survival and longevity. Curves were fitted by nonlinear regression procedures to the adjusted frequencies of cows remaining at each age; scale and shape parameters were estimated and compared for the different breed groups. Breed group cow survival rates, calf crop weaned, and calf weaning weights were used 1) to construct population projection and production matrices for each breed group and 2) to generate breed group vectors containing projected age distributions and production information. Cows sired by Nellore and Gir were projected to require the fewest purebred cows to generate replacement heifers and to have the most calves and the largest total calf weight sold per year. PMID:11424680

  1. Quality characteristics of Longissimus dorsi muscle from Bos indicus animals treated with vitamin D3 Características qualitativas do músculo Longissimus dorsi de animais Bos indicus tratados com vitaminaD3

    Directory of Open Access Journals (Sweden)

    Aparecida Carla de Moura Silveira Pedreira

    2003-12-01

    Full Text Available Among several techniques to improve beef tenderness, vitamin D3, important for calcium mobilization, has recently been developed as an alternative. It acts on the intracellular calcium-dependent proteases (mu- and m-calpain. Ten days prior to slaughter, 36 Nelore steers were fed 0, 3, 6 and 9 million IU of supplemental vitamin D3 (D3 per animal per day (an-1 d-1. Animals were slaughtered and tenderness (shear force, cooking losses (1, 8 and 15 days of aging, sensory evaluation, and minerals in blood plasma and muscle (Longissimus dorsi were measured. There were no differences (P > 0.05 among treatments for blood plasma and muscle mineral concentration, evaporation losses, and sensory juiciness. For drip and total loss, the smallest losses were for the 6 × 10(6 IU an-1 d-1 treatment. The control treatment resulted in lowest shear force and aging also tended to lower resistance to shearing. The 3 × 10(6 IU an-1 d-1 treatment had a positive effect on tenderness, flavor and overall palatability. High levels of supplemental D3 did not improve the quality characteristicsof Longissimus dorsi muscle from Bos indicus animals.Muitas técnicas são empregadas para melhorar a maciez da carne de bovinos. A mais recente usa a vitamina D3, que tem importância na mobilização do cálcio e na ativação das proteases cálcio-dependentes (mi- e m-calpaína. Neste estudo, 36 machos castrados (Nelore foram suplementados por via oral com quatro níveis de vitamina D3 (0, 3, 6 e 9 milhões de UI de vitamina D3 animal-1 dia-1 durante os 10 dias que antecederam o abate. Após o abate foram medidos a força de cisalhamento e perdas por cozimento (aos dias 1, 8 e 15 de maturação, pH, concentração de minerais no plasma sangüíneo e no músculo Longissimus dorsi, além de análise sensorial de amostras. Não houve (P > 0.05 efeito da dose de vitamina D3 na concentração de minerais no plasma sangüíneo e no músculo, nas perdas por evaporação, e na sucul

  2. Chemical sterilisation of Bos indicus bull calves following intratesticular injection of zinc acetate: effects on semen quality and testicular changes.

    Science.gov (United States)

    Cavalieri, J; Wang, M; Johnson, L

    2015-05-01

    The aim of this study was to determine the effects in Bos indicus bull calves of intratesticular administration of 1mL of either saline (n=9) or one of the two doses of zinc acetate (ZA1, 57.75mg, n=10 or ZA2, 71.75mg, n=10) on semen quality and testicular changes. Semen was collected by electroejaculation on Days 343, 524 and 783 and animals were slaughtered on Day 860. Treatment reduced median maximum number of progressively motile and morphologically normal sperm collected (P=0.001) and the percentage of animals in which sperm were recovered (saline: 100%, 9/9; ZA1: 44.9%, 4/9 and ZA2: 40.0%, 4/10; P=0.013). Compared to saline treated controls, treatment with ZA reduced the mean diameter of the testes after Day 34 of treatment (treatment×time, P=0.013) and total testicular weight at slaughter (treatment: mean±SEM; saline: 569.4±59.0g, ZA1: 249.3±72.9g, ZA2: 247.5±68.1g; P=0.004). Histological changes in testes of bulls treated with ZA were characterized by germ cell depletion, vacuolation of Sertoli cells, interstitial fibrosis, epididymal duct atrophy with variable remnants of testicular tissue and degeneration. We conclude that intratesticular administration of two doses of ZA in B. indicus calves is able to severely impair spermatogenesis and cause varying degrees of testicular degeneration and a reduction in testicular diameter and mass. Further investigation is required to determine ways of obtaining more consistent results from treatment. PMID:25752498

  3. Age-related changes in the morphology and protein expression of the thymus of healthy yaks (Bos grunniens).

    Science.gov (United States)

    Zhang, Qian; Yang, Kun; Yangyang, Pan; He, Junfeng; Yu, Sijiu; Cui, Yan

    2016-06-01

    OBJECTIVE To evaluate age-related changes in the morphology and expression of cluster of differentiation 3 (CD3), S100 β, and caspase-3 of the thymus of healthy yaks (Bos grunniens). ANIMALS 15 healthy male yaks of various ages from highland plateaus. PROCEDURES Yaks were allocated to 3 groups on the basis of age (newborn [1 to 7 days old; n = 5], juvenile [5 to 7 months old, 5], and adult [3 to 4 years old; 5]) and euthanized. The thymus was harvested from each yak within 10 minutes after euthanasia. Morphological characteristics were assessed by histologic examination and transmission electron microscopy. Expression of CD3, S100 β, and caspase-3 mRNA and protein was measured by quantitative real-time PCR assay, Western blot analysis, and immunohistochemical staining. RESULTS As age increased, functional thymic tissue was replaced with adipose and connective tissues and the thymic capsule thickened. Expression of CD3 and S100 β mRNA and protein decreased with age, whereas expression of caspase-3 mRNA and protein increased with age. Immunohistochemical staining revealed that CD3-positive thymocytes were located within both the thymic cortex and medulla, S100 β-positive thymic dendritic cells were located in the corticomedullary junction and medulla, and caspase-3-positive thymocytes were diffusely scattered throughout the cortex and medulla. CONCLUSIONS AND CLINICAL RELEVANCE Results indicated that age-related thymic changes in yaks that live on highland plateaus were similar to those observed in humans and other mammals. Thus, yaks might serve as a model to study thymic immune system adaptations to high elevations. PMID:27227493

  4. Superovulation, collection and transfer of embryos and demi-embryos from Boran(Bos indicus ) cows and heifers.

    Science.gov (United States)

    Jordt, T; Lorenzini, E

    1988-08-01

    Twenty-three Boran(Bos indicus ) cows and heifers were superovulated with pregnant mare serum gonadotropin (PMSG); a total of four embryos and 4.1 +/- 0.3 (mean +/- SEM) ova per ova-producing donor resulted. Follicle stimulating hormone (FSH-P) was then used to superovulate 49 Boran cows for a total of 106 superovulations, of which 63 (59.4%) produced an average of 3.7 +/- 0.4 (mean +/- SEM) embryos. The embryo production was not influenced by either the season or the number of times(one to five) the cows were superovulated. A higher pregnancy rate was obtained when the selection of Boran recipients was based on their plasma-progesterone values (overall 52.5%, single embryos 63.3%, twin demi-embryos 45.8%) than when they were selected by palpation per rectum only (overall 43.8%, single embryos 50%, twin demi-embryos 36.4%). The twinning rate of twin demiembryos was 62.5%, whereas only single calves were born after transfer of two embryos per recipient. No pregnancies were produced following transfer of twin demi-embryos without zonae pellucidae. Transferring single demi-embryos gave a low pregnancy rate (13.3%). Twelve donor Boran cows (21 superovulations) bred with their fathers resulted in a high rate of early embryonic death; additionally, only 20.9% (overall) of the recipients became pregnant. Estrus synchronization of Boran cows with a progesterone releasing intravaginal device (PRID) for a short period (7 d) combined with one injection of prostaglandin (Day 6) produced a larger number of good quality recipients (70.5%) than using double prostaglandin injections (60%). PMID:16726476

  5. Hydrogen Peroxide Production as a Limiting Factor in Xenobiotic Compound Oxidation by Nitrogen-Sufficient Cultures of Bjerkandera sp. Strain BOS55 Overproducing Peroxidases

    OpenAIRE

    Kotterman, M.; Wasseveld, R. A.; Field, J. A.

    1996-01-01

    The overproduction of ligninolytic peroxidase by the N-deregulated white rot fungus Bjerkandera sp. strain BOS55 under nitrogen-sufficient conditions had no noteworthy effect on the oxidation of anthracene or the decolorization of the polymeric aromatic dye Poly R-478 in 6-day-old cultures. Only when the endogenous production of H(inf2)O(inf2) was increased by the addition of extra oxygen and glucose could a 2.5-fold increase in the anthracene oxidation rate and a 6-fold increase in the Poly ...

  6. Heat tolerance in two tropically adapted Bos taurus breeds, Senepol and Romosinuano, compared with Brahman, Angus, and Hereford cattle in Florida.

    Science.gov (United States)

    Hammond, A C; Olson, T A; Chase, C C; Bowers, E J; Randel, R D; Murphy, C N; Vogt, D W; Tewolde, A

    1996-02-01

    Two trials were conducted with heifers to determine heat tolerance among temperate Bos taurus (Angus, Hereford), Bos indicus (Brahman), tropical Bos taurus (Senepol, Romosinuano), and the reciprocal crosses of Hereford and Senepol. Differences among breeds in temperament score, circulating concentrations of cortisol, and blood packed cell volume were also investigated. Trial 1 used 43 Angus, 28 Brahman, 12 Hereford, 23 Romosinuano, 16 Senepol, 5 Hereford x Senepol (H x S), and 5 Senepol x Hereford (S x H) heifers. Trial 2 used 36 Angus, 31 Brahman, 9 Hereford, 14 Senepol, 19 H x S, and 10 S x H heifers. On the hottest summer date in Trial 1, rectal temperature of Angus was greater (P Brahman, Senepol, or Romosinuano. Rectal temperature and plasma cortisol were significantly less in Senepol than in Brahman, suggesting that the differences in rectal temperature between these breeds may be due to differences in stress response possibly related to differences in temperament. Reciprocal crosses of Hereford and Senepol had rectal temperatures nearly as low as that of Senepol and displayed substantial heterosis (-9.4%, P Brahman, Romosinuano, or Senepol heifers, and Brahman had significantly slower respiration rates than Romosinuano or Senepol. On the hottest summer date in Trial 2, rectal temperature in Angus heifers was greater (P Brahman or Senepol had rectal temperatures similar to that of Senepol, or heterosis for log10 rectal temperature was similar to that in Trial 1 (-9.8%, P Brahman always had the slowest respiration rate and greatest packed cell volume. Brahman had significantly greater temperament scores and plasma cortisol concentrations than Angus or Senepol, except that plasma cortisol was not different between Brahman and Senepol on the hottest summer date. On this date, rectal temperature did not differ between Brahman and Senepol, which supports the hypothesis that there is a relationship between response to stress and rectal temperature that helps

  7. Chemical and sensory meat characteristics of Nellore cattle (Bos indicus) finished with different levels of backfat thickness in the longissimus thoracis muscle

    OpenAIRE

    Jéssica Moraes Malheiros; Welder Angelo Baldassini; Victor Augusto Domingos Dias; Josineudson Augusto II Vasconcelos da Silva; Rogério Abdalah Curi; Luiz Artur Loyola Chardulo

    2016-01-01

    The objective of this study was to evaluate the effect of backfat thickness (BFT) on the meat quality of feedlot-finished Nellore bulls (Bos indicus). Seventy-two animals were feedlot finished for about 100 days. For this study, 24 animals were sampled according to BFT in the longissimus thoracis muscle after slaughter: 12 animals with BFT up to 3.0 mm (class BFT-3) and 12 animals with BFT > 6.0 mm (class BFT-6). Chemical (myofibrillar fragmentation index, intramuscular fat content, and unsat...

  8. The effects of intramuscular or intravenous injections of gonadotropin releasing hormone at fixed-time artificial insemination on pregnancy rates of Bos indicus beef cows

    Directory of Open Access Journals (Sweden)

    Danilo Demeterco

    2014-06-01

    Full Text Available The effect of an intramuscular versus intravenous administration of gonadotropin releasing hormone (GnRH at fixed-time AI (FTAI on the pregnancy rates of crossbred Bos indicus beef cows was evaluated. Pluriparous nursing calv cows (n=120 were synchronized as follows: d 0 cows received a 2.0 mg injection of estradiol benzoate (EB and insertion of a controlled intravaginal progesterone releasing device containing 0.558 g of progesterone, d 8 removal of the progesterone device , a 0.15 mg injection of prostaglandin F2α (PGF, a 1.0 mg injection of EB, and 400 IU injection of equine chorionic gonadotropin. Fifty-four hr after PGF, all cows were exposed to FTAI and a 0.084 mg injection of GnRH was administered either via Vena caudalis (n=60, or via Longissimus dorsi (n=60. Cows were inseminated with the same sire and by a single AI technician. Pregnancy was determined by the transrectal ultrasonography on d 40 after AI. Cows receiving the intravenous administration of GnRH had higher (P = 0.04 pregnancy rates than the cows receiving the intramuscular injection of GnRH (65 vs 46.6%, respectively. It was concluded that the intravenous administration of GnRH at the time of AI improved the pregnancy rates of crossbred Bos indicus beef cows submitted to FTAI.

  9. Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

    Directory of Open Access Journals (Sweden)

    Joana D'Arc Rocha Alves

    2001-08-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

  10. Nucleotide polymorphisms in the bovine lymphotoxin A gene and their distribution among Bos indicus zebu cattle breeds.

    Science.gov (United States)

    Behl, Jyotsna Dhingra; Mishra, Priyanka; Verma, N K; Niranjan, S K; Dangi, P S; Sharma, Rekha; Behl, Rahul

    2016-03-15

    The present study was undertaken to characterize the genetic variation present in lymphoxin A gene (LTA gene) encoding for the lymphotoxin A protein also known as tumor necrosis factor beta, a cytokine produced by lymphocytes, known to be cytotoxic for a wide range of tumor cells both in vitro and in vivo, and, which is essential for normal immunological development; in 40 animals of 5 diverse Bos indicus Indian zebu cattle breeds. These breeds survive under the harsh and tough tropical climatic conditions of various parts of the Indian subcontinent. The LTA gene in the present study was observed to contain 33 SNPs and 3 small insertion/deletion polymorphisms. Four SNPs occurred in the coding regions of the gene viz. g.1327A>G and g.1400C>T in exon 2 and g.1840C>T and g.1942C>T in exon 3, of which the SNP g.1327A>G in exon 2 resulted in a non-synonymous amino acid change G38D. This amino acid change was however predicted not be affecting the protein function in any manner. The gene contained putative transcription factor binding sites for the c-Re1 and for Pax-4 transcription factors. A putative promoter region was also predicted on the reverse DNA strand from position 894 to 644. Several repeat elements and microsatellite repeats were detected to be occurring across the 3.2kb LTA gene sequence. The study showed the occurrence of 40 genotypes and 48 most probable haplotypes. The genotypes at the observed SNP positions in the LTA gene were in near Hardy-Weinberg equilibrium. A negative Tajima's D value that was not significant statistically at P>0.10 indicated that the neutral mutation hypothesis could not be excluded. The genetic variations observed in the LTA gene in the present study have not been reported earlier and these could possibly be used as molecular markers for further studies involving association of the gene variability with disease resistance/tolerance traits.

  11. Water Intake and Utilization in Mithun (Bos frontalis):Effect of Environmental Temperature, Rearing System and Concentrate Feed Supplement

    Institute of Scientific and Technical Information of China (English)

    D. T. Pal; A. Dhali; S. K. Mondal; C. Rajkhowa; K. M. Bujarbaruah

    2008-01-01

    Seasonal and sexual variations as well as the effect of dry feed supplement on total drinking water intake and its utilization were observed in mithun (Bos frontalis)-a semi-wild animal found in North Eastern Hill Region (NEHR) of India. In a completely randomized design, twelve adult mithuns (B. frontalis) as per their sex and body weight were assigned in two different rearing systems (free grazing and free grazing with dry concentrate feed supplementation), and ten growing male mithuns as per their body weight assigned in two different levels of dry concentrate feed supplementation (1.0 kg and 2.0 kg dry concentrate feeds on green forage based diet) and in two different seasons (summer and winter). It was observed that the environmental temperature had a significant effect on drinking water intake by mithuns. Drinking water consumption (per unit of body weight) was significantly (P < 0.05) higher in summer than in winter. Supplementation of concentrate feed on free grazing animals resulted in increase in water consumption. Total water consumption (drinking as well as performed water) was found to be 15.18 litres per 100 kg body weight by growing mithun. Feed dry matter and digestible nutrient intakes by growing mithun were observed to be increased with the increase of supplementation of dry concentrate feed. Roughage to concentrate ratio did not affect the nutrient digestibility. Mithun calves drank an average of 4.30 litres water for each kg of dry matter intake. Metabolic water was significantly (P<0.01) increased with the increase of supplementation of concentrate feed whereas water turn over, which depends upon the body weight of the animals, did not differ significantly on offering of lower or higher level of dry feed. Faecal water loss of growing mithun was decreased with the increase in intake of concentrate feed and was estimated to be 33~46% of total water intake. Excretion of water through faeces of mithun was about 3.8% of body weight. It could

  12. Genomic conservation of cattle microsatellite loci in wild gaur (Bos gaurus and current genetic status of this species in Vietnam

    Directory of Open Access Journals (Sweden)

    Renard Jean-Paul

    2007-11-01

    Full Text Available Abstract Background The wild gaur (Bos gaurus is an endangered wild cattle species. In Vietnam, the total number of wild gaurs is estimated at a maximum of 500 individuals. Inbreeding and genetic drift are current relevant threats to this small population size. Therefore, information about the genetic status of the Vietnamese wild gaur population is essential to develop strategies for conservation and effective long-term management for this species. In the present study, we performed cross-species amplification of 130 bovine microsatellite markers, in order to evaluate the applicability and conservation of cattle microsatellite loci in the wild gaur genome. The genetic diversity of Vietnamese wild gaur was also investigated, based on data collected from the 117 successfully amplified loci. Results One hundred-thirty cattle microsatellite markers were tested on a panel of 11 animals. Efficient amplifications were observed for 117 markers (90% with a total of 264 alleles, and of these, 68 (58.1% gave polymorphic band patterns. The number of alleles per locus among the polymorphic markers ranged from two to six. Thirteen loci (BM1314, BM2304, BM6017, BMC2228, BMS332, BMS911, CSSM023, ETH123, HAUT14, HEL11, HEL5, ILSTS005 and INRA189 distributed on nine different cattle chromosomes failed to amplify wild gaur genomic DNA. Three cattle Y-chromosome specific microsatellite markers (INRA124, INRA126 and BM861 were also highly specific in wild gaur, only displaying an amplification product in the males. Genotype data collected from the 117 successfully amplified microsatellites were used to assess the genetic diversity of this species in Vietnam. Polymorphic Information Content (PIC values varied between 0.083 and 0.767 with a mean of 0.252 while observed heterozygosities (Ho ranged from 0.091 to 0.909 (mean of 0.269. Nei's unbiased mean heterozygosity and the mean allele number across loci were 0.298 and 2.2, respectively. Conclusion Extensive

  13. Amino acid profile of salivary proteins and plasmatic trace mineral response to dietary condensed tannins in free-ranging zebu cattle (Bos indicus) as a marker of habitat degradation

    NARCIS (Netherlands)

    Yisehak, K.; Becker, A.; Rothman, J.M.; Dierenfeld, E.S.; Marescau, B.; Bosch, G.; Hendriks, W.H.; Janssens, G.P.J.

    2012-01-01

    In the southern hemisphere, foraging areas of cattle are affected by overgrazing and soil erosion resulting in decreased availability of grasses and increased amounts of browse plants high in condensed tannins (CT). This study aimed to identify biomarkers in free-ranging zebu cattle (Bos indicus) fo

  14. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

    DEFF Research Database (Denmark)

    Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede;

    2013-01-01

    the HH group did. However, we also found interactions between the effects of haplotype and biopsy for body temperature, heart rate, and PMNL. In conclusion, when challenged with E. coli mastitis, HF cows with the specific Bos taurus autosome 9-located QTL haplotypes were associated with differences...... autosome 9. In the present study, we induced experimental E. coli mastitis in Danish HF cows to investigate the effect of 2 E. coli mastitis-associated QTL haplotypes on the cows' disease phenotypes and recovery in early lactation. Thirty-two cows were divided in 2 groups bearing haplotypes with either low...... motility; and the paraclinical parameters: bacterial counts, somatic cell count (SCC), and milk amyloid A levels in milk; and white blood cell count, polymorphonuclear neutrophilic leukocyte (PMNL) count, and serum amyloid A levels in blood were recorded at different time points post-E. coli inoculation...

  15. Seminal plasma proteins and their relationship with percentage of morphologically normal sperm in 2-year-old Brahman (Bos indicus) bulls.

    Science.gov (United States)

    Boe-Hansen, G B; Rego, J P A; Crisp, J M; Moura, A A; Nouwens, A S; Li, Y; Venus, B; Burns, B M; McGowan, M R

    2015-11-01

    The objective was to determine the relationship between seminal plasma proteins and sperm morphology in Bos indicus bulls of the Brahman breed. Fifty-six 24-month-old Australian Brahman bulls were electroejaculated and samples were examined to determine the percentage of morphologically normal sperm (PNS24) and the seminal plasma protein composition was identified and quantified by 2-D gel electrophoresis. The total integrated optical density of 152 seminal plasma protein spots (SPPs) across all gels was determined using the PDQuest software version 8.0 (Bio Rad, USA). Using a single regression mixed model with the density of individual spots as a covariate for PNS24, 17 SPPs were significantly associated with PNS24 (pBrahman bulls and sperm morphology. PMID:26417650

  16. Effects of electrical stimulation and postmortem storage on changes in titin, nebulin, desmin, troponin-T, and muscle ultrastructure in Bos indicus crossbred cattle.

    Science.gov (United States)

    Ho, C Y; Stromer, M H; Rouse, G; Robson, R M

    1997-02-01

    The effects of electrical stimulation (ES) on degradation of titin, nebulin, desmin, and troponin-T (TN-T) and on structural changes in the longissimus muscle (LM) from Brahman x Simmental (B x S) cattle (Bos indicus cross) were determined. The left side of seven B x S beef carcasses was stimulated (200 V, 20 Hz) within 1 h of death, and the right side was the nonstimulated (NS) control. Myofibrils for SDS-PAGE and samples for transmission electron microscopy were prepared from the LM at 0, 1, 3, 7, 14, and 28 d postmortem (PM). The SDS-PAGE results showed that the T1 band of titin was absent by 7 d in two animals, by 14 d in four animals, and by 28 d in one animal in both NS and ES samples. By SDS-PAGE, intact nebulin was gone by 7 d in two animals and by 14 d in five animals, but in blots, nebulin decreased by 7 d and was absent by 14 d in both NS and ES samples. The desmin band could still be seen as a light band at 28 d in Western blots of both NS and ES samples. A decrease in TN-T and a concomitant increase in the 30-kDa polypeptide were observed in both NS and ES samples. Western blots with a monoclonal antibody to TN-T confirmed that TN-T decreased at similar rates in NS and ES samples but showed that the 30-kDa polypeptide was more heavily labeled in ES samples from 7 to 28 d. Contraction nodes were present in O-d ES samples and were still observed in 28-d ES samples. Narrow, intermediate, and wide I-band fractures were seen earlier and at a greater frequency in ES than in NS samples. Overall, ES had no detectable effect on titin, nebulin, desmin, or TN-T degradation but accelerated the appearance and enhanced the frequency of three types of I-band fractures in the LM from Bos indicus crossbred cattle. PMID:9051459

  17. Effects of electrical stimulation and postmortem storage on changes in titin, nebulin, desmin, troponin-T, and muscle ultrastructure in Bos indicus crossbred cattle.

    Science.gov (United States)

    Ho, C Y; Stromer, M H; Rouse, G; Robson, R M

    1997-02-01

    The effects of electrical stimulation (ES) on degradation of titin, nebulin, desmin, and troponin-T (TN-T) and on structural changes in the longissimus muscle (LM) from Brahman x Simmental (B x S) cattle (Bos indicus cross) were determined. The left side of seven B x S beef carcasses was stimulated (200 V, 20 Hz) within 1 h of death, and the right side was the nonstimulated (NS) control. Myofibrils for SDS-PAGE and samples for transmission electron microscopy were prepared from the LM at 0, 1, 3, 7, 14, and 28 d postmortem (PM). The SDS-PAGE results showed that the T1 band of titin was absent by 7 d in two animals, by 14 d in four animals, and by 28 d in one animal in both NS and ES samples. By SDS-PAGE, intact nebulin was gone by 7 d in two animals and by 14 d in five animals, but in blots, nebulin decreased by 7 d and was absent by 14 d in both NS and ES samples. The desmin band could still be seen as a light band at 28 d in Western blots of both NS and ES samples. A decrease in TN-T and a concomitant increase in the 30-kDa polypeptide were observed in both NS and ES samples. Western blots with a monoclonal antibody to TN-T confirmed that TN-T decreased at similar rates in NS and ES samples but showed that the 30-kDa polypeptide was more heavily labeled in ES samples from 7 to 28 d. Contraction nodes were present in O-d ES samples and were still observed in 28-d ES samples. Narrow, intermediate, and wide I-band fractures were seen earlier and at a greater frequency in ES than in NS samples. Overall, ES had no detectable effect on titin, nebulin, desmin, or TN-T degradation but accelerated the appearance and enhanced the frequency of three types of I-band fractures in the LM from Bos indicus crossbred cattle.

  18. Evaluation of the impacts of spaying by either the dropped ovary technique or ovariectomy via flank laparotomy on the welfare of Bos indicus beef heifers and cows.

    Science.gov (United States)

    Petherick, J C; McCosker, K; Mayer, D G; Letchford, P; McGowan, M

    2013-01-01

    The welfare outcomes for Bos indicus cattle (100 heifers and 50 cows) spayed by either the dropped ovary technique (DOT) or ovariectomy via flank laparotomy (FL) were compared with cattle subjected to physical restraint (PR), restraint by electroimmobilization in conjunction with PR (EIM), and PR and mock AI (MAI). Welfare assessment used measures of morbidity, mortality, BW change, and behavior and physiology indicative of pain and stress. One FL heifer died at d 5 from peritonitis. In the 8-h period postprocedures, plasma bound cortisol concentrations of FL, DOT, and EIM cows were not different and were greater (P0.05) between treatments in BW changes. For both heifers and cows, FL and DOT spaying caused similar levels of acute pain, but FL had longer-lasting adverse impacts on welfare. Electroimmobilization during FL contributed to the pain and stress of the procedure. We conclude that: i) FL and DOT spaying should not be conducted without measures to manage the associated pain and stress; ii) DOT spaying is preferable to FL spaying; iii) spaying heifers is preferable to spaying cows; and iv) electroimmobilization causes pain and stress and should not be routinely used as a method of restraint. PMID:23048132

  19. PREVALENCE OF SULFONAMIDE AND FLORFENICOL RESISTANCE GENES IN ESCHERICHIA COLI ISOLATED FROM YAKS (BOS GRUNNIENS) AND HERDSMEN IN THE TIBETAN PASTURE.

    Science.gov (United States)

    Zhang, Anyun; Yang, Yunfei; Wang, Hongning; Lei, Changwei; Xu, Changwen; Guan, Zhongbin; Liu, Bihui; Huang, Xi; Peng, Linyao

    2015-07-01

    To determine the antimicrobial susceptibility profiles and prevalence of resistance genes in Escherichia coli isolated from yaks (Bos grunniens) and herdsmen in nine plateau pastures in Tibet, we isolated 184 nonidentical strains of E. coli from yaks and herdsmen. Antimicrobial susceptibility testing of 15 antimicrobials was conducted and the prevalence of sulfonamide resistance genes (sul1, sul2, and sul3) and florfenicol resistance genes (floR, cfr, cmlA, fexA, pexA, and estDL136) was determined. Escherichia coli isolated from yaks had a high resistance rate to sulfamethoxazole (44%), sulphafurazole (40.4%), and florfenicol (11.4%). Escherichia coli isolated from herdsmen had a high resistance rate to sulfamethoxazole (57%) and sulphafurazole (51%). In addition, sul genes were present in 93% of sulfonamide-resistant isolates (84/90), and 17 floR genes and four cmlA genes were found in 19 florfenicol-resistant isolates. Even though florfenicol is prohibited from use in humans, three floR genes were detected in strains isolated from herdsmen. The three floR-positive isolates from herdsmen had pulsed-field gel electrophoresis patterns similar to isolates from yaks. In addition to documenting the sul and floR genes in E. coli isolated from yaks and herdsmen in the Tibetan pasture, we demonstrated the potential risk that antimicrobial-resistant E. coli could spread among herdsmen and yaks.

  20. Infrared thermography as a tool to evaluate body surface temperature and its relationship with feed efficiency in Bos indicus cattle in tropical conditions

    Science.gov (United States)

    Martello, Luciane Silva; da Luz e Silva, Saulo; da Costa Gomes, Rodrigo; da Silva Corte, Rosana Ruegger Pereira; Leme, Paulo Roberto

    2016-01-01

    The aims of this study were to evaluate the use of infrared thermography (IRT) images as a tool for monitoring body surface temperature and to study its relationship with residual feed intake (RFI) in Nellore cattle. We also evaluated IRT as an indicator of feed efficiency in Bos indicus cattle. In this study, 144 Nellore steers were fed high-concentrate diets for 70 days to evaluate feedlot performance. We examined nine animals classified as high RFI and nine animals classified as low RFI by measuring rectal temperature (RT), respiratory frequency (RF), and IRT in the front, eye, ocular area, cheek, flank, ribs, rump, and front feet. The measurements were taken at 0700, 1200, and 1600 hours. The IRT temperatures measured at the eye, cheek, flank, ribs, rump, and front feet were positively associated with RF and RT. These results indicate that increases in the temperatures are associated with increased RF and RT. There was an effect in the RFI group in the front region where IRT correlates with RT. The front IRT for high-RFI cattle was lower ( P cattle. The higher skin temperature measured by IRT for animals in the RFI group may be related to improved efficiency of thermoregulatory mechanisms because the RT remained lower in the low-RFI group. IRT can be used in the head for studies related to RFI in beef cattle.

  1. Microsatellite DNA typing for assessment of genetic variability in Tharparkar breed of Indian zebu (Bos indicus) cattle, a major breed of Rajasthan

    Indian Academy of Sciences (India)

    M. Sodhi; M. Mukesh; B. Prakash; S. P. S. Ahlawat; R. C. Sobti

    2006-12-01

    The present study estimates genetic variability with a set of 25 microsatellite markers in a random sample of 50 animals of Tharparkar breed of Indian zebu (Bos indicus) cattle. Tharparkar is a dual-purpose breed, valued for its milk as well as draught utility, and is adapted to the inhospitable Thar desert conditions of Rajasthan typified by summer temperature hovering above 50°C, sparse rainfall and vegetation, and scarcity of even drinking water. The observed number of alleles ranged from 4 (ETH3, ILSTS030, INRA5, INRA63 and MM8) to 11 (HEL9 and ILSTS034), with allelic diversity (average number of observed alleles per locus) of 6.20. Observed and expected heterozygosity ranged from 0.25 (INRA63) to 0.77 (ETH10), and from 0.51 (HEL5 and HAUT27) to 0.88 (HEL9) respectively. Wide range of genetic variability supported the utility of these microsatellite loci in measurement of genetic diversity indices in other Indian cattle breeds too. Various average genetic variability measures, namely allele diversity (6.20), observed heterozygosity (0.57), expected heterozygosity (0.67) and mean polymorphism information content (0.60) values showed substantial within-breed genetic variability in this major breed of Rajasthan, despite accumulated inbreeding as reflected by high average inbreeding coefficient $(F_{\\text{IS}} = 0.39)$. The Tharparkar population has not experienced a bottleneck in the recent past.

  2. The effect of supplementing leaves of four tannin-rich plant species with polyethylene glycol on digestibility and zootechnical performance of zebu bulls (Bos indicus).

    Science.gov (United States)

    Yisehak, K; De Boever, J L; Janssens, G P J

    2014-06-01

    The effect of supplementing leaves of four tannin-rich plant species with polyethylene glycol 6000 (PEG) on nutrient intake and digestibility as well as on weight gain, feed conversion ratio (FCR) and N retention of zebu bulls (Bos indicus) was studied. Leaves of Albizia gummifera, Grewia ferruginea, Prunus africana and Syzygium guineense, containing, respectively, 85, 55, 76 and 172 g condensed tannins (CT) per kg dry matter (DM), were combined with natural pasture hay in a ratio of 40:60 on DM basis. The four diets were fed both without and with addition of PEG, at a dose of 40 g per kg DM, to eight zebu bulls during trials of 25 days in an 8 × 8 randomized crossover design. Supplementation with PEG increased nutrient intake, digestibility, FCR, N retention and average daily gain (p < 0.01). A diet × PEG interaction was observed for nutrient intake as well as for crude protein, neutral detergent fibre and acid detergent fibre digestibility (p < 0.05), but the effect size of PEG addition could not be attributed to the CT content as such, and also digestibility without PEG was not related to CT content of the diets. The reason why the efficacy of PEG addition did not relate to the CT content pointed the need to evaluate other factors that can help to predict the efficacy of PEG, for example, tannin type or interaction with other nutrients.

  3. Exploring genetic polymorphism in innate immune genes in Indian cattle (Bos indicus) and buffalo (Bubalus bubalis) using next generation sequencing technology.

    Science.gov (United States)

    Patel, Shreya M; Koringa, Prakash G; Nathani, Neelam M; Patel, Namrata V; Shah, Tejash M; Joshi, Chaitanya G

    2015-02-01

    Activation of innate immunity initiates various cascades of reactions that largely contribute to defense against physical, microbial or chemical damage, prompt for damage repair and removal of causative organisms as well as restoration of tissue homeostasis. Genetic polymorphism in innate immune genes plays prominent role in disease resistance capabilities in various breeds of cattle and buffalo. Here we studied single nucleotide variations (SNP/SNV) and haplotype structure in innate immune genes viz CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1, BNBD4, BNBD5, TAP and LAP in Gir cattle and Murrah buffalo. Targeted sequencing of exonic regions of these genes was performed by Ion Torrent PGM sequencing platform. The sequence reads obtained corresponding to coding regions of these genes were mapped to reference genome of cattle BosTau7 by BWA program using genome analysis tool kit (GATK). Further variant analysis by Unified Genotyper revealed 54 and 224 SNPs in Gir and Murrah respectively and also 32 SNVs was identified. Among these SNPs 43, 36, 11,32,81,21 and 22 variations were in CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1 and TAP genes respectively. Among these identified 278 SNPs, 24 were found to be reported in the dbSNP database. Variant analysis was followed by structure formation of haplotypes based on multiple SNPs using SAS software revealed a large number of haplotypes. The SNP discovery in innate immune genes in cattle and buffalo breeds of India would advance our understanding of role of these genes in determining the disease resistance/susceptibility in Indian breeds. The identified SNPs and haplotype data would also provide a wealth of sequence information for conservation studies, selective breeding and designing future strategies for identifying disease associations involving samples from distinct populations.

  4. Exploring genetic polymorphism in innate immune genes in Indian cattle (Bos indicus and buffalo (Bubalus bubalis using next generation sequencing technology

    Directory of Open Access Journals (Sweden)

    Shreya M. Patel

    2015-02-01

    Full Text Available Activation of innate immunity initiates various cascades of reactions that largely contribute to defense against physical, microbial or chemical damage, prompt for damage repair and removal of causative organisms as well as restoration of tissue homeostasis. Genetic polymorphism in innate immune genes plays prominent role in disease resistance capabilities in various breeds of cattle and buffalo. Here we studied single nucleotide variations (SNP/SNV and haplotype structure in innate immune genes viz CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1, BNBD4, BNBD5, TAP and LAP in Gir cattle and Murrah buffalo. Targeted sequencing of exonic regions of these genes was performed by Ion Torrent PGM sequencing platform. The sequence reads obtained corresponding to coding regions of these genes were mapped to reference genome of cattle BosTau7 by BWA program using genome analysis tool kit (GATK. Further variant analysis by Unified Genotyper revealed 54 and 224 SNPs in Gir and Murrah respectively and also 32 SNVs was identified. Among these SNPs 43, 36, 11,32,81,21 and 22 variations were in CHGA, CHGB, CHGC, NRAMP1, NRAMP2, DEFB1 and TAP genes respectively. Among these identified 278 SNPs, 24 were found to be reported in the dbSNP database. Variant analysis was followed by structure formation of haplotypes based on multiple SNPs using SAS software revealed a large number of haplotypes. The SNP discovery in innate immune genes in cattle and buffalo breeds of India would advance our understanding of role of these genes in determining the disease resistance/susceptibility in Indian breeds. The identified SNPs and haplotype data would also provide a wealth of sequence information for conservation studies, selective breeding and designing future strategies for identifying disease associations involving samples from distinct populations.

  5. Comparison of 37 months global net radiation flux derived from PICARD-BOS over the same period observations of CERES and ARGO

    Science.gov (United States)

    Zhu, Ping; Wild, Martin

    2016-04-01

    The absolute level of the global net radiation flux (NRF) is fixed at the level of [0.5-1.0] Wm-2 based on the ocean heat content measurements [1]. The space derived global NRF is at the same order of magnitude than the ocean [2]. Considering the atmosphere has a negligible effects on the global NRF determination, the surface global NRF is consistent with the values determined from space [3]. Instead of studying the absolute level of the global NRF, we focus on the interannual variation of global net radiation flux, which were derived from the PICARD-BOS experiment and its comparison with values over the same period but obtained from the NASA-CERES system and inferred from the ocean heat content survey by ARGO network. [1] Allan, Richard P., Chunlei Liu, Norman G. Loeb, Matthew D. Palmer, Malcolm Roberts, Doug Smith, and Pier-Luigi Vidale (2014), Changes in global net radiative imbalance 1985-2012, Geophysical Research Letters, 41 (no.15), 5588-5597. [2] Loeb, Norman G., John M. Lyman, Gregory C. Johnson, Richard P. Allan, David R. Doelling, Takmeng Wong, Brian J. Soden, and Graeme L. Stephens (2012), Observed changes in top-of-the-atmosphere radiation and upper-ocean heating consistent within uncertainty, Nature Geoscience, 5 (no.2), 110-113. [3] Wild, Martin, Doris Folini, Maria Z. Hakuba, Christoph Schar, Sonia I. Seneviratne, Seiji Kato, David Rutan, Christof Ammann, Eric F. Wood, and Gert Konig-Langlo (2015), the energy balance over land and oceans: an assessment based on direct observations and CMIP5 climate models, Climate Dynamics, 44 (no.11-12), 3393-3429.

  6. Variations in the Regulatory Region of Alpha S1-Casein Milk Protein Gene among Tropically Adapted Indian Native (Bos Indicus) Cattle

    Science.gov (United States)

    Kishore, Amit; Mukesh, Manishi; Sobti, Ranbir C.; Mishra, Bishnu P.; Sodhi, Monika

    2013-01-01

    Regulatory region of milk protein alpha S1-casein (αS1-CN) gene was sequenced, characterized, and analyzed to detect variations among 13 Indian cattle (Bos indicus) breeds. Comparative analysis of 1,587 bp region comprising promoter (1,418 bp), exon-I (53 bp), and partial intron-I (116 bp) revealed 35 nucleotide substitutions (32 within promoter region, 1 in exon-I, and 2 in partial intron-I region) and 4 Indels. Within promoter, 15 variations at positions −1399 (A > G), −1288 (G > A), −1259 (T > C), −1158 (T > C), −1016 (A > T), −941 (T > G), −778 (C > T), −610 (G > A), −536 (A > G), −521 (A > G), −330 (A > C), −214 (A > G), −205 (A > T), −206 (C > A), and −175 (A > G) were located within the potential transcription factor binding sites (TFBSs), namely, NF-κE1/c-Myc, GATA-1, GATA-1/NF-E, Oct-1/POU3F2, MEF-2/YY1, GATA-1, AP-1, POU1F1a/GR, TMF, GAL4, YY1/Oct-1, HNF-1, GRalpha/AR, GRalpha/AR, and AP-1, respectively. Seventy-four percent (26/35) of the observed SNPs were novel to Indian cattle and 11 of these novel SNPs were located within one or more TFBSs. Collectively, these might influence the binding affinity towards their respective nuclear TFs thus modulating the level of transcripts in milk and affecting overall protein composition. The study provides information on several distinct variations across indicine and taurine αS1-CN regulatory domains. PMID:25937984

  7. Chemical and sensory meat characteristics of Nellore cattle (Bos indicus finished with different levels of backfat thickness in the longissimus thoracis muscle

    Directory of Open Access Journals (Sweden)

    Jéssica Moraes Malheiros

    2016-01-01

    Full Text Available The objective of this study was to evaluate the effect of backfat thickness (BFT on the meat quality of feedlot-finished Nellore bulls (Bos indicus. Seventy-two animals were feedlot finished for about 100 days. For this study, 24 animals were sampled according to BFT in the longissimus thoracis muscle after slaughter: 12 animals with BFT up to 3.0 mm (class BFT-3 and 12 animals with BFT > 6.0 mm (class BFT-6. Chemical (myofibrillar fragmentation index, intramuscular fat content, and unsaturated and saturated fatty acids and physical (cold carcass weight, rib eye area, and marbling score characteristics of the meat were evaluated. Additionally, shear force and sensory characteristics (aroma, flavor, tenderness, chewiness, and juiciness were analyzed. Marbling score and intramuscular fat content were considered low for the two BFT classes. The mean values of the characteristics studied did not differ (P>0.05 between BFT classes, except for fatty acids, with the observation of higher unsaturated fatty acid levels in the BFT-6 class. There was no difference (P>0.05 in sensory characteristics between BFT classes. The most consistent relationship was observed between the myofibrillar fragmentation index and tenderness, measured as shear force, in animals with greater BFT (BFT-6 class compared to animals with lower BFT (BFT-3 class, suggesting possible tenderness problems in animals with a leaner carcass. The observation of a higher concentration of unsaturated fatty acids in animals with greater BFT suggests an increase in the sensory perception of meat, especially flavor.

  8. The potential for transmission of BCG from orally vaccinated white-tailed deer (Odocoileus virginianus to cattle (Bos taurus through a contaminated environment: experimental findings.

    Directory of Open Access Journals (Sweden)

    Pauline Nol

    Full Text Available White-tailed deer (Odocoileus virginianus experimentally infected with a virulent strain of Mycobacterium bovis have been shown to transmit the bacterium to other deer and cattle (Bos taurus by sharing of pen waste and feed. The risk of transmission of M. bovis bacille Calmette-Guerin (BCG vaccine from orally vaccinated white-tailed deer to other deer and cattle, however, is not well understood. In order to evaluate this risk, we orally vaccinated 14 white-tailed deer with 1×10(9 colony forming units BCG in lipid-formulated baits and housed them with nine non-vaccinated deer. Each day we exposed the same seven naïve cattle to pen space utilized by the deer to look for transmission between the two species. Before vaccination and every 60 days until the end of the study, we performed tuberculin skin testing on deer and cattle, as well as interferon-gamma testing in cattle, to detect cellular immune response to BCG exposure. At approximately 27 weeks all cattle and deer were euthanized and necropsied. None of the cattle converted on either caudal fold, comparative cervical tests, or interferon-gamma assay. None of the cattle were culture positive for BCG. Although there was immunological evidence that BCG transmission occurred from deer to deer, we were unable to detect immunological or microbiological evidence of transmission to cattle. This study suggests that the risk is likely to be low that BCG-vaccinated white-tailed deer would cause domestic cattle to react to the tuberculin skin test or interferon-gamma test through exposure to a BCG-contaminated environment.

  9. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East.

    Directory of Open Access Journals (Sweden)

    Anna Olivieri

    Full Text Available Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near East or surrounding areas. Egypt is in close geographic and cultural proximity to the Near East, in particular the Nile Delta region, and was one of the first neighboring areas to adopt the Neolithic package. Thus, a survey of mitogenome variation of autochthonous taurine breeds from the Nile Delta region might provide new insights on the early spread of cattle rearing outside the Near East.Using Illumina high-throughput sequencing we characterized the mitogenomes from two cattle breeds, Menofi (N = 17 and Domiaty (N = 14, from the Nile Delta region. Phylogenetic and Bayesian analyses were subsequently performed.Phylogenetic analyses of the 31 mitogenomes confirmed the prevalence of haplogroup T1, similar to most African cattle breeds, but showed also high frequencies for haplogroups T2, T3 and Q1, and an extremely high haplotype diversity, while Bayesian skyline plots pointed to a main episode of population growth ~12.5 ky ago. Comparisons of Nile Delta mitogenomes with those from other geographic areas revealed that (i most Egyptian mtDNAs are probably direct local derivatives from the founder domestic herds which first arrived from the Near East and the extent of gene flow from and towards the Nile Delta region was limited after the initial founding event(s; (ii haplogroup Q1 was among these founders, thus proving that it underwent domestication in the Near East together with the founders of the T clades.

  10. Functional and structural comparison of pyrrolnitrin- and iprodione-induced modifications in the class III histidine-kinase Bos1 of Botrytis cinerea.

    Directory of Open Access Journals (Sweden)

    Sabine Fillinger

    Full Text Available Dicarboximides and phenylpyrroles are commonly used fungicides against plant pathogenic ascomycetes. Although their effect on fungal osmosensing systems has been shown in many studies, their modes-of-action still remain unclear. Laboratory- or field-mutants of fungi resistant to either or both fungicide categories generally harbour point mutations in the sensor histidine kinase of the osmotic signal transduction cascade.In the present study we compared the mechanisms of resistance to the dicarboximide iprodione and to pyrrolnitrin, a structural analogue of phenylpyrrole fungicides, in Botrytis cinerea. Pyrrolnitrin-induced mutants and iprodione-induced mutants of B. cinerea were produced in vitro. For the pyrrolnitrin-induced mutants, a high level of resistance to pyrrolnitrin was associated with a high level of resistance to iprodione. For the iprodione-induced mutants, the high level of resistance to iprodione generated variable levels of resistance to pyrrolnitrin and phenylpyrroles. All selected mutants showed hypersensitivity to high osmolarity and regardless of their resistance levels to phenylpyrroles, they showed strongly reduced fitness parameters (sporulation, mycelial growth, aggressiveness on plants compared to the parental phenotypes. Most of the mutants presented modifications in the osmosensing class III histidine kinase affecting the HAMP domains. Site directed mutagenesis of the bos1 gene was applied to validate eight of the identified mutations. Structure modelling of the HAMP domains revealed that the replacements of hydrophobic residues within the HAMP domains generally affected their helical structure, probably abolishing signal transduction. Comparing mutant phenotypes to the HAMP structures, our study suggests that mutations perturbing helical structures of HAMP2-4 abolish signal-transduction leading to loss-of-function phenotype. The mutation of residues E529, M427, and T581, without consequences on HAMP structure

  11. An interpretive review of selective sweep studies in Bos taurus cattle populations: identification of unique and shared selection signals across breeds.

    Directory of Open Access Journals (Sweden)

    Beatriz eGutiérrez-Gil

    2015-05-01

    Full Text Available This review compiles the results of 21 genomic studies of European Bos taurus breeds and thus provides a general picture of the selection signatures in taurine cattle identified by genome-wide selection-mapping scans. By performing a comprehensive summary of the results reported in the literature, we compiled a list of 1,049 selection sweeps described across 37 cattle breeds (17 beef breeds, 14 dairy breeds and 6 dual-purpose breeds, and four different beef-vs-dairy comparisons, which we subsequently grouped into core selective sweep (CSS regions, defined as consecutive signals within 1 Mb of each other. We defined a total of 409 CSSs across the 29 bovine autosomes, 232 (57% of which were associated with a single-breed (Single-breed CSSs, 134 CSSs (33% were associated with a limited number of breeds (Two-to-four-breed CSSs and 39 CSSs (9% were associated with five or more breeds (Multi-breed CSSs. For each CSS, we performed a candidate gene survey that identified 291 genes within the CSS intervals (from the total list of 5,183 BioMart-extracted genes linked to dairy and meat production, stature and coat colour traits. A complementary functional enrichment analysis of the CSS positional candidates highlighted other genes related to pathways underlying behaviour, immune response and reproductive traits. The Single-breed CSSs revealed an over-representation of genes related to dairy and beef production, this was further supported by over-representation of production-related pathway terms in these regions based on a functional enrichment analysis. Overall, this review provides a comparative map of the selection sweeps reported in European cattle breeds and presents for the first time a characterization of the selection sweeps that are found in individual breeds. Based on their uniqueness, these breed-specific signals could be considered as divergence signals, which may be useful in characterising and protecting livestock genetic diversity.

  12. 杂交牛(大额牛×云南黄牛)朊蛋白基因的分子克隆及其序列分析%Molecular Cloning and Sequences Characteristics Analysis of the Prion Protein Gene from the Hybrids between Gayal (Bos frontalis)and Yunnan Yellow Cattle (Bos taurus)

    Institute of Scientific and Technical Information of China (English)

    刘情; 席冬梅; 陈学礼; 李继中; 杨舒黎; 邓卫东

    2012-01-01

    朊蛋白(prion protein,PRNP)基因编码朊蛋白,是引起疯牛病的主效基因.本研究利用PCR方法首次从杂交牛(大额牛×云南黄牛)基因组中扩增了PRNP基因,GenBank登录号为HQ875337.PCR产物直接双向测序表明,该序列包含杂交牛PRNP基因795 bp的开放阅读框(ORF),编码264个氨基酸前体蛋白.生物信息学分析结果发现,该蛋白包含1个信号肽、3个α螺旋、2个β折叠、6个八肽重复序列、1个疏水区域、1个二硫键和1个糖基磷脂酰肌醇锚定位点.与已报道的其他牛PRNP基因进行序列比对分析,核苷酸和氨基酸的同源性均在97%以上.%The priori protein was encoded by the prion protein (PRNP) gene which was the major gene for affecting mad cow disease or BSE. In the present study, the PCR method was used to amplify the PRNP gene from the hybrids between Gay-al (Bos frontalis) and Yunnan Yellow cattle (Bos taurus). The sequence was deposited in the GenBank under accession number HQ875337. The PCR products were sequenced bi-directly. By sequence analysis,the length of open read frame (ORF) of the PRNP gene was 795 bp, which encodes a protein of 264 amino acids,including a signal region,a octapeptide repeat,three α-heli-ces.two β-sheets,a hydrophobic region,a disulfide bridge, a glycosyl phosphatidyl inositol (GPI) anchor site. The homology of both nucleotide and amino acid sequences with other cattle was more than 97%. All this will provide the molecular basal data for breakthrough of transmissible spongiform encephalopathy among different animal species.

  13. Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Sergio do Nascimento Kronka

    2008-08-01

    Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

  14. AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus), INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893) DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

    OpenAIRE

    Maria Aparecida Schenki; Cláudio Roberto Madruga; Aguemi Kohayagawa; Carla Lopes de Mendonça; Dirson Vieira; Raul Kessler

    2006-01-01

    Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus) inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, ...

  15. Severe diarrhea outbreak in beef calves (Bos indicus caused by G6P[11], an emergent genotype of bovine rotavirus group A

    Directory of Open Access Journals (Sweden)

    Thais N.S. Medeiros

    2014-08-01

    Full Text Available The episodes of diarrhea caused by neonatal bovine rotavirus group A (BoRVA constitute one of the major health problems in the calf rearing worldwide. The main G (VP7 and P (VP4 genotypes of BoRVA strains involved in the etiology of diarrhea in calves are G6P[1], G10P[11], G6P[5], and G8P[1]. However, less frequently, other G and P genotypes have been described in BoRVA strains identified in diarrheic fecal samples of calves. This study describes the identification and molecular characterization of an emerging genotype (G6P[11] in BoRVA strains involved in the etiology of a diarrhea outbreak in beef calves in a cattle herd of high production in extensive management system. The diarrhea outbreak, which showed high morbidity (60% and lethality (7% rates, occurred in calves (n= 384 Nelore (Bos indicus up to 30-day-old from the State of Mato Grosso do Sul, Brazil. BoRVA was identified in 80% (16/20 of the fecal samples analyzed by polyacrylamide gel electrophoresis (PAGE technique. In all PAGE-positive fecal samples were amplified products with 1,062-bp and 876-bp in the RT-PCR assays for VP7 (G type and VP4 (VP8* (P type of BoRVA, respectively. The nucleotide sequence analysis of VP7 and VP4 genes of four wild-type BoRVA strains showed G6-III P[11]-III genotype/lineage. The G6P[11] genotype has been described in RVA strains of human and animal hosts, however, in calves this genotype was only identified in some cross-sectional studies and not as a single cause of diarrhea outbreaks in calves with high morbidity and lethality rates as described in this study. The monitoring of the G and P genotypes of BoRVA strains involved in diarrhea outbreaks in calves is important for both animal and public health by allowing the identification of the most frequent genotypes, the characterization of novel genotypes and to identify reassortments with genotypes described in animal and human hosts. The results of this study show the importance of the monitoring of

  16. Identification of a two-marker-haplotype on Bos taurus autosome 18 associated with somatic cell score in German Holstein cattle

    Directory of Open Access Journals (Sweden)

    Reinsch Norbert

    2009-09-01

    Full Text Available Abstract Background The somatic cell score (SCS is implemented in routine sire evaluations in many countries as an indicator trait for udder health. Somatic cell score is highly correlated with clinical mastitis, and in the German Holstein population quantitative trait loci (QTL for SCS have been repeatedly mapped on Bos taurus autosome 18 (BTA18. In the present study, we report a refined analysis of previously detected QTL regions on BTA18 with the aim of identifying marker and marker haplotypes in linkage disequilibrium with SCS. A combined linkage and linkage disequilibrium approach was implemented, and association analyses of marker genotypes and maternally inherited two-marker-haplotypes were conducted to identify marker and haplotypes in linkage disequilibrium with a locus affecting SCS in the German Holstein population. Results We detected a genome-wide significant QTL within marker interval 9 (HAMP_c.366+109G>A - BMS833 in the middle to telomeric region on BTA18 and a second putative QTL in marker interval 12-13 (BB710 - PVRL2_c.392G>A. Association analyses with genotypes of markers flanking the most likely QTL positions revealed the microsatellite marker BMS833 (interval 9 to be associated with a locus affecting SCS within the families investigated. A further analysis of maternally inherited two-marker haplotypes and effects of maternally inherited two-marker-interval gametes indicated haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A to be associated with SCS in the German Holstein population. Conclusion Our results confirmed previous QTL mapping results for SCS and support the hypothesis that more than one locus presumably affects udder health in the middle to telomeric region of BTA18. However, a subsequent investigation of the reported QTL regions is necessary to verify the two-QTL hypothesis and confirm the association of two-marker-haplotype 249-G in marker interval 12-13 (BB710 - PVRL2_c.392G>A with SCS. For this

  17. Comparative expression profiling of insulin-like growth factor binding protein-5 in milk of Bos indicus and Bubalus bubalis during lactation.

    Science.gov (United States)

    Mohapatra, S K; Singh, S; Kumar, S; Dang, A K; Datta, T K; Das, S K; Mohanty, T K; Kaushik, J K; Mohanty, A K

    2015-04-01

    Insulin-like growth factor binding protein-5 (IGFBP-5) is a key molecule in mammary gland development, which facilitates the removal of mammary epithelial cells (MECs) by apoptosis that takes place during remodeling of the mammary gland during involution. IGFBP-5 binds with IGFs for their bioavailability. IGFBP-5 has been reported to perform pleiotropic roles such as cellular apoptosis, proliferation and differentiation. To understand the role of IGFBP-5 during lactation and clinical mastitis, expression profiling of IGFBP-5 at the protein level was performed in both indigenous cows (Bos indicus) and buffaloes (Bubalus bubalis) belonging to two different breeds - Sahiwal cows and Murrah buffaloes. Reverse-transcriptase PCR (RT-PCR) of IGFBP-5 mRNA confirmed its expression in milk somatic cells and MECs of Sahiwal cows. ELISA was performed for quantitative measurement of IGFBP-5 concentrations in milk during different days (0, 50, 100, 150, 200, 250 and 300) of lactation, during the involution period and in animals exhibiting short lactation and clinical mastitis. The highest concentration of IGFBP-5 in milk was observed during the involution period followed by colostrum, late and early lactation, respectively, in both cattle and buffaloes. No significant difference in the concentration of IGFBP-5 was observed during the first 150 days of lactation between cows and buffaloes. However, higher concentration of IGFBP-5 was observed in cows during late lactation (200 to 300 days) in comparison with buffaloes. To validate the ELISA data, quantitative real-time PCR was performed in MECs of Sahiwal cows. The relative mRNA abundance of IGFBP-5 was found to be significantly (Pcows. Highest mRNA expression of IGFBP-5 was observed around 300 days of lactation followed by 200 and 250 days (Pmilk as compared with Sahiwal cows during lactation in ELISA. Animals having history of short lactation length (short lactating animals) showed higher levels of IGFBP-5 expression (at

  18. Comparison of the pregnancy rates and costs per calf born after fixed-time artificial insemination or artificial insemination after estrus detection in Bos indicus heifers.

    Science.gov (United States)

    Edwards, S A A; Bo, G A; Chandra, K A; Atkinson, P C; McGowan, M R

    2015-01-01

    This study compared pregnancy rates (PRs) and costs per calf born after fixed-time artificial insemination (FTAI) or AI after estrus detection (i.e., estrus detection and AI, EDAI), before and after a single PGF2α treatment in Bos indicus (Brahman-cross) heifers. On Day 0, the body weight, body condition score, and presence of a CL (46% of heifers) were determined. The heifers were then alternately allocated to one of two FTAI groups (FTAI-1, n = 139) and (FTAI-2, n = 141) and an EDAI group (n = 273). Heifers in the FTAI groups received an intravaginal progesterone-releasing device (IPRD; 0.78 g of progesterone) and 1 mg of estradiol benzoate intramuscularly (im) on Day 0. Eight days later, the IPRD was removed and heifers received 500 μg of PGF2α and 300 IU of eCG im; 24 hours later, they received 1 mg estradiol benzoate im and were submitted to FTAI 30 to 34 hours later (54 and 58 hours after IPRD removal). Heifers in the FTAI-2 group started treatment 8 days after those in the FTAI-1 group. Heifers in the EDAI group were inseminated approximately 12 hours after the detection of estrus between Days 4 and 9 at which time the heifers that had not been detected in estrus received 500 μg of PGF2α im and EDAI continued until Day 13. Heifers in the FTAI groups had a higher overall PR (proportion pregnant as per the entire group) than the EDAI group (34.6% vs. 23.2%; P = 0.003), however, conception rate (PR of heifers submitted for AI) tended to favor the estrus detection group (34.6% vs. 44.1%; P = 0.059). The cost per AI calf born was estimated to be $267.67 and $291.37 for the FTAI and EDAI groups, respectively. It was concluded that in Brahman heifers typical of those annually mated in northern Australia FTAI compared with EDAI increases the number of heifers pregnant and reduces the cost per calf born. PMID:25284281

  19. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Directory of Open Access Journals (Sweden)

    Daniela Bebbere

    Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

  20. How to Implement Blue Ocean Strategy (BOS in B2B Sector Kaip įgyvendinti žydrųjų vandenynų strategiją (ŽVS sektoriuje „verslas – verslui“

    Directory of Open Access Journals (Sweden)

    Andrejs Čirjevskis

    2011-11-01

    Full Text Available The aim of research is to confirm the hypothesis that BOS is viable in the B2B sectors. The objects of research are two business entities: world’s lead­ing suppliers of construction chemicals and manufacturer of purification equip­ment. Authors posed first research question is BOS a suitable within construction chemicals and purification equipment manufacturers’ industries? Second research question was about how to evaluate acceptability of new strategic choice on BOS? Third research question was how to diagnosis organisational hurdles on BOS implementation? Research has confirmed the hypothesis and suggested application of innovation value chain to diagnosing company’s ability to implement value in­novation.

    Tyrimo tikslas patvirtina hipotezę, kad ŽVS yra gyvybinga B2B sektoriuose. Tyrimo objektai yra du verslo subjektai: pasaulyje pirmaujantys statybos chemikalų tiekėjai ir valymo įrenginių gamintojai. Autorių keliamas pirmasis mokslinių tyrimų klausimas – ar ŽVS yra tinkama statybos chemikalų ir valymo įrenginių gamintojų pramonei? Antrasis mokslinių tyrimų klausimas – apie tai, kaip įvertinti naujo strateginio pasirinkimo

  1. ONTOGENY OF CAMBRIAN TRILOBITE CHEIRUROIDES PRIMIGENIUS%皖南寒武纪三叶虫Cheiruroides primigenius 的个体发育

    Institute of Scientific and Technical Information of China (English)

    朱学剑; 彭善池

    2004-01-01

    描述采自皖南东至庞汪剖面黄柏岭组黄绿色页岩中的处于不同发育阶段的Cheiruroides primigenius标本的形态特征和各器官在个体发育过程中的变化趋势.在个体发育过程中,该种最显著的变化是头鞍沟形态的改变和面线后支的逐渐后伸.

  2. INFLUÊNCIA DO GENÓTIPO BOS INDICUS NA ATIVIDADE DE CALPASTATINA E NA TEXTURA DA CARNE DE NOVILHOS ABATIDOS NO SUL DO BRASIL EFFECTS OF THE BOS INDICUS GENOTYPE ON CALPASTATIN ACTIVITIY AND TEXTURE OF BEEF FROM STEERS SLAUGHTERED IN THE SOUTH OF BRAZIL

    Directory of Open Access Journals (Sweden)

    Jane M. RUBENSAM

    1998-10-01

    Full Text Available Amostras de contrafilé (músculo L. dorsi provenientes de 26 bovinos, sendo 14 Polled Hereford (HH, sete 3/4Hereford 1/4Nelore (3/4H1/4N e cinco 5/8Hereford 3/8Nelore (5/8H3/8N, machos castrados, abatidos aos dois anos de idade, foram coletadas 24 h após o abate e analisadas quanto à atividade de calpastatina e textura, tanto no 1o dia post mortem quanto após um período de maturação de 10 dias a 2o C. A atividade de calpastatina foi determinada pelo ensaio de inibição da m-calpaína e a textura através da força de cisalhamento (Warner-Bratzler. A carne de novilhos 5/8H3/8N apresentou, no 1o dia, maiores (p0,05 entre os grupos HH e 3/4H1/4N para as mesmas características. Após 10 dias, houve uma diferença na atividade de calpastatina, porém não significativa (p>0,05, entre o grupo 5/8H3/8N (1,57U/g e os demais (HH=1,23U/g; 3/4H1/4N=1,35U/g, e diferença significativa entre os grupos HH e 5/8H3/8N para força de cisalhamento (3,67 e 5,00kg, respectivamente. Conclui-se que a atividade de calpastatina determinada 24 h post mortem pode ser útil para a previsão da textura da carne, maturada ou não, em programas de melhoramento genético, e que a participação crescente do genótipo Bos indicus nos rebanhos da Região Sul, a par das conhecidas vantagens zootécnicas, poderá resultar em carne de pior textura.Boneless rib steaks (L. dorsi muscle from 26 two years old steers, 14 Polled Hereford, seven 3/4Hereford 1/4Nelore (3/4H1/4N and five 5/8Hereford 3/8Nelore (5/8H3/8N, were collected 24 hs after slaughter and analysed for calpastatin activity and texture at the 1st day post mortem and at the 10th day of aging at 2o C. Calpastatin activity was determined by m-calpain inhibition assay and texture by shear force (Warner-Bratzler. Beef from 5/8H3/8N steers showed higher (p0.05 were detected in the same traits between groups HH and 3/4H1/4N. After 10 days of aging, there was a difference in calpastatin activity, although non

  3. Polymorphism of Adipocyte Fatty Acid-binding Protein Gene(A-FABP) in Yak (Bos grunniens)%牦牛脂肪型脂肪酸结合蛋白基因(A-FABP)多态性分析

    Institute of Scientific and Technical Information of China (English)

    曹健; 罗玉柱; 胡江; 成述儒; 杨果; 刘秀

    2012-01-01

    脂肪型脂肪酸结合蛋白(A-FABP)属脂肪酸结合蛋白家族(FABPs)成员,参与调节哺乳动物细胞内脂肪浓度,进而影响肌肉内脂肪含量(IMF),因此A-FABP可作为影响IMF的候选基因.本研究采用PCR-SSCP技术检测甘南牦牛、青海牦牛、天祝白牦牛(Bos grunniens)A-FABP基因部分第3内含子、第4外显子及部分3'-UTR区单核苷酸多态性( SNPs),分析检测区域分子遗传特征.结果表明,3类群牦牛引物扩增区域发现5种等位基因A-E;同普通牛A-FABP基因序列比对发现6处SNPs,其中第4外显子区存在c.4222A>G的同义突变;3'-UTR区c.* 94T>A只存在于牦牛群体,是其区别于普通牛的遗传特征之一.各等位基因在群体间分布差异较大,其中天祝白牦牛只发现3种等位基因,而青海牦牛发现4种等位基因,这可能与牦牛类群的地域分布及选育程度有关.3类群牦牛A-FABP基因检测位点表现为中度多态(PIC为0.29 ~0.36),有效等位基因数较高,可作为潜在的牦牛肉质性状分子标记位点.%Adipocyte fatty acid-binding protein( A-FABP) ,as a member of the fatty acid binding protein(FAB-Ps) family,play a pivotal role in regulating intracellular fat concentration and then affect intramuscular fat(IMF) in mammalian. So A-FABP was suggested as a candidate gene of IMF in some species of livestock and poultry. In this study, single nucleotide polymorphisms (SNPs) was investigated at A-FABP intron 3,exon4 and 3'-UTR in Gannan yak,Qinghai yak and Tianzhu white yak (Bos grunniens) by polymerase chain reaction-single strand conformational polymorphism (PCR-SSCP) so as to analyse their molecular genetic characteristics. Five novel SSCP patterns,representing five different alleles A-E were identified in three yak populations. With alignment of the bovine (Bos tauras) and yak A-FABP allelic sequences, six SNPs including a synonymous mutation ( c. 4222A > G) at exon 4 were checked in yak. SNP c. * 94T > A in 3'-UTR of A

  4. Response to GnRH on day 6 of the estrous cycle is diminished as the percentage of Bos indicus breeding increases in Angus, Brangus, and Brahman x Angus heifers.

    Science.gov (United States)

    Portillo, Germán E; Bridges, G Allen; de Araujo, Jennifer W; Shaw, Mary-Karen V; Schrick, F Neal; Thatcher, William W; Yelich, Joel V

    2008-01-15

    Angus (n=6), Brangus (5/8 Angus x 3/8 Brahman, n=6), and Brahman x Angus (3/8 Angus x 5/8 Brahman, n=6) heifers exhibiting estrous cycles at regular intervals were used to determine if the percentage of Bos indicus breeding influenced the secretory patterns of LH in response to a GnRH treatment on Day 6 of the estrous cycle. Heifers were pre-synchronized with a two-injection PGF(2 alpha) protocol (25 mg i.m. Day -14 and 12.5 mg i.m. Day -3 and -2 of experiment). Heifers received 100 microg GnRH i.m. on Day 6 of the subsequent estrous cycle. Blood samples were collected at -60, -30, and -1 min before GnRH and 15, 30, 60, 90, 120, 150, 180, 240, 300, 360, 420, and 480 min after GnRH to determine concentrations of serum LH. Estradiol concentrations were determined at -60, -30, and -1 min before GnRH. On Day 6 and 8, ovaries were examined by ultrasonography to determine if ovulation occurred. On Day 13, heifers received 25 mg PGF(2 alpha) i.m. and blood samples were collected daily until either the expression of estrus or Day 20 for heifers not exhibiting estrus to determine progesterone concentrations. There was no effect (P>0.10) of breed on ovulation rate to GnRH as well as size of the largest follicle, mean estradiol, and mean corpus luteum volume at GnRH. Mean LH was greater (PBrangus (4.6+/-0.8 ng/mL) and Brahman x Angus (2.9+/-0.8 ng/mL), which were similar (P>0.10). Mean LH peak-height was similar (P>0.10) for Brangus (13.9+/-3.4 ng/mL) compared to Angus (21.9+/-3.4 ng/mL) and Brahman x Angus (8.0+/-3.4 ng/mL), but was greater (P0.10) between breeds. As the percentage of Bos indicus breeding increased the amount of LH released in response to GnRH on Day 6 of the estrous cycle decreased. PMID:17212980

  5. Perfil de ácidos grasos en leche de vacas Chinampas (Bos taurus alimentadas con forraje fresco de matorral sarcocaulescente o heno de alfalfa Fatty acids profile in milk of Chinampo cows (Bos taurus fed fresh forage from sarcocaulescent shrubs or alfalfa hay

    Directory of Open Access Journals (Sweden)

    R Ortega-Pérez

    2013-01-01

    Full Text Available El objetivo del estudio fue determinar la concentración de ácidos grasos (AG en la leche de vacas Chinampas, con énfasis en los ácidos grasos conjugados (CLA. Se colectó una muestra manual de leche (10 ml de 32 vacas entre los 60 y 120 días de lactación. Un grupo (FV; n = 25 se alimentó en pastoreo con forraje verde durante la estación de lluvias de septiembre a octubre de 2009 en una zona semiárida de matorral sarcocaulescente (Municipio La Paz, B.C.S.. Otro grupo (HA; n = 7 se mantuvo en corral y se alimentó con heno de alfalfa. El análisis cromatográfico revela que la concentración de AG saturados fue menor (P The objective of the present study was to determine the concentration of fatty acids (FA in the milk of Chinampo cows (Bos taurus, with emphasis on conjugated fatty acids (CLA. A sample of 10 ml was collected from 32 cows that had been lactating at least 60 days, but not longer than 120 days. A group (FV, n = 25 was free-ranged grazed on green fresh pasture (sarcocaulescent shrub semiarid area, La Paz, B.C.S. during the wet season (September-October 2009. The second group (HA, n = 7 was penned and fed fodder of alfalfa hay. The FA analysis revealed that there were less saturated FA in the FV group (P < 0.05. This difference was basically explained by the lesser content of 14:0, 15:0, and 16:0. The concentration of total monounsaturated FA was higher in FV (P < 0.05, given by the higher concentration of 18:1 n-9 and 18:1 n-7 trans-11. The total concentration of polyunsaturated FA was similar for both groups, but there was a higher concentration of 18:2 n-6 and 18:2 n-7 cis-9 trans-11 in the FV group (P < 0.01. The proportion of omega-3 FA was similar for both groups, but the concentration of omega-6 FA was higher in FV (P < 0.01, resulting in an increased omega-6:omega-3 ratios in the FV group compared to HA. It is concluded that Chinampo cows left to free-range on fresh green pasture reduced the total saturated FA of

  6. Definition of the cattle killer cell Ig-like receptor gene family: Comparison with aurochs and human counterparts

    OpenAIRE

    Sanderson, Nicholas D; Norman, Paul J.; Guethlein, Lisbeth A; Ellis, Shirley A; Williams, Christina; Breen, Matthew; Park, Steven D E; Magee, David A; Babrzadeh, Farbod; Warry, Andrew; Watson, Mick; Bradley, Daniel G.; MacHugh, David E; Parham, Peter; Hammond, John A

    2014-01-01

    Under selection pressure from pathogens, variable NK cell receptors that recognize polymorphic MHC class I evolved convergently in different species of placental mammal. Unexpectedly, diversified killer cell Ig-like receptors (KIRs) are shared by simian primates, including humans, and cattle, but not by other species. Whereas much is known of human KIR genetics and genomics, knowledge of cattle KIR is limited to nine cDNA sequences. To facilitate comparison of the cattle and human KIR gene fa...

  7. First finding of a mammoth female ( Mammuthus primigenius Blum.) on the Taimyr Peninsula

    Science.gov (United States)

    Kirillova, I. V.; Shidlovskiy, F. K.; Khasanov, B. F.

    2011-02-01

    The first finding of a mammoth female skeleton from the Kastykhtakh River valley, Taimyr Peninsula, is described. The skeleton consists of 104 elements including the skull and lower jaw; small distal limb bones, tail vertebrae, and one tusk are absent. There are teeth of the two last changes in the jaws. The skeleton elements have individual features: sigmoid contact of the low second and third molars, crack in the neural arch of the atlas, and false joint and calluses on places of the rib fractures. The calibrated radiocarbon dating of the tubular bone is 32 070-30 565 yr (Kargin interglacial time).

  8. Population-level genotyping of coat colour polymorphism in woolly mammoth ( Mammuthus primigenius )

    Science.gov (United States)

    Workman, Claire; Dalen, Love; Vartanyan, Sergey; Shapiro, Beth; Kosintsev, Pavel; Sher, Andrei; Gotherstrom, Anders; Barnes, Ian

    2011-08-01

    Patterns in the spatial or temporal distribution of genotypes may be indicative of natural selection. Previous work on the woolly mammoth melanocortin-1 receptor ( Mc1r) gene identified three polymorphic positions that suggest Pleistocene populations may have harboured both light- and dark-haired mammoths ( Rompler et al., 2006, 313: 62). Here, we extend this work and present the first population-level analysis of a functional gene in an extinct species. We genotyped the Mc1r gene in 47 woolly mammoth samples excavated from sites across the central portion of the woolly mammoths' former range to examine the extent of variation of this polymorphism through time and across space. Only one individual was found to be heterozygous, indicating that the frequency of the 'light' mutant allele was very low. We conclude that light-coloured woolly mammoths would have been very rare, and may even have been non-existent if the 'light' mutant allele was strongly selected against in its homozygotic form. With the increasing availability of large-scale sequencing technologies, population-level datasets capable of identifying local adaptation will become increasingly attainable.

  9. Anatomy, death, and preservation of a woolly mammoth (Mammuthus primigenius) calf, Yamal Peninsula, northwest Siberia

    NARCIS (Netherlands)

    Fisher, Daniel C.; Tikhonov, Alexei N.; Kosintsev, Pavel A.; Rountrey, Adam N.; Buigues, Bernard; van der Plicht, Johannes

    2012-01-01

    A well-preserved woolly mammoth calf found in northwest Siberia offers unique opportunities to investigate mammoth anatomy, behavior, life history and taphonomy. Analysis of the fluvial setting where the specimen was found suggests it was derived from eroding bluffs during ice-out flooding in June 2

  10. 野牛的种群现状、生态习性及致危因素∗%Population status,ecological habit and threatened factors of wild gaurs (Bos gaurus):a review

    Institute of Scientific and Technical Information of China (English)

    尹峰; 马凯; 刘定震

    2015-01-01

    野牛(Bos gaurus)主要分布于中国、印度、孟加拉、尼泊尔、不丹、越南、老挝、柬埔寨、泰国、缅甸和马来西亚。据评估,其全球种群数量约13000~30000头。在我国主要分布于云南省,1996—2000年的调查显示共有约480头,种群下降趋势严重,灭绝风险较大。栖息地丧失和破碎化、盗猎和非法贸易、种群衰退和杂交污染以及疾病和传染病是其主要威胁。建议加强野牛的生态学研究,加大栖息地保护力度,打击非法贸易并加强管理和监控,促进野牛种群的恢复。%The wild gaur (Bos gaurus)is a rare and most endangered species in China.This species is also listed in the IUCN Red Data Book as vulnerable and in Appendix I by CITES.Now wild gaurs are restricted to tiny,fragmented populations in areas of Southern and Southeastern Asia including China,India,Bangladesh, Nepal,Bhutan,Vietnam,Laos,Cambodia,Thailand,Myanmar and Malaysia.The global population is estimated to be 13 000 30 000 with a total of 5 200 18 000 mature individuals.A survey conducted by the Chinese government in 1996 2000 showed a total of 480 gaurs in Xishuangbanna and Puer of Yunnan Province. This paper reviews the population status and impacting environmental factors on the wild gaur by referring to both literature and field investigation in 2013. Currently, there are four major factors threatening the subsistence of wild gaurs:1 )habitat loss and fragmentation,2 )poaching and illegal trade,3 )population decline and hybridizing contamination,4)diseases including infectious diseases.Wild gaur population is declining continuously,the species is on the brink of extinction.The status of gaur population has drawn attention from scientists and governmental officers in recent years.Consequently some efforts have been made including constructing biological corridors between different habitats in which gaur habituated.However,the efficacy of those works is not easy to evaluate due to the

  11. An examination of positive selection and changing effective population size in Angus and Holstein cattle populations (Bos taurus using a high density SNP genotyping platform and the contribution of ancient polymorphism to genomic diversity in Domestic cattle

    Directory of Open Access Journals (Sweden)

    Hayes Ben

    2009-04-01

    Full Text Available Abstract Background Identifying recent positive selection signatures in domesticated animals could provide information on genome response to strong directional selection from domestication and artificial selection. With the completion of the cattle genome, private companies are now providing large numbers of polymorphic markers for probing variation in domestic cattle (Bos taurus. We analysed over 7,500 polymorphic single nucleotide polymorphisms (SNP in beef (Angus and dairy (Holstein cattle and outgroup species Bison, Yak and Banteng in an indirect test of inbreeding and positive selection in Domestic cattle. Results Outgroup species: Bison, Yak and Banteng, were genotyped with high levels of success (90% and used to determine ancestral and derived allele states in domestic cattle. Frequency spectrums of the derived alleles in Angus and Holstein were examined using Fay and Wu's H test. Significant divergences from the predicted frequency spectrums expected under neutrality were identified. This appeared to be the result of combined influences of positive selection, inbreeding and ascertainment bias for moderately frequent SNP. Approximately 10% of all polymorphisms identified as segregating in B. taurus were also segregating in Bison, Yak or Banteng; highlighting a large number of polymorphisms that are ancient in origin. Conclusion These results suggest that a large effective population size (Ne of approximately 90,000 or more existed in B. taurus since they shared a common ancestor with Bison, Yak and Banteng ~1–2 million years ago (MYA. More recently Ne decreased sharply probably associated with domestication. This may partially explain the paradox of high levels of polymorphism in Domestic cattle and the relatively small recent Ne in this species. The period of inbreeding caused Fay and Wu's H statistic to depart from its expectation under neutrality mimicking the effect of selection. However, there was also evidence for selection

  12. Efecto de la progesterona natural con o sin la adición de benzoato de estradiol sobre la presentación de celo, ovulación y gestación en animales tipo Bos indicus en el trópico mexicano Effect of natural progesterone with and without estradiol benzoate on the onset signs of oestrus, ovulation and pregnancy in Bos indicus cattle raised under mexican tropical conditions

    Directory of Open Access Journals (Sweden)

    G.S. DIAZ

    2002-01-01

    Full Text Available Se evaluó el efecto de un dispositivo intravaginal que contiene 1.9 g de progesterona y una cápsula de 10 mg de benzoato de estradiol (BE (CIDR-B®, seguido o no de la aplicación intramuscular de BE, a las 24 horas de retirado el dispositivo, y se observó el porcentaje de estro, ovulación y gestación. Se utilizaron 122 vacas (experimento 1 y 30 novillas (experimento 2 tipo Bos indicus, que fueron asignadas aleatoriamente a tres grupos:Grupo ST: 20 vacas y 10 novillas sin tratamiento; Grupo CIDR-BE: 51 vacas y 10 novillas con un dispositivo por 10 ó 13 días respectivamente; y Grupo CIDRB+ E: 51 vacas y 10 novillas con un dispositivo por 10 ó 13 días, además de una inyección a las 24 horas de 1 ó 2 mg de BE. La detección de estros se realizó mediante la observación visual, haciéndose durante 96 horas después de retirar el CIDR-B, y posteriormente entre los 17 a 24 días posteriores a cada período de servicios, hasta concluir los 90 días que duró el empadre. Las que presentaron estro entre los días 0 a 47 fueron servidas por IA y las que lo presentaron del 48 al 90 por monta natural. Se tomaron muestras sanguíneas para medir niveles de progesterona para corroborar ovulación. El diagnóstico de gestación se realizó por palpación rectal y ultrasonografía. Las variables categóricas se analizaron mediante la prueba exacta de Fisher y las continuas mediante t de Student. Las condiciones reproductivas previas de las vacas se relacionaron con celos, ovulación y gestación con un modelo lineal logarítmico del Proc CATMOD, SAS. En ambos experimentos el grupo CIDR-B+E presentó un alto porcentaje de estro, 92.2 y 90.0% para vacas y novillas, siendo diferente (pThe effect of a intravaginal device containing 1.9 g of progesterone and one capsule of 10 mg of estradiol benzoate (EB (CIDR-B was evaluated in Bos indicus cattle. Upon withdrawal, calculations regarding estrous rate, ovulation and pregnancy were considered. 122 Bos

  13. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:2005021

  14. Physiological responses of newborn Bos indicus and Bos indicus x Bos taurus calves after exposure to cold.

    Science.gov (United States)

    Godfrey, R W; Smith, S D; Guthrie, M J; Stanko, R L; Neuendorff, D A; Randel, R D

    1991-01-01

    Brahman (n = 9) and 1/2 Simmental x 1/4 Brahman x 1/4 Hereford (n = 11) calves were utilized to determine the influence of exposure to cold on the physiology of the neonate. All calves were removed from their dams within 20 min of birth and prior to suckling. Calves were assigned randomly within breed to either a warm (W; 31 degrees C) or cold (C; 4 degrees C) environmental treatment group. Jugular blood samples were collected via indwelling catheters at 20-min intervals for 180 min. At 100 to 120 min of sampling, all calves were given 1.2 liters of colostrum from their dams via stomach tube. At 120 min, C calves were placed in the W environment. Calf vigor score (CVS) and rectal temperature were determined at each time blood was collected. Serum or plasma was analyzed for glucose (GLU), lactate (LAC), blood urea nitrogen (BUN), hemoglobin (HEM), triglyceride (TRG), triiodothyronine (T3), thyroxine (T4), insulin (INS), cortisol (CORT) and nonesterified fatty acid (NEFA) concentration. Rectal temperature was lower (P less than .01) in C Brahman than in W Brahman and C or W crossbred calves. Crossbred calves had higher (P less than .01) CVS than Brahman calves. Calves in W had lower (P less than .01) GLU than C calves. Brahman calves had higher GLU, LAC, BUN, TRG, T3, T4 and CORT (P less than .05) than crossbred calves. The C Brahman calves had the highest (P less than .05) TRG, CORT, T3 and T4 of all groups. Concentration of NEFA were higher (P less than .01) in C than in W calves.(ABSTRACT TRUNCATED AT 250 WORDS)

  15. Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

    Directory of Open Access Journals (Sweden)

    Leslie Scarpelli

    2009-01-01

    Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

  16. Etniske minoriteters bosætning

    DEFF Research Database (Denmark)

    Børresen, Sølvi Karin

    Etniske minoriteter synes at samles i bestemte dele af boligbestanden og i bestemte boligområder. Hvorfor forholder det sig sådan? Forskningen viser, at forklaringerne er sammensatte. I denne rapport gøres rede for udvalgte danske og udenlandske undersøgelser vedrørende etniske minoriteters...

  17. Ovarian, hormonal, and reproductive events associated with synchronization of ovulation and timed appointment breeding of Bos indicus-influenced cattle using intravaginal progesterone, gonadotropin-releasing hormone, and prostaglandin F2alpha.

    Science.gov (United States)

    Saldarriaga, J P; Cooper, D A; Cartmill, J A; Zuluaga, J F; Stanko, R L; Williams, G L

    2007-01-01

    The objectives of this study were to 1) compare cumulative pregnancy rates in a traditional management (TM) scheme with those using a synchronization of ovulation protocol (CO-Synch + CIDR) for timed AI (TAI) in Bos indicus-influenced cattle; 2) evaluate ovarian and hormonal events associated with CO-Synch + CIDR and CO-Synch without CIDR; and 3) determine estrual and ovulatory distributions in cattle synchronized with Select-Synch + CIDR. The CO-Synch + CIDR regimen included insertion of a controlled internal drug-releasing device (CIDR) and an injection of GnRH (GnRH-1) on d 0, removal of the CIDR and injection of PGF2alpha (PGF) on d 7, and injection of GnRH (GnRH-2) and TAI 48 h later. For Exp. 1, predominantly Brahman x Hereford (F1) and Brangus females (n = 335) were stratified by BCS, parity, and day postpartum (parous females) before random assignment to CO-Synch + CIDR or TM. To maximize the number of observations related to TAI conception rate (n = 266), an additional 96 females in which TM controls were not available for comparison also received CO-Synch + CIDR. Conception rates to TAI averaged 39 +/- 3% and were not affected by location, year, parity, AI sire, or AI technician. Cumulative pregnancy rates were greater (P < 0.05) at 30 and 60 d of the breeding season in CO-Synch + CIDR (74.1 and 95.9%) compared with TM (61.8 and 89.7%). In Exp. 2, postpartum Brahman x Hereford (F1) cows (n = 100) were stratified as in Exp. 1 and divided into 4 replicates of 25. Within each replicate, approximately one-half (12 to 13) received CO-Synch + CIDR, and the other half received CO-Synch only (no CIDR). No differences were observed between treatments, and the data were pooled. Percentages of cows ovulating to GnRH-1, developing a synchronized follicular wave, exhibiting luteal regression to PGF, and ovulating to GnRH-2 were 40 +/- 5, 60 +/- 5, 93 +/- 2, and 72 +/- 4%, respectively. In Exp. 3, primiparous Brahman x Hereford, (F1) heifers (n = 32) and pluriparous

  18. Ovarian, hormonal, and reproductive events associated with synchronization of ovulation and timed appointment breeding of Bos indicus-influenced cattle using intravaginal progesterone, gonadotropin-releasing hormone, and prostaglandin F2alpha.

    Science.gov (United States)

    Saldarriaga, J P; Cooper, D A; Cartmill, J A; Zuluaga, J F; Stanko, R L; Williams, G L

    2007-01-01

    The objectives of this study were to 1) compare cumulative pregnancy rates in a traditional management (TM) scheme with those using a synchronization of ovulation protocol (CO-Synch + CIDR) for timed AI (TAI) in Bos indicus-influenced cattle; 2) evaluate ovarian and hormonal events associated with CO-Synch + CIDR and CO-Synch without CIDR; and 3) determine estrual and ovulatory distributions in cattle synchronized with Select-Synch + CIDR. The CO-Synch + CIDR regimen included insertion of a controlled internal drug-releasing device (CIDR) and an injection of GnRH (GnRH-1) on d 0, removal of the CIDR and injection of PGF2alpha (PGF) on d 7, and injection of GnRH (GnRH-2) and TAI 48 h later. For Exp. 1, predominantly Brahman x Hereford (F1) and Brangus females (n = 335) were stratified by BCS, parity, and day postpartum (parous females) before random assignment to CO-Synch + CIDR or TM. To maximize the number of observations related to TAI conception rate (n = 266), an additional 96 females in which TM controls were not available for comparison also received CO-Synch + CIDR. Conception rates to TAI averaged 39 +/- 3% and were not affected by location, year, parity, AI sire, or AI technician. Cumulative pregnancy rates were greater (P breeding season in CO-Synch + CIDR (74.1 and 95.9%) compared with TM (61.8 and 89.7%). In Exp. 2, postpartum Brahman x Hereford (F1) cows (n = 100) were stratified as in Exp. 1 and divided into 4 replicates of 25. Within each replicate, approximately one-half (12 to 13) received CO-Synch + CIDR, and the other half received CO-Synch only (no CIDR). No differences were observed between treatments, and the data were pooled. Percentages of cows ovulating to GnRH-1, developing a synchronized follicular wave, exhibiting luteal regression to PGF, and ovulating to GnRH-2 were 40 +/- 5, 60 +/- 5, 93 +/- 2, and 72 +/- 4%, respectively. In Exp. 3, primiparous Brahman x Hereford, (F1) heifers (n = 32) and pluriparous cows (n = 18) received the

  19. Mitochondrial control region genetic diversity and maternal ancestry of a Brangus-Ibage cattle populations

    Directory of Open Access Journals (Sweden)

    Luiz Ernani Henkes

    2005-03-01

    Full Text Available The genetic diversity of 277 nucleotides in the mitochondrial DNA control region (nt 15,964 to 16,240 in reference sequence was analyzed in crossbreed beef cattle (Brangus-Ibage, 5/8 Bos primigenius taurus x 3/8 Bos primigenius indicus as well as in some Nellore samples (B. p. indicus. Fifty-seven mutations were found in Brangus-Ibage comprising 18 haplotypes (haplotype diversity, h = 0.851 ± 0.041 and nucleotide diversity, ntd = 0.009 ± 0.006 and 66 in Nellore (h = 1.00 ± 0.27, ntd = 0.014 ± 0.012. These data indicated sequence identities of 99.6 and 92.1% between the B. p. taurus' reference sequence and Brangus-Ibage and Nellore, respectively. The comparison of our data with sequence data for 612 individuals recovered from GenBank showed a total of 205 haplotypes defined by 99 polymorphic sites. Most of the variability (53% was due to differentiation within breeds. The phylogenetic tree constructed using the neighbor-joining method showed clearly the well-known dichotomy between B. p. taurus and B. p. indicus. The Brangus-Ibage clustered with B. p. taurus lineages; however, the displacement of Nellore from B. p. indicus branch probably indicates a substantial B. p. taurus maternal ancestry in some Nellore samples (obtained from GenBank and reflects the primarily male-driven introduction of this breed in Brazil.

  20. 牦牛HSP27基因的克隆及其在雌性生殖器官中的表达%Cloning of Bos Grunniens HSP27 Gene and Its Expression in the Female Yak Reproductive Organs

    Institute of Scientific and Technical Information of China (English)

    何翃闳; 崔燕; 潘阳阳; 樊江峰; 胡威; 张译夫; 刘鹏刚; 李秦; 余四九

    2015-01-01

    determined that the atom number, molecular formula, calculated molecular weight and theoretical isoelectric point of the encoded protein were 2366, C747H1189N205O220S5, 16.722 kD, and 5.33 respectively. The HSP27 encoded protein of HSP27 was predicted to be a type of soluble and non-transmembrane protein. Nucleotide sequence analysis revealed that the HSP27 gene nucleotide sequence of yak was similar to those ofBos taurus(99.8%),Bubalus bubalis(98.4%),Ovis aries(97.8%),Pantholops hodgsonii(97.6%),Orcinus orca(90.3%),Camelus ferus(89.7%),Sus scrofa(89.7%),Equus caballus (86.7%),Canis lupus(86.7%),Homo sapiens(85.5%) andGorilla gorilla(85.3%). The similarity of resulting amino acid sequence of HSP27 gene between yak andbos taurus, bubalus bubalis, ovis aries pantholops hodgsonii, orcinus orca, camelus ferus sus scrofa, equus caballus, canis lupus, homo sapiensand gorilla gorilla were 100%、100%、100%、100%、96.3%、100%、96.8%、100%、100%、96.3% and 96.3%, respectively. The phylogenetic tree indicated that HSP27 gene of yak was close to bos taurus, bubalus bubalis, ovis aries and pantholops hodgsonii, but far from canis lupus, gorilla gorillaand homo sapiens. Moreover, the RT-qPCR indicated that HSP27 gene expressed universally in ovary, oviduct and uterus tissues during all reproductive periods, including follicular, luteal and pregnancy phases. The gene had its highest expression level in the follicle at follicle phase and its lowest expression in uterus in the luteal phase. In addition, the expression level of HSP27 gene in ovary was significantly higher than in the uterus during each of the different stages of the reproductive cycle. Its expression in ovaries, fallopian tubes and uterus changed dramatically because of pregnancy.[Conclusion]It is concluded from the present study that HSP27 gene in the yak is highly conservative in mammalian evolution according to the comparative nucleotide sequence analysis.. Analyzing HSP27 gene expression in central reproductive

  1. Collection of radiocarbon dates on the mammoths ( Mammuthus primigenius) and other genera of Wrangel Island, northeast Siberia, Russia

    Science.gov (United States)

    Vartanyan, Sergey L.; Arslanov, Khikmat A.; Karhu, Juha A.; Possnert, Göran; Sulerzhitsky, Leopold D.

    2008-07-01

    We present and discuss a full list of radiocarbon dates for woolly mammoth and other species of the Mammoth fauna available from Wrangel Island, northeast Siberia, Russia. Most of the radiocarbon dates are published here for the first time. Of the124 radiocarbon dates on mammoth bone, 106 fall between 3700 and 9000 yr ago. We believe these dates bracket the period of mammoth isolation on Wrangel Island and their ultimate extinction, which we attribute to natural causes. The absence of dates between 9-12 ka probably indicates a period when mammoths were absent from Wrangel Island. Long bone dimensions of Holocene mammoths from Wrangel Island indicate that these animals were comparable in size to those on the mainland; although they were not large animals, neither can they be classified as dwarfs. Occurrence of mammoth Holocene refugia on the mainland is suggested. Based on other species of the Mammoth fauna that have also been radiocarbon on Wrangel Island, including horse, bison, musk ox and woolly rhinoceros, it appears that the mammoth was the only species of that fauna that inhabited Wrangel Island in the mid-Holocene.

  2. The multifaceted origin of taurine cattle reflected by the mitochondrial genome.

    Directory of Open Access Journals (Sweden)

    Alessandro Achilli

    Full Text Available A Neolithic domestication of taurine cattle in the Fertile Crescent from local aurochsen (Bos primigenius is generally accepted, but a genetic contribution from European aurochsen has been proposed. Here we performed a survey of a large number of taurine cattle mitochondrial DNA (mtDNA control regions from numerous European breeds confirming the overall clustering within haplogroups (T1, T2 and T3 of Near Eastern ancestry, but also identifying eight mtDNAs (1.3% that did not fit in haplogroup T. Sequencing of the entire mitochondrial genome showed that four mtDNAs formed a novel branch (haplogroup R which, after the deep bifurcation that gave rise to the taurine and zebuine lineages, constitutes the earliest known split in the mtDNA phylogeny of B. primigenius. The remaining four mtDNAs were members of the recently discovered haplogroup Q. Phylogeographic data indicate that R mtDNAs were derived from female European aurochsen, possibly in the Italian Peninsula, and sporadically included in domestic herds. In contrast, the available data suggest that Q mtDNAs and T subclades were involved in the same Neolithic event of domestication in the Near East. Thus, the existence of novel (and rare taurine haplogroups highlights a multifaceted genetic legacy from distinct B. primigenius populations. Taking into account that the maternally transmitted mtDNA tends to underestimate the extent of gene flow from European aurochsen, the detection of the R mtDNAs in autochthonous breeds, some of which are endangered, identifies an unexpected reservoir of genetic variation that should be carefully preserved.

  3. Construction of Bovine (Bos taurus) Transgenic Cloned Embryos with Lysostaphin and Endolysin Genes by Electronic Transfection%电转染法制备奶牛转溶葡球菌酶(Lysostaphin)和内溶素(Endolysin)基因胚胎

    Institute of Scientific and Technical Information of China (English)

    杨林; 杜卫华; 郝海生; 刘岩; 秦彤; 赵学明; 王栋; 朱化彬; 王宗礼

    2013-01-01

    Lysostaphin is a single chain protease containing zinc which can kill staphylococcus aureus effectively. Endolysin which is the peculiar of the double-stranded DNA bacteriophages is a murein hydrolytic enzyme, it has a wide range of antibacterial effect. Lysostaphin and Endolysin have the high synergistic effect. In this study, the vectors pBCl-seq2 +seq3-EGFP-neo containing Endolysin and Lysostaphin genes and two other marker genes of enhenced green fluorescent protein (EGFP) andneomycin (neo) were transfected into bovine (Bos taurus) fetal fibroblast by electroporation and nucleofector of AMAXA. Stable transfected monoclonal cells which were identified to be the positive-cells in the way of PCR technique were obtained through fluorescence and G418 selection. Using transfected cells as the donor, transfected embryos were produced with somatic cell nuclear transfer, we used different conditions of AMAXA nuleofecor(A-023,V-013, V-023 and T-016) to transfect bovine fetal fibroblast, the results showed the suitable program was T-016. There were 5 times transfection efficient of AMAXA nuleofecor (20.11%) than it of electroporation. The blastocyst developed normally and the rate was of it 20.08%. In our study, we built up bovine fetal fibroblast cell line, sought out transfection parameter of high transfection efficiency, and acquired transgenic cell lines and transgenic blastocyst containing Lysostaphin and Endolysin genes, In conclusion, the results can provide technology supporting for producing anti-mastitis transgenic bovine and searching the new therapy way of mastitis.%溶葡球菌酶(Lysostaphin)是一种含锌的单链蛋白酶,能有效地杀灭金黄色葡萄球菌.内溶素(Endolysin)是双链DNA噬菌体所特有,是一类胞壁质水解酶,具有广泛的抗菌效果.内溶素与抗生素之间有高效的协同作用.本研究通过BTX电转染和AMAXA核转染的方法将含有溶葡球菌酶(Lysostaphin)和内溶素(Endolysin)两个目的基因(Seq2

  4. Desenvolvimento folicular no pós-parto de vacas da raça Gir tratadas com acetato de buserelina (GnRH ou gonadotrofina coriônica humana (hCG Follicular development in Gir breed cows (Bos indicus treated with buserelin acetate or human chorionic gonadotrophin during the postpartum period

    Directory of Open Access Journals (Sweden)

    Álan Maia Borges

    2004-12-01

    Full Text Available Foram utilizadas 22 vacas da raça Gir (Bos indicus em anestro pós-parto, amamentando e mantidas sob regime de pastejo. O padrão de crescimento folicular foi estudado em 15 animais, enquanto os outros sete foram utilizados somente no acompanhamento da resposta aos tratamentos hormonais. Ultra-sonografia em tempo real foi realizada diariamente, do quarto ao qüinquagésimo dia de lactação, por meio de aparelho equipado com probe de 5MHz. Nenhum animal apresentou estro, ovulação ou luteinização folicular durante o período de avaliação. Verificaram-se quatro a oito ondas foliculares surgindo em intervalos de seis a sete dias, cujo diâmetro máximo dos folículos dominantes e subordinados foi de 8,9±0,6 e 6,3±0,7mm, respectivamente. Aos 56 dias pós-parto, as 22 vacas foram divididas em dois grupos: 11 tratadas com 4,2 mig de acetato de buserelina e 11 com 3.000UI de hCG. A ovulação, regressão e luteinização folicular foram verificadas em animais dos dois tratamentos e uma nova onda folicular surgiu dentro de dois a três dias após a terapia hormonal. Corpos lúteos de menor tamanho e concentrações de progesterona abaixo de 1ng/mL indicaram baixa atividade luteal.This experiment was carried out with 22 anestrus Gir cows (Bos indicus, with the postpartum follicular growth studied in 15 of these suckling and kept on pasture, while the seven others were used only for hormonal treatments. Daily real time ultrasonography was done from 4th to the 50th day, using B-mode ultrasound scanner equipped with a linear array 5.0MHz probe. No animal showed estrus, ovulation or follicular luteinization during de experimental period. Four to eight follicular waves emerged each six or seven days and maximum diameter of dominant and subordinate follicles were 8.9±0.6mm and 6.3±0.7mm, respectively. On day 56 of postpartum all cows were separated in two groups: 11 cows were treated either with 4.2 mug of buserelin acetate and 11 with 3,000UI of h

  5. COWS AND GOATS AS SENTINELS FOR ENVIRONMENTAL LEAD (Pb BURDEN IN ZARIA, NIGERIA

    Directory of Open Access Journals (Sweden)

    Udiba Udiba Ugumanim

    2015-11-01

    Full Text Available Blood lead levels (BLLs is considered as a good indicator of current body burden of the toxic metal. Assessment of BLLs of white Fulani cattle(Bos primigenius indicusand red Sokoto goats (Capra aegagrus hircus grazed freely on open pastures in Zaria was carried out by Atomic Absorption Spectrophotometry using Shimadzu Atomic Absorption Spectrophotometer (model AA-6800, Japan after wet digestion to evaluate the potential effects of the metal on the animals, the toxicological implication of consuming this major source of animal protein by humans and most importantly as an indirect measure of the lead pollution status of Zaria ecological geochemical environment. The blood lead levels of Bos primigenius indicus ranged from a minimum of 0.62 mg/l to a maximum of 2.28 mg/l with a mean value of 1.36±0.48 mg/l. On the other hand, blood lead levels of Capra aegagrus hircus ranged between 0.26 mg/l and 1.56 mg/l with a mean value of 0.89±0.43mg/l. The BLLs of both cows and goats were found to exceed the allowable limit for the elements in blood of food animals indicating that cows and goats grazed freely on open pastures in Zaria metropolis are not safe for human consumption. Routine monitoring of the heavy metal in plant and animal products is therefore recommended to safeguard human health. Most importantly, the study indicates the presence of elevated levels of environmental lead in Zaria ecological geochemical environment.

  6. Pimply gut condition in mithun (Bos frontalis) calves.

    Science.gov (United States)

    Chamuah, J K; Pegu, S R; Raina, O K; Siju, S J; Sakhrie, A; Deka, Anil; Rajkhowa, C

    2016-06-01

    The present observation was recorded at National Research Centre on Mithun, Jharnapani from May 2010 to September 2012. A total of 15 mithun calves, which died in and around Jharnapani, were attended and detailed post-mortem examination was carried out. Out of these, five calves (33.33 %) aging between 1 and 1.5 years exhibiting the condition of chronic wasting and diarrhoea were found positive for pimply gut condition based on gross and microscopic examination. Post-mortem examination revealed extensive nodule formation on the wall of the rectum; however, the entire lumen did not reveal any of adult parasites. In all the cases, there were congestion in the mucous layer and thickening of the intestinal wall. Histopathological examination revealed chronic enteritis with mononuclear cell infiltration comprising mostly of macrophages, lymphocytes and eosinophils. In the muscularis mucosae, encysted larvae were found along with fibrous tissue proliferation. These lesions gave the intestine a nodular appearance as they thickened the wall and projected from the serosal surface. These extensive numbers of nodules in the intestine might have interfered with peristalsis and intestinal absorption which led to chronic wasting and diarrhoea in the calves. PMID:27413288

  7. Impact of Bos indicus genetics on the global beef industry

    Science.gov (United States)

    More than half of the cattle in the world are maintained in tropical environments between the tropics of Cancer and Capricorn. In the U.S., about 40% of the beef cows are located in subtropical environments of the hot and humid Southeast or more arid Southwest. Results of research documenting the ...

  8. BLUE OCEAN STRATEGY (BOS SEBAGAI PARADIGMA BARU MANAJEMEN PENDIDIKAN ISLAM

    Directory of Open Access Journals (Sweden)

    Ikhwan Fuad

    2016-08-01

    Full Text Available The focus of this article is to describe the Blue Ocean Strategy as a new paradigm of Islamic education management. the author seeks to elaborate on how the adoption of the Blue Ocean strategy of the business world to the world of education and answered the principles of what is accepted and rejected away from the theory. Adoption of blue ocean strategy is done by applying the universal principles are : among others reconstruct market boundaries, focus on the big picture rather than numbers, reach beyond existing demand, perform a series of strategies with appropriate, efforts to overcome organizational constraints and integrate execution into strategy. The principles of Blue Ocean Strategy Indicators that can be absorbed is an indicator that focuses gave excellent service and were not absorbed is a strong indicator of economic motivation. Generally, Blue Ocean Strategy quite well applied as a management paradigm of Islamic education.

  9. Polymorphism and Mobilization of Rransposons in Bos taurus

    DEFF Research Database (Denmark)

    Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

    ,983 sites were polymorphic. Some were absent in one or more of the breeds, including 680 which were absent in the Jersey breed, but only 13 were completely absent in all dairy breeds. The fact that so many of the putative retrotransposons are polymorphic, suggests that retrotransposition has been happening...

  10. Study of the temperament of bos indicus calves on weaning

    OpenAIRE

    Gustavo da Silva Freitas; Paola Moretti Rueda; Tiago da Silva Valente; Luísa Cunha Carneiro; Mateus José Rodrigues Paranhos da Costa

    2012-01-01

    Ones of the largest commercial cattle herd in the world, Brazil has its cattle characterized by the use of an extensive system and the predominance of zebu breeds, especially the Nelore and its crosses. In this system the temperament of cattle becomes a problem because of the low human-animal interaction, and bad-tempered animals can cause accidents, increase maintenance costs of facilities and provide poorer quality of the carcass, meat and leather. The aim of this study was to evaluate the ...

  11. Filmcoating beschermt boomzaden tegen kiemplantenziekte : bos- en haagplantsoen

    NARCIS (Netherlands)

    Derkx, M.P.M.; Brouwer, J.

    2006-01-01

    Onderzoek heeft aangetoond dat filmcoating van zaden met gewasbeschermingsmiddelen vlak vóór uitzaai, de uitval kan beperken. In tabellen wordt het effect van filmcoatbehandeling bij boomzaden van Prunus avium aangegeven.

  12. De betekenis van bodem en klimaat voor het Nederlandse bos.

    OpenAIRE

    Burg, van den, S.W.K.

    1996-01-01

    This publication is largely based on growth-site studies carried out on important tree species in Dutch forests during the period 1950-1991. Two of the ways the data yielded by these studies can be used were investigated. The first aimed to identify important correlations between growth and site properties. The second used combinations of site properties in an attempt to predict site index; this is important for the proper choice of tree species, or if previously unforested land is to be affo...

  13. Melatonin receptor(MT1 and MT2) expression in reproductive endocrine organs of yak(Bos grunniens) during breeding seasons%褪黑素受体在发情季节牦牛生殖内分泌器官中的表达研究

    Institute of Scientific and Technical Information of China (English)

    霍生东; 阎萍

    2013-01-01

    为了研究褪黑素受体(MT)对季节性发情牦牛的调控作用,采用real-time PCR和免疫组织化学SP法,对发情季节牦牛松果体、下丘脑、垂体、卵巢中MT蛋白和MT mRNA的表达进行了研究.结果表明:发情季节牦牛松果体、下丘脑、垂体和子宫中均有MT mRNA和MT蛋白的表达;在松果体中,MT蛋白免疫阳性产物表达于松果体细胞、神经纤维和神经结节;在下丘脑中,MT蛋白免疫阳性产物表达于大细胞神经结节和小细胞神经结节;在垂体中,MT蛋白免疫阳性产物表达于α细胞和β细胞;在卵巢中,MT蛋白免疫阳性产物表达于卵泡、卵母细胞、颗粒细胞、间质细胞和黄体细胞.松果体中的MT mRNA在发情季节表达最强(P<0.01);卵巢中的MT mRNA表达最低,下丘脑和垂体中的MT mRNA表达量均高于卵巢,但其间无显著差异(P>0.05).证实褪黑素参与了牦牛季节性发情的调控过程.%To better understand the role of melatonin receptor(MT) in yak(Bos grunniens),the expression level of MT and MT mRNA in the pineal gland,hypothalamus,pituitary gland,and ovary of yak during breeding seasons was determined using immunohistochemical SP and real-time PCR,respectively.Yak MT was located in the pinealocyte,synaptic ribbon and the synaptic spherules of the pineal gland and that melatonin interact via nerve fibers.In the hypothalamus,MT was located in the magnocellular neurons and parvicellular neurons.MT was also localized in the acidophilic cells and basophilic cells in the pituitary gland.In the ovary,MT was present in the follicle,oocyte,granulocyte,corpus luteum,and Leydig' s cells.The MT mRNA expression level was higher in the pineal gland tissue than the hypothalamus,pituitary gland,and ovary(P<0.01).The results indicated that MT plays a role in the regulation of seasonal estrus in yaks.

  14. Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

    Directory of Open Access Journals (Sweden)

    Huang Xiao

    2012-10-01

    Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

  15. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    Directory of Open Access Journals (Sweden)

    Diego Azevedo Mota

    2015-02-01

    Full Text Available The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW were evaluated in a 4 × 4 Latin square experimental design with four treatments and four periods in two simultaneous replicates. Dietary treatments were: soybean meal; cottonseed meal; peanut meal; and sunflower meal. When associated with diets containing sugarcane, the different protein sources did not affect intake or digestibility of dry mater, crude protein, organic matter and neutral detergent fiber. The average ruminal pH, NH3-N and concentration of total volatile fatty acids were not different among the diets supplied. The concentration of butyric acid was different among the protein sources, wherein the animals fed the diet with sunflower meal presented lower values than those fed the other sources. Diets did not affect nitrogen balance, microbial nitrogen, microbial synthesisefficiency, estimated dry matter flow, or passage rate. Alternative protein sources can be used to reduce the costs without changing the animal metabolism.

  16. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    OpenAIRE

    Diego Azevedo Mota; Juliana Duarte Messana; Roberta Carrilho Canesin; Giovani Fiorentini; Alexandre Vaz Pires; Telma Teresinha Berchielli

    2015-01-01

    The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW) were evaluated in a 4 × 4 Latin square experimental design with four treatments and four ...

  17. Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

    Directory of Open Access Journals (Sweden)

    Roberto César Araujo Lima

    2014-02-01

    Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

  18. Produtividade à Desmama de Novilhas Nelore e F1 Bos taurus x Nelore e Bos indicus x Nelore Productivity to Weaning of Nellore and F1 Guzerath x Nellore and Bos taurus x Nellore Heifers

    Directory of Open Access Journals (Sweden)

    Daniel Perotto

    2001-12-01

    Full Text Available A eficiência produtiva das vacas de corte está relacionada com o tamanho do animal, a fertilidade e a produção de leite. Este trabalho avaliou a eficiência à desmama de 289 novilhas sendo 100 Nelore (N, 47 F1 Guzerá x Nelore (GN, 67 F1 Red Angus x Nelore (RN, 37 F1 Marchigiana x Nelore (MN e 38 F1 Simental x Nelore (SN da Est. Exp. Paranavaí/IAPAR. Foram analisadas a idade ao primeiro parto (IPP, a relação entre o peso do bezerro à desmama e o peso da mãe ao parto, dividida pela idade da mãe em dias ao parto (PDPV, e a relação entre o peso do bezerro à desmama e o peso metabólico da mãe ao parto, dividida pela idade da mãe em dias ao parto (PDPM. As médias por quadrados mínimos para IPP em dias, PDPV [((kg/kg/dia x 1000] e PDPM [((kg/kg0,75/dia x 100] foram: 1416, 1340, 1053, 1187 e 1117; 0,394, 0,414, 0,422, 0,379 e 0,418; e 0,169, 0,179, 0,187, 0,169 e 0,188, respectivamente para os grupos N, GN, RN, MN e SN. Para IPP, foram significativos os contrastes N- RN (362 dias, GN -- RN (287 dias e RN -- MN (-133 dias. Para PDPV, foi significativo o contraste RN - MN [-0,04287((kg/kg/dia x 1000] e para PDPM foram significativos os contrastes N -- RN [-0,01803((kg/kg0,75/dia x 100], RN -- MN [0,01841((kg/kg0,75/dia x 100] e MN -- SN [-0,01915((kg/kg0,75/dia x 100]. Conclui-se que novilhas RN e SN foram mais eficientes à primeira desmama que novilhas MN, as quais não diferiram das zebuínas N e GN.Production efficiency of a beef cow-calf herd is determined by the ability of the cows in converting the ingested food into calf weight. This ability is related to cow size, fertility and milk production. The present study evaluated efficiency at weaning after first calving of 100 Nellore (N, 47 F1 Guzerath x Nellore (GN, 67 F1 Red Angus x Nellore (RN, 37 F1 Marchigiana x Nellore (MN and 38 F1 Simental x Nellore (SN heifers at Estação Experimental Paranavaí/IAPAR. The traits analyzed were age at first calving (IPP, the ratio of calf weaning weight to heifer weight at calving, divided by the age of the heifer at calving (PDPV and the ratio of calf weaning weight to heifer metabolic weight at calving, divided by the age of the heifer at calving (PDPM. Least squares means for IPP in days, PDPV [((kg/kg/day x 1000] and PDPM [((kg/kg0.75/day x 100] were: 1416, 1340, 1053, 1187 and 1117; 0.394, 0.414, 0.422, 0.379 and 0.418; and 0.169, 0.179, 0.187, 0.169 and 0.188, respectively for N, GN, RN, MN and SN. The contrasts N -- RN (362 days, GN -- RN (287 days and RN -- MN (-133 days were significant for IPP. For PDPV, the contrast RN -- MN [-0.04287((kg/kg/day x 1000] was significant while for PDPM the contrasts N -- RN [-0.01803((kg/kg0.75/day x 100], RN -- MN [0,01841((kg/kg0.75/day x 100] and MN -- SN [-0.01915((kg/kg0.75/day x 100] were significant. It can be concluded that RN and SN heifers had greater production efficiency at first weaning than MN heifers, which did not differ from N and GN heifers.

  19. Expression of genes related to quality of Longissimus dorsi muscle meat in Nellore (Bos indicus) and Canchim (5/8 Bos taurus × 3/8 Bos indicus) cattle.

    Science.gov (United States)

    Giusti, Juliana; Castan, Eduardo; Dal Pai, Maeli; Arrigoni, Mário De Beni; Rodrigues Baldin, Samira; De Oliveira, Henrique Nunes

    2013-06-01

    This study was performed to compare CAPN1, CAPN2, CAST, TG, DGAT1 and LEP gene expressions and correlate them with meat quality traits in two genetic groups (Nellore and Canchim) in order to assess their expression profile and use their expression profile as genetic markers. We analyzed 30 young bulls (1year old), 15 of each genetic group. Samples of the Longissimus dorsi muscle were collected for analysis of: total lipids (TL) and meat tenderness measured as Warner-Bratzler shear force (SF) and myofibrillar fragmentation (MFI) at day of slaughter and 7days of aging. Gene expression profiles were obtained via RT-qPCR. TL and MFI showed differences between breeds, higher MFI in Canchim and higher TL in Nellore. Calpains showed no differential expression between groups, as did DGAT1, TG, and LEP. CAST was expressed more in the Nellore cattle. The only significant within-breed correlation (0.79) between gene expression and meat traits was found for DGAT1 and MFI in Canchim breed. Although the number of animals used in this study was small, the results indicate that the increased expression of CAST in Nellore may reflect tougher meat, but the lack of correlations with the meat traits indicates it is not a promising genetic marker.

  20. Patterns of cell proliferation and apoptosis by topographic region in normal Bos taurus vs. Bos indicus crossbreeds bovine placentae during pregnancy

    Directory of Open Access Journals (Sweden)

    Ambrósio Carlos E

    2009-03-01

    Full Text Available Abstract Background Placental and fetal growth requires high rates of cellular turnover and differentiation, which contributes to conceptus development. The trophoblast has unique properties and a wide range of metabolic, endocrine and angiogenic functions, but the proliferative profile of the bovine placenta characterized by flow cytometry analysis and its role in fetal development are currently uncharacterized. Complete understanding of placental apoptotic and proliferative rates may be relevant to development, especially if related to the pathogenesis of pregnancy losses and placental abnormalities. Methods In this study, the proliferation activity and apoptosis in different regions of normal bovine placenta (central and boundary regions of placentomes, placentomal fusion, microplacentomes, and interplacentomal regions, from distinct gestation periods (Days 70 to 290 of pregnancy, were analyzed by flow cytometry. Results Our results indicated that microplacentomes presented a lower number of apoptotic cells throughout pregnancy, with a higher proliferative activity by the end of gestation, suggesting that such structures do not contribute significantly to normal of placental functions and conceptus development during pregnancy. The placentome edges revealed a higher number of apoptotic cells from Day 170 on, which suggests that placentome detachment may well initiate in this region. Conclusion Variations involving proliferation and apoptotic rates may influence placental maturation and detachment, compromising placental functions and leading to fetal stress, abnormalities in development and abortion, as frequently seen in bovine pregnancies from in vitro fertilization and cloning procedures. Our findings describing the pattern of cell proliferation and apoptosis in normal bovine pregnancies may be useful for unraveling some of the developmental deviations seen in nature and after in vitro embryo manipulations.

  1. Differential expression of IGF family members in heat-stressed embryos produced in vitro from OPU-derived oocytes of Nelore (Bos indicus) and Holstein (Bos taurus) cows.

    Science.gov (United States)

    Satrapa, R A; Razza, E M; Castilho, A C S; Simões, R A L; Silva, C F; Nabhan, T; Pegorer, M F; Barros, C M

    2013-12-01

    The IGF system is related to embryo quality. We aim to determine the effect of the heat stress on the mRNA expression of IGF1 and IGF2, IGFR1 and IGFR2, IGFBP2 and IGFBP4, and PAPPA in in vitro production (IVP) blastocysts from Nelore and Holstein after ovum pick up (OPU) to better understand the differences between these breeds. Oocytes from four Nelore and seven Holstein were collected in six OPU sessions. Following in vitro maturation and fertilization using six Nelore or Holstein sires, embryos were divided into control (cultured at 39°C) and heat stress (HS; exposed to 41°C for 9 h). Blastocysts were submitted to RNA extraction. The IGF1 expression was higher in blastocysts under HS in both breeds, and the expression of IGFBP2 and IGFBP4 was higher in Holstein blastocysts under HS. The high PAPPA expression and the low expression of IGFBP2 and IGFBP4 are associated with a more efficient degradation of IGFBPs, which results in greater IGF bioavailability in Nelore blastocysts and may contribute to the superior HS tolerance in Nelore, when compared to Holstein.

  2. Purebred-crossbred performance and genetic evaluation of postweaning growth and carcass traits in Bos indicus x Bos taurus crosses in Australia.

    Science.gov (United States)

    Newman, S; Reverter, A; Johnston, D J

    2002-07-01

    Growth and carcass data on 7,154 cattle from a purebred project and 1,241 cattle from a crossbred project, comprising 916 first-crosses and 325 purebred Brahman controls, were analyzed to estimate genetic parameters, including the genetic correlations between purebred and crossbred performance (rpc). The data also allowed the estimation of sire breed means for various growth and carcass traits. Crossbred calves were produced using 9 Angus, 8 Hereford, 7 Shorthorn, 14 Belmont Red, and 8 Santa Gertrudis sires bred to Brahman dams. These same sires produced 1,568 progeny in a separate purebreeding project. Cattle in both projects were managed under two finishing regimens (pasture and feedlot) to representative market live weights of 400 (domestic), 520 (Korean), and 600 kg (Japanese). The traits studied included live weight at around 400 d of age (400W), hot carcass weight (CWT), retail beef yield percentage (RBY), intramuscular fat percentage (IMF), rump fat depth (P8), and preslaughter ultrasound scanned eye muscle area (SEMA). Estimated breeding values (EBV) of sires from their BREEDPLAN genetic evaluations were used to assess their value in predicting crossbred performance. Regressions of actual crossbred calf performance on sire EBV for each of the traits differed little from their expectation of 0.5. Angus sires produced crossbred carcasses with the highest P8 and lowest RBY but highest IMF. In contrast, crossbred progeny from Belmont Red sires had the lightest 400W and CWT, lowest P8, and highest RBY. Estimates of rpc were 0.48, 0.48, 0.83, 0.95, 1.00, and 0.78 for 400W, CWT, RBY, IMF, P8, and SEMA, respectively. Commercial breeders selecting sires for crossbreeding programs with Brahman females, based on EBV computed from purebred data, might encounter some reranking of sire's performance for weight-related traits, with little expected change in carcass traits.

  3. Detection of quantitative trait loci for growth and beef carcass fatness traits in a cross between Bos taurus (Angus) and Bos indicus (Brahman) cattle.

    Science.gov (United States)

    Kim, J J; Farnir, F; Savell, J; Taylor, J F

    2003-08-01

    This study was conducted to detect quantitative trait loci (QTL) affecting growth and beef carcass fatness traits in an experimental population of Angus and Brahman crossbreds. The three-generation mapping population was generated with 602 progeny from 29 reciprocal backcross and three F2 full-sib families, and 417 genetic markers were used to produce a sex-averaged map of the 29 autosomes spanning 2,642.5 Kosambi cM. Alternative interval-mapping approaches were applied under line-cross (LC) and random infinite alleles (RA) models to detect QTL segregating between and within breeds. A total of 35 QTL (five with genomewide significant and 30 with suggestive evidence for linkage) were found on 19 chromosomes. One QTL affecting yearling weight was found with genomewide significant evidence for linkage in the interstitial region of bovine autosome (BTA) 1, and an additional 19 QTL were detected with suggestive evidence for linkage under the LC model. Many of these QTL had a dominant (complete or overdominant) mode of gene action, and only a few of the QTL were primarily additive, which reflects the fact that heterosis for growth is known to be appreciable in crosses among Brahman and British breeds. Four QTL affecting growth were detected with genomewide significant evidence for linkage under the RA model on BTA 2 and BTA 6 for birth weight, BTA 5 for yearling weight, and BTA 23 for hot carcass weight. An additional 11 QTL were detected with suggestive evidence for linkage under the RA model. None of the QTL (except for yearling weight on BTA 5) detected under the RA model were found by the LC analyses, suggesting the segregation of alternate alleles within one or both of the parental breeds. Our results reveal the utility of implementing both the LC and RA models to detect dominant QTL and also QTL with similar allele frequency distributions within parental breeds.

  4. Detection of quantitative trait loci for growth and beef carcass fatness traits in a cross between Bos taurus (Angus) and Bos indicus (Brahman) cattle.

    Science.gov (United States)

    Kim, J J; Farnir, F; Savell, J; Taylor, J F

    2003-08-01

    This study was conducted to detect quantitative trait loci (QTL) affecting growth and beef carcass fatness traits in an experimental population of Angus and Brahman crossbreds. The three-generation mapping population was generated with 602 progeny from 29 reciprocal backcross and three F2 full-sib families, and 417 genetic markers were used to produce a sex-averaged map of the 29 autosomes spanning 2,642.5 Kosambi cM. Alternative interval-mapping approaches were applied under line-cross (LC) and random infinite alleles (RA) models to detect QTL segregating between and within breeds. A total of 35 QTL (five with genomewide significant and 30 with suggestive evidence for linkage) were found on 19 chromosomes. One QTL affecting yearling weight was found with genomewide significant evidence for linkage in the interstitial region of bovine autosome (BTA) 1, and an additional 19 QTL were detected with suggestive evidence for linkage under the LC model. Many of these QTL had a dominant (complete or overdominant) mode of gene action, and only a few of the QTL were primarily additive, which reflects the fact that heterosis for growth is known to be appreciable in crosses among Brahman and British breeds. Four QTL affecting growth were detected with genomewide significant evidence for linkage under the RA model on BTA 2 and BTA 6 for birth weight, BTA 5 for yearling weight, and BTA 23 for hot carcass weight. An additional 11 QTL were detected with suggestive evidence for linkage under the RA model. None of the QTL (except for yearling weight on BTA 5) detected under the RA model were found by the LC analyses, suggesting the segregation of alternate alleles within one or both of the parental breeds. Our results reveal the utility of implementing both the LC and RA models to detect dominant QTL and also QTL with similar allele frequency distributions within parental breeds. PMID:12926775

  5. Preweaning growth of Angus- (Bos taurus), Brahman- (Bos indicus), and Tuli- (Sanga) sired calves and reproductive performance of their Brahman dams.

    Science.gov (United States)

    Browning, R; Leite-Browning, M L; Neuendorff, D A; Randel, R D

    1995-09-01

    Calves born to Angus (A), Brahman (B), or Tuli (T) bulls and B cows were evaluated to determine sire breed of calf effects on preweaning calf growth and reproductive performance of their dams. Records from 242 cow-calf pairs over 2 yr were used to assess birth weight, calf ADG, weaning weight, gestation length, and postpartum interval to estrus (PPI). The sire breed x sex of calf interaction was important (P Angus-sired F1 calves and similar to straightbred Brahman calves in preweaning growth. Crossbred calves had shorter gestations but longer postpartum intervals than purebred calves. PMID:8582844

  6. Purebred-crossbred performance and genetic evaluation of postweaning growth and carcass traits in Bos indicus x Bos taurus crosses in Australia.

    Science.gov (United States)

    Newman, S; Reverter, A; Johnston, D J

    2002-07-01

    Growth and carcass data on 7,154 cattle from a purebred project and 1,241 cattle from a crossbred project, comprising 916 first-crosses and 325 purebred Brahman controls, were analyzed to estimate genetic parameters, including the genetic correlations between purebred and crossbred performance (rpc). The data also allowed the estimation of sire breed means for various growth and carcass traits. Crossbred calves were produced using 9 Angus, 8 Hereford, 7 Shorthorn, 14 Belmont Red, and 8 Santa Gertrudis sires bred to Brahman dams. These same sires produced 1,568 progeny in a separate purebreeding project. Cattle in both projects were managed under two finishing regimens (pasture and feedlot) to representative market live weights of 400 (domestic), 520 (Korean), and 600 kg (Japanese). The traits studied included live weight at around 400 d of age (400W), hot carcass weight (CWT), retail beef yield percentage (RBY), intramuscular fat percentage (IMF), rump fat depth (P8), and preslaughter ultrasound scanned eye muscle area (SEMA). Estimated breeding values (EBV) of sires from their BREEDPLAN genetic evaluations were used to assess their value in predicting crossbred performance. Regressions of actual crossbred calf performance on sire EBV for each of the traits differed little from their expectation of 0.5. Angus sires produced crossbred carcasses with the highest P8 and lowest RBY but highest IMF. In contrast, crossbred progeny from Belmont Red sires had the lightest 400W and CWT, lowest P8, and highest RBY. Estimates of rpc were 0.48, 0.48, 0.83, 0.95, 1.00, and 0.78 for 400W, CWT, RBY, IMF, P8, and SEMA, respectively. Commercial breeders selecting sires for crossbreeding programs with Brahman females, based on EBV computed from purebred data, might encounter some reranking of sire's performance for weight-related traits, with little expected change in carcass traits. PMID:12162647

  7. Comportamento de vacas da raça Gir (Bos taurus indicus em estro Estrus behaviour in Gir cows (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    M.F. Ávila Pires

    2003-04-01

    Full Text Available O comportamento de vacas da raça Gir em estro e a concentração plasmática de progesterona foram avaliadas durante um estro induzido e o natural subseqüente, em 35 animais da raça Gir, no inverno e no verão de dois anos consecutivos. Observou-se efeito de interação entre estação e ano do experimento sobre a duração do ciclo estral. O proestro foi maior no verão (51,82± 4,77h do que no inverno (33,43± 4,82h e no estro natural (64,41± 4,95h do que no induzido (20,85± 4,64h. Observou-se menor duração da atividade sexual total no estro induzido do que no natural (41,62± 4,81 vs 94,83± 4,56h no inverno, e 64,00± 4,14 vs 127,44± 4,04h no verão. A duração do estro foi similar no inverno (12,33± 0,74h e no verão (11,82± 0,74h, e maior nas vacas sincronizadas (13,24± 0,70 vs 10,91± 0,78h. O número de montas recebidas durante o estro foi similar no inverno (28,16± 2,61 e no verão (22,98± 2,58 e maior nos animais sincronizados (29,97± 2,48 vs 21,17± 2,17. Observou-se efeito de interação entre estação e tipo de luteólise sobre o número de montas recebidas por hora em estro. O inverno não se constituiu em fator limitante à manifestação do estro, cuja duração e intensidade foram suficientes para permitir sua detecção; contudo, a sincronização dos estros interferiu com a manifestação do comportamento sexual.The estrus behaviour and the plasma progesterone concentration were monitored during an induced and a natural subsequent estrus, in 35 Gir cows, during the winter and summer seasons of two consecutives years. The length of estrous cycle was influenced by the interaction between season and experimental year. The proestrus period was longer in the summer (51.82± 4.77h compared to the one in the winter (33.43± 4.82h season as far as in the natural (64.41± 4.95h vs in the induced estrus (20.85± 4.64h. The total sexual activity was shorter in the induced than in the natural estrus (41.62± 4.81 vs 94.83± 4.56h in the winter, and 64.00± 4.14 vs 127.44± 4.04h in the summer. The length of estrus was similar between winter (12.33± 0.74h and summer (11.82± 0.74h, and longer in the synchronized cows (13.24± 0.70 vs 10.91± 0.78h. The number of mounts accepted during the estrus was similar between winter (28.16± 2.61 and summer (22.98± 2.58, and greater in the synchronized animals (29.97± 2.48 vs 21.17± 2.17. It was observed effect of interaction between season of the year and luteolysis type on the total received mountings per hour in estrus. The winter was not a limiting factor to the estrus manifestation, once its length and intensity allowed heat detection, however, heat synchronization meddled the manifestation of sexual behaviour.

  8. Combining organic and inorganic nitrogen fertilisation reduces N2O emissions from cereal crops

    DEFF Research Database (Denmark)

    Nyamadzawo, George; Shi, Yeufeng; Chirinda, Ngonidzashe;

    2014-01-01

    ha−1 cattle manure-N. In China, treatments were; (i) Control, (ii) 300 kg N ha−1 Urea, (iii) 92 kg N ha−1 Urea plus 65 kg ha−1 chicken (Gallus domesticus) manure-N, (iv) 100 kg N ha−1 Urea and (v) 100 kg N ha−1 control release Urea. Our results showed that under both temperate and tropical conditions...... emissions were measured from maize and winter wheat plots. In Zimbabwe the treatments were; (i) Control, (ii) 60 kg N ha−1 ammonium nitrate (NH4NO3), (iii) 120 kg N ha−1 NH4NO3, (iv) 60 kg ha−1 cattle (Bos primigenius) manure-N, plus 60 kg N ha−1 NH4NO3, (v) 60 kg N ha−1 cattle manure-N, and (vi) 120 kg N......, integrated nutrient management resulted in lower N2O emissions compared to inorganic fertilizers which had higher total and yield-scale N2O emissions. We conclude that by combining organic and inorganic N sources, smallholder farmers in both China and Zimbabwe, and other countries with similar climatic...

  9. Polymorphisms of two Y chromosome microsatellites in Chinese cattle

    Directory of Open Access Journals (Sweden)

    Xue Kai

    2006-09-01

    Full Text Available Abstract Two Y chromosome specific microsatellites UMN2404 and UMN0103 were genotyped and assessed for polymorphisms in a total of 423 unrelated males from 25 indigenous Chinese cattle breeds. Consistently, both microsatellites displayed specific indicine and taurine alleles in each bull examined. The indicine and taurine alleles were detected in 248 males (58.6%, and 175 males (41.4%, respectively, although these frequencies varied amongst different breeds examined. The indicine alleles dominated in the southern group (92.4%, while the taurine alleles dominated in the northern group (95.5%. Hainan Island was possibly the site for the origin of Chinese zebu, and Tibetan cattle were probably independently domesticated from another strain of Bos primigenius. The geographical distribution of these frequencies reveals a pattern of male indicine introgression and a hybrid zone of indicine and taurine cattle in China. The declining south-to-north and east-to-west gradient of male indicine introgression in China could be explained by historical data, geographical segregation and temperature and weather conditions.

  10. Worldwide patterns of ancestry, divergence, and admixture in domesticated cattle.

    Directory of Open Access Journals (Sweden)

    Jared E Decker

    2014-03-01

    Full Text Available The domestication and development of cattle has considerably impacted human societies, but the histories of cattle breeds and populations have been poorly understood especially for African, Asian, and American breeds. Using genotypes from 43,043 autosomal single nucleotide polymorphism markers scored in 1,543 animals, we evaluate the population structure of 134 domesticated bovid breeds. Regardless of the analytical method or sample subset, the three major groups of Asian indicine, Eurasian taurine, and African taurine were consistently observed. Patterns of geographic dispersal resulting from co-migration with humans and exportation are recognizable in phylogenetic networks. All analytical methods reveal patterns of hybridization which occurred after divergence. Using 19 breeds, we map the cline of indicine introgression into Africa. We infer that African taurine possess a large portion of wild African auroch ancestry, causing their divergence from Eurasian taurine. We detect exportation patterns in Asia and identify a cline of Eurasian taurine/indicine hybridization in Asia. We also identify the influence of species other than Bos taurus taurus and B. t. indicus in the formation of Asian breeds. We detect the pronounced influence of Shorthorn cattle in the formation of European breeds. Iberian and Italian cattle possess introgression from African taurine. American Criollo cattle originate from Iberia, and not directly from Africa with African ancestry inherited via Iberian ancestors. Indicine introgression into American cattle occurred in the Americas, and not Europe. We argue that cattle migration, movement and trading followed by admixture have been important forces in shaping modern bovine genomic variation.

  11. Candidate Gene Expression in Bos indicus Ovarian Tissues: Prepubertal and Postpubertal Heifers in Diestrus

    Science.gov (United States)

    Weller, Mayara Morena Del Cambre Amaral; Fortes, Marina Rufino S.; Porto-Neto, Laercio R.; Kelly, Matthew; Venus, Bronwyn; Kidd, Lisa; do Rego, João Paulo Arcelino; Edwards, Sophia; Boe-Hansen, Gry B.; Piper, Emily; Lehnert, Sigrid A.; Guimarães, Simone Eliza Facioni; Moore, Stephen Stewart

    2016-01-01

    Growth factors such as bone morphogenetic proteins 6, 7, 15, and two isoforms of transforming growth factor-beta (BMP6, BMP7, BMP15, TGFB1, and TGFB2), and insulin-like growth factor system act as local regulators of ovarian follicular development. To elucidate if these factors as well as others candidate genes, such as estrogen receptor 1 (ESR1), growth differentiation factor 9 (GDF9), follicle-stimulating hormone receptor (FSHR), luteinizing hormone receptor (LHR), bone morphogenetic protein receptor, type 2 (BMPR2), type 1 insulin-like growth factor receptor (IGFR1), and key steroidogenic enzymes cytochrome P450 aromatase and 3-β-hydroxysteroid dehydrogenase (CYP19A1 and HSD3B1) could modulate or influence diestrus on the onset of puberty in Brahman heifers, their ovarian mRNA expression was measured before and after puberty (luteal phase). Six postpubertal (POST) heifers were euthanized on the luteal phase of their second cycle, confirmed by corpus luteum observation, and six prepubertal (PRE) heifers were euthanized in the same day. Quantitative real-time PCR analysis showed that the expression of FSHR, BMP7, CYP19A1, IGF1, and IGFR1 mRNA was greater in PRE heifers, when contrasted to POST heifers. The expression of LHR and HSD3B1 was lower in PRE heifers. Differential expression of ovarian genes could be associated with changes in follicular dynamics and different cell populations that have emerged as consequence of puberty and the luteal phase. The emerging hypothesis is that BMP7 and IGF1 are co-expressed and may modulate the expression of FSHR, LHR and IGFR1, and CYP19A1. BMP7 could influence the downregulation of LHR and upregulation of FSHR and CYP19A1, which mediates the follicular dynamics in heifer ovaries. Upregulation of IGF1 expression prepuberty, compared to postpuberty diestrus, correlates with increased levels FSHR and CYP19A1. Thus, BMP7 and IGF1 may play synergic roles and were predicted to interact, from the expression data (P = 0.07, r = 0.84). The role of these co-expressed genes in puberty and heifers luteal phase merits further research. PMID:27803898

  12. Diagrama de fases de átomos bosónicos sujetos a confinamiento no diagonal

    OpenAIRE

    Cruz Reyes, Greis Julieth

    2014-01-01

    Los sistemas de muchas partículas conformados por bosones, se han estudiado de forma extensa gracias a los aportes significativos que se han hecho a la física de bajas temperaturas; el condensado de Bose-Einstein y la observación de una transición de fase cuántica son ejemplos experimentales de adelantos en este tema que han abierto nuevos campos de investigación. La física de bosones confinados esta descrita por el modelo de Bose-Hubbard, donde el Hamiltoniano contiene el t...

  13. Development of a physiologically based pharmacokinetic model for flunixin in cattle (Bos taurus)

    Science.gov (United States)

    Violative residues of flunixin in tissues from bob veal calves and cull dairy cows has been attributed to noncompliance with the FDA-approved route of administration and withdrawal time, however, the effect of administration route and physiological differences among animals on tissue residue depleti...

  14. Expression Variants of the Lipogenic AGPAT6 Gene Affect Diverse Milk Composition Phenotypes in Bos taurus

    OpenAIRE

    Littlejohn, Mathew D; Kathryn Tiplady; Thomas Lopdell; Law, Tania A.; Andrew Scott; Chad Harland; Ric Sherlock; Kristen Henty; Vlad Obolonkin; Klaus Lehnert; Alistair Macgibbon; Spelman, Richard J; Stephen R. Davis; Snell, Russell G.

    2014-01-01

    Milk is composed of a complex mixture of lipids, proteins, carbohydrates and various vitamins and minerals as a source of nutrition for young mammals. The composition of milk varies between individuals, with lipid composition in particular being highly heritable. Recent reports have highlighted a region of bovine chromosome 27 harbouring variants affecting milk fat percentage and fatty acid content. We aimed to further investigate this locus in two independent cattle populations, consisting o...

  15. Spatial movement of free-roaming cattle (Bos Taurus) when in proximity to wolves (Canis lupus)

    Science.gov (United States)

    In 1995 and 1996, 31 wolves were reintroduced into Yellowstone National Park and 35 in central Idaho. These populations have grown to more than 1,500 with more than 835 in Idaho. As wolf populations have grown, so has predation on livestock, complicating cow and ranch management. Our study was de...

  16. Parâmetros genéticos entre características de leite, de peso e a idade ao primeiro parto em gado mestiço leiteiro (Bos taurus x Bos indicus Genetic parameters between milk traits, weight traits and age at first calving in crossbreed dairy cattle (Bos taurus x Bos indicus

    Directory of Open Access Journals (Sweden)

    A.E. Vercesi Filho

    2007-08-01

    Full Text Available Foram estimadas as correlações genéticas entre características de produção de leite (produção de leite, gordura, proteína e duração da lactação em até 305 dias, na primeira lactação, características de peso (taxa de crescimento de novilhas entre 12-24 meses e peso médio de vacas e idade ao primeiro parto, em uma população de fêmeas Mestiço Leiteiro Brasileiro (MLB, por meio de metodologia REML, sob modelo animal. As estimativas de herdabilidade das características estudadas na ordem acima foram, respectivamente, 0,28± 0,08, 0,30±0,11, 0,28±0,09, 0,19±0,07, 0,18±0,06, 0,42±0,10 e 0,48±0,12. As correlações genéticas entre peso médio da vaca e a produção de leite, gordura e proteína foram, respectivamente, -0,22±0,22, -0,49±0,31 e -0,22±0,23 e da taxa de crescimento das novilhas com a produção de leite, gordura e proteína foram respectivamente, -0,59±0,35, -0,73±0,44 e -0,62±0,37. As correlações genéticas entre produção de leite, peso médio das vacas e taxa de crescimento das novilhas com idade ao primeiro parto foram respectivamente, 0,05±0,18, -0,05±0,18 e 0,02±0,20. A alta correlação genética (0,93±0,02 entre produção de leite e duração da lactação indicou que não se deve remover a variação na duração da lactação na seleção de gado leiteiro tropical.Genetic correlations between milk production (milk, fat, protein yield lactation length in 305-d lactation, live weight (average cow live weight, growth rate between 12-24 mo and age at first calving traits were estimated in a population of Mestiço Leiteiro Brasileiro (MLB females using REML methodology and animal model. The estimates of heritability were respectively, 0.28± 0.08, 0.30±0.11, 0.28±0.09, 0.19±0.07, 0.18±0.06, 0.42±0.10 and 0.48±0.12 for those traits. Genetic correlations between milk, fat and protein yield with cow average weight were, respectively, -0.22±0.22, -0.49±0.31, -0.22±0.23, and between milk, fat and protein yield with heifer live weight gain, -0.59±0.35, -0.73±0.44, -0.62±0.37 as well. Genetic correlations between milk yield, cow average weight and heifer live weight gain with age at first calving were, respectively, 0.05±0.18, -0.05±0.18, 0.02±0.20. The high genetic correlation between milk production and lactation length (0.93±0.02 indicated that variation of the lactation length should not be removed when selecting tropical dairy cattle.

  17. Effects of roof modifications on growth performance and physiological changes of crossbred beef heifers (Bos indicus

    Directory of Open Access Journals (Sweden)

    Titaporn Khongdee

    2016-04-01

    Full Text Available The objective of the experiment was to examine and evaluate growth performance and physiological changes of cattle raised under normal roof versus a modified roof. Ten Hindu Brazil x Brahman heifers were used in the experiment. The animals were divided randomly into two groups. They were used to evaluate the effects of modified roofing on the subjects’ physiological responses to heat stress and performance under hot humid conditions. It was found that the modified roof (MR offered a more efficient way to lower heat stress in the cattle than the normal roof (NR. The difference was sufficient to enable the NR at 14:00 p.m. to have a THI higher (P<0.001 than that of the MR. Roof temperature of the MR (35.67±4.28°C was found to be lower (P<0.01 than that of the NR (44.49±7.61°C. Rectal temperature (RT and average rate of gain (ADG of the cattle kept under MR (39.02°C; 0.632 kg/d was lower (P<0.01 and higher (P<0.01, respectively than the NR (40.05 °C; 0.350 kg/d cattle

  18. Dubbel bosättning : Bostadens betydelse vid flytt från Sverige

    OpenAIRE

    Månsson, Robin

    2011-01-01

    The Swedish tax on income for persons who are unlimited liable to tax is based on his domicile and double taxation treaties between Sweden and other countries are based on his residence. In order to determine a person’s tax liability, the dwelling or home is of vital importance to determine where a person has his domicile and residence. For a person who has moved from Sweden, to be unlimited tax liable here, there must be an essential link. This link can be through previous residence in Swede...

  19. Bovine Genome Database: supporting community annotation and analysis of the Bos taurus genome

    Directory of Open Access Journals (Sweden)

    Childs Kevin L

    2010-11-01

    Full Text Available Abstract Background A goal of the Bovine Genome Database (BGD; http://BovineGenome.org has been to support the Bovine Genome Sequencing and Analysis Consortium (BGSAC in the annotation and analysis of the bovine genome. We were faced with several challenges, including the need to maintain consistent quality despite diversity in annotation expertise in the research community, the need to maintain consistent data formats, and the need to minimize the potential duplication of annotation effort. With new sequencing technologies allowing many more eukaryotic genomes to be sequenced, the demand for collaborative annotation is likely to increase. Here we present our approach, challenges and solutions facilitating a large distributed annotation project. Results and Discussion BGD has provided annotation tools that supported 147 members of the BGSAC in contributing 3,871 gene models over a fifteen-week period, and these annotations have been integrated into the bovine Official Gene Set. Our approach has been to provide an annotation system, which includes a BLAST site, multiple genome browsers, an annotation portal, and the Apollo Annotation Editor configured to connect directly to our Chado database. In addition to implementing and integrating components of the annotation system, we have performed computational analyses to create gene evidence tracks and a consensus gene set, which can be viewed on individual gene pages at BGD. Conclusions We have provided annotation tools that alleviate challenges associated with distributed annotation. Our system provides a consistent set of data to all annotators and eliminates the need for annotators to format data. Involving the bovine research community in genome annotation has allowed us to leverage expertise in various areas of bovine biology to provide biological insight into the genome sequence.

  20. Nucleolus-like bodies in the pineal gland of the adult yak (Bos grunniens).

    Science.gov (United States)

    Xie, Zhaohui H; Gan, Ping

    2013-05-28

    The pineal glands of adult yak were studied electron microscopically. Nucleolus-like bodies (NLBs) were found mostly in the pinealocytes and the interstitial cells of the pineal glands of the yak. The NLBs were electron-dense, round or ovoid bodies with a diameter of 50 nm - 500 nm. Two types of granules were identified as melanin. These may correspond to different stages of a progressive storage of melanin. Rough endoplasmic reticula with abundant ribosomes were observed. There was no correlation between the number of NLBs and the sex of the animals.

  1. Analysis of Two Chinese Yak(Bos grunniens) Population Using Bovine Microsatellite Primers

    Institute of Scientific and Technical Information of China (English)

    Wang Minqiang; S.Weigend; A.Barre-Dirie; J.W.Carnwath; Lou Zhonglin; H.Niemann

    2005-01-01

    Two Chinese domestic yak populations representing the Plateau type and the Huanhu Alpine type were analysed with 12 bovine microsatellite primers. All primer pairs functioned in the yak genome and polymorphism was found at all loci. The allele size ranges and frequencies of the two yak populations were similar and there was considerable overlap with the allele size ranges observed in cattle. Data for European cattle breeds was obtained from the Cattle Diversity Database(CaDBase)to interpret the heterozygosity and genetic distance estimates in yak populations. Heterozygosity estimated for the two yak populations was comparable to that of European cattle while Nei's Genetic Distance DA between the two yak populations was less than distances between the most closely related German cattle breeds. Bovine microsatellite primers proved to be a valuable tool for characterization of yak populations.

  2. Y chromosome polymorphism in various breeds of cattle (Bos taurus) in Switzerland.

    Science.gov (United States)

    Stranzinger, Gerald F; Steiger, Dagmar; Kneubuhler, Josef; Hagger, Christian

    2007-01-01

    The evolutionary development of mammals involves mutations and fixations of chromosomal types. The Y chromosome polymorphism in cattle is important for the breeding strategy, since chromosomal incompatibilities in crossings result in fertility problems. In bulls of various breeds in Switzerland, data on chromosome status have been collected for over 20 years. Data from 7 years were analysed in this study through chromosome measurements and their normalization. Some highly significant differences were found between the 7 groups of breeds, especially between Holsteins and the original Swiss breeds Braunvieh and Simmental. Fleckvieh (purebred or crossbred) did not differ significantly from Black or Red Holsteins. The results were discussed with respect to fertility problems. The observed Y chromosome polymorphism should be taken into account in breeding, and research in this field should be continued.

  3. Loss of miRNAs during Processing and Storage of Cow's (Bos taurus)Milk

    OpenAIRE

    Howard, Katherine M; Kusuma, Rio Jati; Baier, Scott R.; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, and Janos

    2015-01-01

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (

  4. Loss of miRNAs during processing and storage of cow's (Bos taurus) milk.

    Science.gov (United States)

    Howard, Katherine M; Jati Kusuma, Rio; Baier, Scott R; Friemel, Taylor; Markham, Laura; Vanamala, Jairam; Zempleni, Janos

    2015-01-21

    MicroRNAs (miRs, miRNAs) play central roles in gene regulation. Previously, we reported that miRNAs from pasteurized, store-bought bovine milk have biological activity in humans. Here, we assessed the effects of milk processing, storage, somatic cell content, and handling by consumers on the degradation of miRNAs in milk; we also quantified miRNAs in dairy products. Pasteurization and homogenization caused a 63% loss of miR-200c, whereas a 67% loss observed for miR-29b was statistically significant only in skim milk. Effects of cold storage and somatic cell content were quantitatively minor (caused a 40% loss of miR-29b but no loss of miR-200c. The milk fat content had no effect on miRNA stability during storage and microwave heating. The concentrations of miRNAs in dairy products were considerably lower than in store-bought milk. We conclude that processing of milk by dairies and handling by consumers causes a significant loss of miRNAs. PMID:25565082

  5. Effect of catalase on the liquid storage of mithun (Bos frontalis) semen

    Institute of Scientific and Technical Information of China (English)

    P Peruma; JK Chamuah; C Rajkhowa

    2013-01-01

    Objective: To assess the effect of catalase (CAT) on sperm motility, viability, total sperm abnormality, acrosomal and plasma membrane integrity, enzymatic profiles such as aspartate amino transaminase (AST), alanine amino transaminase (ALT), biochemical profiles such as cholesterol efflux and malonaldehyde (MDA) production and antioxidant profiles such as reduced glutathione (GSH), superoxide dismutase (SOD) and total antioxidant capacity (TAC). Methods: Total numbers of 50 ejaculates were collected twice a week from eight mithun bulls and semen was split into four equal aliquots, diluted with the TEYC extender. Group 1: semen without additives (control), group 2 to group 4: semen was diluted with 50 U/mL, 100 U/mL and 150 U/mL of catalase, respectively. These seminal, enzymatic, biochemical and antioxidant profiles were assessed at 5 ℃ for 0, 6, 12, 24 and 30 h of incubation. Results: Inclusion of catalase into diluent resulted in significant (P < 0.05) decrease in percentages of dead spermatozoa, abnormal spermatozoa and acrosomal abnormalities at different hours of storage periods as compared with control group. Additionally, CAT at 50 and 150 U/mL were inferior to CAT 100 U/mL treatments as regards to these characteristics and CAT at 100 U/mL has significant improvement in quality of mithun semen in in- vitro stored for up to 30 h.Conclusions:It was concluded that the possible protective effects of CAT on sperm parameters are it prevent efflux of cholesterol from cell membrane, MDA production and protect the function of antioxidants during preservation.

  6. Genome-wide association with residual body weight gain in Bos indicus cattle.

    Science.gov (United States)

    Santana, M H A; Gomes, R C; Utsunomiya, Y T; Neves, H H R; Novais, F J; Bonin, M N; Fukumasu, H; Garcia, J F; Alexandre, P A; Oliveira Junior, G A; Coutinho, L L; Ferraz, J B S

    2015-01-01

    Weight gain is a key performance trait for beef cat-tle; however, attention should be given to the production costs for better profitability. Therefore, a feed efficiency trait based on per-formance can be an interesting approach to improve performance without increasing food costs. To identify candidate genes and ge-nomic regions associated with residual body weight gain (RWG), we conducted a genome-wide association study (GWAS) with 720 Nellore cattle using the GRAMMAR-Gamma association test. We identified 30 significant single nucleotide polymorphisms (SNPs), especially on chromosomes 2, 8, 12, and 17. Several genes and quantitative train loci (QTLs) present in the regions identified were appointed; we highlight DMRT2 (doublesex and mab-3 related tran-scription factor 2), IFFO2 (intermediate filament family orphan 2), LNX2 (ligand of numb-protein X 2), MTIF3 (mitochondrial transla-tional initiation factor 3), and TRNAG-CCC (transfer RNA glycine anticodon CCC). The metabolic pathways that can explain part of the phenotypic variation in RWG are related to oxidative stress and muscle control. PMID:26125717

  7. Assessment of inbreeding depression in Nellore cows (Bos indicus) through high-density SNP genotypes

    Science.gov (United States)

    Inbreeding has been incriminated as a cause of decrease in reproductive performance in cattle. This negative correlation is known as ‘inbreeding depression’, and evidence supporting this hypothesis was generated from association studies between reproductive traits and estimates of inbreeding coeffic...

  8. Responses of single chorda tympani taste fibers of the calf (Bos taurus).

    Science.gov (United States)

    Hellekant, Göran; Roberts, Thomas; Elmer, Donald; Cragin, Tiffany; Danilova, Vicktoria

    2010-06-01

    In spite of a wealth of information on feed and nutrition in cattle, there little is published of what they actually can taste. Here, we attempt to remedy some of this deficiency by presenting recordings of the chorda tympani proper nerve of young Holstein calves during stimulation of approximately 30 compounds. Hierarchical cluster analysis of 46 single taste fibers separated 4 fiber clusters: N (salt best), H (sour best), and 2 clusters, which could not be related to any human taste quality. The N fibers responded best to LiCl, NaCl, urea, monosodium glutamate, and KCl, whereas the H fibers responded strongly to citric and ascorbic acid. Interestingly, propionic and butyric acid stimulated best the 3rd cluster, whereas the 4th cluster responded best to denatonium benzoate and only to a small extent to quinine hydrochloride. Sweeteners stimulated moderately all clusters. Beginning with the largest response to sweet, the order between the responses was: acesulfame-K, saccharin, D-phenylalanine, glycine, sucrose, fructose, erythritol, cyclamate, and lactose. Alitame, aspartame, and super-aspartame evoked no or little responses. Three and 5 M ethanol stimulated all clusters. Comparison with taste fibers in other species suggests that the taste world of cattle is quite different from other species'. PMID:20212013

  9. Bos taurus papillomavirus activity in peripheral blood mononuclear cells: demonstrating a productive infection.

    Science.gov (United States)

    Melo, T C; Araldi, R P; Pessoa, N S D; de-Sá-Júnior, P L; Carvalho, R F; Beçak, W; Stocco, R C

    2015-01-01

    Bovine papillomavirus (BPV) is an oncogenic virus with mucous and epithelial tropism. Possible productive virus infection in other tissues, such as blood, has been hypothesized. In order to investigate this possibility, three samples of skin papillomas and blood were collected from bovines with BPV infection and five samples of peripheral blood and one sample of normal tissue were collected from a calf without BPV infection. Peripheral blood mononuclear cells (PBMCs) were isolated from whole blood and examined by reverse transcription-polymerase chain reaction, immunofluorescence, in situ hybridization, and electron microscopy. The tissue samples were examined for histopathological and immunohistochemical features. The skin papillomas showed the presence of DNA sequences of BPV-2, BPV-11, and a putative virus type. The blood samples showed DNA sequences of BPV-1, 2, and 4 simultaneously. Immunohistochemistry showed BPV L1 protein in both epithelium and stroma and BPV E2 protein in koilocytes. In situ hybridization confirmed the presence of BPV DNA in PBMCs and immunofluorescence showed nuclear labeling of E2 and L1 BPV proteins in PBMCs. The transcription analysis revealed transcripts of BPV-1 L1, BPV-2 L2, and BPV-4 E7 in blood and papilloma samples of BPV-infected cattle. The comet assay revealed high levels of host cell DNA damage upon BPV infection. Electron microscopy analysis of PBMCs identified the presence of particles in the cytoplasm that are consistent with papillomavirus in size and shape. The productive infection of PBMCs with BPV has been previously discussed and this study provides evidence indicating that PBMCs are a target of BPV. PMID:26681018

  10. Intrinsic movement patterns of grazing Rocky Mountains elk (Cervus elaphus nelsonii) and beef cattle (Bos taurus)

    Science.gov (United States)

    Rocky Mountain elk and cattle are important components of mountainous ecosystems in the western United States and exist contemporaneously on many landscapes. These animals utilize similar resources yet the evolutionary lines that produced them have been distinct for approximately 30 million years. ...

  11. Analysis of genetic diversity and population structure of Chinese yak breeds (Bos grunniens) using microsatellite markers

    Institute of Scientific and Technical Information of China (English)

    Guixiang Zhang; Weisheng Chen; Ming Xue; Zhigang Wang; Hong Chang; Xu Han; Xinjun Liao; Donglei Wang

    2008-01-01

    Nine Chinese yak breeds (Maiwa,Tianzhu White,Qinghai Plateau,Sibu,Zhongdian,Pall,Tibetan High Mountain,Jiulong,and Xin-jiang) and Gayal were analyzed by means of 16 microsatellite markers to determine the level of genetic variation within populations,genetic relationship between populations,and population structure for each breed.A total of 206 microsatellite alleles were observed.Mean F-statistics (0.056) for 9 yak breeds indicated that 94.4% of the genetic variation was observed within yak breeds and 5.6% of the genetic variation existed amongst breeds.The Neighbor-Joining phylogenetic free was constructed based on Nei's standard genetic dis-tances and two clusters were obtained.The Gayal separated from the yaks far away and formed one cluster and 9 yak breeds were grouped together.The analysis of population structure for 9 yak breeds and the Gayal showed that they resulted in four clusters; one clus-ter includes yaks from Tibet Autonomous Region and Qinghai Province,one cluster combines Zhongdian,Maiwa,and Tianzhu White,and Jiulong and Xinjiang come into the third cluster.Pali was mainly in the first cluster (90%),Jiulong was mainly in the second cluster (87.1%),Zhongdian was primarily in the third cluster (83%),and the other yak breeds were distributed in two to three clusters.The Gayal was positively left in the fourth cluster (99.3%).

  12. Nellore cattle (Bos indicus) and ticks within the Brazilian Pantanal: ecological relationships.

    Science.gov (United States)

    Ramos, Vanessa N; Piovezan, Ubiratan; Franco, Ana Helena A; Rodrigues, Vinicius S; Nava, Santiago; Szabó, Matias P J

    2016-02-01

    Pantanal is a huge floodplain mostly in Brazil, and its main economic activity is extensive cattle raising, in farms characterized by an extremely wildlife-rich environment. We herein describe tick infestations of cattle and of the natural environment in Pantanal of Nhecolândia in Brazil, at areas with and without cattle during both dry and wet seasons. Environmental sampling resulted in three tick species: Amblyomma sculptum (423 nymphs and 518 adults), Amblyomma parvum (7 nymphs and 129 adults), Amblyomma ovale (3 adults) as well as three clusters and two individuals of Amblyomma sp. larvae. A significantly higher number of adult A. sculptum ticks was found in areas with cattle in the wet season. From 106 examinations of bovines 1710 ticks from three species were collected: Rhipicephalus microplus (55.7% of the total), A. sculptum (38%) and A. parvum (4.1%), as well as 32 Amblyomma sp. larvae. A significant similarity was found between Amblyomma tick fauna from environment and on cattle during both seasons. All A. sculptum females on bovines were flat whereas many of A. parvum females and A. sculptum nymphs were engorging. Although R. microplus was the most abundant tick species on cattle, overall highest tick prevalence on bovines in the dry season was of A. sculptum nymphs. Lack of R. microplus in environmental sampling, relationship between cattle and increase in adult A. sculptum numbers in the environment as well as suitability of bovine for the various tick species are discussed.

  13. The complete mitochondrial genome of Bos taurus coreanae (Korean native cattle).

    Science.gov (United States)

    Wang, Xi; Zhang, Yuan Qing; He, Dong Chang; Yang, Xiao Ming; Li, Bo; Wang, Dong Cai; Guang, Jin; Xu, Fang; Li, Jun Ya; Gao, Xue; Gao, Hui Jiang; Zhang, Lu Pei; Zhang, Xi Zhong

    2016-01-01

    Korean native cattle is one of the famous native breeds in Korean. In the present work, we report the complete mitochondrial genome sequence of Korean native cattle for the first time. The total length of the mitogenome was 16,339 bp with the base composition of 33.4% for A, 27.2% for T, 26.0% for C, and 13.4% for G, and an A-T (60.6%)-rich feature was detected. It harbored 13 protein-coding genes, 2 ribosomal RNA genes, 22 transfer RNA genes and 1 non-coding control region (D-loop region). The arrangement of all genes was identical to the typical mitochondrial genomes of cattle. The complete mitochondrial genome sequence of Korean native cattle would serve as an important data set of the germplasm resources for further study.

  14. WHOLE GENOME ASSOCIATION ANALYSIS IDENTIFIES SUSCEPTIBILITY ALLELES FOR PARASITIC INFECTION IN BOS TAURUS CATTLE

    Science.gov (United States)

    DNA markers associated with parasite indicator traits are ideal targets for study of marker assisted selection aimed at controlling infections that reduced herd use of anthelminthics. For this study, we collected fecal egg count (FEC) data from post-weaning animals of an Angus resource population c...

  15. Morfometría ovárica de hembras Cebú (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Ana Sánchez

    2007-10-01

    Full Text Available El estudio de la morfometría ovárica está directamente relacionado con sus aplicaciones para analizar e interpretar los hallazgos, en los exámenes ginecológicos de las vacas. Para este trabajo se recolectaron 114 pares de ovarios en frigorífico, clasificados a partir del ancho, grueso, largo, volumen, diámetro del folículo, diámetro y área del cuerpo lúteo. Fue observada una diferencia significativa en el ancho (1,95cm y 1,83cm y el volumen (7,26 mL y 6,23 mL de los ovarios izquierdos y derechos, respectivamente. En cuanto al tamaño y el volumen de los folículos, el diámetro y el área de los cuerpos lúteos, no hubo diferencia relevante. En los lados hubo correlación positiva (p<0,01 entre el volumen del ovario izquierdo y el área del cuerpo lúteo. La presencia de folículos con diámetro igual o superior a 9mm, el cuerpo lúteo de tipo macizo y protruso presente en 43,39% de los 53 ovarios, predominó con relación al tipo cóncavo. De los 84 ovarios con cuerpos lúteos, el 26,20% eran de tipo extrapolado. Se concluye, que la presencia de cuerpo lúteo incluso, en vacas cebú, puede resultar en fallas diagnósticas durante el examen de palpación rectal para estimar la actividad ovárica.

  16. Proteome analysis of functionally differentiated bovine (Bos indicus) mammary epithelial cells isolated from milk

    KAUST Repository

    Janjanam, Jagadeesh

    2013-10-01

    Mammary gland is made up of a branching network of ducts that end in alveoli. Terminally differentiated mammary epithelial cells (MECs) constitute the innermost layer of aveoli. They are milk-secreting cuboidal cells that secrete milk proteins during lactation. Little is known about the expression profile of proteins in the metabolically active MECs during lactation or their functional role in the lactation process. In the present investigation, we have reported the proteome map of MECs in lactating cows using 2DE MALDI-TOF/TOF MS and 1D-Gel-LC-MS/MS. MECs were isolated from milk using immunomagnetic beads and confirmed by RT-PCR and Western blotting. The 1D-Gel-LC-MS/MS and 2DE-MS/MS based approaches led to identification of 431 and 134 proteins, respectively, with a total of 497 unique proteins. Proteins identified in this study were clustered into functional groups using bioinformatics tools. Pathway analysis of the identified proteins revealed 28 pathways (p < 0.05) providing evidence for involvement of various proteins in lactation function. This study further provides experimental evidence for the presence of many proteins that have been predicted in annotated bovine genome. The data generated further provide a set of bovine MEC-specific proteins that will help the researchers to understand the molecular events taking place during lactation. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Particle-in-a-bos model of one-dimensional excitons in conjugated polymers

    DEFF Research Database (Denmark)

    Pedersen, T.G.; Johansen, P.M.; Pedersen, H.C.

    2000-01-01

    A simple two-particle model of excitons in conjugated polymers is proposed as an alternative to usual highly computationally demanding quantum chemical methods. In the two-particle model, the exciton is described as an electron-hole pair interacting via Coulomb forces and confined to the polymer...... backbone by rigid walls. Furthermore, by integrating out the transverse part, the two-particle equation is reduced to one-dimensional form. It is demonstrated how essentially exact solutions are obtained in the cases of short and long conjugation length, respectively. From a linear combination...

  18. Efficiency of utilization of dietary energy for milk production in lactating crossbred cattle (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Debashis Saha

    2012-09-01

    Full Text Available The present study was conducted on efficiency of utilization of dietary energy for milk production in lactating crossbred cattle. 18 lactating crossbred cattle of early to mid-lactation, approximate body weight (375.39±23.43 kg, milk yield, parity and stage of lactation were divided into three groups of six animals each and were fed 0, 50 and 100% diammonium phosphate (DAP in the mineral mixture of concentrates for 120 days. The chaffed mixed roughage (berseem + wheat straw and concentrate mixture was fed to supply about nearly 18:82 concentrate to roughage ratio on dry matter basis. Tap water was available to the animals twice daily. A metabolism trial of seven days was conducted at the end of experiment to study digestibility of organic nutrients and balances of energy. DAP did not affect the nutrient intake, body weight changes, digestibility of Dry matter (DM, Crude protein (CP, Ether extract (EE, Crude fiber (CF, Nitrogen free extract (NFE and daily milk yield. It was concluded that the at 46.07 Mcal Gross energy intake level the losses in feces, urine, methane and heat production was 45.82%, 5.40%, 4.31% and 33.01%, respectively, and net energy retention for milk production was 11.43%. The gross efficiency of conversion of metabolic energy ME for milk production was 35.69% and the net efficiency of conversion of ME for milk production was 39.56%.

  19. Latent Semantic Indexing and Information Retrieval-A quest with BosSE

    OpenAIRE

    Geiß, Johanna

    2006-01-01

    This master thesis deals with the implementation of a search engine using Latent Semantic Indexing (LSI) called BoSSE. Four different search types were implemented which allow a search for documents or terms similar to a given term, query or document. These search types are evaluated and the importance of term weighting, exclusion of non content words and the right selection of k for the reduction of dimension are discussed. Furthermore, an introduction to Latent Semantic Indexing (LSI) and a...

  20. Expansion of the preimmune antibody repertoire by junctional diversity in Bos taurus.

    Directory of Open Access Journals (Sweden)

    Jenni Liljavirta

    Full Text Available Cattle have a limited range of immunoglobulin genes which are further diversified by antigen independent somatic hypermutation in fetuses. Junctional diversity generated during somatic recombination contributes to antibody diversity but its relative significance has not been comprehensively studied. We have investigated the importance of terminal deoxynucleotidyl transferase (TdT -mediated junctional diversity to the bovine immunoglobulin repertoire. We also searched for new bovine heavy chain diversity (IGHD genes as the information of the germline sequences is essential to define the junctional boundaries between gene segments. New heavy chain variable genes (IGHV were explored to address the gene usage in the fetal recombinations. Our bioinformatics search revealed five new IGHD genes, which included the longest IGHD reported so far, 154 bp. By genomic sequencing we found 26 new IGHV sequences that represent potentially new IGHV genes or allelic variants. Sequence analysis of immunoglobulin heavy chain cDNA libraries of fetal bone marrow, ileum and spleen showed 0 to 36 nontemplated N-nucleotide additions between variable, diversity and joining genes. A maximum of 8 N nucleotides were also identified in the light chains. The junctional base profile was biased towards A and T nucleotide additions (64% in heavy chain VD, 52% in heavy chain DJ and 61% in light chain VJ junctions in contrast to the high G/C content which is usually observed in mice. Sequence analysis also revealed extensive exonuclease activity, providing additional diversity. B-lymphocyte specific TdT expression was detected in bovine fetal bone marrow by reverse transcription-qPCR and immunofluorescence. These results suggest that TdT-mediated junctional diversity and exonuclease activity contribute significantly to the size of the cattle preimmune antibody repertoire already in the fetal period.

  1. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    Directory of Open Access Journals (Sweden)

    Schreiber Mark

    2006-11-01

    Full Text Available Abstract Background Single nucleotide polymorphisms (SNPs are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence tagged (EST sequences were used to search for coding SNPs (cSNPs. A total of 15,353 SNPs were detected in the transcribed sequences studied, of which 6,325 were predicted to be coding SNPs with the remaining 9,028 SNPs presumed to be in untranslated regions. Of the cSNPs detected, 2,868 were predicted to result in a change in the amino acid encoded. In order to determine the actual number of non-synonymous polymorphic SNPs we designed assays for 920 of the putative SNPs. These SNPs were then genotyped through a panel of cattle DNA pools using chip-based MALDI-TOF mass spectrometry. Of the SNPs tested, 29% were found to be polymorphic with a minor allele frequency >10%. A subset of the SNPs was genotyped through animal resources in order to look for association with age of puberty, facial eczema resistance or meat yield. Three SNPs were nominally associated with resistance to the disease facial eczema (P Conclusion We have identified 15,353 putative SNPs in or close to bovine genes and 2,868 of these SNPs were predicted to be non-synonymous. Approximately 29% of the non-synonymous SNPs were polymorphic and common with a minor allele frequency >10%. Of the SNPs detected in this study, 99% have not been previously reported. These novel SNPs will be useful for association studies or gene mapping.

  2. Tick loads in Bos taurus cattle grazing in two contrasting production systems

    OpenAIRE

    Raquel Salazar B; Rolando Barahona-Rosales; María-Solange Sánchez P

    2016-01-01

    Objectives. To relate the effect of biotic and abiotic factors on Rhipicephalus (Boophilus) microplus tick loads on cows grazing either in intensive silvopastoral systems (ISS) (Lucerna) or in grass pastures associated with sugarcane plantations (La Isabela). Materials and methods. Tick counts were performed on 27 Lucerne breed animals that were in different physiological states, six of which were grazing on forage grass paddocks associated with commercial sugarcane plantations and the remain...

  3. PRIMER REPORTE DE Cryptosporidium parvum EN TERNEROS HOLSTEIN (Bos taurus DE MANIZALES, CALDAS, COLOMBIA4

    Directory of Open Access Journals (Sweden)

    R. J. Ocampo

    2012-01-01

    Full Text Available RESUMEN El objetivo de este estudio fue identificar especies o genotipos del protozoario parásito Cryptosporidium presentes en heces colectadas de terneros Holstein del municipio de Manizales, Departamento de Caldas, Colombia. El ADN fue extraído a 80 muestras de materia fecal, de las cuales 11 fueron diagnosticadas positivas para Cryptosporidium spp., mediante reacción en cadena de la polimerasa (PCR. El análisis PCR-RFLP del locus 18S ADNr, identificó la presencia de Cryptosporidium parvum en todas las muestras positivas analizadas. Este hallazgo sugiere que el ganado puede ser una fuente potencial de infección por Cryptosporidium en humanos y se constituye en el primer reporte publicado de C. parvum en bovinos de Manizales, Caldas.

  4. Translating culture: Matthee’s Kringe in ’n bos as a case in point

    Directory of Open Access Journals (Sweden)

    W. Cloete

    2007-07-01

    Full Text Available The translation of “cultural identity” in a novel such as “Kringe in ’n bos” contributes towards the definition of a uniquely South African representation of time and space in the global context. When translation is studied as a product of its socio-historical context, the translator is faced with problems of translating ideology and cultural identity in literature. Realia constitute a particular challenge to the translator because, according to the definition, precise equivalents of these words do not exist in other languages, which could cause shifts in the target language text. This article considers the concept of translatability and concludes that, despite the problems encountered, an adequate and satisfactory German translation from the Afrikaans original should be possible. The question of translatability assumes an interesting dimension as the Afrikaans novel was translated into English by the author herself. The privileged position of author-translator granted Matthee a near-perfect understanding of the different layers of meaning and intention of the source text and eliminated the gap between the author and translator. However, one gains the impression that the German translator (Stege resorted to transference as a strategy to avoid translation and it emerges that most instances of definite mistranslations are, indeed, attributable to Stege’s unfamiliarity with the South African context.

  5. Novel Features of the Prenatal Horn Bud Development in Cattle (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Dominique Judith Wiener

    Full Text Available Whereas the genetic background of horn growth in cattle has been studied extensively, little is known about the morphological changes in the developing fetal horn bud. In this study we histologically analyzed the development of horn buds of bovine fetuses between ~70 and ~268 days of pregnancy and compared them with biopsies taken from the frontal skin of the same fetuses. In addition we compared the samples from the wild type (horned fetuses with samples taken from the horn bud region of age-matched genetically hornless (polled fetuses. In summary, the horn bud with multiple layers of vacuolated keratinocytes is histologically visible early in fetal life already at around day 70 of gestation and can be easily differentiated from the much thinner epidermis of the frontal skin. However, at the gestation day (gd 212 the epidermis above the horn bud shows a similar morphology to the epidermis of the frontal skin and the outstanding layers of vacuolated keratinocytes have disappeared. Immature hair follicles are seen in the frontal skin at gd 115 whereas hair follicles below the horn bud are not present until gd 155. Interestingly, thick nerve bundles appear in the dermis below the horn bud at gd 115. These nerve fibers grow in size over time and are prominent shortly before birth. Prominent nerve bundles are not present in the frontal skin of wild type or in polled fetuses at any time, indicating that the horn bud is a very sensitive area. The samples from the horn bud region from polled fetuses are histologically equivalent to samples taken from the frontal skin in horned species. This is the first study that presents unique histological data on bovine prenatal horn bud differentiation at different developmental stages which creates knowledge for a better understanding of recent molecular findings.

  6. Establishment of a pipeline to analyse non-synonymous SNPs in Bos taurus

    OpenAIRE

    Schreiber Mark; Morris Chris A; McCulloch Alan F; Dodds Ken G; Cullen Neil G; Manley Tim R; Glass Belinda C; Keane Orla M; Lee Michael A; Warren Jonathan; Zadissa Amonida; Wilson Theresa; McEwan John C

    2006-01-01

    Abstract Background Single nucleotide polymorphisms (SNPs) are an abundant form of genetic variation in the genome of every species and are useful for gene mapping and association studies. Of particular interest are non-synonymous SNPs, which may alter protein function and phenotype. We therefore examined bovine expressed sequences for non-synonymous SNPs and validated and tested selected SNPs for their association with measured traits. Results Over 500,000 public bovine expressed sequence ta...

  7. New Q lineage found in bovine (Bos taurus) of Iberian Peninsula.

    Science.gov (United States)

    Lopez-Oceja, Andres; Muro-Verde, Amara; Gamarra, David; Cardoso, Sergio; de Pancorbo, Marian M

    2016-09-01

    The northern Iberian Peninsula is home to a variety of autochthonous cattle breeds, such as the Terreña and Pirenaica. With the objective of characterizing the matrilineal lineages of these breeds, a study of mitochondrial DNA was performed. The D-loop of 155 individuals was analyzed and most of the individuals were carriers of the T3 haplogroup, while haplogroups T and T1 were much less frequent. A Pirenaica individual belonging to the Q haplogroup was found. To verify the presence of the Q haplogroup individual, the entire mitochondrial DNA was sequenced and compared with two descendants. The individuals were assigned to the Q1 sub-haplogroup. These findings extend the geographic distribution of the Q haplogroup to the south west of the European continent. This new Q1 lineage has seven polymorphisms in the coding region, so this lineage is probably as old as the Q lineages described to date. PMID:26554433

  8. Nutrition, metabolic profiles and puberty in Brahman (Bos indicus) beef heifers.

    Science.gov (United States)

    Samadi, F; Blache, D; Martin, G B; D'Occhio, M J

    2014-05-01

    The aim of the present study was to gain an improved understanding of the relationships between body weight (BW), body condition (BCS), and metabolic homeostasis, and the attainment of puberty in Brahman heifers in a subtropical environment. Brahman heifers (200±3kg BW; 2.00±0.0 BCS) were assigned to a moderate nutrition (MN, n=11) or improved nutrition (IN, n=11) treatment from 11 to 23 months-of-age. The heifers were monitored at regular intervals for circulating concentrations of GH, IGF-1, insulin, glucose and leptin, and ovarian follicular activity was recorded until the first ovulation. From approximately 16 months of age, heifers on IN had a greater (PBrahman heifers on IN had a metabolic homeostasis that was supportive of reproductive maturation and puberty. PMID:24725537

  9. Adipose tissue macrophages in non-rodent mammals: a comparative study.

    Science.gov (United States)

    Ampem, Grace; Azegrouz, Hind; Bacsadi, Árpád; Balogh, Lajos; Schmidt, Susanne; Thuróczy, Julianna; Röszer, Tamás

    2016-02-01

    The stromal vascular fraction (SVF) of adipose tissue in rodents and primates contains mesenchymal stem cells and immune cells. SVF cells have complex metabolic, immune and endocrine functions with biomedical impact. However, in other mammals, the amount of data on SVF stem cells is negligible and whether the SVF hosts immune cells is unknown. In this study, we show that the SVF is rich in immune cells, with a dominance of adipose tissue macrophages (ATMs) in cattle (Bos primigenius taurus), domestic goat (Capra aegagrus hircus), domestic sheep (Ovis aries), domestic cat (Felis catus) and domestic dog (Canis familiaris). ATMs of these species are granulated lysosome-rich cells with lamellipodial protrusions and express the lysosome markers acid phosphatase 5 (ACP-5) and Mac-3/Lamp-2. Using ACP-5 and Mac-3/Lamp-2 as markers, we additionally detected ATMs in other species, such as the domestic horse (Equus ferus caballus), wild boar (Sus scrofa) and red fox (Vulpes vulpes). Feline and canine ATMs also express the murine macrophage marker F4/80 antigen. In the lean condition, the alternative macrophage activation marker CD206 is expressed by feline and canine ATMs and arginase-1 by feline ATMs. Obesity is associated with interleukin-6 and interferon gamma expression and with overt tyrosine nitration in both feline and canine ATMs. This resembles the obesity-induced phenotype switch of murine and human ATMs. Thus, we show, for the first time, that the presence of ATMs is a general trait of mammals. The interaction between the adipose cells and SVF immune cells might be evolutionarily conserved among mammals. PMID:26239911

  10. Characteristics and functions of a minor FSH surge near the end of an interovulatory interval in Bos taurus heifers.

    Science.gov (United States)

    Ginther, O J; Baldrighi, J M; Siddiqui, M A R; Wolf, C A

    2016-07-01

    The apparent function of a minor FSH surge based on temporality with follicular events was studied in 10 heifers with 2 follicular waves per interovulatory interval. Individual follicles were tracked from their emergence at 2 mm until their outcome was known, and a blood sample was collected for FSH and LH assay every 12 h from day -14 (day 0 = ovulation) to day 4. A minor FSH surge occurred in each heifer (peak, day -4.6 ± 0.2). Concentration of LH increased (P heifers. The maximal diameter (mean, 3.4 ± 0.9 mm) of 77% of the minor-wave follicles occurred in synchrony on day -4.4 ± 0.4. Most (59%) of minor-wave follicles regressed before ovulation and 41% decreased and then increased in diameter (recovered) on day -1.9 ± 0.3 to become part of the subsequent wave 1. A mean of 3.7 ± 0.9 regressing subordinate follicles from wave 2 recovered on the day before or at the peak of the minor FSH surge. The growth rate of the preovulatory follicle decreased (P < 0.02) for 3 d before the peak of the minor FSH surge and then increased (P < 0.03). Concentration of LH increased slightly but significantly temporally with the resurgence in growth rate of the preovulatory follicle. A minor LH surge peaked (P < 0.0002) on day 3 at the expected deviation in growth rates between the future dominant and subordinate follicles. Results indicated on a temporal basis that the recovery of some regressing subordinate follicles of wave 2 was attributable to the minor FSH surge. The hypothesis was supported that some regressing follicles from the minor follicular wave recover to become part of wave 1. PMID:27131335

  11. Variance component estimates applying random regression models for test-day milk yield in Caracu heifers (Bos taurus Artiodactyla, Bovidae

    Directory of Open Access Journals (Sweden)

    Lenira El Faro

    2008-01-01

    Full Text Available Random regression models (RRM were used to estimate covariance functions for 2,155 first-lactation milk yields of native Brazilian Caracu heifers. The models included contemporary group (defined as year-month of test and paddock fixed effects, and quadratic effect of age of cow at calving. Genetic and permanent environmental effects were fitted by a random regression model and Legendre polynomials of days in milk (DIM. Schwarz's Bayesian information criteria (BIC indicated that the best RRM assumed a six coefficient function for both random effects and a sixth order variance function for residual structure. Akaike's information criteria suggested a model with the same number of coefficients for both effects and a residual structure fitted by a step function with 15 variances. Phenotypic, additive genetic, permanent environmental and residual variances were higher at the beginning and declined during lactation. The RRM heritability estimates were 0.09 to 0.26 and generally higher at the beginning and end of lactation. Some unexpected negative genetic correlations emerged when higher order covariance functions were used. A model with four coefficients for additive genetic covariance function explains more parsimoniously the changes in genetic variation with DIM since the genetic parameter was more acceptable and BIC was close to that for a six coefficient covariance function.

  12. Sequence diversity between class I MHC loci of African native and introduced Bos taurus cattle in Theileria parva endemic regions

    DEFF Research Database (Denmark)

    Obara, Isaiah; Nielsen, Morten; Jeschek, Marie;

    2016-01-01

    There is strong evidence that the immunity induced by live vaccination for control of the protozoan parasite Theileria parva is mediated by class I MHC-restricted CD8+ T cells directed against the schizont stage of the parasite that infects bovine lymphocytes. The functional competency of class I...

  13. The efficacy of a vitamin D(3) metabolite for improving the myofibrillar tenderness of meat from Bos indicus cattle.

    Science.gov (United States)

    Lawrence, R W; Doyle, J; Elliott, R; Loxton, I; McMeniman, J P; Norton, B W; Reid, D J; Tume, R W

    2006-01-01

    The influence of a once only administration of a metabolite of vitamin D(3) (HY·D(®)-25-hydroxy vitamin D(3)) on myofibrillar meat tenderness in Australian Brahman cattle was studied. Ninety-six Brahman steers of three phenotypes (Indo-Brazil, US and US/European) and with two previous hormonal growth promotant (HGP) histories (implanted or not implanted with Compudose(®)) were fed a standard feedlot ration for 70d. Treatment groups of 24 steers were offered daily 10g/head HY·D(®) (125mg 25-hydroxyvitamin D(3)) for 6, 4, or 2d before slaughter. One other group of 24 steers was given the basal diet without HY·D(®). Feed lot performance, blood and muscle samples and carcass quality data were collected at slaughter. Calcium, magnesium, potassium, sodium, iron and Vitamin D(3) metabolites were measured in plasma and longissimus dorsi muscle. Warner-Bratzler (WB) shear force (peak force, initial yield) and other objective meat quality measurements were made on the longissimus dorsi muscle of each steer after ageing for 1, 7 and 14d post-mortem at 0-2°C. There were no significant effects of HY·D(®) supplements on average daily gain (ADG, 1.28-1.45kg/d) over the experimental period. HY·D(®) supplements given 6d prior to slaughter resulted in significantly higher (Pmeat colour, ultimate pH, sarcomere length, cooking loss, instron compression or peak force. There was a significant treatment (HY·D(®)) by phenotype/HGP interaction for peak force (P=0.028), in which Indo-Brazil steers without previous HGP treatment responded positively (increased tenderness) to HY·D(®) supplements at 2d when compared with Indo-Brazil steers previously given HGP. There were no significant effects of treatment on other phenotypes. HY·D(®) supplements did not affect muscle or plasma concentrations of calcium, potassium or sodium, but did significantly decrease plasma magnesium and iron concentrations when given 2d before slaughter. There were no detectable amounts of 25-hydroxyvitamin D(3) in the blood or muscle of any cattle at slaughter. PMID:22061376

  14. Impact of puberty status and melengestrol acetate supplementation before the breeding period on reproductive efficiency of Bos indicus beef heifers.

    Science.gov (United States)

    Martins, J H; Santos, C S; Silva, M A V; Aguiar, H M V S B; França, I G; Pereira, H G; Ribeiro, D L; Chaves, R M; Souza, J A T; Monteiro, B M; Sá Filho, M F; Torres-Júnior, J R S

    2015-06-01

    Two experiments were designed to evaluate the impact of puberty status and the administration of melengestrol acetate (MGA) before onset of the breeding period on ovulatory responses (Exp. 1) and conception rate after AI performed on estrus detection during 10 d and the pregnancy rate through 80 d of breeding period (Exp. 2) of pasture-grazed beef heifers. In Exp. 1, heifers (15 pubertal and 15 prepubertal) received 0.5 mg per heifer/d -1 of MGA over 14 d. No differences in the ovulatory responses were found 10 d after the MGA administration (pubertal = 46.7% vs. prepubertal P = 53.3%; P = 0.72). In Exp. 2, 368 heifers were randomly assigned to groups according to pubertal status and the MGA treatment. All heifers were inseminated on estrus detection for up 10 d after MGA administration and following exposure to bulls between 20 and 80 d. The MGA-treated heifers exhibited a greater AI service rate than control heifers (72.1 vs. 41.6%;P breeding period (95.3 vs. 87.5%;P breeding period. At onset of the breeding period, pubertal heifers presented a greater pregnancy rate following AI (pubertal P = 42.2% vs. prepubertal P = 24.9%; P = 0.01). Therefore, pubertal heifers seem to have greater overall reproductive efficiency than prepubertal heifers, particularly at the beginning of the breeding period. Interestingly, administration of MGA before the onset of the breeding period increased AI service rate but did not alter the rate of pregnancy throughout the breeding period of pasture-grazed beef heifers.

  15. Effect of Addition of Taurine on the Liquid Storage (5°C of Mithun (Bos frontalis Semen

    Directory of Open Access Journals (Sweden)

    P. Perumal

    2013-01-01

    Full Text Available The present study was undertaken to assess the effect of taurine on sperm motility, viability, total sperm abnormalities, acrosomal and plasma membrane integrity, enzymatic profiles such as reduced glutathione (GSH, glutathione peroxidase (GPX, superoxide dismutase (SOD, and catalase (CAT, and biochemical profiles such as cholesterol efflux and malondialdehyde (MDA production. A total of 50 ejaculates were collected twice a week from 8 mithun bulls, and semen was split into 4 equal aliquots and diluted with the TEYC extender. Group 1: semen was without additives (control; groups 2 to 4: semen was diluted with 25 mM, 50 mM, and 100 mM of taurine, respectively. Seminal parameters and enzymatic and biochemical profiles were assessed at 5°C. Inclusion of taurine into diluent resulted in significant ( decreases in percentages of dead spermatozoa, abnormal spermatozoa, and acrosomal abnormalities after liquid storage compared with the control group. Additionally, taurine at 50 mM has significant improvement in quality of mithun semen than taurine at 25 or 100 mM stored in in vitro at 5°C. It was concluded that the possible protective effects of taurine on sperm parameters are from enhancing the function of antioxidant enzymes, preventing efflux of cholesterol from cell membranes and decreased MDA production.

  16. Effect of Addition of Melatonin on the Liquid Storage (5°C of Mithun (Bos frontalis Semen

    Directory of Open Access Journals (Sweden)

    P. Perumal

    2013-01-01

    Full Text Available The present study was undertaken to assess the effect of melatonin (MT on sperm motility, viability, total sperm abnormality, acrosomal and plasma membrane integrity, DNA abnormality, antioxidant profiles such as superoxide dismutase (SOD, catalase (CAT, glutathione (GSH and total antioxidant capacity (TAC, enzymatic profiles such as aspartate amino transaminase (AST, alanine amino transaminase (ALT, and biochemical profiles such as malonaldehyde (MDA production and cholesterol efflux. Total numbers of 30 ejaculates were collected twice a week from eight mithun bulls and semen was split into five equal aliquots, diluted with the TEYC extender. Group 1 has semen without additives (control and group 2 to group 5 have semen that was diluted with 1 mM, 2 mM, 3 mM, and 4 mM of melatonin, respectively. These seminal parameters, antioxidant, enzymatic, and biochemical profiles were assessed at 5°C for 0, 6, 12, 24, and 30 h of incubation. Inclusion of melatonin into diluent resulted in significant (P<0.05 decrease in percentages of dead spermatozoa, abnormal spermatozoa, and acrosomal abnormalities at different hours of storage periods as compared with control group. Additionally, melatonin at 3 mM has significant improvement in quality of mithun semen than melatonin at 1 mM, 2 mM or 4 mM stored in in vitro for up to 30 h. It was concluded that the possible protective effects of melatonin on sperm parameters are it prevents MDA production and preserve the antioxidants and intracellular enzymes during preservation.

  17. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus)

    OpenAIRE

    Minh Ha; Manya Sabherwal; Elizabeth Duncan; Stewart Stevens; Peter Stockwell; Michelle McConnell; Alaa El-Din Bekhit; Alan Carne

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 pr...

  18. In-Depth Characterization of Sheep (Ovis aries Milk Whey Proteome and Comparison with Cow (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Minh Ha

    Full Text Available An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes. This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  19. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Roggeman, Saskia, E-mail: saskiaroggeman@gmail.com [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); de Boeck, Gudrun [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); De Cock, Hilde [General Medical Laboratory (Medvet/AML), Department of Pathology, Emiel Vloorsstraat 9, 2020 Antwerpen (Belgium); Blust, Ronny; Bervoets, Lieven [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium)

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day.

  20. Evaluation of bovine (Bos indicus) ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon)

    OpenAIRE

    Kouamo, J.; Dawaye, S.M.; Zoli, A. P.; Bah, G. S.

    2014-01-01

    An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon) for in vitro embryo production (IVEP). The ovaries were excised, submerged in normal saline solution (0.9%) and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ) measured and were grouped into 3 categories: small (Φ 8 mm). Each ovary was then sliced in...

  1. Evaluation of bovine (Bos indicus) ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon).

    Science.gov (United States)

    Kouamo, J; Dawaye, S M; Zoli, A P; Bah, G S

    2014-01-01

    An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon) for in vitro embryo production (IVEP). The ovaries were excised, submerged in normal saline solution (0.9%) and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ) measured and were grouped into 3 categories: small (Φ 8 mm). Each ovary was then sliced into a petri dish; the oocytes were recovered in Dulbecco's phosphate buffered saline, examined under a stereoscope (x10) and graded into four groups based on the morphology of cumulus oophorus cells and cytoplasmic changes of the oocytes. Grade I (GI): oocytes with more than 4 layers of bunch of compact cumulus cells mass with evenly granulated cytoplasm; grade II (GII): oocyte with at least 2-4 layers of compact cumulus cell mass with evenly granulated cytoplasm; grade III (GIII): oocyte with at least one layer of compact cumulus cell mass with evenly granulated cytoplasm; grade IV (GIV): denuded oocyte with no cumulus cells or incomplete layer of cumulus cell or expanded cells and having dark or unevenly granulated cytoplasm. The effects of both ovarian (ovarian localization, corpus luteum, size and weight of ovary) and non-ovarian factors (breed, age, body condition score (BCS) and pregnancy status of cow) on the follicular population and oocyte recovery rate were determined. There were an average of 16.75±0.83 follicles per ovary. The small, medium and large follicles were 8.39±0.60, 8.14±0.43 and 0.21±0.02 respectively. Oocyte recovery was 10.97±0.43 per ovary (65%). Oocytes graded I, II, III and IV were 3.53±0.19 (32.21%), 2.72±0.15 (24.82%), 2.24±0.15 (20.43%) and 2.47±0.20 (22.54%) respectively. The oocyte quality index was 2.26. Younger non pregnant cows having BCS of 3 and large ovaries presented higher number of follicles and oocyte quality (P quality (grade I and II) acceptable for IVEP constituted 57.15% of the harvest. This study indicated that factors such as age, pregnancy status, BCS and ovarian size must be taken into account to increase the potential of the ovary for IVEP. PMID:26623353

  2. Effects of Stocking Density or Group Size on Intake, Growth, and Meat Quality of Hanwoo Steers (Bos taurus coreanae)

    OpenAIRE

    Lee, Sang Moo; Kim, Jae Yeon; Kim, Eun Joong

    2012-01-01

    This study was conducted to investigate the effects of stocking density or group size on feed intake, daily gain, and carcass characteristics of Hanwoo (Korean indigenous breed) steers reared from 7 months to 31 months of age. Thirty Hanwoo steers were divided into four groups with three replicates each (a total of 12 pens). In each group, one (G1), two (G2), three (G3), and four steers (G4) per pen were allocated as treatments. Pen size was 32.0 m2, and therefore Hanwoo steers in G1, G2, G3,...

  3. Effects of Stocking Density or Group Size on Intake, Growth, and Meat Quality of Hanwoo Steers (Bos taurus coreanae).

    Science.gov (United States)

    Lee, Sang Moo; Kim, Jae Yeon; Kim, Eun Joong

    2012-11-01

    This study was conducted to investigate the effects of stocking density or group size on feed intake, daily gain, and carcass characteristics of Hanwoo (Korean indigenous breed) steers reared from 7 months to 31 months of age. Thirty Hanwoo steers were divided into four groups with three replicates each (a total of 12 pens). In each group, one (G1), two (G2), three (G3), and four steers (G4) per pen were allocated as treatments. Pen size was 32.0 m(2), and therefore Hanwoo steers in G1, G2, G3, and G4 were reared under different space allowances, i.e. 32.0, 16.0, 10.6, and 8.0 m(2)/steer, respectively. Steers were reared following a conventional beef cattle management method in Korea, and were offered a fixed amount of commercial concentrate with ad libitum forages. Results were subjected to analysis of variance with stocking density as the main effect, and significance was declared at pmeat yield index, and meat yield grade were similar among all levels of stocking density. However, longissimus muscle area was larger in G1 and G2 (pquality traits, including marbling score, meat color, fat color, texture, maturity and meat quality grade, as determined by a group of experts, were not significantly different among the treatments. In conclusion, lower stocking density resulted in increased feed efficiency, daily gain, and carcass weight in Hanwoo steers. However it remains unclear whether such differences are the results of stocking density or group size, or a combination of both. Nonetheless, these results confirm previous studies reporting a negative effect of increased stocking density on animal productivity. Further, animal welfare under an intensive farming system in relation to economical return is discussed. PMID:25049516

  4. Assessment of adaptability of zebu cattle (Bos indicus) breeds in two different climatic conditions: using cytogenetic techniques on genome integrity.

    Science.gov (United States)

    Kumar, Anil; Waiz, Syma Ashraf; Sridhar Goud, T; Tonk, R K; Grewal, Anita; Singh, S V; Yadav, B R; Upadhyay, R C

    2016-06-01

    The aim of this study was to evaluate the genome integrity so as to assess the adaptability of three breeds of indigenous cattle reared under arid and semi-arid regions of Rajasthan (Bikaner) and Haryana (Karnal) India. The cattle were of homogenous group (same age and sex) of indigenous breeds viz. Sahiwal, Tharparkar and Kankrej. A total of 100 animals were selected for this study from both climatic conditions. The sister chromatid exchanges (SCE's), chromosomal gaps and chromatid breaks were observed in metaphase plates of chromosome preparations obtained from in vitro culture of peripheral blood lymphocytes. The mean number of breaks and gaps in Sahiwal and Tharparkar of semi-arid zone were 8.56 ± 3.16, 6.4 ± 3.39 and 8.72 ± 2.04, 3.52 ± 6.29, respectively. Similarly, the mean number of breaks and gaps in Tharparkar and Kankrej cattle of arid zone were 5.26 ± 1.76, 2.74 ± 1.76 and 5.24 ± 1.84, 2.5 ± 1.26, respectively. The frequency of SCEs in chromosomes was found significantly higher (P P P > 0.05) was observed in the same zone. The analysis of frequency of CAs and SCEs revealed significant effects of environmental conditions on the genome integrity of animals, thereby indicating an association with their adaptability. PMID:26476524

  5. Stroomlijning NatuurPlanBureau modellen. Inventarisatie van en keuze voor modellen voor Natuur, Landschap en Bos

    NARCIS (Netherlands)

    Hinsberg A van; Dijkstra HL; Hinssen PJW; Kramer K; Leus FMR; Reiling R; Tol MWM van der; Wiertz J; Staringcentrum SC-DLO; Instituut voor Bos- en Natuuronderzoek IBN-DLO; Rijksinstituut voor Kust en Zee RIKZ; Rijksinstituut voor Integraal Zoetwaterbeheer en; LBG; MNV; SC-DLO; SC-IBN; RIKZ; RIZA

    1999-01-01

    This report describes the proposal for the set of (ecological) models to be used as the prime tools in the analysis of the Nature, Landscape and Woodland policy by the Dutch Nature Policy Assessment Office. The identification of the key models is regarded as the first step towards the construction o

  6. Generation of bovine (Bos indicus) and buffalo (Bubalus bubalis) adipose tissue derived stem cells: isolation, characterization, and multipotentiality.

    Science.gov (United States)

    Sampaio, R V; Chiaratti, M R; Santos, D C N; Bressan, F F; Sangalli, J R; Sá, A L A; Silva, T V G; Costa, N N; Cordeiro, M S; Santos, S S D; Ambrosio, C E; Adona, P R; Meirelles, F V; Miranda, M S; Ohashi, O M

    2015-01-15

    Adult stem cells are known for their plasticity and their potential to differentiate into several different cell types; these characteristics have implications for cell therapy and reproductive biotechnologies. In this study, we report on the isolation and characterization of mesenchymal stem cells (MSC) derived from bovine and buffalo adipose tissue. Cells isolated using enzymatic digestion of bovine and buffalo adipose-tissue biopsy samples were grown in vitro for at least 15 passages, verifying their capacity to proliferate. These cells were also subjected to immunophenotypic characterization for the presence of CD90, CD105, and CD79, and the absence of CD45, CD34, and CD73, which are positive and negative markers of MSC, respectively. To prove their multipotency, the cells were induced to differentiate into three different cell types, chondrocytes, osteoblasts, and adipocytes, which were stained with tissue-specific dyes (Chondrogenic-Alcian Blue, Osteogenic-Alizarin Red, and Adipogenic-Oil-Red O, respectively) to confirm differentiation. Gene expression analysis of pluripotency-related genes was also conducted. Our results suggest that adipose tissue from bovines and buffalos can be used as a source of MSC, making adipose tissue-derived cells an interesting option for cell therapy and regenerative medicine. Additionally, these findings have implications for reproductive biotechnology because the use of MSC as nuclear donors has been linked to an increase in the efficiency of nuclear transfer.

  7. Comparison of a flow assay for brucellosis antibodies with the reference cELISA test in West African Bos indicus.

    Directory of Open Access Journals (Sweden)

    Barend M deC Bronsvoort

    Full Text Available Brucellosis is considered by the Food and Agricultural Organisation and the World Health Organisation as one of the most widespread zoonoses in the world. It is a major veterinary public health challenge as animals are almost exclusively the source of infection for people. It is often undiagnosed in both human patients and the animal sources and it is widely acknowledged that the epidemiology of brucellosis in humans and animals is poorly understood, particularly in sub-Saharan Africa. It is therefore important to develop better diagnostic tools in order to improve our understanding of the epidemiology and also for use in the field for disease control and eradication. As with any new diagnostic test, it is essential that it is validated in as many populations as possible in order to characterise its performance and improve the interpretation of its results. This paper describes a comparison between a new lateral flow assasy (LFA for bovine brucellosis and the widely used cELISA in a no gold standard analysis to estimate test performance in this West African cattle population. A Bayesian formulation of the Hui-Walter latent class model incorporated previous studies' data on sensitivity and specificity of the cELISA. The results indicate that the new LFA is very sensitive (approximately 87% and highly specific (approximately 97%. The analysis also suggests that the current cut-off of the cELSIA may not be optimal for this cattle population but alternative cut-offs did not significantly change the estimates of the LFA. This study demonstrates the potential usefulness of this simple to use test in field based surveillance and control which could be easily adopted for use in developing countries with only basic laboratory facilities.

  8. Predicting wolf (Canis lupus)-cattle (Bos Taurus) encounters and consequential effects on cattle resource selection patterns

    Science.gov (United States)

    The gray wolf population in Idaho has grown dramatically from the original 35 reintroduced individuals in 1995-1996 to 94 documented packs and a minimum population of 835 individuals in 2009. Wolf depredation on livestock has also increased dramatically with this population growth. Substantial spa...

  9. Fertility in Gyr Cows (Bos indicus) with Fixed Time Artificial Insemination and Visual Estrus Detection Using a Classification Table

    Science.gov (United States)

    Ramírez-Iglesia, Lilido Nelson; Roman Bravo, Rafael María; Díaz de Ramirez, Adelina; Torres, Leandro J.

    2014-01-01

    The aim of this research was to compare two artificial insemination protocols (AIP): hormonal synchronization with fixed time artificial insemination (SC-FTAI) and the use of a table based on visual observation of estrus signs (VO) in order to identify cows in natural or spontaneous estrus being assigned to AI (NSE-IA). Two groups were formed: in the first group 109 cows were assigned to SC-FTAI, in which a commercial protocol is used; the second one included 108 randomly chosen cows, which were assigned to NSE-AI and in this group a modified table was used. Response variable was first service fertility rate (FSF), which was coded 1 for pregnant and 0 for empty. Predictor variables were AIP, postpartum anestrus, daily milk yield, body condition score at AI and calving number. Statistical analyses included association chi-square tests and logistic regression. Results showed an overall 41.94% FSF and a significant association was detected (P 0.05). The odds ratio for the effect of AIP was only 1.050, suggesting no differences in FSF between groups. The NSE-AI protocol can enhance both the technique of VO and reproductive efficiency. Further validation of the table is required. PMID:26464929

  10. Bos(d)-(-B)os(d) Mixing and New Physics Effects in a Top Quark Two-Higgs Doublet Model

    Institute of Scientific and Technical Information of China (English)

    L(U) Lin-Xia; XIAO Zhen-Jun

    2007-01-01

    We calculate the new physics contributions to the neutral B0d and B0s meson mass splitting △Md and △Ms induced by the box diagrams involving the charged-Higgs bosons in the top quark two-Higgs doublet model (T2HDM).Using the precision data, we obtain the bounds on the parameter space of the T2HDM: (a) For fixed MH = 400 Ge V and δ = [0°,60°], the upper bound on tanβ is tanβ≤ 30 after the inclusion of major theoretical uncertainties; (b) For the case of tanβ≤ 20, a light charged Higgs boson with a mass around 300 Ge V is allowed; and (c) The bounds on tanβ and MH are strongly correlated: a smaller (larger) tanβ means a lighter (heavier) charged Higgs boson.

  11. Evaluation of bovine (Bos indicus) ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon)

    Science.gov (United States)

    Kouamo, J.; Dawaye, S.M.; Zoli, A.P.; Bah, G.S.

    2014-01-01

    An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon) for in vitro embryo production (IVEP). The ovaries were excised, submerged in normal saline solution (0.9%) and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ) measured and were grouped into 3 categories: small (Φ 8 mm). Each ovary was then sliced into a petri dish; the oocytes were recovered in Dulbecco’s phosphate buffered saline, examined under a stereoscope (x10) and graded into four groups based on the morphology of cumulus oophorus cells and cytoplasmic changes of the oocytes. Grade I (GI): oocytes with more than 4 layers of bunch of compact cumulus cells mass with evenly granulated cytoplasm; grade II (GII): oocyte with at least 2-4 layers of compact cumulus cell mass with evenly granulated cytoplasm; grade III (GIII): oocyte with at least one layer of compact cumulus cell mass with evenly granulated cytoplasm; grade IV (GIV): denuded oocyte with no cumulus cells or incomplete layer of cumulus cell or expanded cells and having dark or unevenly granulated cytoplasm. The effects of both ovarian (ovarian localization, corpus luteum, size and weight of ovary) and non-ovarian factors (breed, age, body condition score (BCS) and pregnancy status of cow) on the follicular population and oocyte recovery rate were determined. There were an average of 16.75±0.83 follicles per ovary. The small, medium and large follicles were 8.39±0.60, 8.14±0.43 and 0.21±0.02 respectively. Oocyte recovery was 10.97±0.43 per ovary (65%). Oocytes graded I, II, III and IV were 3.53±0.19 (32.21%), 2.72±0.15 (24.82%), 2.24±0.15 (20.43%) and 2.47±0.20 (22.54%) respectively. The oocyte quality index was 2.26. Younger non pregnant cows having BCS of 3 and large ovaries presented higher number of follicles and oocyte quality (P BCS and ovarian size must be taken into account to increase the potential of the ovary for IVEP. PMID:26623353

  12. Evaluation of bovine (Bos indicus ovarian potential for in vitro embryo production in the Adamawa plateau (Cameroon

    Directory of Open Access Journals (Sweden)

    J. Kouamo

    2014-12-01

    Full Text Available An abattoir study was conducted to evaluate the ovarian potential of 201 local zebu cattle from Ngaoundere, Adamawa region (Cameroon for in vitro embryo production (IVEP. The ovaries were excised, submerged in normal saline solution (0.9% and transported to the laboratory for a detailed evaluation. Follicles on each ovary were counted, their diameters (Φ measured and were grouped into 3 categories: small (Φ 8 mm. Each ovary was then sliced into a petri dish; the oocytes were recovered in Dulbecco’s phosphate buffered saline, examined under a stereoscope (x10 and graded into four groups based on the morphology of cumulus oophorus cells and cytoplasmic changes of the oocytes. Grade I (GI: oocytes with more than 4 layers of bunch of compact cumulus cells mass with evenly granulated cytoplasm; grade II (GII: oocyte with at least 2-4 layers of compact cumulus cell mass with evenly granulated cytoplasm; grade III (GIII: oocyte with at least one layer of compact cumulus cell mass with evenly granulated cytoplasm; grade IV (GIV: denuded oocyte with no cumulus cells or incomplete layer of cumulus cell or expanded cells and having dark or unevenly granulated cytoplasm. The effects of both ovarian (ovarian localization, corpus luteum, size and weight of ovary and non-ovarian factors (breed, age, body condition score (BCS and pregnancy status of cow on the follicular population and oocyte recovery rate were determined. There were an average of 16.75±0.83 follicles per ovary. The small, medium and large follicles were 8.39±0.60, 8.14±0.43 and 0.21±0.02 respectively. Oocyte recovery was 10.97±0.43 per ovary (65%. Oocytes graded I, II, III and IV were 3.53±0.19 (32.21%, 2.72±0.15 (24.82%, 2.24±0.15 (20.43% and 2.47±0.20 (22.54% respectively. The oocyte quality index was 2.26. Younger non pregnant cows having BCS of 3 and large ovaries presented higher number of follicles and oocyte quality (P < 0.05 compared with other animals. Oocytes with quality (grade I and II acceptable for IVEP constituted 57.15% of the harvest. This study indicated that factors such as age, pregnancy status, BCS and ovarian size must be taken into account to increase the potential of the ovary for IVEP.

  13. Effect of foot and mouth disease vaccination on seminal and biochemical profiles of mithun (Bos frontalis) semen

    Institute of Scientific and Technical Information of China (English)

    P Perumal; K Khate; C Rajkhowa

    2013-01-01

    Objective: To assess the effect of foot and mouth disease (FMD) vaccination on seminal and biochemical profiles of semen of mithun at pre and post vaccinated stage. Methods: The breeding bulls were maintained at Semen Collection Centre, National Research Centre on Mithun, Jharnapani, Nagaland. A total of 160 ejaculates were collected from eight mithun bulls twice a week at about 4 weeks in pre vaccinated stage and 12 weeks post vaccinated stage to know the effect of vaccine stress on seminal and biochemical profiles of mithun semen. The vaccine was given at the end of 4th week of experimental period and semen was collected and evaluated upto the 16th weeks of experimental period. Results: It revealed that FMD vaccination affected the sperm functional and biochemical parameters significantly (P<0.05) upto 10th weeks of vaccination. But the animal recovered slowly in both physical health and spermiogram.Conclusions:The adverse effect of vaccination on seminal parameters suggest that the semen collection and preservation should be suspended till 10th weeks of vaccination to get normal fertility of sperm to avoid the failure of conception from artificial insemination using such semen in this precious species.

  14. Perfluorooctane Sulfonate Plasma Half-Life Determination and Long-Term Tissue Distribution in Beef Cattle (Bos taurus).

    Science.gov (United States)

    Lupton, Sara J; Dearfield, Kerry L; Johnston, John J; Wagner, Sarah; Huwe, Janice K

    2015-12-30

    Perfluorooctane sulfonate (PFOS) is used in consumer products as a surfactant and is found in industrial and consumer waste, which ends up in wastewater treatment plants (WWTPs). PFOS does not breakdown during WWTP processes and accumulates in the biosolids. Common practices include application of biosolids to pastures and croplands used for feed, and as a result, animals such as beef cattle are exposed to PFOS. To determine plasma and tissue depletion kinetics in cattle, 2 steers and 4 heifers were dosed with PFOS at 0.098 mg/kg body weight and 9.1 mg/kg, respectively. Plasma depletion half-lives for steers and heifers were 120 ± 4.1 and 106 ± 23.1 days, respectively. Specific tissue depletion half-lives ranged from 36 to 385 days for intraperitoneal fat, back fat, muscle, liver, bone, and kidney. These data indicate that PFOS in beef cattle has a sufficiently long depletion half-life to permit accumulation in edible tissues.

  15. The efficacy of a vitamin D(3) metabolite for improving the myofibrillar tenderness of meat from Bos indicus cattle.

    Science.gov (United States)

    Lawrence, R W; Doyle, J; Elliott, R; Loxton, I; McMeniman, J P; Norton, B W; Reid, D J; Tume, R W

    2006-01-01

    The influence of a once only administration of a metabolite of vitamin D(3) (HY·D(®)-25-hydroxy vitamin D(3)) on myofibrillar meat tenderness in Australian Brahman cattle was studied. Ninety-six Brahman steers of three phenotypes (Indo-Brazil, US and US/European) and with two previous hormonal growth promotant (HGP) histories (implanted or not implanted with Compudose(®)) were fed a standard feedlot ration for 70d. Treatment groups of 24 steers were offered daily 10g/head HY·D(®) (125mg 25-hydroxyvitamin D(3)) for 6, 4, or 2d before slaughter. One other group of 24 steers was given the basal diet without HY·D(®). Feed lot performance, blood and muscle samples and carcass quality data were collected at slaughter. Calcium, magnesium, potassium, sodium, iron and Vitamin D(3) metabolites were measured in plasma and longissimus dorsi muscle. Warner-Bratzler (WB) shear force (peak force, initial yield) and other objective meat quality measurements were made on the longissimus dorsi muscle of each steer after ageing for 1, 7 and 14d post-mortem at 0-2°C. There were no significant effects of HY·D(®) supplements on average daily gain (ADG, 1.28-1.45kg/d) over the experimental period. HY·D(®) supplements given 6d prior to slaughter resulted in significantly higher (P<0.05) initial yield values compared to supplements given 2d prior to slaughter. Supplementation had no significant effect on meat colour, ultimate pH, sarcomere length, cooking loss, instron compression or peak force. There was a significant treatment (HY·D(®)) by phenotype/HGP interaction for peak force (P=0.028), in which Indo-Brazil steers without previous HGP treatment responded positively (increased tenderness) to HY·D(®) supplements at 2d when compared with Indo-Brazil steers previously given HGP. There were no significant effects of treatment on other phenotypes. HY·D(®) supplements did not affect muscle or plasma concentrations of calcium, potassium or sodium, but did significantly decrease plasma magnesium and iron concentrations when given 2d before slaughter. There were no detectable amounts of 25-hydroxyvitamin D(3) in the blood or muscle of any cattle at slaughter.

  16. The polymorphisms of bovine cocaine- and amphetamine-regulated transcripts and their associations with cattle (Bos taurus) growth traits

    Indian Academy of Sciences (India)

    Chun Lei Zhang; Hong Chen; Yan Hong Wang; Xian Yong Lan; Chu Zhao Lei; Xing Tang Fang

    2008-09-01

    We investigated the polymorphisms of bovine cocaine- and amphetamine-regulated transcripts (CART). The coding and regulating regions of CART were screened in 7 cattle breeds by the single-stranded conformation polymorphism (SSCP) technique. The four loci (C1, C2, C3 and C4) studied were all polymorphic. Polymerase chain reaction (PCR) products representing different SSCP variants were sequenced and a total of 9 single-nucleotide polymorphisms (SNPs) were found. The associations between polymorphic loci and the growth traits of Nanyang cattle were analysed. The results indicated that genotype A1A1 of the C1 locus was associated with a higher body weight ( < 0.05) than heterozygous A1B1. Genotype A2A2 of the C2 locus was associated with lower body weight and average daily weight gain ( ≤ 0.001) than heterozygous A2B2. C3 and C4 loci had no significant effect on Nanyang cattle growth traits (P > 0.05).

  17. Cadmium, chroom, lood, zink en arseen in het freatische grondwater van de zandgebieden van Nederland, onder bos en heidevelden

    NARCIS (Netherlands)

    Boumans LJM; Fraters B

    1993-01-01

    Concentrations of chromium, lead, cadmium, zinc and arsenic in shallow groundwater under Dutch acid sandy soils with natural and semi-natural vegetation were analysed in this study. At 156 sites we took 10 samples per site of groundwater from within 5 m below the soil surface. All samples were ana

  18. Cadmium, chroom, lood, zink en arseen in het freatische grondwater van de zandgebieden van Nederland, onder bos en heidevelden

    NARCIS (Netherlands)

    Boumans LJM; Fraters B

    1993-01-01

    Concentrations of chromium, lead, cadmium, zinc and arsenic in shallow groundwater under Dutch acid sandy soils with natural and semi-natural vegetation were analysed in this study. At 156 sites we took 10 samples per site of groundwater from within 5 m below the soil surface. All samples were analy

  19. Fertility in Gyr Cows (Bos indicus) with Fixed Time Artificial Insemination and Visual Estrus Detection Using a Classification Table

    OpenAIRE

    Lilido Nelson Ramírez-Iglesia; Rafael María Roman Bravo; Adelina Díaz de Ramirez; Torres, Leandro J.

    2014-01-01

    The aim of this research was to compare two artificial insemination protocols (AIP): hormonal synchronization with fixed time artificial insemination (SC-FTAI) and the use of a table based on visual observation of estrus signs (VO) in order to identify cows in natural or spontaneous estrus being assigned to AI (NSE-IA). Two groups were formed: in the first group 109 cows were assigned to SC-FTAI, in which a commercial protocol is used; the second one included 108 randomly chosen cows, which w...

  20. Biomassa voor energie in de stadsregio Arnhem-Nijmegen : ontwikkelingen van een strategie voor biomassa uit bos, natuur en landschap

    NARCIS (Netherlands)

    Spijker, J.H.; Vries, de E.A.; Derksen, J.T.P.

    2010-01-01

    De Stadsregio Arnhem-Nijmegen heeft behoefte aan een strategie voor de optimale inzet van biomassa uit natuur en landschap voor energie-opwekking. In dit rapport wordt inleidend het huidige aandeel duurzame energie in Nederland en de beleidsopgave uiteengezet. Daarna wordt aangegeven dat er legio ka

  1. Association of CAPN1 and CAST gene polymorphisms with meat tenderness in Bos taurus beef cattle from Argentina

    Directory of Open Access Journals (Sweden)

    Pablo Corva

    2007-01-01

    Full Text Available The activity of the calpains/calpastatin proteolytic system is closely related to the postmortem tenderization of meat. We investigated the association between beef tenderness and single nucleotide polymorphism (SNP markers on the CAPN1 gene (SNP316, alleles C/G; SNP530 alleles A/G and the CAST gene 3' untranslated region (SNP2870, alleles A/G. We sampled nine slaughter groups comprising 313 steers which had been reared in beef production systems in Argentina between 2002 and 2004 from crosses between Angus, Hereford and Limousin cattle. Minor allele frequencies for the markers were 0.27 to 0.46 (C, 0.02 to 0.18 (A, and 0.24 to 0.53 (A, respectively. The presence of CAPN1 markers had significant effects on meat shear force but no detectable effects were demonstrated for the CAST marker. The shear force of meat from steers with the SNP316 CC genotype was 11% lower than for the SNP316 CG genotype and 17% lower than for the SNP316 GG genotype. There were very few steers with the SNP530 AA genotype and, contrary to previous studies, meat from steers with the SNP530 GG genotype showed an 11.5% higher shear force than that from steers with the SNP530 GA genotype. Final body weight, carcass weight and rib eye area were not affected by any of the markers. These results support the concept that CAPN1 variants are associated with tenderness across a wide range of beef production systems.

  2. Recreatief gebruik van bos- en natuurgebieden in Brabant en Limburg 1988 [Visiting forests and nature reserves for recreational purposes 1988

    NARCIS (Netherlands)

    Peltzer, R.H.M.

    1988-01-01

    Visiting forests and nature reserves for recreational purposes Frequency and destination of holidays and short holidays / leisure outdoor activities in the Netherlands / having one or more dogs / other activities like visiting relatives and friends, going to the beach, visiting forests and other nat

  3. Screening and characterization of a novel ruminal cellulase gene (Umcel-1) from a metagenomic library of gayal (Bos frontalis)

    Institute of Scientific and Technical Information of China (English)

    LI Bi-feng; MAO Hua-ming; YANG Shu-Li; ZHU Ya-xin; GU Zhao-bing; CHEN Yuan; LENG Jing; GOU Xiao; FENG Li; LI Qing; XI Dong-mei

    2016-01-01

    Gayal is a rare semi-wild bovine species found in the Indo-China. They can graze grasses, including bamboo leaves, as wel as reeds and other plant species, and grow to higher mature live weights than Yunnan Yelow cattle maintained in similar harsh environments. The aim of this study was to identify speciifc celulase in the gayal rumen. A metagenomic fosmid library was constructed using genomic DNA isolated from the ruminal contents of four adult gayals. This library contained 38400 clones with an average insert size of 35.5 kb. TheUmcel-1 gene was isolated from this library. Investigation of the celulase activity of 24 random clones led to the identiifcation of theUmcel-1 gene, which exhibited the most potent celulase activity. Sequencing theUmcel-1 gene revealed that it contained an open reading frame of 942 base pairs that encoded a product of 313 amino acids. The putativegene Umcel-1 product belonged to the glycosyl hydrolase family 5 and showed the highest homology to the celulase (GenBank accession no. YP_004310852.1) fromClostridium lentocelum DSM 5427, with 44% identity and 62% similarity. TheUmcel-1 gene was heterologously expressed inEscherichia coli BL21, and recombinant Umcel-1 was puriifed. The activity of puriifed recombinant Umcel-1 was assessed, and the results revealed that it hydrolyzed carboxymethyl celulose with optimal activity at pH 5.5 and 45°C. To our knowledge, this study provides the ifrst evidence for a celulase produced by bacteria in gayal rumen.

  4. Bos indicus-cross feedlot cattle with excitable temperaments have tougher meat and a higher incidence of borderline dark cutters.

    Science.gov (United States)

    Voisinet, B D; Grandin, T; O'Connor, S F; Tatum, J D; Deesing, M J

    1997-08-01

    Temperament ratings based on a numerical scale (chute score) were assessed during weighing and handling of cattle at a feedlot. Breeds studied included Braford, Red Brangus and Simbrah. Cattle were fed to a constant fat thickness of 9 to 13 mm (target = 11 mm) over the 12th rib as determined by periodic ultrasound measurements. Cattle were slaughtered in a commercial slaughter plant and stunned by captive bolt. Temperament rating had a significant effect on the incidence of borderline dark cutters which were downgraded by a USDA grader (P = 0.01). Temperament score also had a significant effect on tenderness (P < 0.001) as evaluated by Warner-Bratzler Shear (WBS) force at day 14 post mortem. The calmest animals which stood still when restrained in a hydraulic squeeze chute had a mean WBS force of 2.86 ± 11 kg and cattle which became highly agitated and struggled violently during restraint averaged 3.63 ± 19 kg. Forty percent of these cattle had WBS force values which were over 3.9 kg which is a threshold value for acceptability in food service establishments. These data show that cattle with the most excitable temperament ratings produce carcasses with tougher meat and a higher incidence of borderline dark cutters than cattle with calm temperament ratings. PMID:22062320

  5. Localisation of aphidicolin-induced break points in Holstein-Friesian cattle (Bos taurus using RBG-banding

    Directory of Open Access Journals (Sweden)

    Mernies Beatriz

    2002-11-01

    Full Text Available Abstract Fragile sites (FS seem to play a role in genome instability and may be involved in karyotype evolution and chromosome aberrations. The majority of common fragile sites are induced by aphidicolin. Aphidicolin was used at two different concentrations (0.15 and 0.30 μM to study the occurrence of FS in the cattle karyotype. In this paper, a map of aphidicolin induced break points and fragile sites in cattle chromosomes was constructed. The statistical analysis indicated that any band with three or more breaks was significantly damaged (P r = 0.54. On the contrary, 21 FS were identified on negative R bands while 9 FS were located on positive R bands.

  6. Efecto de SNPs de genes candidatos asociados a textura de la carne en bovinos Bos indicus y sus cruces

    OpenAIRE

    Pinilla López, Yenny Catherine

    2014-01-01

    La terneza de la carne es el principal atributo de aceptación de la carne por parte del consumidor, sin olvidar las características de jugosidad y el sabor; por lo que su impacto en la rentabilidad y la calidad de la carne es de gran importancia. La terneza de la carne de bovinos está influenciada por factores genéticos y ambientales. El evaluar el desempeño de la terneza a través de factores como son el tiempo de maduración y el efecto del cruce de los animales, estos han sido de uso frecuen...

  7. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    International Nuclear Information System (INIS)

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day

  8. Comparison of F1 Bos indicus x Hereford cows in central Texas: I. Reproductive, maternal, and size traits.

    Science.gov (United States)

    Riley, D G; Sanders, J O; Knutson, R E; Lunt, D K

    2001-06-01

    Cows (n = 116) sired by Angus, Gray Brahman, Gir, Indu-Brazil, Nellore, and Red Brahman bulls and from Hereford dams were evaluated (when bred to the same breed of bull) for reproductive performance and cow weight and height and their calves (n = 1,161) were evaluated for birth and weaning weight in central Texas (temperate winters and subtropical summers). Cows were born from 1982 to 1985 and their calves were born from 1985 to 1999. Crossbred cows sired by Angus had a higher (P Brahman crossbreds. Calves from Gir crossbreds had lighter (P Angus and Red Brahman crossbreds (39.4 and 37.2 kg). Calves from Angus crossbreds cows had lighter (P Angus were lighter (P Brahman, Indu-Brazil, and Red Brahman crossbreds (585.6, 571.9, and 577.6 kg, respectively). They also had smaller (P Angus and Indu-Brazil crossbred cows were lower (P < or = 0.10) than Gir and Nellore crossbreds for pregnancy rate, calf crop born, and(or) calf crop weaned at some, but not all, ages. Indu-Brazil crossbreds had a lower (P < or = 0.10) calf survival rate than most other breed groups at ages 11 to 14 yr. The results of this study indicate that Nellore and Gir crossbreds, but not Indu-Brazil, could perform as well or better than breeds traditionally used in cross-breeding programs of U.S. cow-calf production. PMID:11424679

  9. Assessment of adaptability of zebu cattle ( Bos indicus) breeds in two different climatic conditions: using cytogenetic techniques on genome integrity

    Science.gov (United States)

    Kumar, Anil; Waiz, Syma Ashraf; Sridhar Goud, T.; Tonk, R. K.; Grewal, Anita; Singh, S. V.; Yadav, B. R.; Upadhyay, R. C.

    2016-06-01

    The aim of this study was to evaluate the genome integrity so as to assess the adaptability of three breeds of indigenous cattle reared under arid and semi-arid regions of Rajasthan (Bikaner) and Haryana (Karnal) India. The cattle were of homogenous group (same age and sex) of indigenous breeds viz. Sahiwal, Tharparkar and Kankrej. A total of 100 animals were selected for this study from both climatic conditions. The sister chromatid exchanges (SCE's), chromosomal gaps and chromatid breaks were observed in metaphase plates of chromosome preparations obtained from in vitro culture of peripheral blood lymphocytes. The mean number of breaks and gaps in Sahiwal and Tharparkar of semi-arid zone were 8.56 ± 3.16, 6.4 ± 3.39 and 8.72 ± 2.04, 3.52 ± 6.29, respectively. Similarly, the mean number of breaks and gaps in Tharparkar and Kankrej cattle of arid zone were 5.26 ± 1.76, 2.74 ± 1.76 and 5.24 ± 1.84, 2.5 ± 1.26, respectively. The frequency of SCEs in chromosomes was found significantly higher ( P 0.05) was observed in the same zone. The analysis of frequency of CAs and SCEs revealed significant effects of environmental conditions on the genome integrity of animals, thereby indicating an association with their adaptability.

  10. NCBI nr-aa BLAST: CBRC-RMAC-01-0084 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-01-0084 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 0.0 78% ...

  11. NCBI nr-aa BLAST: CBRC-TNIG-22-0261 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-22-0261 ref|XP_594146.3| PREDICTED: Toll-like receptor 5 [Bos taurus] gb|...ABC68311.1| toll-like receptor 5 [Bos taurus] gb|ABU86924.1| Toll-like receptor 5 [Bos taurus x Bos indicus]... gb|ABU86926.1| Toll-like receptor 5 [Bos taurus] gb|ABU86927.1| Toll-like receptor 5 [Bos taurus] gb|ABU869...28.1| Toll-like receptor 5 [Bos taurus] gb|ABU86929.1| Toll-like receptor 5 [Bos tau...rus] gb|ABU86931.1| Toll-like receptor 5 [Bos taurus x Bos indicus] gb|ABU86932.1| Toll-like receptor 5 [Bos taurus x Bos indicus] XP_594146.3 9e-85 39% ...

  12. Radiocarbon chronologies and extinction dynamics of the Late Quaternary mammalian megafauna of the Taimyr Peninsula, Russian Federation

    NARCIS (Netherlands)

    MacPhee, RDE; Tikhonov, AN; Mol, D; Maliave, CD; Van der Plicht, H; Greenwood, AD; Flemming, C; Agenbroad, L; MacPhee, Ross D.E.; Tikhonov, Alexei N.; Marliave, Christian de; Greenwood, Alex D.

    2002-01-01

    This paper presents 75 new radiocarbon dates based on late Quaternary mammal remains recovered from eastern Taimyr Peninsula and adjacent parts of the northern Siberian lowlands, Russian Federation, including specimens of woolly mammoth (Mammuthus primigenius), steppe bison (Bison priscus), muskox (

  13. El medio ambiente durante el Pleistoceno Superior en la región Cantábrica con referencia especial a sus faunas de mamíferos.

    Directory of Open Access Journals (Sweden)

    Jesús Altuna

    1992-01-01

    Isturitz, no han sido hallados fósiles hasta el presente en el Cantábrico. Aumentan el corzo y el jabalí a partir de Alleröd. Por fín el paso al Holoceno lo marca la desaparición total del reno, la disminución de caballo, cabra y sarrio, el aumento de corzo y jabalí y la presencia única de Bos primigenius entre los Bovinos.

  14. The first appearance of cattle in Denmark occurred 6000 years ago: an effect of cultural or climate and environmental changes

    DEFF Research Database (Denmark)

    Noe-Nygaard, Nanna; Hede, Mikkel Ulfeldt

    2006-01-01

    Stable carbon and nitrogen isotope ratios from bones of contemporaneous Late Atlantic aurochs and early cattle in eastern Denmark are significantly different and provide information on the origin and feeding strategies of the earliest domestic cattle. The data show that the early cattle were...... the youngest aurochs have similar values to Late Atlantic red deer from the same locality. As eastern Denmark was largely covered by forest, speculations on the origin of the grazing areas are many. The grass may have grown in openings in the forest, at the forest fringe, or more likely on the newly reclaimed...

  15. Oxidative stress and nutritional intakes in lung patients with bronchiolitis obliterans syndrome.

    Science.gov (United States)

    Madill, J; Aghdassi, E; Arendt, B M; Gutierrez, C; Singer, L; Chow, C-W; Keshavjee, S; Allard, J P

    2009-11-01

    Survival after lung transplantation is limited by bronchiolitis obliterans syndrome (BOS). Oxidative stress (OxS) can be associated with BOS due to chronic inflammation. The type of fat and antioxidant intakes may also contribute to OxS. Our aim was to compare OxS and nutritional intakes in non-BOS versus various stages of BOS. Fifty-eight lung recipients with versus without BOS were prospectively classified as: non-BOS; BOS Op-1 (mild), and BOS 2-3 (severe). We measured nutritional intake and plasma vitamins A, C, and E. Among a subgroup of 37 patients, OxS was assessed by measuring lipid peroxidation (LPO micromol/L MDA) and oxidized glutathione (GSSG) in bronchoalveolar lavage BAL fluid (BALF). One-way analysis of variance was used to compare groups. Results are reported as mean values +/- standard errors of the mean. There was no significant difference in demographic features on time posttransplant among groups. Although there were comparable cell counts in BALF, severe BOS patients showed significantly higher BALF LPO concentrations when compared with milder stage of BOS or with non-BOS (P = .001, for both). Severe BOS recipients also displayed higher BALF GSSG concentrations compared to milder stage of BOS (P = .001) or non-BOS (P = .007). In conclusion, patients with severe BOS were more oxidatively stressed compared with mild and non-BOS recipients. PMID:19917398

  16. Gene : CBRC-ACAR-01-0189 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CTED: hypothetical protein [Bos taurus] 1e-06 28% MQIDLMTMSFVAKFGVIWFSGFVVYSIGIILSTNKTQSGYVSIISIIISMIYTPLILSTNKTQSGYVSIISII...ISMIYTPLILSTNKTQSVYVSIISIIISIIYTPLILSTNKTQSVYVSIISIIISMIYTPLILSTNKTQSVYVSITSIIISIIYTPLILSTNKTQSVYVSITSIIISIIYTPLILSTNKTQSGYVSIISIIYTPLILSTNKTQRSYVSINSISMYYYIAA ...

  17. NCBI nr-aa BLAST: CBRC-TTRU-01-1041 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1041 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  18. NCBI nr-aa BLAST: CBRC-PVAM-01-0803 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0803 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 83% ...

  19. NCBI nr-aa BLAST: CBRC-VPAC-01-1397 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1397 gb|ABU86942.1| Toll-like receptor 10 [Bos taurus x Bos indicus] g...b|ABU86944.1| Toll-like receptor 10 [Bos taurus] gb|ABU86945.1| Toll-like receptor 10 [Bos taurus] gb|ABU869...46.1| Toll-like receptor 10 [Bos taurus] gb|ABU86949.1| Toll-like receptor 10 [Bos taurus x Bos indicus] ABU86942.1 0.0 88% ...

  20. Taxonomy Icon Data: cattle [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available rus_L.png Bos_taurus_NL.png Bos_taurus_S.png Bos_taurus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Bos+taurus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Bos+taurus&t=NL http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Bos+taurus&t=S http://biosciencedbc.jp/taxonomy_icon/ico...n.cgi?i=Bos+taurus&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=28 ...

  1. A novel analytical method, Birth Date Selection Mapping, detects response of the Angus (Bos taurus genome to selection on complex traits

    Directory of Open Access Journals (Sweden)

    Decker Jared E

    2012-11-01

    Full Text Available Abstract Background Several methods have recently been developed to identify regions of the genome that have been exposed to strong selection. However, recent theoretical and empirical work suggests that polygenic models are required to identify the genomic regions that are more moderately responding to ongoing selection on complex traits. We examine the effects of multi-trait selection on the genome of a population of US registered Angus beef cattle born over a 50-year period representing approximately 10 generations of selection. We present results from the application of a quantitative genetic model, called Birth Date Selection Mapping, to identify signatures of recent ongoing selection. Results We show that US Angus cattle have been systematically selected to alter their mean additive genetic merit for most of the 16 production traits routinely recorded by breeders. Using Birth Date Selection Mapping, we estimate the time-dependency of allele frequency for 44,817 SNP loci using genomic best linear unbiased prediction, generalized least squares, and BayesCπ analyses. Finally, we reconstruct the primary phenotypes that have historically been exposed to selection from a genome-wide analysis of the 16 production traits and gene ontology enrichment analysis. Conclusions We demonstrate that Birth Date Selection Mapping utilizing mixed models corrects for time-dependent pedigree sampling effects that lead to spurious SNP associations and reveals genomic signatures of ongoing selection on complex traits. Because multiple traits have historically been selected in concert and most quantitative trait loci have small effects, selection has incrementally altered allele frequencies throughout the genome. Two quantitative trait loci of large effect were not the most strongly selected of the loci due to their antagonistic pleiotropic effects on strongly selected phenotypes. Birth Date Selection Mapping may readily be extended to temporally-stratified human or model organism populations.

  2. 牦牛矿物质营养研究进展%Research Progress of Mineral Nutrition of Yak (Bos grunniens )

    Institute of Scientific and Technical Information of China (English)

    马国璧; 才让东智; 赵月平; 陈生梅; 马志杰

    2012-01-01

    自20世纪90年代以来,牦牛矿物质营养研究一直受到科研人员的重视.目前,在对牦牛部分组织及畜产品、牦牛生存地牧草和土壤中矿物质含量测定等方面已取得一定的成果.对近20 a来牦牛矿物质营养研究进展进行了综合论述和分析.受牦牛性别、年龄以及组织类型、所测矿物质元素种类、不同区域生态类型和草场状况等因素的影响,所测定的矿物质元素水平间缺乏可比性.同时,牦牛矿物质营养研究缺乏系统性,这在一定程度上限制了其研究成果在牦牛生产中的实际指导作用.由此提出,应建立针对不同区域生态类型、草场状况和针对不同年龄、性别、组织以及不同季节的牦牛矿物质营养标准.%Since the late 1990s,researchers pay more attention to the studies on mineral nutrition of yak and some achievements have been obtained from the measurements of minerals content in some yak's tissues and products (i. e. meat,milk, et al. ), the grass and soil where yak lived. In this paper,the authors summarized the research progress of mineral nutrition of yak during the past 20 years. However, the differences of sex, age, ecological grassland types, mineral element types and other factors result in the lack of comparability at the mineral element levels in yak. At the same time, the researches of mineral nutrition in yak are also lack of systematic analysis, which restricts the use of research results in yak production and the practical guide. Therefore, the authors think that it is necessary and urgent to establish the mineral nutrition standard in yak based on the different area, seasons, ecological types and grassland status, together with the age and sex of yak.

  3. Genome-wide association study for birth weight Brazilian Nellore cattle (Bos primigenuis indicus) points to previously described orthologous genes affecting human and bovine height

    Science.gov (United States)

    Birth weight (BW) is an economically important trait in beef cattle, and is associated with growth- and stature-related traits. One region of the cattle genome, located on bovine autosome (BTA) 14, has been previously shown to be associated with stature by multiple independent studies, and contains ...

  4. The prey pathway: a regional history of cattle (Bos taurus and pig (Sus scrofa domestication in the northern Jordan Valley, Israel.

    Directory of Open Access Journals (Sweden)

    Nimrod Marom

    Full Text Available The faunal assemblage from the 9(th-8(th millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  5. The prey pathway: a regional history of cattle (Bos taurus) and pig (Sus scrofa) domestication in the northern Jordan Valley, Israel.

    Science.gov (United States)

    Marom, Nimrod; Bar-Oz, Guy

    2013-01-01

    The faunal assemblage from the 9(th)-8(th) millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th) millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  6. Effect of seasons on semen production, effect of melatonin on the liquid storage (5℃) with correlated study of birth rate in mithun (Bos frontalis)

    Institute of Scientific and Technical Information of China (English)

    P Perumal; JK Chamuah; AK Nahak; C Rajkhowa

    2015-01-01

    Objective: To assess the effect of melatonin (MT) at different seasons of the year on sperm motility, viability, total sperm abnormality, acrosomal membrane, plasma membrane and nuclear integrity, antioxidant profiles such as superoxide dismutase (SOD), catalase (CAT), glutathione (GSH) and total antioxidant capacity (TAC), enzymatic profiles such as aspartate amino transaminase (AST), alanine amino transaminase (ALT) and biochemical profiles such as malondialdehyde (MDA) production. Methods: Total numbers of 80 ejaculates (20 ejaculates in each season) were collected twice a week from mithun bulls and semen was split into five equal aliquots, diluted with the tris egg yolk citrate (TEYC) extender. Group 1:semen without additives (control), group 2 to group 5:semen was diluted with 1 mM, 2 mM, 3 mM, and 4 mM of melatonin, respectively. These seminal parameters, antioxidant, enzymatic and biochemical profiles were assessed at liquid storage of mithun semen (5 ℃). Simultaneously, retrospective study was conducted on birth rate of calf at different seasons from 2002 to 2012 from farm birth register of mithun farm. Results: Inclusion of melatonin into diluent resulted in significant (P<0.05) decrease in percentages of dead spermatozoa, abnormal spermatozoa and acrosomal abnormalities at different seasons of the year as compared with control group. Additionally, spring season has highest seminal and antioxidant profiles followed by autumn and winter season, whereas lower values were observed in ejaculates collected from summer season. Similarly retrospective study revealed that highest birth rate was in winter followed by autumn, spring and summer season and breeding was occurred in spring, winter, summer and autumn season, respectively with gestation period of 270- 290 days. Conclusions:The result of present study indicates that the melatonin protects seminal and antioxidant profiles varied in different seasons, semen quality also varied from different seasons and was highest in spring and lowest in summer season. It was concluded from the present study that breeding takes place throughout year but the peak breeding season is from November to April (spring and winter season) in mithun.

  7. Measurement of the CP-violating phase φs in the decay Bo/s →J/ψ/φ

    OpenAIRE

    Fitzpatrick, Conor Thomas

    2012-01-01

    The LHCb experiment is dedicated to making precision measurements involving beauty and charm hadrons at the CERN Large Hadron Collider. The LHCb RICH detectors provide charged particle identification required to distinguish final states in many decays important to the LHCb physics programme. Time alignment of the RICH photon detectors is necessary in order to ensure a high photon collection efficiency. Using both a pulsed laser and proton-proton collision data the photon det...

  8. Genome-wide DNA methylation profiles and their replationship with mRNA and the microRNA transcriptome in bovine muscle tissue (Bos Taurine)

    Science.gov (United States)

    DNA methylation is a key epigenetic modification in mammals, having essential and important roles in muscle development. We sample longissimus thoracis tissues from a well-known elite native breed of Chinese Qinchuan cattle living within comparable environments at fetal and adult stages, using methy...

  9. Serological survey of bovine brucellosis in Fulani nomadic cattle breeds (Bos indicus) of North-central Nigeria: Potential risk factors and zoonotic implications.

    Science.gov (United States)

    Alhaji, N B; Wungak, Y S; Bertu, W J

    2016-01-01

    A cross sectional study was conducted to investigate seroprevalence and associated risk factors of bovine brucellosis in Fulani nomadic herds in the 3 agro-ecological zones of Niger State, North-central Nigeria between January and August 2013. A total of 672 cattle in 113 herds were screened for Brucella antibodies using Rose Bengal Plate Test (RBPT) and confirmed by Lateral flow Assay (LFA). Data on herd characteristics and zoonotic factors were collected using structured questionnaire administered on Fulani herd owners. Factors associated with Brucella infection were tested using Chi-square test and multivariable logistic model. The overall cattle-level seroprevalence was 1.9% (95% CI: 1.1-3.2) with highest in agro-zone C (3.2%). Herd-level seroprevalence was 9.7% (95% CI: 5.23-16.29) and highest in agro-zone C (13.5%). Sex and agro-ecological zones were significantly (Ppractices were significantly associated with brucellosis occurrence. Inhalation of droplets from milk of infected cows, and drinking raw milk were less likely [OR 0.27; 95% CI: 0.09-0.82 and OR 0.27; 95% CI: 0.08-0.99, respectively] not to predisposed to brucellosis in humans. Eating infected raw meat, and contact with infected placenta were more likely [OR 7.49; 95% CI: 2.06-28.32 and OR 5.74; 95% CI: 1.78-18.47, respectively] to be risks for the disease in humans. These results highlighted the important risk factors for bovine brucellosis in Fulani herds. Thus, brucellosis control programs which take these factors into consideration will be beneficial. PMID:26464048

  10. Protocolos de inseminación artificial a tiempo fijo en vacas (Bos indicus en el trópico bajo

    Directory of Open Access Journals (Sweden)

    Andrés M. Sanabria-V.

    2011-02-01

    Full Text Available En una hacienda de clima tropical bajo, se evalula  respuesta  a  tres  programas de  Inseminación Artificial a Tiempo Fijo (IATF en 30 vacas vacías cebú  comercial, cíclicas,  con buena  condición corporal,  seleccionadas por  palpación  rectal  ydistribuidas al azar en  tres grupos de 10 vacas cada uno. A  éstos  se  les  asignó  un  protocolo  de sincronización de celos y ovulación diferente. En el grupo 1 se utilizó un dispositivo  intravaginal impregnado con progesterona;  las vacas del grupo 2 recibieron un  implante auricular  impregnado de Norgestomet  y  en  el  grupo  3  se  realizó  el protocolo de Ovsynch. Se diagnosticó la preñez mediante ultrasonografía, 30 días después de la inseminación en  los  tratamientos y  los datos  fueron analizados mediante  estadística descriptiva  con variables  de  tipo  cuantitativo.  Los  resultados obtenidos para el grupo 1, fueron 4 de 10 vacas preñadas, en el grupo 2, 6 de 10 vacas preñadas y en  el  grupo  3, 3  de 10  vacas. Se  encontraron diferencias  significativas  entre  las  vacas  que recibieron  el  implante  auricular,  así  como  a aquellas  vacas que  se  les hizo  el protocolo de Ovsynch,  pero  no  se  encontraron  diferencias significativas  entre  el  dispositivo  intravaginal impregnado con progesterona,  respecto de  los dos restantes. El valor más económico por preñez se obtuvo  con  la  utilización  del  protocolo  de Ovsynch; sin embargo, en  términos de eficiencia,fue mejor usar el implante auricular impregnado de  Norgestomet;  esto  por  razones  de mejoramiento  genético.  De  esta  forma  se concluyó que el protocolo del implante auricular con Norgestomet  tuvo una superior  tasa de preñez,sin que  esto  sea  una  constante,  debido  a  que  existen diferentes  factores que hacen variar  los resultados de la IATF.

  11. Alteración diurna de la carga calórica corporal e interrelación de las temperaturas rectal y láctea en vacas cruzadas (6/8 Bos taurus x 2/8 Bos indicus, Pardo Suizo y Holstein bajo estrés calórico diurno durante la época seca en el clima tropical húmedo - Daytime alteration of body heat load and relationship between rectal and milk temperatures in crossbred (6/8 Bos taurus x 2/8 Bos indicus, Brown Swiss and Holstein lactating cows under heat stress during summer time in the humid tropical climate

    Directory of Open Access Journals (Sweden)

    Araúz, E. E.

    2010-11-01

    Full Text Available ResumenLas temperaturas rectal y de la secreción láctea y la carga calóricacorporal fueron evaluadas en 191 vacas en lactación (cruzadas 6/8Pardo Suizo x 2/8 Cebú y 6/8 Holstein x 2/8 Cebú: 27; Pardo Suizo:131; y Holstein: 33; bajo estrés calórico diurno en la época secadistribuidas entre 45 y 1064 msnm; con el objetivo de establecer laalteración diurna y su interrelación según el grupo genético y el grado de sensibilidad calórica.SummaryRectal and milk temperatures were measured in the afternoon (2 PM to4 PM in 191 lactating dairy cows (6/8 Brown Swiss x 2/8 Zebu and 6/8Holstein x 2/8 Zebu: 27, Brown Swiss: 131 and Holstein: 33 underheat stress in the tropical environment to evaluate daytime alterationof body heat load and establish the relationship between rectal andmilk temperature.

  12. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus) gestantes e não gestantes

    OpenAIRE

    L.R. Vargas; P.R. Xavier; C.A. Rezende; M.M. Neves; A.P. Marques Júnior

    2015-01-01

    Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o tr...

  13. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae) in two protected areas of Goa

    OpenAIRE

    S.D. Gad; S.K. Shyama

    2009-01-01

    Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%). In summer gaur also consumed the bark of cashew (Anacardium occidentale) and teak (Tectona grandis) trees. Strong association was observed between food preference and season (chi-square...

  14. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae in two protected areas of Goa

    Directory of Open Access Journals (Sweden)

    S.D. Gad

    2009-02-01

    Full Text Available Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%. In summer gaur also consumed the bark of cashew (Anacardium occidentale and teak (Tectona grandis trees. Strong association was observed between food preference and season (chi-square=12.94; p=0.001. Peak feeding activity was observed early in the morning (0630 to 0830 hr and in the evening (1730 to 1845 hr. During hot hours of the day (1330 to 1530 hr, animals were found resting in the shade of large trees.

  15. Effect of seasons on semen production, effect of melatonin on the liquid storage (5 °C with correlated study of birth rate in mithun (Bos frontalis

    Directory of Open Access Journals (Sweden)

    P Perumal

    2015-03-01

    Conclusions: The result of present study indicates that the melatonin protects seminal and antioxidant profiles varied in different seasons, semen quality also varied from different seasons and was highest in spring and lowest in summer season. It was concluded from the present study that breeding takes place throughout year but the peak breeding season is from November to April (spring and winter season in mithun.

  16. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus) and their correlation with climatic factors

    OpenAIRE

    Felipe Rydygier de Ruediger; Marcelo George Mungai Chacur; Francisco Carlos Platzeck Estrella Alves; Eunice Oba; Alcides de Amorim Ramos

    2016-01-01

    The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of t...

  17. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli

    DEFF Research Database (Denmark)

    Sørensen, Lars Peter; Engberg, Ricarda Greuel; Løvendahl, Peter;

    2015-01-01

    The aim of this study was to investigate the effect of a quantitative trait locus associated with mastitis caused by Escherichia coli, with one haplotype being more susceptible (HH) and another being more resistant (HL) to E. coli mastitis, on the activity of 4 inflammatory related milk enzymes....... In particular, we investigated the suitability of β-glucuronidase (GLU) as an early indicator of E. coli mastitis. Besides GLU, the enzymes l-lactate dehydrogenase (LDH), N-acetyl-β-d-glucosaminidase (NAGase), and alkaline phosphatase were included. The study was conducted in an experimental setup with 31...... infection but with differences in the size and profile of the activity of the 4 enzymes. The enzyme GLU was an equally good indicator of E. coli mastitis compared with the other studied enzymes, although it showed a slower response compared with LDH and NAGase....

  18. Molecular Characterization of Bovine SMO Gene and Effects of Its Genetic Variations on Body Size Traits in Qinchuan Cattle (Bos taurus).

    Science.gov (United States)

    Zhang, Ya-Ran; Gui, Lin-Sheng; Li, Yao-Kun; Jiang, Bi-Jie; Wang, Hong-Cheng; Zhang, Ying-Ying; Zan, Lin-Sen

    2015-07-27

    Smoothened (Smo)-mediated Hedgehog (Hh) signaling pathway governs the patterning, morphogenesis and growth of many different regions within animal body plans. This study evaluated the effects of genetic variations of the bovine SMO gene on economically important body size traits in Chinese Qinchuan cattle. Altogether, eight single nucleotide polymorphisms (SNPs: 1-8) were identified and genotyped via direct sequencing covering most of the coding region and 3'UTR of the bovine SMO gene. Both the p.698Ser.>Ser. synonymous mutation resulted from SNP1 and the p.700Ser.>Pro. non-synonymous mutation caused by SNP2 mapped to the intracellular C-terminal tail of bovine Smo protein; the other six SNPs were non-coding variants located in the 3'UTR. The linkage disequilibrium was analyzed, and five haplotypes were discovered in 520 Qinchuan cattle. Association analyses showed that SNP2, SNP3/5, SNP4 and SNP6/7 were significantly associated with some body size traits (p 0.05). Meanwhile, cattle with wild-type combined haplotype Hap1/Hap1 had significantly (p cattle, and the wild-type haplotype Hap1 together with the wild-type alleles of these detected SNPs in the SMO gene could be used to breed cattle with superior body size traits. Therefore, our results could be helpful for marker-assisted selection in beef cattle breeding programs.

  19. The first identification of a blood-sucking abomasal nematode Ashworthius sidemi in cattle (Bos taurus) using simple polymerase chain reaction (PCR).

    Science.gov (United States)

    Moskwa, Bożena; Bień, Justyna; Cybulska, Aleksandra; Kornacka, Aleksandra; Krzysiak, Michał; Cencek, Tomasz; Cabaj, Władysław

    2015-06-30

    A simple polymerase chain reaction (PCR) test was used to identify Ashworthius sidemi, a blood-sucking gastrointestinal nematode that commonly infects bison, red and roe deer, and moose in Poland. The present study uses this technique to confirm the possibility of transmission of A. sidemi infection from wildlife to domestic animals, such as cattle and sheep, grazing on the same natural pastures. A 406 bp fragment of genomic A. sidemi DNA was actually detected in DNA isolated from larval cultures derived from feces from cattle. A. sidemi DNA has been detected in cattle which represent a new host for this parasite. This is the first evidence of A. sidemi in cattle. The results reveal that a PCR test based on DNA from L3 larvae can be used for in vivo detection of A. sidemi invasions in breeding animals. In conclusion, the transfer of A. sidemi infection from wildlife to the farm animals sharing the same pastures appears possible.

  20. Effects of GHRP-2 and Cysteamine Administration on Growth Performance, Somatotropic Axis Hormone and Muscle Protein Deposition in Yaks (Bos grunniens) with Growth Retardation

    Science.gov (United States)

    Hu, Rui; Wang, Zhisheng; Peng, Quanhui; Zou, Huawei; Wang, Hongze; Yu, Xiaoqiang; Jing, Xiaoping; Wang, Yixin; Cao, Binghai; Bao, Shanke; Zhang, Wenhua; Zhao, Suonan; Ji, Hanzhong; Kong, Xiangying; Niu, Quanxi

    2016-01-01

    The objective of this study was to investigate the effects of growth hormone-releasing peptide-2 (GHRP-2) and cysteamine (CS) administration on growth performance in yaks with growth retardation and try to elucidate its regulatory mechanisms. Trial 1, thirty-six 1-year-old Qinghai high plateau yaks (body weight 38–83.2 kg) were randomly chosen for body weight and jugular blood samples collection. The relationship between body weight and serum GHRH (P < 0.05, R = 0.45), GH (P < 0.05, R = 0.47), IGF-1 (P < 0.05, R = 0.62) was significantly correlated in yaks colonies with lighter body weights. Trial 2, fifteen 1-year-old Qinghai high plateau yaks with growth retardation (average body weight 54.8 ± 8.24 kg) were randomly selected and assigned to negative control group (NG), GHRP-2 injection group (GG) and cysteamine feeding group (CG), with 5 yaks per group. Another five 1-year-old Qinghai high plateau yaks with normal growth performance (average body weight 75.3 ± 2.43 kg) were selected as positive control group (PG). The average daily gain (ADG) of the GG and CG were significantly higher than those in the PG and NG (P < 0.05). Both GHRP-2 and CS administration significantly enhanced the myofiber diameter and area of skeletal muscle (P<0.05). GHRP-2 significantly enhanced the serum GH and IGF-1 levels (P < 0.05), and up-regulated GHR, IGF-1 and IGF-1R mRNA expression in the liver and skeletal muscle (P < 0.05), enhanced the mRNA expression of PI3K, AKt and mTOR in the skeletal muscle (P<0.05). CS significantly reduced the serum SS levels and the hypothalamus SS mRNA expression (P < 0.05), and enhanced GHR and IGF-1 mRNA expression in the liver (P < 0.05), decreased the mRNA expression of muscle atrophy F-box (Atrogin-1) and muscle ring finger 1 (MuRF1) mRNA (P < 0.05). Conclusions: Growth retardation in yaks was primarily due to somatotropic axis hormones secretion deficiency. Both GHRP-2 and CS administration can accelerate growth performance and GH, IGF-1 secretion in yaks with growth retardation. GHRP-2 enhanced muscle protein deposition mainly by up-regulated the protein synthesis pathways, whereas CS worked mainly by down-regulated the ubiquitin-proteasome pathway. PMID:26894743

  1. SELEKSI JENIS TUMBUHAN PAKAN DAN KANDUNGAN NUTRIEN JENIS TUMBUHAN YANG DIMAKAN SAPI BALI (Bos sondaicus LEPAS SAPIH DI DAERAH BUKIT BADUNG SELATAN, KABUPATEN BADUNG, BALI

    Directory of Open Access Journals (Sweden)

    I Wayan Heri Dismawan

    2014-09-01

    Full Text Available This study was conducted to determine the plants species and nutrient content of plantspecies selected by weaning of bali cattle in South Badung Hill, Badung regency, Bali. Studywas conducted in three Grazing unit Bali cattle are Sawangan, Kutuh and Pecatu. InDecember 2013 to February 2014. Determination of the composition of plant species in thehabitat (n? is determined by the square method. Determination of plants composition in diet(r? determined by utilization methods. This method is based on the percentage bite mark ofplants species in plot sampling. Nutrient content was analyzed crude protein, energy, calciumand phosphorus. Crude protein determination with a Semi-micro Kjeldahl technique andenergy content by Bomb Calorimeter. Determination of mineral content of calcium (Ca andPhosphorus (P by using Atomic Absorption Spectrophotometer (ASS. Tests carried out inthe Laboratory of Nutrition and Forage Analytical Chemistry, University of Udayana. TheJURNAL SIMBIOSIS II (2: 192- 202 ISSN: 2337-7224Jurusan Biologi FMIPA Universitas Udayana September 2014results study showed 32 species of plants available in the habitat, there are nine species ofplants that are selected by weaning bali cattle, that are Desmodium heterofilum, Pleurainterupta, Polygala glomerata, Cyperus rotundus, Desmodium triflorum, Dactylocteniumaegyptium, Portulaca sp. Polygala chinensis, and Panicum eruciforme. Nutrient content ofplant species eaten a protein ranged from 11.25% - 17.14%, GE 3.10 kcal / g - 4.11 kcal / g,Ca 0.33% - 1.86%, and 0.026% P - 0.24%.Keywords: Weaning bali cattle, plants selected species, nutrient content

  2. Serological survey of bovine brucellosis in Fulani nomadic cattle breeds (Bos indicus) of North-central Nigeria: Potential risk factors and zoonotic implications.

    Science.gov (United States)

    Alhaji, N B; Wungak, Y S; Bertu, W J

    2016-01-01

    A cross sectional study was conducted to investigate seroprevalence and associated risk factors of bovine brucellosis in Fulani nomadic herds in the 3 agro-ecological zones of Niger State, North-central Nigeria between January and August 2013. A total of 672 cattle in 113 herds were screened for Brucella antibodies using Rose Bengal Plate Test (RBPT) and confirmed by Lateral flow Assay (LFA). Data on herd characteristics and zoonotic factors were collected using structured questionnaire administered on Fulani herd owners. Factors associated with Brucella infection were tested using Chi-square test and multivariable logistic model. The overall cattle-level seroprevalence was 1.9% (95% CI: 1.1-3.2) with highest in agro-zone C (3.2%). Herd-level seroprevalence was 9.7% (95% CI: 5.23-16.29) and highest in agro-zone C (13.5%). Sex and agro-ecological zones were significantly (Pbrucellosis occurrence. Inhalation of droplets from milk of infected cows, and drinking raw milk were less likely [OR 0.27; 95% CI: 0.09-0.82 and OR 0.27; 95% CI: 0.08-0.99, respectively] not to predisposed to brucellosis in humans. Eating infected raw meat, and contact with infected placenta were more likely [OR 7.49; 95% CI: 2.06-28.32 and OR 5.74; 95% CI: 1.78-18.47, respectively] to be risks for the disease in humans. These results highlighted the important risk factors for bovine brucellosis in Fulani herds. Thus, brucellosis control programs which take these factors into consideration will be beneficial.

  3. SELEKSI JENIS TUMBUHAN PAKAN DAN KANDUNGAN NUTRIEN JENIS TUMBUHAN YANG DIMAKAN SAPI BALI (Bos sondaicus) LEPAS SAPIH DI DAERAH BUKIT BADUNG SELATAN, KABUPATEN BADUNG, BALI

    OpenAIRE

    I Wayan Heri Dismawan; I Ketut Ginantra; Ni Luh Ni Luh Suriani

    2014-01-01

    This study was conducted to determine the plants species and nutrient content of plantspecies selected by weaning of bali cattle in South Badung Hill, Badung regency, Bali. Studywas conducted in three Grazing unit Bali cattle are Sawangan, Kutuh and Pecatu. InDecember 2013 to February 2014. Determination of the composition of plant species in thehabitat (n?) is determined by the square method. Determination of plants composition in diet(r?) determined by utilization methods. This method is ba...

  4. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus and their correlation with climatic factors

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2016-02-01

    Full Text Available The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of the wet globe were recorded using a globe thermometer (InstruTemp®, ITWTG-2000. Thermal images of the scrotum were analyzed with the Flir Tools® software for the temperatures of scrotal surface, the right and left sides of the scrotum lap thirds: dorsal, middle and ventral testicles; and tails of the epididymis. The semen data and thermograms were submitted to ANOVA and Tukey’s test at 5%. Pearson correlation was used for the surface temperatures of the scrotum, rectal temperature, quantitative and qualitative characteristics of semen and climatic factors. There was a positive correlation (P<0.05 for sperm motility x scrotal temperatures; sperm concentration x scrotal temperatures; climatic factors x rectal temperature. There was a negative correlation (P<0.05 between ambient temperature x sperm concentration. It was concluded that the temperature of the scrotum surface and climatic factors, temperature and humidity, influence the quality of semen. Thermography is recommended as a supplementary examination for reproductive evaluation of bulls.

  5. Morfologia e grânulos citoplasmáticos do corpo lúteo de vacas aneloradas (Bos taurus indicus gestantes e não gestantes

    Directory of Open Access Journals (Sweden)

    L.R. Vargas

    2015-04-01

    Full Text Available Avaliaram-se a proporção volumétrica dos constituintes do corpo lúteo e a distribuição de células lúteas com grânulos citoplasmáticos no corpo lúteo de animais Nelore ao longo da gestação e em animais não gestantes. Foram coletados ovários com corpos lúteos de 24 animais abatidos em frigorífico. Os animais foram distribuídos em dois grupos: gestantes e não gestantes. A idade gestacional foi determinada pela medição do comprimento apicocaudal do feto. Os ovários foram distribuídos segundo o trimestre gestacional: primeiro - gestação de até 90 dias; segundo - de 91 a 180 dias; e terceiro - de 181 a 270 dias. Os corpos lúteos, processados para inclusão em paraplast, foram avaliados em microscópio de luz. Na proporção volumétrica do corpo lúteo, os constituintes avaliados foram citoplasma e núcleo de células lúteas, tecido conjuntivo e fibroblastos, células endoteliais e pericitos e vasos sanguíneos. A proporção volumétrica de citoplasma de células lúteas reduziu de 46,1±2,8% para 37,9±3,5% e a de núcleo de células lúteas reduziu de 9,2±1,0% para 6,2±1,0%, do primeiro para o segundo trimestre. A proporção de tecido conjuntivo e fibroblastos aumentou de 20,9±5,4%, no primeiro trimestre, para 34,0±4,2%, no segundo trimestre. Grânulos citoplasmáticos foram evidenciados pelas técnicas histoquímicas xylidine ponceau e azul de bromofenol, que indicam sua provável composição proteica. A quantidade de células maiores com grânulos aumentou significativamente de 2,3±1,9%, no primeiro trimestre, para 25,5±20,3%, no segundo. A proporção volumétrica de citoplasma e núcleo de células lúteas diminuiu ao longo da gestação, e a de tecido conjuntivo aumentou. A quantidade de células lúteas maiores contendo grânulos também aumentou ao longo da gestação.

  6. Bos indicus cattle possess greater basal concentrations of HSP27, alpha B-crystallin, and HSP70 in skeletal muscle in vivo compared with cattle.

    Science.gov (United States)

    Mullins, C R; Zerby, H N; Fitzpatrick, L A; Parker, A J

    2016-01-01

    The objectives of the present study were to evaluate the basal concentrations of heat shock proteins (HSP) between and cattle and to determine if HSP basal concentrations change as an animal matures. A total of 40 cattle were used in a 2 × 2 factorial design to evaluate the effects of genotype and age (heifers and mature cows) on basal concentrations of heat shock protein 27 (HSP27), α B-crystallin (Cryab), and heat shock protein 70 (HSP70). Each experimental group of 10 animals was sampled on a separate day over a period of 4 wk during July 2014. A muscle sample was collected from the longissimus thoracis (LT) and concentrations of HSP were quantified using ELISA. There were no significant differences in HSP concentration for the interaction between age and genotype or for age alone. cattle had greater ( cattle. The results of this study show that basal in vivo HSP concentrations differ between and cattle. However, further studies are needed to investigate the relationship between HSP concentrations and meat tenderness with respect to genotypes to see if HSP concentrations account for at least some variability in tenderness differences.

  7. Effect of Papain on the Tenderness of Bos grunniens Meat%木瓜蛋白酶对牦牛肉嫩化效果的研究

    Institute of Scientific and Technical Information of China (English)

    施帅; 杨士章; 牛林

    2007-01-01

    本文对木瓜蛋白酶对牦牛肉嫩化效果进行研究,并对处理后的样品的感观品质、剪切力变化、肌纤维直径和pH值进行测定.结果表明:在20 ℃下,注射24000 U/kg木瓜蛋白酶并在20 ℃下放置30 min,再冷却至5 ℃的嫩化条件较好.处理后的样品的感官品质不会改变,剪切力随着贮藏时间的延长均显著降低,肌纤维直径有变细现象,pH值基本稳定.

  8. Diversidad genética de la población colombiana de ganado Cebú Brahman Americano Bos Indicus (Bovidae)

    OpenAIRE

    Novoa Bravo Miguel Adriano; Usaquén Martínez William

    2006-01-01

    La raza Cebú Brahman Americano se encuentra en Colombia alrededor de 100 años. Todo ese tiempo, esta raza ha estado bajo un proceso continuo de selección artificial dirigida, reproducción endogámica, efectos de deriva genética causados por eventos fundadores, migraciones de ejemplares entre las fincas del país y animales importados desde otros países. Estos hechos hacen a esta raza interesante y particular desde el punto de vista de la genética de poblaciones. El objetivo de este trabajo es e...

  9. Dinámica folicular y función lútea durante la gestación temprana. Estudio de un caso en Bos indicus.

    Directory of Open Access Journals (Sweden)

    Henao R Guillermo

    2003-06-01

    Full Text Available A una vaca Cebú de seis años, tres partos y 432 Kg de peso, se le practicaron ecografías ováricas transrectales y muestreos sanguíneo tres veces por semana desde el día uno al 74 de gestación. Se contó el número de folículos > 4 mm y se midió el diámetro de los folículos y el diámetro y tiempo de observación ecográfica del cuerpo lúteo. Se determinó la ovulación y se calculó la tasa de crecimiento del folículo dominante y el intervalo interdominancia. Los niveles de progesterona se midieron por radioinmunoanálisis. Durante los primeros 74 días de la gestación se desarrollaron 10 ondas foliculares; la primera fue conformada por seis folículos  4mm, de los cuales se desarrolló uno dominante que alcanzó un diámetro de 11 mm, creció a una tasa de un mm/día y presentó un intervalo interdominancia de 10 días. El folículo subordinado más desarrollado alcanzó un diámetro de 6 mm. Los folículos dominantes alcanzaron 9.11 mm de diámetro, crecieron a una tasa de 1,0  0,19 mm/día y presentaron un intervalo interdominancia de 7,5  1,73 días. El cuerpo lúteo alcanzó un diámetro máximo de 21mm el día 40 de gestación. La progesterona alcanzó niveles >10 ng/100ml a partir del día 11. Durante la gestación temprana de una vaca Cebú se presentó dinámica folicular caracterizada por el desarrollo de ondas foliculares semejantes a las producidas durante el ciclo estral y se formó un cuerpo lúteo activo productor de niveles característicos de progesterona.

  10. Postweaning substitution of grazed forage with a high-energy concentrate has variable long-term effects on subcutaneous fat and marbling in Bos taurus genotypes.

    Science.gov (United States)

    Greenwood, P L; Siddell, J P; Walmsley, B J; Geesink, G H; Pethick, D W; McPhee, M J

    2015-08-01

    The objective of this study was to quantify the effects and interactions of stage of growth and genotype on commercial carcass traits and intramuscular fat (IMF) content in 5 muscles of steers ( = 165) and to test the hypothesis that substituting pasture with a high-energy concentrate during the immediate postweaning period increases IMF. Cattle of 3 genotypes (Angus, Hereford, and Wagyu × Angus; = 55/genotype) were selected at weaning from commercial herds, targeting genotypic differences in marbling and subcutaneous fatness. Following weaning, steers were fed for 168 d within 2 different improved, temperate pasture-based nutritional systems: a forage-only system (FS) and forage with high-energy supplemented system (SS), with 2 replicates per system. The supplement was fed at a level of 1% of average BW adjusted every 2 wk to provide an estimated 50% of energy requirements for 168 d from weaning. Pasture on offer in both systems was managed to match the BW of the FS and SS steers during the postweaning treatment period to avoid confounding due to differences in growth rate during this period. Steers were then regrouped into 2 replicates and backgrounded on improved, temperate pasture for 158 d and then grain fed within 1 group for 105 d (short fed) or 259 d (long fed). Groups were slaughtered at commencement (d 0) and end of postweaning nutritional treatments (d 168), end of backgrounding (d 326), and after short (d 431) or long feedlotting (d 585). Serial slaughter stage had an effect on all traits assessed ( < 0.01). The FS steers had more rib fat ( < 0.01) and higher Meat Standards Australia marbling score ( < 0.05) and a tendency ( < 0.10) to have greater eye muscle area than the SS steers throughout the study. Genotypic differences were evident ( < 0.05) for all traits assessed except HCW, dressing percentage, rib fat depth, ossification score, ultimate pH, and IMF in the semitendinosus muscle. The results for marbling and IMF do not support the use of a high-energy feed as a substitute for an equivalent amount of energy from pasture during the immediate postweaning period to enhance development of marbling. PMID:26440193

  11. Comparative studies on genital infections and antimicrobial susceptibility patterns of isolates from camels (Camelus dromedarius) and cows (Bos indicus) in Maiduguri, north-eastern Nigeria.

    Science.gov (United States)

    Mshelia, Gideon Dauda; Okpaje, Godfrey; Voltaire, Yepmo Andre Casimir; Egwu, Godwin Onyeamaechi

    2014-01-01

    A total of 160 genitalia of Camels and cows were investigated in Maiduguri, north-eastern Nigeria to compare bacterial isolates and the antibacterial susceptibilities of some of the isolates. Streptococcus (Str.) pyogenes (31%), Escherichia (E.) coli (24%) and Staphylococcus (S.) aureus (20%) were the most common vaginal bacterial isolates in camels; while E. coli (73%), Str. pyogenes (18%) and S. aureus (11%) were the most frequent isolates in the cows. Of the 78 uterine isolates recovered in this study, E. coli was the most prominent in camels (8%) and cows (54%). The overall weight of genital infection in all camels and cows examined was highest (P  0.05) between vaginal and uterine bacterial isolates from camels and cows in this study. The Relative Risk (RR) for an infection of the vagina with E coli (3.04, 95% Confidence Interval (CI): 2.104 to 4.398, P < 0.0001) is more in cows compared to the camel, but the RR for vaginal infection with S. aureus and Str. pyogenes were lower in cows compared to Camels. The E. coli and S. aureus isolates were highly susceptible to the antimicrobial agents tested. Therefore effective management of reproductive disorders associated with these pathogens can be achieved with proper use of these antimicrobial agents in these animal species. PMID:24570857

  12. Molecular differentiation of Sarcocystis buffalonis and Sarcocystis levinei in water buffaloes (Bubalus bubalis) from Sarcocystis hirsuta and Sarcocystis cruzi in cattle (Bos taurus).

    Science.gov (United States)

    Gjerde, Bjørn; Hilali, Mosaad; Abbas, Ibrahim E

    2016-06-01

    The purpose of the present study was to obtain sarcocysts of Sarcocystis buffalonis and Sarcocystis levinei from water buffaloes and characterize the isolates by molecular methods in order to determine whether the two species were genetically different from Sarcocystis hirsuta and Sarcocystis cruzi, respectively, from cattle, which had been characterized before. About 35 macroscopically visible (3-4 × 1-2 mm) and 20 barely visible (1-3 × 0.2 mm) sarcocysts were excised from the esophagus of 18 naturally infected and freshly slaughtered adult water buffaloes at three slaughterhouses in Egypt. Genomic DNA was extracted from the sarcocysts, and all isolates were first characterized at the mitochondrial cytochrome c oxidase subunit I gene (cox1) gene through PCR amplification and direct sequencing. Selected isolates were subsequently further characterized at the 18S and 28S ribosomal (r) RNA genes and the internal transcribed spacer 1 (ITS1) region of the nuclear rDNA unit by direct sequencing or cloning. Only six of the isolated macroscopic sarcocysts belonged to S. buffalonis, whereas the others belonged to Sarcocystis fusiformis. Twelve of the smaller cysts belonged to S. levinei and seven to Sarcocystis sinensis. The characterization of the sarcocysts of S. sinensis and some of the sarcocysts of S. fusiformis have been reported before. Fifteen additional sarcocyst isolates of S. fusiformis were characterized at cox1 in the present study and found to be identical or closely similar to previous isolates. At cox1, the sequence identity between the six isolates of S. buffalonis was 99.8-100 % (two haplotypes), whereas the identity between the 12 isolates of S. levinei was 99.0-100 % (10 haplotypes). The identity between cox1 sequences of S. buffalonis and S. hirsuta (n = 56) was 92.9-93.6 % (on average 93.4 %), and the identity between cox1 sequences of S. levinei and S. cruzi (n = 22) was 92.9-94.0 % (on average 93.5 %). The phylogenetic analyses placed with high support the cox1 sequences of S. buffalonis and S. hirsuta into two monophyletic sister groups, and the same was true for the cox1 sequences of S. levinei and S. cruzi. Hence, the study established that S. buffalonis and S. levinei are distinct species different from S. hirsuta and S. cruzi, respectively. Nucleotide sequences of S. buffalonis could be distinguished from those of S. hirsuta also at the 28S rRNA gene (clearly different) and the ITS1 region (small and uncertain difference) but not at the 18S rRNA gene. Sequences of S. levinei could be distinguished from those of S. cruzi both at the 18S and 28S rRNA genes (ITS1 region not examined). However, the cox1 gene was superior to the 18S and 28S rRNA genes as regards the ability to unambiguously delimit the species within each species pair, since at the latter markers, the number of consistent nucleotide differences between the species was low and there was a slight overlap between the intraspecific and interspecific sequence divergence. Comparison of the newly generated 18S rRNA gene sequences of S. levinei from water buffaloes with similar sequences deposited in GenBank suggested that S. levinei and S. cruzi are not strictly intermediate host specific but might occasionally infect cattle and water buffaloes, respectively. PMID:26979729

  13. Molecular characterisation of Sarcocystis bovifelis, Sarcocystis bovini n. sp., Sarcocystis hirsuta and Sarcocystis cruzi from cattle (Bos taurus) and Sarcocystis sinensis from water buffaloes (Bubalus bubalis).

    Science.gov (United States)

    Gjerde, Bjørn

    2016-04-01

    About 200 individual sarcocysts were excised from 12 samples of cattle beef from five countries (Argentina, Brazil, Germany, New Zealand, Uruguay) and tentatively identified to species or cyst type on the basis of their size and shape and cyst wall morphology. Genomic DNA was extracted from 147 of these sarcocysts and used initially for PCR amplification and sequencing of the partial mitochondrial cytochrome c oxidase subunit I gene (cox1) in order to identify the sarcocysts to species and/or sequence type. In addition, seven Sarcocystis sinensis-like sarcocysts collected from the oesophagus of water buffaloes in Egypt were examined at cox1 for comparative purposes. Based on the results from the cox1 marker, selected sarcocyst isolates from both hosts were further characterised at one to three regions of the nuclear ribosomal (r) DNA unit, i.e. the complete 18S rRNA gene, the complete internal transcribed spacer 1 (ITS1) region and the partial 28S rRNA gene. This was done in order to compare the results with previous molecular identifications based on 18S rRNA gene sequences and to evaluate the utility of these regions for species delimitations and phylogenetic inferences. On the basis of sarcocyst morphology and molecular data, primarily the cox1 sequences, four Sarcocystis spp. were identified in the samples of cattle beef. Twenty-two microscopic sarcocysts (1 × 0.1 mm) with hair-like protrusions were assigned to Sarcocystis cruzi, 56 macroscopic sarcocysts (3-8 × 0.5 mm) with finger-like protrusions were assigned to Sarcocystis hirsuta and 45 and 24 microscopic sarcocysts (1-3 × 0.1-0.2 mm) with finger-like protrusions were assigned to Sarcocystis bovifelis and Sarcocystis bovini n. sp., respectively. Sarcocysts of S. cruzi were identified in samples of beef from Argentina and Uruguay; sarcocysts of S. hirsuta in samples from Argentina, Brazil, Germany and New Zealand; sarcocysts of S. bovifelis in samples from Argentina and Germany; and sarcocysts of S. bovini in samples from Argentina and New Zealand. The microscopic sarcocysts from water buffaloes were confirmed to belong to S. sinensis. The cox1 sequences of S. bovifelis and S. bovini, respectively, shared an identity of 93-94 % with each other, and these sequences shared an identity of 89-90 % with cox1 of S. sinensis. In contrast, the intraspecific sequence identity was 98.4-100 % (n = 45), 99.3-100 % (n = 24) and 99.5-100 % (n = 7) for sequences of S. bovifelis, S. bovini and S. sinensis, respectively. In each of the latter three species, an aberrant type of cox1 sequences was also identified, which was only 91-92 % identical with the predominant cox1 type of the same species and about 98 % identical with the aberrant types of the two other species. These aberrant cox1 sequences are believed to represent non-functional nuclear copies of the mitochondrial genes (numts or pseudogenes). They might be used as additional markers to separate the three species from each other. Sequencing of a considerable number of clones of S. bovifelis, S. bovini and S. sinensis from each of the three regions of the rDNA unit revealed intraspecific sequence variation in all loci in all species and particularly in the ITS1 locus (78-100 % identity). As regards the 18S rRNA gene, it was possible to separate the three species from each other on the basis of a few consistent nucleotide differences in the less variable 3' end half of the gene. A comparison of the new sequences with GenBank sequences obtained from S. sinensis-like sarcocysts in cattle in other studies indicated that previous sequences derived from cattle in Germany and Austria belonged to S. bovifelis, whereas those derived from cattle in China belonged to S. bovini. On the basis of the new 28S rRNA sequences, it was possible to separate S. sinensis from S. bovifelis and S. bovini, whereas the latter two species could not be separated from each other. Based on ITS1 sequences, the three species were indistinguishable. Phylogenetic analysis using maximum parsimony placed with fairly high support cox1 sequences of S. bovifelis, S. bovini and S. sinensis, respectively, into three monophyletic clusters, with S. bovifelis and S. bovini being a sister group to S. sinensis. In contrast, phylogenies based on each of the three regions of the rDNA unit did not separate sequences of the three species completely from each other. Characterisation of cox1 of 56 isolates of S. hirsuta from four countries revealed only 13 haplotypes and an intraspecific sequence identity of 99.3-100 %. In the three regions of the rDNA unit, there was more extensive sequence variation, particularly in the ITS1 region. The 22 cox1 sequences of S. cruzi displayed a moderate intraspecific variation (98.6-100 %), whereas there was no variation at the 18S rRNA gene among 10 sequenced isolates. Sequencing of 16 clones of the partial 28S rRNA gene of S. cruzi yielded two markedly different sequence types, having an overall sequence identity of 95-100 %. PMID:26677095

  14. Fiber degradation potential of natural co-cultures of Neocallimastix frontalis and Methanobrevibacter ruminantium isolated from yaks (Bos grunniens) grazing on the Qinghai Tibetan Plateau.

    Science.gov (United States)

    Wei, Ya-Qin; Long, Rui-Jun; Yang, Hui; Yang, Hong-Jian; Shen, Xi-Hui; Shi, Rui-Fang; Wang, Zhi-Ye; Du, Jun-Guo; Qi, Xiao-Jin; Ye, Qian-Hong

    2016-06-01

    Several natural anaerobic fungus-methanogen co-cultures have been isolated from rumen and feces source of herbivores with strong fiber degrading ability. In this study, we isolated 7 Neocallimastix with methanogen co-cultures from the rumen of yaks grazing on the Qinghai Tibetan Plateau. Based on morphological characteristics and internal transcribed spacer 1 sequences (ITS1), all the fungi were identified as Neocallimastix frontalis. The co-cultures were confirmed as the one fungus - one methanogen pattern by the PCR-denatured gradient gel electrophoresis (DGGE) assay. All the methanogens were identified as Methanobrevibacter ruminantium by 16s rRNA gene sequencing. We investigated the biodegrading capacity of the co-culture (N. frontalis + M. ruminantium) Yaktz1 on wheat straw, corn stalk and rice straw in a 7 days-incubation. The in vitro dry matter digestibility (IVDMD), acid detergent fiber digestibility (ADFD) and neural detergent fiber digestibility (NDFD) values of the substrates in the co-culture were significantly higher than those in the mono-culture N. frontalis Yaktz1. The co-culture exhibited high polysaccharide hydrolase (xylanase and FPase) and esterase activities. The xylanase in the co-culture reached the highest activity of 12500 mU/ml on wheat straw at the day 3 of the incubation. At the end of the incubation, 3.00 mmol-3.29 mmol/g dry matter of methane were produced by the co-culture. The co-culture also produced high level of acetate (40.00 mM-45.98 mM) as the end-product during the biodegradation. Interestingly, the N. frontalis Yaktz1 mono-culture produced large amount of lactate (8.27 mM-11.60 mM) and ethanol (163.11 mM-242.14 mM), many times more than those recorded in the previously reported anaerobic fungi. Our data suggests that the (N. frontalis + M. ruminantium) Yaktz1 co-culture and the N. frontalis Yaktz1 mono-culture both have great potentials for different industrial use.

  15. Marcadores moleculares asociados a la Capacidad de Retención de Agua (CRA) en carne de Bos indicus y sus cruces

    OpenAIRE

    Leal Gutiérrez, Joel David

    2013-01-01

    La Capacidad de Retención de Agua (CRA) es una de las características de la carne con mayor efecto sobre la rentabilidad del sector, al estar asociada a las mermas y a la jugosidad. Los objetivos principales son: resaltar la importancia de la CRA de la carne de bovino, evaluar el desempeño de estos parámetros según los factores tiempo de maduración y cruce de los animales y establecer polimorfismos en genes candidatos asociados al parámetro evaluado. Varios genes y sus polimorfismos han sido ...

  16. Impact of progesterone and estradiol treatment before the onset of the breeding period on reproductive performance of Bos indicus beef heifers.

    Science.gov (United States)

    Sá Filho, M F; Nasser, L F T; Penteado, L; Prestes, R; Marques, M O; Freitas, B G; Monteiro, B M; Ferreira, R M; Gimenes, L U; Baruselli, P S

    2015-09-01

    The present aimed to develop a hormonal therapy based on the insertion of a progesterone (P4) insert (PI) during 10 d plus an estradiol injection (E2) at PI removal before the onset of breeding of beef heifers. In Exp. 1, the plasma P4 profile of prepubertal heifers showed that the insertion of a PI or 24 d previously used P4 insert (UPI) sustained plasma P4 above 1 ng/mL for at least the first 7 d of the treatment. In Exp. 2 there was no positive effect of additional estradiol benzoate (EB) administered at the insertion of UPI on the proportion of heifers with a corpus luteum (CL/Treated) 30 d after UPI removal [UPI + EB = 85.3%(a) (n = 134); EB + UPI + EB = 80.8%(a) (n = 125)]; however, both were greater (P < 0.0001) than the Control group [60.3%(b) (n = 129)]. In Exp. 3, a positive effect (P=0.01) of UPI treatment and both E2 supplementations [EB and estradiol cypionate (EC); P = 0.10] at the UPI removal was observed on CL/Treated [Control = 42.5%(b) (n = 94); UPI = 58.5%(a) (n= 130); UPI + EB = 64.0%(a) (n = 128); UPI + EC = 67.2%(a) (n = 128)]. However, greater pregnancy per treated heifer (P/Treated) following artificial insemination (AI) upon estrus detection was achieved when EC was applied [Control = 20.2%(b); UPI = 29.2%(ab); UPI + EB = 26.6%(b); UPI + EC = 36.7%(a)]. In Exp. 4, the treatment prior to the timed AI (TAI) tended to improve pregnancy per TAI [P/AI; Control 43.6% (n = 298) vs. UPI+EC 51.9% (n = 342); P = 0.08], but increased P/Treated [26.5% vs. 43.3%; P < 0.001]. Thus, UPI + EC treatment were efficient in increasing the CL/Treated, tended to improve the P/AI and consequently enhanced P/Treated of zebu beef heifers.

  17. Diversidad genética de la población colombiana de ganado Cebú Brahman Americano Bos Indicus (Bovidae

    Directory of Open Access Journals (Sweden)

    Novoa Bravo Miguel Adriano

    2006-12-01

    Full Text Available La raza Cebú Brahman Americano se encuentra en Colombia alrededor de 100 años. Todo ese tiempo, esta raza ha estado bajo un proceso continuo de selección artificial dirigida, reproducción endogámica, efectos de deriva genética causados por eventos fundadores, migraciones de ejemplares entre las fincas del país y animales importados desde otros países. Estos hechos hacen a esta raza interesante y particular desde el punto de vista de la genética de poblaciones. El objetivo de este trabajo es estudiar la estructura y diversidad genética de la raza Cebú Brahman americano. Se utilizaron 162 animales registrados en la asociación colombiana de criadores de ganado cebú (ASOCEBU de 20 departamentos de Colombia. La genotipificación de los animales se llevó a cabo con el kit StockMarks® for cattle bovine genotyping de Applied Biosystems®, empleando 10 microsatélites dinucleótidos. Los resultados de los distintos análisis multivariados (Análisis de componentes principales y análisis de correspondencias múltiples, de inferencia bayesiana y distancias genéticas interindividuales, demuestran que no se presenta subestructura en la población, lo cual se explica por una alta tasa de migración de animales entre las diferentes fincas y regiones, que homogeniza las frecuencias en todo el país. Además, esta población posee un alto grado de heterocigocidad y diversidad alélica, comparado con otras razas, lo cual refleja su origen de mezcla multiracial. También se encontraron diferencias genéticas entre sexos, lo cual es causado por un proceso reproductivo diferencial, donde actúan diferentes criterios de selección entre sexos. Finalmente, al realizar un análisis de componentes principales para analizar las relaciones genéticas de Cebú Brahman americano colombiano con las razas cebuinas y taurinas, se determinó que esta raza se diferencia genéticamente de las demás razas cebuinas, debido a un aporte genético de razas taurinas europeas a esta raza.

  18. Hemograma de bovinos (Bos indicus sadios da raça nelore no primeiro mês de vida, criados no estado de São Paulo Hemogram of healthy nelore breed (Bos indicus calf at the first month of life, raised in São Paulo state, Brazil

    Directory of Open Access Journals (Sweden)

    Alexander Welker Biondo

    1998-06-01

    Full Text Available Avaliou-se as mudanças nos constituintes do hemograma de bovinos da raça Nelore, 71 machos e 56 fêmeas, no primeiro mês de vida, criados no Estado de São Paulo. Foram utilizadas 127 amostras de sangue de bezerros criados a pasto, divididos em cinco grupos: de 0-3, 3-7, 7-14 , 14-21 e 21-30 dias de idade. Os valores médios encontrados foram: número de hemácias 8,31 ± l,84 x 10(6/ mi l; Volume globular 39 ± 6%; taxa de hemoglobina 12,89 ± 2,04g/dl; Volume Corpuscular Médio 48,19 ± 5,68fl; Concentração de Hemoglobina Corpuscular Média 32,81 ± 1,84; reticulócitos 0,27 ± 0,54% e eritroblastos 214 ± 594/mil; número de leucócitos/mil 10593 ± 3008, neutrófilos bastonetes 97 ± 165; neutrófilos segmentados 4837 ± 2201; linfócitos 5222 ± 1909; eosinófilos 86 ± 139; monócitos 346 ± 221; basófilos 4 ± 24. Os fatores sexuais não apresentaram influência significativa sobre o hemograma, com exceção dos reticulócitos e eritroblastos. Os fatores etários apresentaram influência significativa (p≤0,03 sobre as curvas de regressão do hemograma, com o volume globular, hemácias e hemoglobina diminuindo e o CHCM e reticulócitos aumentando até os 3 a 7 dias, havendo uma inversão desta variação dos sete até os 30 dias. A curva de regressão do percentual de linfócitos aumentou e de neutrófilos diminuiu gradativamente após o nascimento. O encontro destas curvas ocorreu entre o sétimo e o décimo quarto dia de vida.Changes on the hemogram parameters were evaluated for healthy Nelore purebreed bovines at the first month age, with 71 male and 56 female, and raised in São Paulo State, Brazil. For this purpose, 127 samples of blood were collected, and divided in five groups ; 0-3 , 3-7 . 7-14 , 14-21 and 21-30 days of age. The mean values were: erithrocyte counts 8.31± 1.84 x 10(6/ mu l; Package Cell Volume 39 ± 6%: hemoglobin 12.89 ± 2.04g/dl; Mean Corpuscular Volume 48.19 ± 5.68fl; Mean Corpuscular Hemoglobin Concentration 32.81 ± 1.84 ; Reticulocytes 0.27 ± 0.54%; erythroblast 214 ± 594/mul; leukocytes (mu l: 10593 ± 3008; band neutrophils 97 ± 165; segmented neutrophils 4837 ± 2201; lymphocytes 5222 ± 1909; eosinophils 86 ± 139: monocytes 346 ± 221; basophils 3 ± 24. Sex had no influencing the hemogram values except to reticulocytes and erythroblast that were higher in females. Age significantly influenced the leucogram and eritrogram values (p≤0.0 3. The Package Cell Volume, erythrocytes, and hemoglobin decreasing and the Mean Corpuscular Hemoglobin Concentration and reticulocytes increasing until the thirth to seventh days. There was an subsequent inversion of this variation in this period until the thirtieth day. The lymphocyte percentage regression curve increasing and neutrophils decreasing after birth. The intersection between the two leukocytes curves occurred between the seventh and the fourteenth day of life.

  19. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus) (Nota Científica) EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus)

    OpenAIRE

    Valéria da Silva Gandolfo; Gabriella Biondi de Godoy; Andrea Novoa Castillo Oliveira; Marcelo George Mungai Chacur; Sérgio do Nascimento Kronka

    2009-01-01

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0) e 120 (D120) por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC) com dez animais e grupo tratado (GT) com onze animais. Os to...

  20. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus (Nota Científica EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Valéria da Silva Gandolfo

    2009-04-01

    Full Text Available

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0 e 120 (D120 por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC com dez animais e grupo tratado (GT com onze animais. Os touros do GT receberam 4g de probiótico/animal/dia, durante 120 dias. Houve diferença (p<0,01 entre as colheitas (D0 e D120 nos grupos GC e GT para o perímetro escrotal (GC – D0: 30,50 cm e D120: 33,55 cm; GT – D0: 29,90 cm e D120: 34,30 cm. Houve diferença (p<0,05 entre colheitas (D0 e D120 nos grupos GC e GT, respectivamente, para: defeitos menores (GC – D0: 13,84 % e D120: 21,79%; GT – D0: 14,99% e D120: 20,84% e defeitos totais (GC – D0: 22,29% e D120: 29,24%; GT – D0: 25,14% e D120: 32,81%. Os resultados demonstram que, entre grupos, não houve alteração significativa das características seminais e perímetro escrotal.
       
    PALAVRAS-CHAVES: Aditivo, nutrição, sêmen, touro.

    PALAVRAS-CHAVE: Touro, sêmen, nutrição, aditivo.    The objective of this experiment was to evaluate the effect of the probiotic Proenzime® on scrotal perimeter and spermiogram in young Tabapua bulls. Two samples of semen from 21 Tabapua bulls, aging 30 months, were collected in day zero (D0 and 120 (D120 by electroejaculation, totalizing 42 samples. The bulls were divided in control group (CG with 10 animals and trated group (TG with 11 animals. The bulls of TG received 4g of probiotic/animal/day, during 120 days. There was difference (p<0.01 between collects (D0 and D120 in the groups CG and TG for scrotal perimeter (CG – D0: 30.50 cm and D120: 33.55 cm; TG – D0: 29.90 cm and D120: 34.30 cm. There was difference (p<0.05 between collects (D0 and D120 in the groups CG and TG, respectively. Minor defects (CG – D0: 13.84% and D120: 21.79%; TG – D0: 14.99% and D120: 20.84% and total defects (CG – D0: 22.29% and D120: 29.24%; TG – D0: 25.14% and D120: 32.81%. The results exposed allow concluding that significant alterations were not observed between groups for the seminal characteristics and scrotal perimeter.   

    KEY WORDS: Aditive, bull, nutrition, semen.

  1. Estimulação hormonal, punção folicular transvaginal e avaliação ovocitária em bezerras pré-púberes da raça Nelore (Bos taurus indicus Hormonal stimulation and ultrasound guided transvaginal follicle aspiration and oocyte recovery in Nelore (Bos taurus indicus prepubertal calves

    Directory of Open Access Journals (Sweden)

    Marilia Viviane Snel-Oliveira

    2003-02-01

    Full Text Available O uso de bezerras pré-púberes como doadoras de ovócitos oferece um considerável potencial para acelerar o ganho genético através da diminuição do intervalo de gerações, além de incrementar o aproveitamento de fêmeas bovinas de alto valor genético. Os objetivos deste estudo foram analisar o efeito da idade e do tratamento estimulatório com gonadotrofinas sobre a resposta folicular, a taxa de recuperação, a produção e a avaliação morfológica de ovócitos colhidos em bezerras da raça nelore (B. t. indicus a partir de 10 meses de idade. As bezerras foram distribuídas aleatoriamente em três grupos (n=4 e receberam tratamentos hormonais distintos, repetidos nos mesmos animais nos três períodos, aos 10, 11 e 12 meses de idade. No dia zero (D0, todas as bezerras receberam um implante intravaginal de progesterona e, em D1, 2 mg de benzoato de estradiol intramuscular (im. Em D6, deu-se início à diferenciação dos tratamentos (T: T1- 120 UI de FSH, divididos em quatro aplicações im a cada 12 horas; T2 - 120 UI de FSH, em uma única aplicação subcutânea (sc, mais 300 UI de eCG sc, T3 - sem tratamento estimulatório. No D8, o implante de progesterona foi retirado e a punção folicular transvaginal, guiada por ultra-som (PFTV, foi realizada no D9. Dos 402 ovócitos coletados, 53 foram desnudados e medidos, incluindo a zona pelúcida, encontrando-se um diâmetro médio de 153,38 (8,06 mm. Não houve diferença significativa entre os tratamentos e entre as idades para quantidade de folículos > 3 mm, de ovócitos recuperados e de ovócitos viáveis. A média de ovócitos recuperados e ovócitos viáveis para cada tratamento foi: T1- 11,08 (6,20 e 59,58% (25,80, T2- 12,75 (8,04 e 66,02% (36,71, T3 - 9,66 (8,15 e 51,51% (30,69, respectivamente. O valor médio da taxa de recuperação foi de 78,70%. O uso de FSH e FSH + eCG não aumentou significantemente a quantidade de folículos > 3 mm no momento da PFTV, assim como dos ovócitos recuperados e viáveis aos 10, 11 e 12 meses de idade.The use of pre-pubertal calves as oocyte donors offers a considerable potential to increase the genetic gain lowering the generations interval, as well as increase the usage of bovine females with high genetic value. The objectives of this study were to analyze the effect of age and of the stimulatory treatment with gonadotropins in the follicular response, the recovery rate, quantity and quality of oocytes of the prepubertal Nelore (B. t. indicus calves. Twelve Nelore prepubertal females were stimulated with gonadotrophin hormone and were submitted to ultrasound guided transvaginal oocyte recovery (OPU at 10, 11 and 12 months of age. Before OPU the females were randomly distributed into three treatment groups (n=4, which consist of different protocols of ovarian super stimulation. For all treatments the animals on day zero (D0 received one intravaginal progesterone implant (CIDR-G® and on D1, 2 mg of estradiol benzoate im (Estrogin®. The stimulatory treatment began on D6 according to the following treatments: T1-120 IU of FSH (Foltropin®, divided in 4 im injections with 12 hours interval; T2-120 IU of FSH in one sc application plus 300 IU of eCG (Folligon® on D6; T3 - without stimulatory treatment (control. At D8 the CIDR-G®was removed and OPU was performed on D9. Among the 402 oocytes retrieved, 53 were denuded and measured (including the pellucid zone where a mean diameter of 153.38 ± 8.06 mm was obtained. No significant difference was detected among treatments and among ages for the quantity of follicles > 3 mm, quantity of oocytes recovery and quantity of oocytes morphologically viable. The mean of recovery oocytes and viable oocytes for each treatment was T1- 11.08 (6.20 and 59.58% (25.80, T2 - 12.75 (8.04 and 66.02% (36.71, T3 - 9.66 (8.15 and 51.51% (30.69, respectively. The mean value of recovery rate was 78.70%. The use of FSH or FSH + eCG does not increase significantly the amount of follicles > 3 mm at the OPU moment, as well as the total and viable oocytes by 10, 11 and 12 months of age.

  2. Modelos de regresión aleatoria para la estimación de funciones de covarianza, parámetros genéticos y predicción de valores genéticos en una población bovina multirracial bos indicus-bos taurus en colombia

    OpenAIRE

    Martínez, Carlos Alberto; Elzo, Mauricio; Manrique, Carlos; Grajales, Luis Fernando; Jiménez, Ariel

    2011-01-01

    En este trabajo presentamos una aplicación de modelos de regresión aleatoria (RRM) para obtener estimadores de máxima verosimilitud restringida de funciones de covarianza y predicciones del valor genético para datos longitudinales de área de ojo del lomo medidos por ultrasonido (REA) en una población bovina multirracial en Colombia. El conjunto de datos contenía 708 registros de 340 animales descendientes de 37 toros de 9 razas apareados con hembras Brahman Gris. Los modelos mixtos empleados ...

  3. Perfil metabólico de touros da raça Nelore (Bos taurus indicus confinados e tratados com somatotrofina bovina recombinante (r-bST Metabolic and hormonal profile of feedlot Nellore bulls (Bos taurus indicus and treated with recombinant bovine somatotropin (r-bST

    Directory of Open Access Journals (Sweden)

    L.S. Amorim

    2007-04-01

    Full Text Available Avaliaram-se os efeitos da administração da somatotrofina bovina recombinante (r-bST sobre os metabólitos sangüíneos de touros da raça Nelore de duas diferentes idades. Foram utilizados 16 touros, distribuídos em um delineamento fatorial 2 x 2 (idades: jovens e adultos; r-bST: 0 e 500mg com quatro animais por tratamento. A idade média dos animais foi de 13,37 e 20,62 meses para jovens e adultos, respectivamente. Quatro animais por tratamento receberam, a cada 14 dias, solução salina ou 500mg de r-bST, totalizando nove aplicações por animal, em um período experimental de 120 dias. Os touros foram alimentados com silagem de milho e ração concentrada à base de farelo de milho e soja, duas vezes por dia, fornecidas em baias individuais. As coletas de sangue foram realizadas a cada três dias, para determinação da concentração dos metabólicos sangüíneos. Para análise estatística, foram compilados dados a intervalo de três aplicações, o que constituiu um período (período 1, 2 e 3. As concentrações de ácidos graxos não-esterificados (NEFA foram analisadas semanalmente. As concentrações séricas de colesterol, proteína total e plasmáticas de glicose diferiram para os períodos e nos grupos de tratamentos (P0,05.This study was carried out to evaluate the effect of recombinant bovine somatotropin (r-bST administration on profiles of blood metabolites of two different ages Nellore bulls. Sixteen bulls were randomly allotted in a factorial arrangement 2 x 2 (ages: youngs and adults; and r-bST dose: 0 and 500 mg with four animals per treatment. The mean ages of the young and adult animals were 13.37 and 20.62 months, respectively. Four animals per treatment received saline solution or r-bST 500mg, every 14 days, totaling nine applications per animal during 120 days. The Bulls were fed corn silage and concentrated diet based on corn crumb and soybean meal, twice a day, in individual stalls. Blood was collected every three days for metabolic evaluation. The statistical analyses of the data were performed in three applications, considering three periods (1, 2 and 3. Non-esterified fatty acid (NEFA concentrations were weekly analyzed. Serum cholesterol, total protein and glucose levels were affected either by period or the treatment (P0.05.

  4. Comparative sequence analysis in the exon 5 of growth hormone gene in the various livestock species of India.

    Science.gov (United States)

    Singh, Lakshya Veer; Sharma, Anurodh; Kumari, Namita; Kaur, Navneet; Jayakumar, S; Dixit, S P; Gupta, Neelam; Gupta, S C

    2014-01-01

    The aim of the study was to identify genetic polymorphism in growth hormone (GH) gene locus of six different livestock species using PCR-Direct DNA sequencing method. In exon 5 of GH gene, 10 SNPs variants were identified in all livestock species studied, namely Bubalus bubalis, Bos indicus, Bos frontalis, Bos grunniens, Ovis aries, and Capra hircus. Four SNPs were observed in Bubalus bubalis, two SNPs in Bos indicus, one SNP in Ovis aries, and three SNPs in Capra hircus. No changes were observed in Bos grunniens and Bos frontalis when compared with the template sequence and the SNPs observed in the present investigation may be useful in the marker assisted selection.

  5. Bomen als voedselbron voor insecten

    NARCIS (Netherlands)

    Moraal, L.G.

    2004-01-01

    Informatiemap van het communicatieproject van LNV Kennis en Informatiesysteem Bos. Doelgroep zijn eigenaren en beheerders van bos. Elk hoofdstuk behandeld een apart thema. Aan de orde komen wetten en regelingen, beheerplanning, ziekten en plagen, natuurlijke verjonging, kwaliteitshout, certificering

  6. NCBI nr-aa BLAST: CBRC-TTRU-01-1139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1139 gb|ACX37363.1| toll-like receptor 1 variant 7 [Bos indicus] gb|ACX37365.1| toll...-like receptor 1 variant 9 [Bos indicus] gb|ACX37367.1| toll-like receptor 1 variant 11 [Bos i...ndicus] gb|ACX37383.1| toll-like receptor 1 variant 27 [Bos indicus] gb|ACX37385.1| toll-like receptor 1 var...iant 29 [Bos indicus] gb|ACX37389.1| toll-like receptor 1 variant 33 [Bos indicus] gb|ACX37397.1| toll...-like receptor 1 variant 41 [Bos indicus] gb|ACX37398.1| toll-like receptor 1 variant 42 [Bos indicus] ACX37363.1 0.0 89% ...

  7. Optical-flow-based background-oriented schlieren technique for measuring a laser-induced underwater shock wave

    CERN Document Server

    Hayasaka, Keisuke; Liu, Tianshu; Kameda, Masaharu

    2016-01-01

    The background-oriented schlieren (BOS) technique with the physics-based optical flow method (OF-BOS) is developed for measuring the pressure field of a laser-induced underwater shock wave. Compared to BOS with the conventional cross-correlation method in PIV (called PIV-BOS), by using the OF-BOS, the displacement field generated by the small density gradient in water can be obtained at the spatial resolution of one vector per pixel. The corresponding density and pressure fields can be further extracted. It is particularly demonstrated that the sufficiently high spatial resolution of the extracted displacement vector field is required in the tomographic reconstruction to correctly infer the pressure field of the spherical underwater shock wave. The capability of the OF-BOS is critically evaluated based on synchronized hydrophone measurements. Special emphasis is placed on direct comparison between the OF-BOS with the PIV-BOS.

  8. Nature Conservation and Veterinary Problems: Issues and Options. With case studies of foot and mouth disease and classical swine fever.

    OpenAIRE

    Butter, Maureen E.; Prent, K.

    2005-01-01

    Large herbivores in nature suffer from veterinary law In the Habitat Directive, Natura 2000, the EU aims at preservation, restoration and interconnection of large-scale nature reserves throughout the union. Such a network of interconnected wilderness will provide dearly needed space to large wild animals, many of which are declining or even in danger of extinction. A thousand years ago most of Europe was nature, providing space for aurochs, moose, wild horse, reindeer, wild boar, bear, wolf a...

  9. Insights into the Genetic History of French Cattle from Dense SNP Data on 47 Worldwide Breeds

    OpenAIRE

    Mathieu Gautier; Denis Laloë; Katayoun Moazami-Goudarzi

    2010-01-01

    Background: Modern cattle originate from populations of the wild extinct aurochs through a few domestication events which occurred about 8,000 years ago. Newly domesticated populations subsequently spread worldwide following breeder migration routes. The resulting complex historical origins associated with both natural and artificial selection have led to the differentiation of numerous different cattle breeds displaying a broad phenotypic variety over a short period of time.[br/] Methodology...

  10. Test report on the Abacus 30 kW bimode(reg sign) inverter and Maximum Power Tracker (MPT)

    Science.gov (United States)

    Bonn, Russell; Ginn, Jerry; Zirzow, Jeff; Sittler, Greg

    1995-06-01

    Sandia National Laboratories conducts the photovoltaic balance of systems (BOS) program, which is sponsored by the US Department of Energy's Office of Energy Management. Under this program, SNL lets commercialization contracts and conducts a laboratory program designed to advance BOS technology, improve BOS component reliability, and reduce the BOS life-cycle-cost. This report details the testing of the first large US manufactured hybrid inverter and its associated maximum power tracker.

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0585 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0585 ref|NP_001071387.1| hypothetical protein LOC514131 [Bos taurus] r...ef|XP_001254537.1| PREDICTED: hypothetical protein LOC514131 [Bos taurus] dbj|BAF36506.1| p97Bucentaur-2 [Bos tau...rus] gb|AAI49203.1| P97Bucentaur-2 [Bos taurus] NP_001071387.1 4e-12 32% ...

  12. Gene : CBRC-BTAU-01-2917 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available protein-coupled receptor TGR5 [Bos taurus] sp|Q862A9|GPBAR_BOVIN G-protein coupled bile acid receptor 1 dbj|...BAC55234.1| G protein-coupled receptor [Bos taurus] gb|AAI22825.1| G protein-coupled receptor TGR5 [Bos taur...us] 0.0 100% gnl|UG|Bt#S12378054 Bos taurus G protein-coupled receptor TGR5 (TGR5

  13. Test report on the Abacus 30 kW bimode{reg_sign} inverter and maximum power tracker (MPT)

    Energy Technology Data Exchange (ETDEWEB)

    Bonn, R.; Ginn, J.; Zirzow, J. [and others

    1995-06-01

    Sandia National Laboratories conducts the photovoltaic balance of systems (BOS) program, which is sponsored by the US Department of Energy`s Office of Energy Management. Under this program, SNL lets commercialization contracts and conducts a laboratory program designed to advance BOS technology, improve BOS component reliability, and reduce the BOS life-cycle-cost. This report details the testing of the first large US manufactured hybrid inverter and its associated maximum power tracker.

  14. Predictive Value of Bronchiolitis Obliterans Syndrome Stage 0p in Chronic Graft-versus-Host Disease of the Lung

    Science.gov (United States)

    Abedin, Sameem; Yanik, Gregory A.; Braun, Thomas; Pawarode, Attaphol; Magenau, John; Goldstein, Steven C.; Levine, John E.; Kitko, Carrie L.; Couriel, Daniel R.

    2016-01-01

    Bronchiolitis obliterans syndrome (BOS) is a significant post-transplant complication with low survival. BOS stage 0p (BOS 0p) is a parameter detected on pulmonary function tests (PFTs) after lung transplantation to identify patients at risk to develop BOS. We performed a retrospective study on 442 patients who underwent allogeneic stem cell transplant from 2007 to 2011 to evaluate whether development of BOS 0p is a risk factor in this population for BOS. Patients who met criteria for BOS 0p were significantly more likely to develop BOS (hazard ratio [HR], 3.22; P HR, 2.48; P =.001) and chronic graft-versus-host disease (GVHD) outside the lung post-transplant (HR, 23; P < .001). Finally, BOS 0p criteria were adequately sensitive in predicting BOS (85%), with a high negative predictive value (98%). Our findings suggest a routine PFT screening strategy with the intent of detecting BOS 0p, especially among patients with prior lung disease and who developed chronic GVHD, could suitably identify an at-risk population for the development of BOS. PMID:25687798

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-1139 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1139 gb|ACX37386.1| toll-like receptor 1 variant 30 [Bos indicus] gb|ACX37387.1| toll...-like receptor 1 variant 31 [Bos indicus] gb|ACX37395.1| toll-like receptor 1 variant 39 [Bos indicus] ACX37386.1 0.0 89% ...

  16. NCBI nr-aa BLAST: CBRC-FCAT-01-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0063 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 2e-49 86% ...

  17. NCBI nr-aa BLAST: CBRC-OANA-01-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0052 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 62% ...

  18. NCBI nr-aa BLAST: CBRC-CFAM-37-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-37-0004 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-173 82% ...

  19. NCBI nr-aa BLAST: CBRC-HSAP-03-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-03-0018 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 1e-169 79% ...

  20. NCBI nr-aa BLAST: CBRC-MMUS-01-0025 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-01-0025 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-145 71% ...

  1. NCBI nr-aa BLAST: CBRC-MDOM-07-0080 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-07-0080 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-148 71% ...

  2. NCBI nr-aa BLAST: CBRC-MMUR-01-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-0053 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 6e-33 72% ...

  3. NCBI nr-aa BLAST: CBRC-OCUN-01-1390 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1390 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|A...AX46341.1| chemokine binding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 6e-88 76% ...

  4. NCBI nr-aa BLAST: CBRC-PCAP-01-1467 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1467 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-117 81% ...

  5. NCBI nr-aa BLAST: CBRC-ETEL-01-1472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-1472 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-121 76% ...

  6. NCBI nr-aa BLAST: CBRC-MEUG-01-2178 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2178 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-61 57% ...

  7. NCBI nr-aa BLAST: CBRC-TSYR-01-1334 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TSYR-01-1334 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-134 79% ...

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-0816 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0816 ref|NP_001069804.1| solute carrier family 16, member 7 [Bos tauru...s] gb|ABD39318.1| monocarboxylate transporter 2 [Bos taurus] gb|AAI40525.1| SLC16A7 protein [Bos taurus] NP_001069804.1 1e-125 79% ...

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0732 ref|NP_001094755.1| chemokine receptor CXCR2 [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 1e-113 59% ...

  10. NCBI nr-aa BLAST: CBRC-MLUC-01-0338 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0338 ref|NP_001071415.1| G protein-coupled receptor 77 [Bos taurus] gb...|AAI23494.1| G protein-coupled receptor 77 [Bos taurus] gb|ABI98946.1| C5L2 [Bos taurus] NP_001071415.1 1e-124 68% ...

  11. NCBI nr-aa BLAST: CBRC-MEUG-01-2252 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-2252 ref|NP_001094755.1| interleukin 8 receptor beta [Bos taurus] gb|ABC59060.1| CXCR2 [Bos tau...rus] gb|ABR88132.1| chemokine receptor CXCR2 [Bos taurus] NP_001094755.1 4e-70 71% ...

  12. Biomarkers for the prediction of the bronchiolitis obliterans syndrome after lung transplantation

    NARCIS (Netherlands)

    Paantjens, A.W.M.

    2011-01-01

    The main limitation for overall survival after lung transplantation (LTx) is the development of chronic rejection, which is represented by the bronchiolitis obliterans syndrome (BOS). The diagnosis BOS is based on lung function testing, however, it is a surrogate marker. And because BOS is an irreve

  13. UCP Mainport : kontseptuaalne uurimus Utrechti raudteejaama maa-ala arendamiseks = UCP Mainport : concept study redevelopment station area Utrecht

    Index Scriptorium Estoniae

    2000-01-01

    Mainporti projekti arhitekt Ben van Berkel, projekteerijad: Van Berkel & Bos, Holland Railconsult. Projekti II etapis uuriti Hoog Catherijne ostukeskuse laiendamist. Projekteerijad: Van Berkel & Bos, Neutelings & Riedijk, Alsop & Störmer.Van Berkel & Bos (arhitektibüroo, Holland). Holland Railconsult (projekteerimisbüroo, Utrecht). Alsop & Störmer (arhitektibüroo, London). Neutelings & Riedijk (arhitektibüroo, Rotterdam)

  14. Radiocarbon dates of late quaternary mammals in the Archangelsk Region and their contribution to reconstructions of the last glaciation in Eastern Europe

    NARCIS (Netherlands)

    Ponomarev, D. V.; Markova, A. K.; van Kolfschoten, T.; van der Plicht, J.; Yushkin, N.P.

    2012-01-01

    Twelve new AMS (Accelerator Mass Spectrometry) dates of large Quaternary mammal remains were reported: mammoth (Mammuthus primigenius, bison (Bison priscus), and musk ox (Ovibos pallantis) found in the Archangelsk Region. The absolute age of the identified samples varies from 46 000 to 22 000 calibr

  15. Cost of photovoltaic energy systems as determined by balance-of-system costs

    Science.gov (United States)

    Rosenblum, L.

    1978-01-01

    The effect of the balance-of-system (BOS), i.e., the total system less the modules, on photo-voltaic energy system costs is discussed for multikilowatt, flat-plate systems. Present BOS costs are in the range of 10 to 16 dollars per peak watt (1978 dollars). BOS costs represent approximately 50% of total system cost. The possibility of future BOS cost reduction is examined. It is concluded that, given the nature of BOS costs and the lack of comprehensive national effort focussed on cost reduction, it is unlikely that BOS costs will decline greatly in the next several years. This prognosis is contrasted with the expectations of the Department of Energy National Photovoltaic Program goals and pending legislation in the Congress which require a BOS cost reduction of an order of magnitude or more by the mid-1980s.

  16. PENGARUH PENERAPAN GOOD CORPORATE GOVERNANCE TERHADAP PERILAKU ETIS DALAM PENGELOLAAN DANA BANTUAN OPERASIONAL SEKOLAH

    Directory of Open Access Journals (Sweden)

    Fauzan Fauzan

    2014-11-01

    Full Text Available Penelitian ini bertujuan menguji pengaruh penerapan good corporate governance terhadap perilaku etis dalam pengelolaan Dana BOS SMP di Kota Malang. Jenis penelitian adalah survey. Populasinya adalah kepala sekolah SMP baik negeri dan swasta penerima Dana BOS. Ada 24 SMP Negeri dan 66 SMP Swasta penerima Dana BOS. Teknik pengambilan sampelnya adalah simple random sampling. Penelitian ini menggunakan metode analisis regresi linear berganda. Hasil analisis menunjukkan bahwa semua variabel independen secara simultan berpengaruh positif dan signifikan terhadap variabel dependen. Secara parsial, transparansi berpengaruh secara positif dan signifikan terhadap pengelolaan dana BOS. Akuntabilitas berpengaruh negative dan tidak signifikan terhadap pengelolaan dana BOS. Partisipasi masyarakat berpengaruh secara positif dan tidak signifikan terhadap pengelolaan dana BOS. Transparansi yang paling dominan mempengaruhi pengelolaan dana BOS.

  17. Bovine gene polymorphisms related to fat deposition and meat tenderness.

    Science.gov (United States)

    Fortes, Marina R S; Curi, Rogério A; Chardulo, Luis Artur L; Silveira, Antonio C; Assumpção, Mayra E O D; Visintin, José Antonio; de Oliveira, Henrique N

    2009-01-01

    Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP), thyroglobulin (TG) and diacylglycerol O-acyltransferase (DGAT1). A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus), Canchim (5/8 Bos taurus + 3/8 Bos indicus), Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus), Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus) and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus) breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM) procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus.

  18. Bovine gene polymorphisms related to fat deposition and meat tenderness

    Directory of Open Access Journals (Sweden)

    Marina R.S. Fortes

    2009-01-01

    Full Text Available Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP, thyroglobulin (TG and diacylglycerol O-acyltransferase (DGAT1. A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus, Canchim (5/8 Bos taurus + 3/8 Bos indicus, Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus, Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus.

  19. Bovine gene polymorphisms related to fat deposition and meat tenderness.

    Science.gov (United States)

    Fortes, Marina R S; Curi, Rogério A; Chardulo, Luis Artur L; Silveira, Antonio C; Assumpção, Mayra E O D; Visintin, José Antonio; de Oliveira, Henrique N

    2009-01-01

    Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP), thyroglobulin (TG) and diacylglycerol O-acyltransferase (DGAT1). A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus), Canchim (5/8 Bos taurus + 3/8 Bos indicus), Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus), Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus) and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus) breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM) procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus. PMID:21637649

  20. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus durante o anestro pós-parto

    Directory of Open Access Journals (Sweden)

    R.S. Lima

    2011-08-01

    Full Text Available Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12. Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica de imunoistoquímica. Altas contagens relativas e alta intensidade de marcação para receptor de estrógeno e progesterona no epitélio glandular e no estroma foram observadas nos dois grupos. No entanto, a intensidade de marcação para o receptor de progesterona no epitélio glandular foi mais alta no grupo 2 comparado ao grupo 1. Quando o epitélio glandular e o estroma foram comparados, o número relativo de receptor de estrógeno no grupo 1 foi mais alto no epitélio glandular comparado ao estroma, e a intensidade de marcação para o receptor de progesterona no grupo 2 foi mais alta no epitélio glandular comparado ao estroma. Os resultados sugerem que os mecanismos que controlam a expressão de receptores no anestro são semelhantes aos observados durante o ciclo estral.

  1. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-07-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitro en los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  2. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-06-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitroen los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  3. Análisis de los tipos de fibras musculares del toro bravo (Bos Taurus ibericus): su relación con algunas enzimas de fatiga muscular y el comportamiento durante la lidia

    OpenAIRE

    Ros Sempere, Juan

    2016-01-01

    Muestras de músculo esquelético y sangre fueron tomadas a 48 toros bravos (novillos) lidiados en la plaza de toros de Calasparra (Murcia). Los músculos seleccionados, cabeza larga del tríceps braquial y semitendinoso, fueron analizados desde el punto de vista histológico, con el fin de estudiar las características morfológicas e histoquímicas de los distintos tipos de miocitos y las posibles alteraciones consecuencia de la lidia. Las técnicas histoquímicas han posibilitado reconocer tres tipo...

  4. Análisis de los tipos de fibras musculares del toro bravo (Bos Taurus ibericus): su relación con algunas enzimas de fatiga muscular y el comportamiento durante la lidia

    OpenAIRE

    Ros Sempere, Juan

    2016-01-01

    Muestras de músculo esquelético y sangre fueron tomadas a 48 toros bravos (novillos) lidiados en la plaza de toros de Calasparra (Murcia). Los músculos seleccionados, cabeza larga del tríceps braquial y semitendinoso, fueron analizados desde el punto de vista histológico, con el fin de estudiar las características morfológicas e histoquímicas de los distintos tipos de miocitos y las posibles alteraciones consecuencia de la lidia. Las técnicas histoquímicas han posibilitado reconocer tres tip...

  5. Detecção imunoistoquímica de receptores de estrógeno e progesterona no endométrio de vacas Nelore (Bos taurus indicus) durante o anestro pós-parto

    OpenAIRE

    Lima, R S; I. Martin; W.C. Marques Filho; M.M.P. Rodrigues; R Laufer-Amorim; Ferreira, J.C.P.

    2011-01-01

    Foram utilizadas 24 vacas Nelore P.O., em anestro pós-parto, diagnosticado pelo histórico reprodutivo, por avaliações ultrassonográficas transretais e por dosagem de progesterona plasmática, que foram submetidas à colheita de fragmento uterino via transcervical. Os animais foram divididos em dois grupos conforme o máximo diâmetro folicular: grupo 1: folículos 6mm (n=12). Para avaliar receptor de estrógeno e receptor de progesterona no epitélio glandular e no estroma, foi utilizada a técnica d...

  6. Cadenas cuánticas con acoplos espín-bosón: aplicaciones en simulación cuántica (Quantum chains with spin-boson couplings: applications in quantum simulation)

    OpenAIRE

    Nevado Serrano, Pedro

    2012-01-01

    En este trabajo pretendemos estudiar modelos colectivos de espines acoplados a bosones para ser implementados en sistemas de iones atrapados o cavity/circuit QED. El problema que vamos a tratar podría servir para generar estados entrelazados de fotones, lo cual tiene especial utilidad en cualquier realización práctica de información o computación cuántica. Existen modelos relacionados que se han introducido en física del estado sólido para el estudio de acoplos Jahn-Teller entre estados elect...

  7. Búsqueda del Bosón de Higgs del Modelo Standard en el canal de desintegración H → WW∗ → 2μ2ν en el experimento CMS del LHC

    CERN Document Server

    Gonzalez Suarez, Rebeca; Rodrigo Anoro, Teresa

    2010-01-01

    A prospective analysis for the search of a SM Higgs boson in the Compact Muon Solenoid (CMS) experiment at the LHC is performed in this thesis, focusing in the gg → H → WW∗ → μνμν process. The search channel has a clear signature characterized by the presence of two high PT muons in the final state and a significant amount of missing ET due to the undetected neutrinos. No hard jet activity is expected. The principal sources of background come from several SM processes that may have similar final states as those of the signal, mainly W + jets, Z + jets, tt and the almost irreducible WW. Other sources of background are WZ, ZZ and tW processes. Final states coming from QCD processes have different signatures but very large cross-sections and they have also been studied. Several analysis techniques have been developed in this work. The main one is based on the application of a sequential selection criteria using a set of physical observables which characterize the main kinematic properties of the sign...

  8. 川西北牦牛布鲁氏菌病血清流行病学调查%Sero-epidemiological Survey of Brucellosis among Yak(Bos grunniens) in Northwestern Sichuan province

    Institute of Scientific and Technical Information of China (English)

    杨发龙; 张焕容; 王言轩; 周子雄; 王远微; 汤承

    2013-01-01

    The indirect ELISA(iELISA),the Rose bengal plate test(RBPT)and standard tube agglutination test(SAT), were used to investigate the serological prevalence of bovine brucellosis in yak in regions ordering northwestern Sichuan province of China. A total of 1070 serum samples collected from 8 counties in the grassland area in northwest Sichuan province of China,were examined to investigate the brucellosis sero-prevalence by the three methods. Serological evi-dence indicated that the apparent prevalence of brucellosis in yaks was 25.4%(272/1070) detected by iELISA,12.7%(136/1070)by RBPT,and 9.1%(97/1070) by STAT,suggesting that yak brucellosis existed in all the 8 counties under in the study. The relative sensitivity and speciifcity of RBPT were 50.0%and 100%,those of STAT were 35.7%and 100%respectively,compared with iELISA. The results shown that iELISA was the most sensitive method.%同时采用间接ELISA、虎红平板凝集试验和试管凝集试验三种血清学方法调查川西北牦牛布鲁氏菌病血清流行情况。对1070份采自川西北阿坝州8个草地县的牦牛血清样品经三种血清学方法检测,间接ELISA检测阳性率为25.4%(272/1070),虎红平板凝集试验检测阳性率为12.7%(136/1070),而试管凝集试验检测阳性率为9.1%(97/1070)。8个县均发现阳性布鲁氏菌病血清。与间接ELISA相比,虎红平板凝集试验的相对敏感性和特异性分别为50%和100%,而试管凝集试验的相对敏感性和特异性分别为35.7%和100%。布鲁氏菌病在川西北地区广泛存在,血清学方法是检测和监测布鲁氏菌病最常用和最简便的方法,其中间接ELISA方法最为敏感。

  9. Fatores etários no leucograma de fêmeas zebuínas sadias da raça Nelore (Bos indicus Influence of age on the leukogram values for healthy Nelore (Zebu cattle

    Directory of Open Access Journals (Sweden)

    Joselito Nunes Costa

    2000-06-01

    Full Text Available Para avaliar-se a influência dos fatores etários sobre o leucograma de fêmeas zebuínas da raça Nelore, examinaram-se amostras de sangue de 158 animais, distribuídos por sete grupos etários ( até 3 meses; 3 a 6 meses; 6 a 12 meses; 12 a 24 meses; 24 a 48 meses; 48 a 72 meses e maior que 72 meses. Os resultados expressos em valores médios (± desvios padrões máximo (máx. e mínimo (mín. em milhares de células por mm³ para os diferentes componentes do leucograma foram os seguintes: leucócitos total máx. - 16992 ± 4104 ( 6 a 12 meses e min. -10353 ± 2397 (48 a 72 meses ; neutrófilos total máx. - 3931 ± 1578 (até 3 meses e min. - 2416 ± 1118 ( 6 a 12 meses ; eosinófilos máx. - 999 ± 499 (24 a 48 meses e min. - 265 ± 276 ( 3 a 6 meses ; basófilos máx. - 67 ± 88 (> 72 meses e min. - 39 ± 78 (6 a 12 meses; linfócitos típicos máx. - 12758 ± 3608 (6 a 12 meses e min. - 5906 ± 1883 (48 a 72 meses; linfócitos atípicos máx. - 1310 ± 603 (3 a 6 meses e min. - 760 ± 419 ( 48 a 72 meses ; linfócitos total máx. - 14079 ± 4027 (6 a 12 meses e min. - 6666 ± 2059 ( 48 a 72 meses ; monócitos máx. -27 ± 62 ( até 3 meses e min.- 0 ( 6 a 12 meses. A existência de diferenças (p > 0,05 entre grupos demonstrando diminuição dos neutrófilos e aumento dos linfócitos no primeiro ano de vida; a diminuição dos valores do total de leucócitos a partir de um ano de idade, como reflexo de comportamento similar dos números de linfócitos (típicos e atípicos e o aumento dos eosinófilos entre 24 e 48 meses de vida, caracterizaram a influência dos fatores etários sobre a variação dos valores dos componentes do leucograma de fêmeas zebuínas da raça Nelore criadas em São Paulo - Brasil.In order to evaluate the influence of the age on the white blood cell counts of Nelore (Zebu cattle, 158 blood samples from seven groups of different ages (group I-up to three months; group II-three to six months; group III-six to 12 months; group IV-12 to 24 months; group V-24 to 48 months; group VI-48 to 72 months and group VII-older than 72 months were studied. The highest and lowest mean values observed were total white blood cell/mm³-16992±4104 (group III and 10353±2397 (group VI; neutrophils/mm³-3931±1578 (group I and 2416 ±1118 (group III; eosinophils/ mm³-999±499 (group V and 265±276 (group II; basophils/mm³-67±88 (group VII and 39±78 (group III; typical lymphocytes/ mm³-12758±3608 (group III and 5906±1883 (group VI; atypical lymphocytes/ mm³-1310±603 (group II and 760±419 (group VI ; lymphocytes total/ mm³-14079±4027 (group III and 6666±2059 (group VI; monocytes/mm³-27±62 (group I and 0 (group III. The differences (p>0.05 observed among the groups in relation to total white blood cell, lymphocytes, neutrophils and eosinophils can be related to the influence of the age on leukogram of Nelore (Zebu cattle raised in São Paulo- Brazil.

  10. Tipos de fibras en el músculo esquelético del toro bravo (bos taurus ibericus) : su relación con la caída durante la lídia / 2001.

    OpenAIRE

    Martínez Gomariz, Francisco

    2001-01-01

    Tesis-Universidad de Murcia. Consulte la tesis en: BCA. GENERAL. ARCHIVO UNIVERSITARIO. T.M.-2275. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Departamentos. E002B TESIS 95. Consulte la tesis en: BCA. GENERAL. Fac. Veterinaria. Sala de estudio. Tesis-V 153.

  11. Parámetros protéicos del plasma seminal y su relación con la calidad del semen en toros de la raza nelore (bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Ana Sánchez

    2006-10-01

    Full Text Available El propósito de este estudio fue investigar la presenciae incidencia de bandas proteicas específicas delplasma seminal en toros Nelore, completa y parcialmente aptos para la actividad reproductiva. Se utilizaron 68 ejemplares; 20 de variedad Padrón y 48 Mochos, con edad media de 4 años. En el perímetro escrotal (35,05±0,49 cm e 33,30±0,39cm, índice de masa corpórea (302,62±5,87 e 284,19±5,15Kg|m2 hubo diferencia (p<0,05 entre las variedades Padrón y Mocho, respectivamente. Con respecto al peso corpóreo (627,70±11,37 e 611,58±8,66Kg; la altura (1,44±0,01e 1,47±0,01m; el volumen del eyaculado (5,82±0,48 e 5,17±0,29 mL, la motilidad espermática progresiva (73,50±2,81% e75,62±0,97%, el vigor espermático (4,30±0,19 e4,27±0,11 y motilidad en masa (4,27±0,11 e3,33±0,23 no se presentó diferencia (p>0,05. En morfología espermática, tampoco hubo desigualdad entre las variedades Padrón y Mocho, respectivamente con 5,06 ± 8,20% e 5,32 ± 6,40% de defectos mayores; 9,91±6,74% e 8,36±6,06% para los defectos menores; e 14,76±13,20% e 13,82±12,61% para los defectos totales. La electroforesis del plasma seminal reveló bandas proteicas con pesos entre 5 a 105 KDa. En el 100% de toros aptos para la reproducción, la proteína con pesos de 13 Kda estuvo presente. De la misma forma ocurrió con las bandas de 20 KDa. El resto de las bandas proteicas mostraron presencia con diferentes porcentajes de incidencia en toros aptos o parcialmente aptos para la actividad reproductiva. Las dos variedades estudiadas hicieron evidente la adaptación reproductiva eficaz en condiciones de clima semejantes.

  12. Un modelo didáctico para comprender el bosón de Higgs como parte del modelo estándar de partículas elementales

    Directory of Open Access Journals (Sweden)

    Jonás Valencia Carrillo

    2016-01-01

    Full Text Available Se explica de forma didáctica, accesible para profesores que imparten los cursos de física moderna básica, el mecanismo del rompimiento espontáneo de la sime - tría con la presencia de un campo de Higgs. Para conseguir este objetivo, se desarrolla un modelo matemático basado en el comportamiento de resortes que obedecen a las leyes del oscilador armónico simple y con la presencia de cargas que oscilan junto con éstos. Como resultado, se obtiene que la luz emitida por las cargas oscilantes, los fotones, duplican su masa cuando los resortes se deforman más allá de su límite elástico debido a la presencia de una fuerza externa que rompe la simetría inicial del sistema.

  13. Effects of equine chorionic gonadotrophin on follicular, luteal and conceptus development of non-lactating Bos indicus beef cows subjected to a progesterone plus estradiol-based timed artificial insemination protocol

    Directory of Open Access Journals (Sweden)

    Paulo Pitaluga Costa e Silva Filho

    2013-08-01

    Full Text Available The aim of this study was to evaluate the effects of equine chorionic gonadotropin (eCG on ovarian follicular responses, corpus luteum (CL development and conceptus length on day 16 after timed artificial insemination (TAI. A total of 124 cows at day 0 (D0 received 2 mg of estradiol benzoate (EB and the insertion of a progesterone (P4 intravaginal device. Eight days later, the device was removed, and cows received 0.15 mg of prostaglandin and 0.5 mg of estradiol cypionate (EC, and were randomly assigned to 1 of 2 treatments: eCG (n=60, in which cows received 300 U of eCG; and control (n=64. Cows were TAI 48 h after P4 device removal. The diameter of the largest follicle (LF present on D8 and D10 and of CL on D15 and D26 were measured. Conceptus recovered rate, conceptus length, CL diameter and weight were determined at slaughter on D26. Plasma P4 concentration was determined on D15 and D26. Follicular growth from D8 to D10 (P=0.03, the diameter of CL at D15 (P=0.03 and D26 (P=0.003 and the CL weight at day 26 (P=0.04 were greater in the eCG group than the control. However, there was no effect of eCG treatment on oestrus occurrence, conceptus recovery rate and length, or P4 concentrations on either D15 or D26. In conclusion, although eCG increases follicular responses and the diameter of the CL, this gonadotropin treatment does not influence the length of the conceptus or the P4 concentration on the subsequent oestrus cycle.

  14. Influência de diferentes concentrações de etileno glicol nO número de células da granulosa e morfometria de folículos pré-antrais inclusos em tecido ovariano de Bos taurus indicus, Linnaeus, 1758 Influence of different concentrations of the glycol in the number of granulosa cells and morphometry of the preantral ovarian follicles of Bos taurus indicus, Linnaeus, 1758

    Directory of Open Access Journals (Sweden)

    Hélder Silva e Luna

    2010-12-01

    Full Text Available A criopreservação de folículos ovarianos pré-antrais pode ajudar na conservação de muitas espécies domésticas e selvagens. Neste trabalho, objetivou-se verificar o efeito do etileno glicol, em diferentes concentrações, na morfometria e número de células da granulosa de folículos pré-antrais inclusos em tecido ovariano bovino. O teste de toxicidade foi realizado com fragmentos ovarianos expostos ao etileno glicol em concentrações de 10, 20 ou 40%. O tecido foi analisado por técnica histológica clássica. Os folículos primordiais expostos à concentração de 40% apresentaram redução do diâmetro folicular e ovocitário quando comparados ao grupo controle (sem exposição, 10% e 20% (P0,05. Esses resultados sugerem que folículos primários são mais resistentes aos efeitos do etileno glicol quando comparados aos primordiais.The cryopreservation of the ovarian preantral follicles could help the conservation of several domestic and wild animal species. The objective of this study was to verify the effect of different concentrations of ethylene glycol on the morphometry and number of granulosa cells of the preantral ovarian follicles. A toxicity test was conducted with strips of ovarian cortex using ethylene glycol (10, 20 or 40%. Tissue analysis was done using classical histology techniques. The primordial follicles expose at a concentration of 40% showed reduction of the follicular diameter and oocyte when compared to the control (non exposing, 10 and 20% groups (P0.05. These results suggest that primary follicles are more resistant to the effect of ethylene glycol when compared to primordial ones.

  15. An Official Critical Care Societies Collaborative Statement-Burnout Syndrome in Critical Care Health-care Professionals: A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients. PMID:27396776

  16. An Official Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Health Care Professionals: A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of health care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health care professionals and diminish the harmful consequences of BOS, both for critical care health care professionals and for patients. PMID:27369038

  17. An Official Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Healthcare Professionals: A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of healthcare professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other healthcare professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care healthcare professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care healthcare professionals and diminish the harmful consequences of BOS, both for critical care healthcare professionals and for patients. PMID:27309157

  18. A Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Health-care Professionals. A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients. PMID:27367887

  19. Dicty_cDB: Contig-U06832-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *** SEQUENCING IN ... 44 0.14 3 ( AC222622 ) Bos taurus clone CH240-444H3, WORKI...la robusta Primary Ear... 48 0.20 1 ( AC160169 ) Bos taurus clone CH240-83D1, WORK...ING DRAFT SEQUEN... 42 0.20 2 ( AC174785 ) Bos taurus clone CH240-232O2, WORKING DRAFT SEQUE... 40 0.20 3 (... AC163194 ) Bos taurus clone CH240-81E14, WORKING DRAFT SEQUE... 42 0.29 3 ( AC172241 ) Bos taurus clone CH240-109C14, WORK...ING DRAFT SEQU... 42 0.42 3 ( AC174203 ) Bos taurus clone CH240-310M23, WORKING DRAFT SEQU...

  20. Dicty_cDB: Contig-U08964-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -133 3 ( AC224028 ) Bos taurus clone CH240-451P24, WORKING DRAFT SEQU... 52 0.047 1 ( AC222332 ) Bos taurus clone CH240-415E17, WORK...ING DRAFT SEQU... 52 0.047 1 ( AC219483 ) Bos taurus clone CH240-332B8, WORK...ING DRAFT SEQUE... 52 0.047 1 ( AC165698 ) Bos taurus clone CH240-166F6, WORKING DRAFT SE...Bos taurus clone CH240-227E24, WORKING DRAFT SEQU... 50 0.076 3 ( BX005088 ) Zebrafish DNA sequence from clo... 1 ( AC096711 ) Homo sapiens BAC clone RP11-1E22 from 4, complete... 50 0.19 1 ( AC157136 ) Bos taurus clone CH240-71E13, WORK

  1. Dicty_cDB: Contig-U11830-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 46 ) Bos taurus clone CH240-527K6, WORKING DRAFT SEQUE... 60 2e-04 1 ( AC172145 ) Bos taurus clone CH240-161L3, WORK...chromosome 7, compl... 54 2e-04 12 ( AC158065 ) Bos taurus clone CH240-58F5, WORKING DRAFT SEQUEN... 44 3e-0...147O16 on chro... 58 6e-04 1 ( AC156122 ) Bos taurus clone CH240-47H2, WORKING DR...AFT SEQUEN... 58 6e-04 1 ( AC156049 ) Bos taurus clone CH240-57F7, WORKING DRAFT SEQUEN... 58 6e-04 1 ( AC15...2624 ) Bos taurus clone CH240-14A23, WORKING DRAFT SEQUE... 58 6e-04 1 ( AC120061 ) Rattus norvegicus clone

  2. Dicty_cDB: Contig-U15162-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC173024 ) Bos taurus clone CH240-289A10, WORKING DRAFT SEQU... 40 0.083 2 ( AC1...56078 ) Bos taurus clone CH240-52A9, WORKING DRAFT SEQUEN... 40 0.25 4 ( EY327866 ) CAWY1292.fwd CAWY Helobd...0.55 1 ( AC162073 ) Bos taurus clone CH240-111I24, WORKING DRAFT SEQU... 48 0.55 ...1 ( AC162002 ) Bos taurus clone CH240-108P17, WORKING DRAFT SEQU... 48 0.55 1 ( AC157385 ) Bos taurus clone CH240-61K23, WORK...ING DRAFT SEQUE... 48 0.55 1 ( AC155032 ) Bos taurus clone CH240-31K3, WORKING DRAFT SEQUEN

  3. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  4. Exposing Compassion Fatigue and Burnout Syndrome in a Trauma Team: A Qualitative Study.

    Science.gov (United States)

    Berg, Gina M; Harshbarger, Jenni L; Ahlers-Schmidt, Carolyn R; Lippoldt, Diana

    2016-01-01

    Compassion fatigue (CF) and burnout syndrome (BOS) are identified in trauma, emergency, and critical care nursing practices. The purpose of this qualitative study was to measure CF and BOS in a trauma team and allow them to share perceptions of related stress triggers and coping strategies. Surveys to measure CF and BOS and a focus group allowed a trauma team (12 practitioners) to share perceptions of related stress triggers and coping strategies. More than half scored at risk for CF and BOS. Stress triggers were described as situation (abuse, age of patient) versus injury-related. Personal coping mechanisms were most often reported. Both CF and BOS can be assessed with a simple survey tool. Strategies for developing a program culturally sensitive to CF and BOS are provided. PMID:26745533

  5. Improving survival outcomes in lung transplant recipients through early detection of bronchiolitis obliterans: Daily home spirometry versus standard pulmonary function testing

    OpenAIRE

    Robson, Kevin S; West, Andrew J.

    2014-01-01

    BACKGROUND: Long-term lung transplant success is limited by bronchiolitis obliterans syndrome (BOS), a form of chronic allograft rejection that manifests in the majority of patients by five years post-transplant. Frequent monitoring of pulmonary function measurements through the use of daily home spirometry may have the capability to detect the onset of BOS sooner than standard pulmonary function testing. Early detection of BOS would confer a treatment advantage that may improve survival outc...

  6. Intraspecific phylogenetic analysis of Siberian woolly mammoths using complete mitochondrial genomes

    DEFF Research Database (Denmark)

    Gilbert, M Thomas P; Drautz, Daniela I; Lesk, Arthur M;

    2008-01-01

    We report five new complete mitochondrial DNA (mtDNA) genomes of Siberian woolly mammoth (Mammuthus primigenius), sequenced with up to 73-fold coverage from DNA extracted from hair shaft material. Three of the sequences present the first complete mtDNA genomes of mammoth clade II. Analysis...... to indicate any important functional difference between genomes belonging to the two clades, suggesting that the loss of clade II more likely is due to genetic drift than a selective sweep....

  7. Gene : CBRC-TTRU-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

  8. Lung transplantation: does oxidative stress contribute to the development of bronchiolitis obliterans syndrome?

    Science.gov (United States)

    Madill, Janet; Aghdassi, Ellie; Arendt, Bianca; Hartman-Craven, Brenda; Gutierrez, Carlos; Chow, Chung-Wai; Allard, Johane

    2009-04-01

    Lung transplantation is the ultimate treatment of end-stage lung disease. After transplantation, the 1-year survival rate is 80%. However, 5-year survival rates drop to 50% due to bronchiolitis obliterans syndrome (BOS). Ischemia/reperfusion injury, infections, and acute rejection are major risk factors contributing to the development of BOS. These risk factors are also associated with increased oxidative stress. Oxidative stress is a condition whereby prooxidants overwhelm the antioxidant defense system and may contribute to the pathogenesis of BOS by inducing more tissue injury and inflammation. This article reviews the current state of knowledge on oxidative stress in lung transplantation and BOS. PMID:19298941

  9. Maternal rigidity in infancy and level of intelligence at school age in children born preterm

    NARCIS (Netherlands)

    Butcher, P.R.; Wijnberg-Williams, B.J; Hegemann, N; Stremmelaar, E.F; Schoemaker, M.M.; Van der Meere, J.J.; Bambang Oetomo, S

    2004-01-01

    Forty-four children who had been born preterm and their mothers participated in the follow-up study. At 3 and 14 months (corrected age) cognitive development was assessed using the BOS 2-30, the Dutch version of the Bayley Scales of Infant Development. The BOS yields measures of mental and motor dev

  10. 76 FR 10299 - Endangered and Threatened Wildlife and Plants: 90-Day Finding on a Petition To List the Wild...

    Science.gov (United States)

    2011-02-24

    ... completed a 90-day finding on August 15, 2007 (72 FR 45717). Based upon the information available at that... first classified the bison in 1758, assigning the animal to Bos, the same genus as domestic cattle (Bos... FR 54707), for the Arctic grayling (Thymallus arcticus) and a 12-month finding published on...

  11. NCBI nr-aa BLAST: CBRC-GGAL-03-0011 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGAL-03-0011 ref|NP_001029461.1| degenerative spermatocyte homolog 1, lipid de...saturase [Bos taurus] gb|AAI03032.1| Degenerative spermatocyte homolog 1, lipid desaturase [Bos taurus] NP_001029461.1 1e-128 81% ...

  12. NCBI nr-aa BLAST: CBRC-CJAC-01-1624 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1624 ref|NP_001029461.1| degenerative spermatocyte homolog 1, lipid de...saturase [Bos taurus] gb|AAI03032.1| Degenerative spermatocyte homolog 1, lipid desaturase [Bos taurus] NP_001029461.1 1e-134 88% ...

  13. NCBI nr-aa BLAST: CBRC-PTRO-01-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-01-0105 ref|NP_001029461.1| degenerative spermatocyte homolog 1, lipid de...saturase [Bos taurus] gb|AAI03032.1| Degenerative spermatocyte homolog 1, lipid desaturase [Bos taurus] NP_001029461.1 1e-134 88% ...

  14. NCBI nr-aa BLAST: CBRC-OLAT-26-0037 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0037 ref|NP_001029461.1| degenerative spermatocyte homolog 1, lipid de...saturase [Bos taurus] gb|AAI03032.1| Degenerative spermatocyte homolog 1, lipid desaturase [Bos taurus] NP_001029461.1 1e-116 77% ...

  15. NCBI nr-aa BLAST: CBRC-ETEL-01-0187 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0187 ref|NP_001029461.1| degenerative spermatocyte homolog 1, lipid de...saturase [Bos taurus] gb|AAI03032.1| Degenerative spermatocyte homolog 1, lipid desaturase [Bos taurus] NP_001029461.1 1e-129 86% ...

  16. NCBI nr-aa BLAST: CBRC-HSAP-01-0110 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-01-0110 ref|NP_001029461.1| degenerative spermatocyte homolog 1, lipid de...saturase [Bos taurus] gb|AAI03032.1| Degenerative spermatocyte homolog 1, lipid desaturase [Bos taurus] NP_001029461.1 1e-133 88% ...

  17. Germline LEMD3 mutations are rare in sporadic patients with isolated melorheostosis

    DEFF Research Database (Denmark)

    Hellemans, Jan; Debeer, Philippe; Wright, Michael;

    2006-01-01

    To further explore the allelic heterogeneity within the group of LEMD3-related disorders, we have screened a larger series of patients including 5 probands with osteopoikilosis or Buschke-Ollendorff syndrome (BOS), 2 families with the co-occurrence of melorheostosis and BOS, and 12 unrelated pati...

  18. NCBI nr-aa BLAST: CBRC-OANA-01-1282 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1282 ref|NP_776559.1| oxytocin receptor [Bos taurus] sp|P56449|OXYR_BO...VIN Oxytocin receptor (OT-R) gb|AAC70786.1| oxytocin receptor [Bos taurus] NP_776559.1 1e-136 80% ...

  19. NCBI nr-aa BLAST: CBRC-GACU-03-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-03-0016 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-115 50% ...

  20. NCBI nr-aa BLAST: CBRC-OLAT-17-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-17-0016 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-99 58% ...

  1. NCBI nr-aa BLAST: CBRC-FRUB-02-0631 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0631 ref|NP_776543.2| myocilin, trabecular meshwork inducible glucocor...ticoid response [Bos taurus] gb|AAI04572.1| Myocilin, trabecular meshwork inducible glucocorticoid response [Bos taurus] NP_776543.2 1e-102 53% ...

  2. NCBI nr-aa BLAST: CBRC-STRI-01-2431 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2431 ref|NP_001030220.1| neuromedin U receptor 2 [Bos taurus] sp|Q58CW...4|NMUR2_BOVIN RecName: Full=Neuromedin-U receptor 2; Short=NMU-R2 gb|AAX46680.1| neuromedin U receptor 2 [Bos taurus] NP_001030220.1 0.0 84% ...

  3. NCBI nr-aa BLAST: CBRC-TTRU-01-1168 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-1168 ref|NP_001030220.1| neuromedin U receptor 2 [Bos taurus] sp|Q58CW...4|NMUR2_BOVIN RecName: Full=Neuromedin-U receptor 2; Short=NMU-R2 gb|AAX46680.1| neuromedin U receptor 2 [Bos taurus] NP_001030220.1 1e-163 90% ...

  4. NCBI nr-aa BLAST: CBRC-PVAM-01-0659 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-0659 ref|NP_001030220.1| neuromedin U receptor 2 [Bos taurus] sp|Q58CW...4|NMUR2_BOVIN RecName: Full=Neuromedin-U receptor 2; Short=NMU-R2 gb|AAX46680.1| neuromedin U receptor 2 [Bos taurus] NP_001030220.1 0.0 84% ...

  5. NCBI nr-aa BLAST: CBRC-BTAU-01-1883 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1883 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 99% ...

  6. NCBI nr-aa BLAST: CBRC-RMAC-11-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-11-0047 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-0778 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0778 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 8e-63 89% ...

  8. NCBI nr-aa BLAST: CBRC-TTRU-01-0439 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0439 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 91% ...

  9. NCBI nr-aa BLAST: CBRC-FCAT-01-1221 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1221 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  10. NCBI nr-aa BLAST: CBRC-TNIG-11-0018 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-11-0018 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-105 51% ...

  11. NCBI nr-aa BLAST: CBRC-CFAM-27-0019 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-27-0019 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 83% ...

  12. NCBI nr-aa BLAST: CBRC-PABE-13-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-13-0047 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  13. NCBI nr-aa BLAST: CBRC-TBEL-01-1351 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1351 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  14. NCBI nr-aa BLAST: CBRC-PTRO-13-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-13-0056 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  15. NCBI nr-aa BLAST: CBRC-GACU-23-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0004 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-108 51% ...

  16. NCBI nr-aa BLAST: CBRC-MMUR-01-1175 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1175 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  17. NCBI nr-aa BLAST: CBRC-GGOR-01-0838 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0838 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-92 84% ...

  18. NCBI nr-aa BLAST: CBRC-OCUN-01-1169 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1169 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-167 79% ...

  19. NCBI nr-aa BLAST: CBRC-OANA-01-0848 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0848 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-135 64% ...

  20. NCBI nr-aa BLAST: CBRC-MLUC-01-0607 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0607 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  1. NCBI nr-aa BLAST: CBRC-EEUR-01-1395 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1395 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-132 85% ...

  2. NCBI nr-aa BLAST: CBRC-MEUG-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MEUG-01-0121 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-131 72% ...

  3. NCBI nr-aa BLAST: CBRC-PVAM-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PVAM-01-1419 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-156 73% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-1013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1013 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-129 59% ...

  5. NCBI nr-aa BLAST: CBRC-PHAM-01-1399 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1399 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 86% ...

  6. NCBI nr-aa BLAST: CBRC-PCAP-01-1579 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1579 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 84% ...

  7. NCBI nr-aa BLAST: CBRC-CJAC-01-1501 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1501 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  8. NCBI nr-aa BLAST: CBRC-OGAR-01-1283 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1283 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  9. NCBI nr-aa BLAST: CBRC-RNOR-07-0387 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-07-0387 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 82% ...

  10. NCBI nr-aa BLAST: CBRC-FRUB-02-0486 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0486 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-105 52% ...

  11. NCBI nr-aa BLAST: CBRC-ETEL-01-0242 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ETEL-01-0242 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 85% ...

  12. NCBI nr-aa BLAST: CBRC-HSAP-12-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-12-0048 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 89% ...

  13. NCBI nr-aa BLAST: CBRC-STRI-01-2762 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2762 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 1e-110 85% ...

  14. NCBI nr-aa BLAST: CBRC-MMUS-15-0051 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-15-0051 ref|NP_001033657.1| inflammation-related G protein-coupled recept...or EX33 [Bos taurus] gb|AAX31354.1| inflammation-related G protein-coupled receptor EX33 [Bos taurus] NP_001033657.1 0.0 82% ...

  15. NCBI nr-aa BLAST: CBRC-TTRU-01-0672 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0672 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-178 74% ...

  16. NCBI nr-aa BLAST: CBRC-MLUC-01-0889 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0889 ref|NP_001039933.1| protein kinase C and casein kinase substrate in neurons... 2 [Bos taurus] gb|AAI14746.1| Protein kinase C and casein kinase substrate in neurons 2 [Bos taurus] NP_001039933.1 1e-173 68% ...

  17. Acute cellular rejection is a risk factor for bronchiolitis obliterans syndrome independent of post-transplant baseline FEV1

    DEFF Research Database (Denmark)

    Burton, C.M.; Iversen, M.; Carlsen, J.;

    2009-01-01

    BACKGROUND: Post-transplant baseline forced expiratory volume in 1 second (FEV(1)) constitutes a systematic bias in analyses of bronchiolitis obliterans syndrome (BOS). This retrospective study evaluates risk factors for BOS adjusting for the confounding of post-transplant baseline FEV(1). METHODS...

  18. The number of FoxP3+ cells in transbronchial lung allograft biopsies does not predict bronchiolitis obliterans syndrome within the first five years after transplantation

    DEFF Research Database (Denmark)

    Krustrup, Dorrit; Iversen, Martin; Martinussen, Torben;

    2015-01-01

    Background: An important limitation to the success of lung transplantation is the development of bronchiolitis obliterans syndrome (BOS). It has been hypothesized that regulatory T lymphocytes (Tregs) are related to the risk of BOS. We aim to evaluate whether the number of forkhead box P3 (FoxP3...

  19. NCBI nr-aa BLAST: CBRC-PTRO-20-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-20-0075 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-164 78% ...

  20. NCBI nr-aa BLAST: CBRC-CJAC-01-0842 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0842 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-158 75% ...

  1. NCBI nr-aa BLAST: CBRC-HSAP-19-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-19-0098 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-174 82% ...

  2. NCBI nr-aa BLAST: CBRC-PABE-20-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-20-0085 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-177 82% ...

  3. NCBI nr-aa BLAST: CBRC-RNOR-01-0328 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-01-0328 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-171 79% ...

  4. NCBI nr-aa BLAST: CBRC-ACAR-01-0124 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0124 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 4e-82 52% ...

  5. NCBI nr-aa BLAST: CBRC-BTAU-01-2396 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2396 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 0.0 97% ...

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-3875 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3875 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 3e-91 55% ...

  7. NCBI nr-aa BLAST: CBRC-MMUS-07-0133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-07-0133 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-168 78% ...

  8. NCBI nr-aa BLAST: CBRC-CPOR-01-1030 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1030 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-125 88% ...

  9. NCBI nr-aa BLAST: CBRC-FRUB-02-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0066 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 6e-80 49% ...

  10. NCBI nr-aa BLAST: CBRC-RMAC-19-0061 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-19-0061 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-176 82% ...

  11. NCBI nr-aa BLAST: CBRC-DRER-15-0047 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-15-0047 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 6e-87 51% ...

  12. NCBI nr-aa BLAST: CBRC-TNIG-16-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-16-0004 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 2e-74 48% ...

  13. NCBI nr-aa BLAST: CBRC-EEUR-01-0668 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-0668 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-169 79% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0033 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-113 86% ...

  15. NCBI nr-aa BLAST: CBRC-OLAT-13-0066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-13-0066 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 5e-75 50% ...

  16. NCBI nr-aa BLAST: CBRC-OCUN-01-1014 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1014 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 1e-75 89% ...

  17. NCBI nr-aa BLAST: CBRC-CFAM-01-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-01-0045 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 0.0 87% ...

  18. NCBI nr-aa BLAST: CBRC-GACU-01-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-01-0029 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 4e-79 52% ...

  19. NCBI nr-aa BLAST: CBRC-PMAR-01-0479 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0479 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 2e-42 38% ...

  20. NCBI nr-aa BLAST: CBRC-FCAT-01-0194 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0194 ref|NP_001015622.1| prostacyclin receptor [Bos taurus] sp|P79393|PI2R_BOVIN Prostacy...clin receptor (Prostanoid IP receptor) (PGI receptor) (Prostaglandin I2 receptor) emb|CAB07510.1| prostacyclin receptor [Bos taurus] NP_001015622.1 4e-81 92% ...