WorldWideScience

Sample records for aurochs bos primigenius

  1. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius).

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  2. A Complete Mitochondrial Genome Sequence from a Mesolithic Wild Aurochs (Bos primigenius)

    Science.gov (United States)

    McGettigan, Paul A.; Lohan, Amanda J.; Murphy, Alison; Finlay, Emma K.; Shapiro, Beth; Chamberlain, Andrew T.; Richards, Martin B.; Bradley, Daniel G.; Loftus, Brendan J.; MacHugh, David E.

    2010-01-01

    Background The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. Methodology DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738±68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. Conclusions For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified aurochsen

  3. A complete mitochondrial genome sequence from a mesolithic wild aurochs (Bos primigenius.

    Directory of Open Access Journals (Sweden)

    Ceiridwen J Edwards

    Full Text Available BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer. In total, 289.9 megabases (22.48% of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously

  4. Ancient DNA extracted from Danish aurochs (Bos primigenius)

    DEFF Research Database (Denmark)

    Nielsen, Peter Gravlund; Aaris-Sørensen, Kim; Hofreiter, Michael

    2012-01-01

    study of genetic variation of Danish aurochs. In addition, for all specimens we address correlations between the ability to obtain DNA sequences and various parameters such as the age of the sample, the collagen content, the museum storage period, Danish geography and whether the specimens were found...... in an archeological or geological context. We find that aurochs from southern Scandinavia display a star-shaped population genetic structure, that is indicative of a local and relatively recent diversification from a few ancestral haplotypes that may have originated in the ancestral Western European population before...... support, that aurochs in Northwestern Europe underwent a population expansion beginning shortly after the retreat of the glacial ice from Denmark and had a stable population size until the population decline that must have occurred prior to extinction. The absence of haplotypes similar to modern domestic...

  5. Bos primigenius in Ancient Egyptian art – historical evidence for the continuity of occurrence and ecology of an extinct key species

    Directory of Open Access Journals (Sweden)

    Carl Beierkuhnlein

    2015-11-01

    Full Text Available Knowledge of the habitat requirements and temporal stability of populations of extinct aurochs (Bos primigenius is surprisingly scarce. Reliable reports of this species, which by its domestication remains tremendously important for humans, are rare. As the species became extinct about 400 years ago and regionally disappeared much earlier, its behaviour and morphology are also under debate. Aurochs is also a crucial component of the mega-herbivore theory in nature conservation, but in fact its natural habitat and behaviour are unknown. Here, I report records of aurochs for the time period of Ancient Egypt. They are found in archaeological sites and literature, and in collections. Records of the species continue through all the periods of Ancient Egypt. In particular, hunting scenes illustrating the merits of high-ranking persons, in their graves (mastabas and temples, provide insights into the behaviour and ecology of the depicted game. Here, special attention is given to one outstanding hunting scene that is documented in a relief at the mortuary temple of Ramesses III (1175 BC, Medinet Habu, Egypt. Assisted by a group of hunters, the pharaoh kills three specimens of aurochs. The whole scene is stunningly realistic.  The adult specimen is fleeing towards the reed belt of the River Nile, suggesting that the species’ habitat was probably in large valley bottoms, where open grassland is regularly created by flooding. Endemic species of fish and game confirm that this scene took place in Lower Egypt. The regional populations of the North-African subspecies of aurochs probably went extinct shortly after this piece of art was produced. Records of species in ancient art can be very informative in terms of ecology and behaviour of species, especially when extinct species are addressed. In addition, the dating of old pieces of art containing biological information can be very precise, for instance when these refer to a historic personage. 

  6. Necrotizing Infiltrative Lipomatosis in a Miniature Zebu Bull (Bos primigenius indicus

    Directory of Open Access Journals (Sweden)

    Scott D. Reed

    2010-01-01

    Full Text Available Lipomatosis is described in a miniature Zebu, Bos primigenius indicus, bull that died of perianesthetic complications. This is the first pathologic description of lipomatosis that we are aware of in this species and breed of cattle. Infiltration of multiple visceral organs is described and depicted along with comparison to previously published cases of lipomatosis in other breeds of cattle.

  7. Complete mitochondrial genome of the Yakow (Bos primigenius taurus × Bos grunniens) in China.

    Science.gov (United States)

    Na, Ri-Su; Zhao, Yong-Ju; Gao, Hui-Jiang; An, Tian-Wu; Huang, Yong-Fu; E, Guang-Xin

    2016-11-01

    The Chinese Yakow, Bos primigenius taurus × Bos grunniens, is a large and commercially important hybrid in family Bovidae. We first determined and annotated its complete mitochondrial genome. The mitogenome is 16,322 bp in length, consisting of 13 protein-coding genes, 22 transfer RNA (tRNA) genes, 2 ribosomal RNA (rRNA) genes and a control region. As in other mammals, most mitochondrial genes are encoded on the heavy strand, except for ND6 and eight tRNA genes, which are encoded on the light strand. Its overall base composition is A: 33.7%, T: 27.3%, C: 25.8% and G: 13.2%. The complete mitogenome of Yakow (B. p. taurus × B. grunniens) could provide an important data to further explore the taxonomic status of Yakow (B. p. taurus × B. grunniens) in B. grunniens and enrich the genetic information or evolutionary history of the Bovidae.

  8. Genome sequencing of the extinct Eurasian wild aurochs illuminates the phylogeography and evolution of cattle

    Science.gov (United States)

    Interrogation of modern and ancient bovine genome sequences provides a valuable model to study the evolution of cattle. Here, we analyse the first complete wild aurochs (Bos primigenius) genome sequence using DNA extracted from a ~ 6,750 year-old humerus bone retrieved from a cave site in Derbyshire...

  9. Mitochondrial DNA analysis shows a Near Eastern Neolithic origin for domestic cattle and no indication of domestication of European aurochs

    Science.gov (United States)

    Edwards, Ceiridwen J; Bollongino, Ruth; Scheu, Amelie; Chamberlain, Andrew; Tresset, Anne; Vigne, Jean-Denis; Baird, Jillian F; Larson, Greger; Ho, Simon Y.W; Heupink, Tim H; Shapiro, Beth; Freeman, Abigail R; Thomas, Mark G; Arbogast, Rose-Marie; Arndt, Betty; Bartosiewicz, László; Benecke, Norbert; Budja, Mihael; Chaix, Louis; Choyke, Alice M; Coqueugniot, Eric; Döhle, Hans-Jürgen; Göldner, Holger; Hartz, Sönke; Helmer, Daniel; Herzig, Barabara; Hongo, Hitomi; Mashkour, Marjan; Özdogan, Mehmet; Pucher, Erich; Roth, Georg; Schade-Lindig, Sabine; Schmölcke, Ulrich; Schulting, Rick J; Stephan, Elisabeth; Uerpmann, Hans-Peter; Vörös, István; Voytek, Barbara; Bradley, Daniel G; Burger, Joachim

    2007-01-01

    The extinct aurochs (Bos primigenius primigenius) was a large type of cattle that ranged over almost the whole Eurasian continent. The aurochs is the wild progenitor of modern cattle, but it is unclear whether European aurochs contributed to this process. To provide new insights into the demographic history of aurochs and domestic cattle, we have generated high-confidence mitochondrial DNA sequences from 59 archaeological skeletal finds, which were attributed to wild European cattle populations based on their chronological date and/or morphology. All pre-Neolithic aurochs belonged to the previously designated P haplogroup, indicating that this represents the Late Glacial Central European signature. We also report one new and highly divergent haplotype in a Neolithic aurochs sample from Germany, which points to greater variability during the Pleistocene. Furthermore, the Neolithic and Bronze Age samples that were classified with confidence as European aurochs using morphological criteria all carry P haplotype mitochondrial DNA, suggesting continuity of Late Glacial and Early Holocene aurochs populations in Europe. Bayesian analysis indicates that recent population growth gives a significantly better fit to our data than a constant-sized population, an observation consistent with a postglacial expansion scenario, possibly from a single European refugial population. Previous work has shown that most ancient and modern European domestic cattle carry haplotypes previously designated T. This, in combination with our new finding of a T haplotype in a very Early Neolithic site in Syria, lends persuasive support to a scenario whereby gracile Near Eastern domestic populations, carrying predominantly T haplotypes, replaced P haplotype-carrying robust autochthonous aurochs populations in Europe, from the Early Neolithic onward. During the period of coexistence, it appears that domestic cattle were kept separate from wild aurochs and introgression was extremely rare. PMID

  10. Incorporation of aurochs into a cattle herd in Neolithic Europe: single event or breeding?

    Science.gov (United States)

    Schibler, Jörg; Elsner, Julia; Schlumbaum, Angela

    2014-07-01

    Domestication is an ongoing process continuously changing the lives of animals and humans and the environment. For the majority of European cattle (Bos taurus) genetic and archaeozoological evidence support initial domestication ca. 11'000 BP in the Near East from few founder aurochs (Bos primigenius) belonging to the mitochondrial DNA T macro-haplogroup. Gene flow between wild European aurochs of P haplogroup and domestic cattle of T haplogroup, coexisting over thousands of years, appears to have been sporadic. We report archaeozoological and ancient DNA evidence for the incorporation of wild stock into a domestic cattle herd from a Neolithic lake-dwelling in Switzerland. A complete metacarpus of a small and compact adult bovid is morphologically and genetically a female. With withers height of ca. 112 cm, it is comparable in size with small domestic cattle from contemporaneous sites in the area. The bone is directly dated to 3360-3090 cal BC and associated to the Horgen culture, a period of the secondary products revolution. The cow possessed a novel mtDNA P haplotype variant of the European aurochs. We argue this is either a single event or, based on osteological characteristics of the Horgen cattle, a rare instance of intentional breeding with female aurochs.

  11. CH4 Emission Model from Bos Primigenius Waste in Fish-Water: Implications for Integrated Livestock-Fish Farming Systems

    Directory of Open Access Journals (Sweden)

    Joshua O. Okeniyi

    2013-07-01

    Full Text Available This paper studies a methane (CH4 emission model from the waste of cattle (B. primigenius based on trends in integrated livestock-fish farming adoption by farmers in Nigeria. Dung of B. primigenius was employed as substrate in fish-water, obtained from a fish-rearing farm, as a matrix medium for simulating a low-oxygen wastewater environment of an agriculture-aquaculture system. A substrate to fish-water mass ratio of 1:3 was used, developed in a laboratory-size digesting reactor system. Volumetric readings, at ambient temperature conditions and with a retention time of thirty-two days, were then subjected to the logistic probability density function, and tested against correlation coefficient and Nash-Sutcliffe coefficient of efficiency criteria. The readings show that a volume of CH4-containing gas as high as 65.3 x 10−3 dm3 was produced on the 13th day from the B. primigenius substrate. Also, production of 234.59 x 10−3 dm3/kg CH4-containing gas, totaling 703.76 x 10−3 dm3, was observed through the studied retention time. The 60% CH4 constituent model of the measured gas generation showed a potency of 2.0664 kg emission per animal, which is equivalent to 43.3944 CO2eq of global warming potential (GWP annually per animal. This bears environmental and climate change implications, and therefore alternative sustainable practices for integrated livestock-fish farming adoption are suggested.

  12. A Late Mesolithic kill site of aurochs at Jardinga, Netherlands

    NARCIS (Netherlands)

    Prummel, W.; Niekus, M.J.L.Th.; van Gijn, A.L; Cappers, R.T.J.

    A site beside the river Tjonger near Jardinga in the northern Netherlands is shown to be a rare Late Mesolithic kill and primary butchering site. Finds consist mainly of bones form aurochs and red deer, with a few flint artefacts. Radiocarbon evidence shows that there must have been two phases of

  13. Complete mitochondrial genome and phylogeny of Pleistocene mammoth Mammuthus primigenius.

    Directory of Open Access Journals (Sweden)

    Evgeny I Rogaev

    2006-03-01

    Full Text Available Phylogenetic relationships between the extinct woolly mammoth (Mammuthus primigenius, and the Asian (Elephas maximus and African savanna (Loxodonta africana elephants remain unresolved. Here, we report the sequence of the complete mitochondrial genome (16,842 base pairs of a woolly mammoth extracted from permafrost-preserved remains from the Pleistocene epoch--the oldest mitochondrial genome sequence determined to date. We demonstrate that well-preserved mitochondrial genome fragments, as long as approximately 1,600-1700 base pairs, can be retrieved from pre-Holocene remains of an extinct species. Phylogenetic reconstruction of the Elephantinae clade suggests that M. primigenius and E. maximus are sister species that diverged soon after their common ancestor split from the L. africana lineage. Low nucleotide diversity found between independently determined mitochondrial genomic sequences of woolly mammoths separated geographically and in time suggests that north-eastern Siberia was occupied by a relatively homogeneous population of M. primigenius throughout the late Pleistocene.

  14. Correction: The Draft Genome of Extinct European Aurochs and its Implications for De-Extinction

    OpenAIRE

    Mikkel-Holger S Sinding; Gilbert, M Thomas P

    2017-01-01

    This article details a correction to the article: Sinding, M-H.S. & Gilbert, M.T.P. 2016 The Draft Genome of Extinct European Aurochs and its Implications for De-Extinction. Open Quaternary. 2(7): DOI: http://doi.org/10.5334/oq.25

  15. [The characteristics of the reproductive capacity of hybrids of banteng (Bos (Bibos) javanicus d'Alton) with the domestic cow (Bos (Bos) primigenius taurus)].

    Science.gov (United States)

    Steklenev, E P; Elistratova, T M

    1992-01-01

    The hybrid progeny of F1 produced by crossing of banteng and domestic cow is characterized by absolute sterility of the male line and fertility of the female line. The crossbred males become fertile in further progenies while crossing cross-females with males of initial forms. Successful use of inter-subgenetic hybrids of banteng and domestic cow in selection work is hindered by pathological deviations in their genitals structure as well as frequent deaths of the embryos and foetus in hybrid cows at the different stages of embryogenesis. It is suggested that those deviations (both in cow and in bulls) are caused mainly by genetic and immunological factors and are determined to a greater extent by combination of parental couples.

  16. [DNA fingerprinting of individual species and intergeneric and interspecific hybrids of genera Bos and Bison, subfamily Bovinae].

    Science.gov (United States)

    Vasil'ev, V A; Steklenev, E P; Morozova, E V; Semenova, S K

    2002-04-01

    Genome fingerprinting with a hypervariable minisatellite sequence of phage M13 DNA was used to study the genetic variation in individual species of the genera Bos and Bison (subfamily Bovinae) and in their interspecific and intergeneric hybrids. DNA fingerprints were obtained for domestic cow Bos taurus primigenius, vatussy Bos taurus macroceros, banteng Bos javanicus, gaur Bos gaurus, wisent Bison bonasus, bison Bison bison, and for the interspecific and intergeneric hybrids. Compared with the original species, most hybrids showed a greater variation in number and size of hybridization fragments. An association was revealed between the number of hybridization fragments and blood composition of interspecific hybrids resulting from unique crossing of domestic cow and banteng. Pairwise similarity coefficients were calculated to construct a dendrogram of genetic similarity, which reflected the relationships between the parental species and hybrids varying in blood composition. The applicability of the method for identifying interspecific and intergeneric hybrids and for studying the consequences of distant hybridization in the subfamily Bovinae is discussed.

  17. The Muirkirk Mammoth : A Late Pleistocene woolly mammoth (Mammuthus primigenius) skeleton from southern Ontario, Canada

    NARCIS (Netherlands)

    Harington, C. R.; Mol, Dick; van der Plicht, Johannes

    2012-01-01

    The Muirkirk Mammoth, found in 1895 2.4 km northeast of the village of Muirkirk in southern Ontario, is the most complete woolly mammoth (Mammuthus primigenius) skeleton known from Canada. Approximate tusk measurements and extreme wear on the sixth molars indicate it is best referred to an old male.

  18. Tracking the past: Interspersed repeats in an extinct Afrotherian mammal, Mammuthus primigenius

    OpenAIRE

    Zhao, Fangqing; Qi, Ji; Stephan C. Schuster

    2009-01-01

    The woolly mammoth (Mammuthus primigenius) died out about several thousand years ago, yet recent paleogenomic studies have successfully recovered genetic information from both the mitochondrial and nuclear genomes of this extinct species. Mammoths belong to Afrotheria, a group of mammals exhibiting extreme morphological diversity and large genome sizes. In this study, we found that the mammoth genome contains a larger proportion of interspersed repeats than any other mammalian genome reported...

  19. Primer hallazgo de Mamut (Mammuthus primigenius Blumenbach en el País Vasco Meridional.

    Directory of Open Access Journals (Sweden)

    Jesús Altuna

    1984-01-01

    Full Text Available Se da a conocer el hallazgo de un astrágalo de Mammuthus primigenius en la cueva de Urtiagako Leizea (Deba, junto con la fauna acompañante, entre la que destacan, por su abundancia, los restos de Rangifer tarandus y Ursus spelaeus. Se describe el resto en cuestión, se dan sus medidas y se enumeran los hallazgos anteriores en el País Vasco y en el resto del Cantábrico.

  20. Environmental reconstruction inferred from the intestinal contents of the Yamal baby mammoth Lyuba (Mammuthus primigenius Blumenbach, 1799)

    NARCIS (Netherlands)

    Kosintsev, Pavel A.; Lapteva, Elena G.; Trofimova, Svetlana S.; Zanina, Oksana G.; Tikhonov, Aleksey N.; Van der Plicht, Johannes

    2012-01-01

    The article presents the results of a complex investigation of the intestinal content of the frozen mummy of a baby woolly mammoth (Mammuthus primigenius Blumenbach, 1799) found in 2007 in the Yamal Peninsula (Western Siberia). The mummy belongs to a female mammoth calf approximately 1-1.5 months of

  1. Genetic diversity and structure in Bos taurus and Bos indicus populations analyzed by SNP markers.

    Science.gov (United States)

    Lin, Bang Zhong; Sasazaki, Shinji; Mannen, Hideyuki

    2010-06-01

    The purpose of this study was to assess genetic diversity, phylogenetic relationship and population structure among nine Eurasian cattle populations using 58 single nucleotide polymorphism (SNP) markers. The calculated distribution of minor allele frequencies and heterozygosities suggested that the genetic diversity of Bos indicus populations was lower than that of Bos taurus populations. Phylogenetic analyses revealed the main divergence between the Bos taurus and Bos indicus populations, and subsequently between Asian and European populations. By principal components analysis, the Bos taurus and Bos indicus populations were clearly distinguished with PC1 (61.1%); however, six Bos taurus populations clustered loosely and the partial separation between European and Asian groups was observed by PC2 (12.5%). The structure analysis was performed using the STRUCTURE program. Distinct separation between Bos taurus and Bos indicus was shown at K = 2, and that between European and Asian populations at K = 3. At K = 4, 5 and 6, Mongolian population showed an admixture pattern with different ancestry of Asian and European cattle. At K = 7, all Bos taurus populations showed each cluster with little proportion of admixture. In conclusion, 58 SNP markers in this study could sufficiently estimate the genetic diversity, relationship and structure for nine Eurasian cattle populations, especially by analyses of principal components and STRUCTURE.

  2. Haemoglobins in cattle and buffalo. Haemoglobin types of Bos taurus, Bos indicus, Bos banteng and Bubalis bubalis in northern Australia.

    Science.gov (United States)

    Bachmann, A W; Campbell, R S; Yellowlees, D

    1978-10-01

    The frequency of haemoglobin types in several major breeds of cattle in northern Austrailia was determined. In all Boss taurus cattle examined only the three common bovine haemoglobin types (AA, AB, BB) were found. F2 Africander cross-breeds showed only AA patterns. The frequency of haemoglobin B was significantly higher in Bos indicus type cattle than in Bos taurus breeds. In the pure breed Banteng cattle (Bos banteng) three genotypes (BB, CB, CC) were present. The eleven buffaloes types each showed two haemoglobins (A1 and A2) in proporotions of 71 to 29 respectively.

  3. Genetic effects on beef tenderness in Bos indicus composite and Bos taurus cattle.

    Science.gov (United States)

    O'Connor, S F; Tatum, J D; Wulf, D M; Green, R D; Smith, G C

    1997-07-01

    Bos indicus composite and Bos taurus cattle, originating from diverse production environments, were used to quantify genetic variation in marbling, 24-h calpastatin activity, and beef tenderness and to identify strategies for prevention of beef tenderness problems in Bos indicus composite cattle. Comparisons among 3/8 Bos indicus breeds (Braford, Red Brangus, Simbrah) revealed significant differences in marbling and 24-h calpastatin activity, but not in tenderness. Compared with Bos taurus cattle, 3/ 8 Bos indicus cattle had similar marbling scores but higher 24-h calpastatin activities. Also, beef from 3/8 Bos indicus composites aged more slowly from 1 to 7 d and was less tender at 4, 7, 14, 21, and 35 d postmortem than beef from Bos taurus cattle. However, beef from 3/8 Bos indicus cattle was relatively tender if it was aged for a sufficient period of time (21 d). The delayed response to aging and greater toughness of beef from 3/8 Bos indicus cattle was associated with Brahman breed effects and was not related to the Bos taurus germplasm source. Marbling was moderately heritable (.52 +/- .21) but exhibited positive genetic correlations with shear force at d 1 through 14 of aging, suggesting that, in these cattle, selection for increased marbling would have an unfavorable effect on beef tenderness. A low heritability estimate for 24-h calpastatin activity (.15 +/- .15), coupled with low genetic correlations between calpastatin activity and shear force at 7, 14, and 35 d, suggested that selection for low calpastatin activity would have little effect on aged beef tenderness. Panel tenderness and shear force at 7, 14, and 21 d were moderately heritable (.27 to .47), indicating that aged beef tenderness could be improved by direct selection (via progeny testing). Comparisons among Simbrah, Senegus x Simbrah, and Red Angus x Simmental steers showed that inclusion of a tropically adapted Bos taurus breed (Senepol) could be an effective strategy for preventing beef

  4. Tracking the past: interspersed repeats in an extinct Afrotherian mammal, Mammuthus primigenius.

    Science.gov (United States)

    Zhao, Fangqing; Qi, Ji; Schuster, Stephan C

    2009-08-01

    The woolly mammoth (Mammuthus primigenius) died out about several thousand years ago, yet recent paleogenomic studies have successfully recovered genetic information from both the mitochondrial and nuclear genomes of this extinct species. Mammoths belong to Afrotheria, a group of mammals exhibiting extreme morphological diversity and large genome sizes. In this study, we found that the mammoth genome contains a larger proportion of interspersed repeats than any other mammalian genome reported so far, in which the proliferation of the RTE family of retrotransposons (covering 12% of the genome) may be the main reason for an increased genome size. Phylogenetic analysis showed that RTEs in mammoth are closely related to the family BovB/RTE. The incongruence of the reconstructed RTE phylogeny indicates that RTEs in mammoth may be acquired through an ancient lateral gene transfer event. A recent proliferation of SINEs was also found in the probocidean lineage, whereas the Afrotherian-wide SINEs in mammoth have undergone a rather flat and stepwise expansion. Comparisons of the transposable elements (TEs) between mammoth and other mammals may shed light on the evolutionary history of TEs in various mammalian lineages.

  5. A designated centre for people with disabilities operated by Muiriosa Foundation, Kildare

    LENUS (Irish Health Repository)

    Edwards, Ceiridwen J

    2010-01-01

    BACKGROUND: The derivation of domestic cattle from the extinct wild aurochs (Bos primigenius) has been well-documented by archaeological and genetic studies. Genetic studies point towards the Neolithic Near East as the centre of origin for Bos taurus, with some lines of evidence suggesting possible, albeit rare, genetic contributions from locally domesticated wild aurochsen across Eurasia. Inferences from these investigations have been based largely on the analysis of partial mitochondrial DNA sequences generated from modern animals, with limited sequence data from ancient aurochsen samples. Recent developments in DNA sequencing technologies, however, are affording new opportunities for the examination of genetic material retrieved from extinct species, providing new insight into their evolutionary history. Here we present DNA sequence analysis of the first complete mitochondrial genome (16,338 base pairs) from an archaeologically-verified and exceptionally-well preserved aurochs bone sample. METHODOLOGY: DNA extracts were generated from an aurochs humerus bone sample recovered from a cave site located in Derbyshire, England and radiocarbon-dated to 6,738+\\/-68 calibrated years before present. These extracts were prepared for both Sanger and next generation DNA sequencing technologies (Illumina Genome Analyzer). In total, 289.9 megabases (22.48%) of the post-filtered DNA sequences generated using the Illumina Genome Analyzer from this sample mapped with confidence to the bovine genome. A consensus B. primigenius mitochondrial genome sequence was constructed and was analysed alongside all available complete bovine mitochondrial genome sequences. CONCLUSIONS: For all nucleotide positions where both Sanger and Illumina Genome Analyzer sequencing methods gave high-confidence calls, no discrepancies were observed. Sequence analysis reveals evidence of heteroplasmy in this sample and places this mitochondrial genome sequence securely within a previously identified

  6. Tenderness profiles of ten muscles from F1 Bos indicus x Bos taurus and Bos taurus cattle cooked as steaks and roasts.

    Science.gov (United States)

    Highfill, C M; Esquivel-Font, O; Dikeman, M E; Kropf, D H

    2012-04-01

    Twenty Bos taurus (Hereford x Angus crosses) and 20 F1 Bos indicus x Bos taurus heifers of the same age, management and feeding regimen, were harvested and evaluated at 2 days postmortem for carcass and meat traits. Ten muscles were obtained from the right sides and aged until 10 days postmortem. Bos indicus carcasses were lighter, had less fat cover, smaller ribeyes, and less intramuscular lipid (all p≤0.05). Bos taurus longissimus lumborum, gluteus medius, triceps brachii, and semimembranosus muscles cooked as steaks and roasts had a lower Warner-Bratzler shear force (WBSF) (p≤0.05) than those from Bos indicus. Bos taurus deep pectoral and semitendinosus muscles cooked as roasts had a lower WBSF (ptaurus when cooked as steaks, roasts or both. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. The Bos taurus-Bos indicus balance in fertility and milk related genes.

    Science.gov (United States)

    Kasarapu, Parthan; Porto-Neto, Laercio R; Fortes, Marina R S; Lehnert, Sigrid A; Mudadu, Mauricio A; Coutinho, Luiz; Regitano, Luciana; George, Andrew; Reverter, Antonio

    2017-01-01

    Numerical approaches to high-density single nucleotide polymorphism (SNP) data are often employed independently to address individual questions. We linked independent approaches in a bioinformatics pipeline for further insight. The pipeline driven by heterozygosity and Hardy-Weinberg equilibrium (HWE) analyses was applied to characterize Bos taurus and Bos indicus ancestry. We infer a gene co-heterozygosity network that regulates bovine fertility, from data on 18,363 cattle with genotypes for 729,068 SNP. Hierarchical clustering separated populations according to Bos taurus and Bos indicus ancestry. The weights of the first principal component were subjected to Normal mixture modelling allowing the estimation of a gene's contribution to the Bos taurus-Bos indicus axis. We used deviation from HWE, contribution to Bos indicus content and association to fertility traits to select 1,284 genes. With this set, we developed a co-heterozygosity network where the group of genes annotated as fertility-related had significantly higher Bos indicus content compared to other functional classes of genes, while the group of genes associated with milk production had significantly higher Bos taurus content. The network analysis resulted in capturing novel gene associations of relevance to bovine domestication events. We report transcription factors that are likely to regulate genes associated with cattle domestication and tropical adaptation. Our pipeline can be generalized to any scenarios where population structure requires scrutiny at the molecular level, particularly in the presence of a priori set of genes known to impact a phenotype of evolutionary interest such as fertility.

  8. The Bos taurus–Bos indicus balance in fertility and milk related genes

    Science.gov (United States)

    Lehnert, Sigrid A.; Mudadu, Mauricio A.; Coutinho, Luiz; Regitano, Luciana; George, Andrew; Reverter, Antonio

    2017-01-01

    Numerical approaches to high-density single nucleotide polymorphism (SNP) data are often employed independently to address individual questions. We linked independent approaches in a bioinformatics pipeline for further insight. The pipeline driven by heterozygosity and Hardy-Weinberg equilibrium (HWE) analyses was applied to characterize Bos taurus and Bos indicus ancestry. We infer a gene co-heterozygosity network that regulates bovine fertility, from data on 18,363 cattle with genotypes for 729,068 SNP. Hierarchical clustering separated populations according to Bos taurus and Bos indicus ancestry. The weights of the first principal component were subjected to Normal mixture modelling allowing the estimation of a gene’s contribution to the Bos taurus-Bos indicus axis. We used deviation from HWE, contribution to Bos indicus content and association to fertility traits to select 1,284 genes. With this set, we developed a co-heterozygosity network where the group of genes annotated as fertility-related had significantly higher Bos indicus content compared to other functional classes of genes, while the group of genes associated with milk production had significantly higher Bos taurus content. The network analysis resulted in capturing novel gene associations of relevance to bovine domestication events. We report transcription factors that are likely to regulate genes associated with cattle domestication and tropical adaptation. Our pipeline can be generalized to any scenarios where population structure requires scrutiny at the molecular level, particularly in the presence of a priori set of genes known to impact a phenotype of evolutionary interest such as fertility. PMID:28763475

  9. Genome wide scan for quantitative trait loci affecting tick resistance in cattle (Bos taurus x Bos indicus)

    National Research Council Canada - National Science Library

    Machado, Marco Antonio; Azevedo, Ana Luisa S; Teodoro, Roberto L; Pires, Maria A; Peixoto, Maria Gabriela C D; de Freitas, Célio; Prata, Márcia Cristina A; Furlong, John; da Silva, Marcos Vinicius G B; Guimarães, Simone E F; Regitano, Luciana C A; Coutinho, Luiz L; Gasparin, Gustavo; Verneque, Rui S

    2010-01-01

    .... Genetic variation between Bos taurus and Bos indicus to tick resistance and molecular biology tools might allow for the identification of molecular markers linked to resistance traits that could be...

  10. Diversity and Evolution of 11 Innate Immune Genes in Bos Taurus Taurus and Bos Taurus Indicus Cattle

    National Research Council Canada - National Science Library

    Christopher M. Seabury; Paul M. Seabury; Jared E. Decker; Robert D. Schnabel; Jeremy F. Taylor; James E. Womack

    2010-01-01

    ...) for 37 cattle breeds. Bayesian haplotype reconstructions and median joining networks revealed haplotype sharing between Bos taurus taurus and Bos taurus indicus breeds at every locus, and we were unable to differentiate...

  11. The Zhenya Mammoth ( Mammuthus primigenius (Blum.)): Taphonomy, geology, age, morphology and ancient DNA of a 48,000 year old frozen mummy from western Taimyr, Russia

    NARCIS (Netherlands)

    Maschenko, Evgeny N.; Potapova, Olga R.; Vershinina, Alisa; Shapiro, Beth; Streletskaya, Irina D.; Vasiliev, Alexander A.; Oblogov, Gleb E.; Kharlamova, Anastasia S.; Potapov, Eugene; van der Plicht, J.; Tikhonov, Alexey N.; Serdyuk, Natalia V.; Tarasenko, Konstantin K.

    2017-01-01

    This paper reports the results of an in-depth analysis of the frozen remains of a woolly mammoth (Mammuthus primigenius) named Zhenya, which has been dated to 48,000 cal BP. The carcass, found near the mouth of the Yenisey River in eastern Siberia, was a juvenile male whose ontogenetic age at death

  12. BosFinder: a novel pre-microRNA gene prediction algorithm in Bos taurus.

    Science.gov (United States)

    Sadeghi, B; Ahmadi, H; Azimzadeh-Jamalkandi, S; Nassiri, M R; Masoudi-Nejad, A

    2014-08-01

    MicroRNAs (miRNAs) are small non-coding RNAs that modulate gene expression transcriptionally (transcriptional activation or inactivation) and/or post-transcriptionally (translation inhibition or degradation of their target mRNAs). This phenomenon has significant roles in growth and developmental processes in plants and animals. Bos taurus is one of the most important livestock animals, having great importance in food and economical sciences and industries. However, limited information is available on Bos taurus constituent miRNAs because its whole genome assembly has been only recently published. Therefore, computational methods have been essential tools in miRNA gene prediction and discovery. Among these, machine-learning-based approaches are used to characterize genome scale pre-miRNAs from expressed sequence tags (ESTs). In this study, a support vector machine model was used to classify 33 structural and thermodynamic features of pre-miRNA genes. Public bovine EST data were obtained from different tissues in various developmental stages. A new algorithm, called BosFinder, was developed to identify and annotate the whole genome's derived pre-miRNAs. We found 18 776 highly potential pre-miRNA sequences. This is the first genome survey report of Bos taurus based on a machine-learning method for pre-miRNA gene finding. The bosfinder program is freely available at http://lbb.ut.ac.ir/Download/LBBsoft/BosFinder/. © 2014 Stichting International Foundation for Animal Genetics.

  13. Is the American Zebu really Bos indicus?

    Directory of Open Access Journals (Sweden)

    Meirelles Flávio V.

    1999-01-01

    Full Text Available The American continent was colonized in the 16th century by Europeans who first introduced cattle of Bos taurus origin. Accounts register introduction of Bos indicus cattle into South America in the 19th and continuing through the 20th century, and most reported imports were males derived from the Indian subcontinent. In the present study we show, by using mitochondrial DNA (mtDNA polymorphism, major participation of matrilineages of taurus origin in the American Zebu purebred origin, i.e., 79, 73 and 100% for the Nellore, Gyr and Brahman breeds, respectively. Moreover, we have created a restriction map identifying polymorphism among B. taurus and B. indicus mtDNA using three restriction enzymes. Results are discussed concerning American Zebu origins and potential use of this information for investigating the contribution of cytoplasmic genes in cattle production traits.

  14. Plasma antimullerian hormone as a predictor of ovarian antral follicular population in Bos indicus (Nelore) and Bos taurus (Holstein) heifers.

    Science.gov (United States)

    Batista, E O S; Macedo, G G; Sala, R V; Ortolan, M D D V; Sá Filho, M F; Del Valle, T A; Jesus, E F; Lopes, R N V R; Rennó, F P; Baruselli, P S

    2014-06-01

    In Bos taurus cattle, antimullerian hormone (AMH) has been demonstrated to have a high degree of correlation with ovarian antral follicle count and the number of healthy follicles and oocytes. To document the correlation between the plasma concentration of AMH and follicular number in Bos indicus and Bos taurus heifers, Nelore (Bos indicus, n = 16) and Holstein heifers (Bos taurus, n = 16) had their ovarian follicular waves synchronized. After synchronization, ovarian antral follicular population (AFP) was evaluated three times at 60-day (d) intervals (T-120 d, 120 days before plasma AMH determination; T-60 d, 60 days before; and T0, at the time of plasma AMH determination). The plasma AMH concentration was positively correlated with the number of ovarian follicles on the day of the follicular wave emergence in Bos indicus (Nelore) and Bos taurus (Holstein) heifers at each evaluation time (p taurus (Holstein) heifers (p taurus (Holstein) heifers (p taurus (Holstein) heifers. Furthermore, Bos indicus (Nelore) heifers presented both greater plasma AMH concentrations and AFP than Bos taurus (Holstein) heifers. © 2014 Blackwell Verlag GmbH.

  15. Le Flaubert de Charles Du Bos

    Directory of Open Access Journals (Sweden)

    Jacques Neefs

    2009-01-01

    Full Text Available Charles Du Bos a porté une attention constante à l’œuvre de Flaubert (à l’exclusion de Bouvard et Pécuchet qui semble ne pas exister pour lui, à Madame Bovary et à L’Éducation sentimentale en particulier. La mise en relation de son étude : « Sur le milieu intérieur chez Flaubert », écrite en 1921, avec des textes du Journal de 1923 et de 1937, les rapprochements avec Gogol, Thomas Hardy, Tolstoï, Baudelaire, Henry James qui traversent les écrits de Du Bos, permettent de suivre ce que celui-ci décrit comme « l’expérience spirituelle » d’une matérialité comprise dans la conquête de la triple exigence du Beau, du Vivant et du Vrai. Du Bos décèle la force de l’œuvre de Flaubert dans la « disproportion » du style, et dans la puissance d’absorption qui fait la densité de cette prose, et qui désigne un extraordinaire travail de conversion. L’obscure expérience spirituelle ainsi poursuivie est celle d’un absolu de l’art, expérience paradoxale d’un « mystique qui ne croit à rien » (comme se désignait Flaubert lui-même, que le critique lie à une interrogation sur sa propre conversion.Charles Du Bos devoted an unflagging attention to Flaubert’s work (except for Bouvard et Pécuchet, which, apparently, according to him did not exist, to Madame Bovary and in particular L’Éducation sentimentale. The connection between his essay “Sur le milieu intérieur chez Flaubert”, written in 1921, and extracts from his Journal, from 1923 to 1937, the comparisons with Gogol, Thomas Hardy, Tolstoy, Baudelaire, and Henry James that run through the writings of Du Bos, allow us to follow what he terms “the spiritual experience” of a materiality encompassed in the conquest of the triple demand of the Beautiful, the Living, the Truth. Du Bos detects the power of Flaubert’s work in the “disproportion” of his style, and the power of absorption that forms the density of his prose, showing an

  16. Genetic diversity and bottleneck analysis of Yunnan mithun ( Bos ...

    African Journals Online (AJOL)

    Mithun or gayal (Bos frontalis) is endemic to the Gaoligongshan Mountains and Drung River Basin in Yunnan, China; a rare and endangered Bos species. To evaluate the genetic diversity and bottleneck effect of Yunnan mithun population, we screened 16 bovine microsatellite loci of Yunnan mithun (N = 34) to provide ...

  17. El bosón de Higgs

    OpenAIRE

    Duque Escobar, Gonzalo

    2012-01-01

    Posiblemente ninguna experiencia puede resultar más conmovedora en el mundo físico, que sumergirse en la inmensidad del Universo o en el enigmático mundo subatómico. Entre esas pequeñas piezas del mundo subatómico al que pertenecen electrones y neutrinos, está el bosón de Higgs que es la clave para explicar los orígenes de la masa de estas partículas elementales, ahora capturado mediante investigaciones experimentales del LHC.

  18. Effect of early luteolysis in progesterone-based timed AI protocols in Bos indicus, Bos indicus x Bos taurus, and Bos taurus heifers.

    Science.gov (United States)

    Carvalho, J B P; Carvalho, N A T; Reis, E L; Nichi, M; Souza, A H; Baruselli, P S

    2008-01-15

    The objective of this study was to evaluate the effects of treatment with an intravaginal progesterone-releasing device (CIDR) and estradiol benzoate (EB) on follicular dynamics in Bos indicus (n=23), Bos taurus (n=25), and cross-bred (n=23) heifers. To assess the influence of reduced serum progesterone concentrations during 8 days of treatment with a progesterone-releasing device on follicular dynamics, half of the heifers received PGF at CIDR insertion (Day 0; 3 x 2 factorial design). Mean (+/-S.E.M.) serum progesterone concentrations during CIDR treatment varied (Ptaurus (3.3+/-0.0 ng/mL), and cross-bred (4.3+/-0.1 ng/mL). Maximum diameter of the dominant follicle (DF) was smaller (Ptaurus heifers (11.6+/-0.5 mm). B. indicus experienced lower (Ptaurus (72.7%) and cross-bred (84.0%). Heifers treated with PGF on Day 0 had lower (Ptaurus heifers. Prostaglandin treatment on the day of CIDR insertion reduced serum progesterone during treatment, and resulted in increased maximum DF diameter and ovulation rate.

  19. Estimate of the population of preantral follicles in the ovaries of Bos taurus indicus and Bos taurus taurus cattle.

    Science.gov (United States)

    Silva-Santos, K C; Santos, G M G; Siloto, L S; Hertel, M F; Andrade, E R; Rubin, M I B; Sturion, L; Melo-Sterza, F A; Seneda, M M

    2011-10-01

    The number of oocytes recovered from Bos taurus indicus females subjected to ovum pick-up averaged two to four times greater compared to Bos taurus taurus females. The objective of the present study was to test the hypothesis that this difference in oocyte yield was due to more preantral follicles in the ovaries of Bos indicus females. Ovaries (n = 64) from Nelore (Bos indicus) fetuses (n = 10), heifers (n = 12), and cows (n = 10), and Aberdeen Angus (Bos taurus) fetuses (n = 10), heifers (n = 12), and cows (n = 10) were cut longitudinally into halves, fixed, and processed for histological evaluation. The number of preantral follicles was estimated by counting them in each histological section, using the oocyte nucleus as a marker and employing a correction factor. The average number of preantral follicles in the ovaries of Bos indicus vs Bos taurus was (mean ± SD) 143,929 ± 64,028 vs 285,155 ± 325,195 for fetuses, 76,851 ± 78,605 vs 109,673 ± 86,078 for heifers, and 39,438 ± 31,017 vs 89,577 ± 86,315 for cows (P > 0.05). The number of preantral follicles varied greatly among individual animals within the same category, as well as between breeds. In conclusion, we inferred that the higher oocyte yield from Bos indicus females was not due to a greater ovarian reserve of preantral follicles. Therefore, mechanisms controlling follicle development after the preantral stage likely accounted for differences between Bos indicus and Bos taurus females in number of oocytes retrieved at ovum pick-up. Copyright © 2011 Elsevier Inc. All rights reserved.

  20. MADURACIÓN DEL SOLOMO (Biceps femoris) EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    OpenAIRE

    Roger Alonso Cubero-Rojas; Eliana Mora-Peraza; Rodolfo WingChing-Jones; Sandra Calder\\u00F3n-Villaplana

    2013-01-01

    El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de I...

  1. Superovulation and embryo production in tropical adapted Bos taurus (Caracu and Bos indicus (Nelore cows

    Directory of Open Access Journals (Sweden)

    Rafael Herrera Alvarez

    2011-01-01

    Full Text Available The aim of this study was to compare ovarian response and embryo production of superovulated Bos indicus and Bos taurus cows adapted to the environmental conditions from São Paulo State, Brazil. Ninety non-lactating cows from Caracu ( Bos taurus, n=40 and Nelore (Bos indicus, n=50 were treated with an intravaginal device containing progesterone (1.38 mg; CIDRB ®, Pfizer Animal Health, Montreal, Québec, Canada and 2.5 mg, intramuscularly (IM, of estradiol benzoate (Estrogin®, Farmavet, São Paulo, Brazil. Four days later, all animals were treated with multiple IM injections of 400 IU of FSH (Pluset®, Calier, Spain in decreasing doses (75–75; 75–50; 50–25, and 25–25 IU at 12-h intervals over 4 days. On the seventh day, CIDR-B device was removed and cows received, IM, 150 ìg of cloprostenol (Veteglan®, Calier, Spain. Cows were then inseminated 48 and 62 h after cloprostenol treatment and embryos were recovered non-surgically seven days after first insemination. Differences in the number of corpora lutea (CL number, total number of structures (ova/embryos, and number of transferable embryos were analyzed by Student t test. There was no difference (P > 0.05 in the average number of CL, total ova/embryos and transferable embryos of Caracu (11.4 ± 3.3; 8.6 ± 2.6 e 6.0 ± 2.4 and Nelore (12.0 ± 4.1; 9.0 ± 4.3 e 5.1 ± 2.9 cows, respectively. These results suggest that Caracu and Nelore cows superovulated in tropical climate had similar ovarian responses and embryo production.

  2. Evaluation of carcass characteristics and meat chemical composition of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in pasture systems

    Directory of Open Access Journals (Sweden)

    Fernanda Barros Moreira

    2003-12-01

    Full Text Available The objective of this study was to evaluate the carcass characteristics (carcass weight, carcass yield, fat thickness, loin area, marbling and colour and chemical composition of the Longissimus dorsi muscle (moisture, ash, crude protein, fat and cholesterol of cuts with or without fat thickness, of Bos indicus and Bos indicus x Bos taurus crossbred steers finished in millet (Pennisetum americanum L. or star grass (Cynodon plectostachyus Pilger pasture systems, with mineral or mineral protein supplementation. Animals were slaughtered with an average body weight of 450 kg (Bos indicus or 470 kg (Bos indicus x Bos taurus crossbreed. There was no treatments effect on carcass characteristics and meat chemical composition of cut without fat thickness. The cuts with fat thickness of steers fed millet presented the highest fat deposition. Bos indicus steers presented higher carcass yield (57.23% and fat thickness (4.88 mm compared with crossbreed (53.40% and 3.05 mm. There was no breed effect on chemical composition of meat. The mean levels of cholesterol concentration were 31.41 mg/100 and 37.55 mg/100g of meat with and without fat thickness.O objetivo deste trabalho foi avaliar as características de carcaça (peso de carcaça, rendimento de carcaça, espessura de gordura de cobertura, área de olho de lombo, marmoreio e coloração e composição química do músculo Longissimus dorsi (umidade, cinzas, proteína bruta, gordura e colesterol de cortes, com ou sem gordura de cobertura, de novilhos Bos indicus e mestiços Bos indicus x Bos taurus terminados em sistemas em pastagem de milheto (Pennisetum americanum L. ou grama estrela (Cynodon plectostachyus Pilger, com suplementação mineral ou protéica e mineral. Os animais foram abatidos com peso médio de 450 kg (Bos indicus ou 470 kg (mestiços. Não houve efeito de tratamento sobre as características de carcaça e composição da carne com ou sem gordura de cobertura. Os cortes com gordura de

  3. Close genetic relationship of early neolithic cattle from Ziegelberg (Freising, Germany) with modern breeds.

    Science.gov (United States)

    Kühn, R; Ludt, C; Manhart, H; Peters, J; Neumair, E; Rottmann, O

    2005-04-01

    In 2003 a variety of crafts and bone specimens were found during excavations of a Neolithic settlement near Freising, the southernmost site of the Linear Pottery Culture in Bavaria. Six cattle bones were used to extract ancient DNA (aDNA). Applying nested and touchdown PCR, two fragments of the mitochondrial (mt) DNA control region could be amplified from specimen 533/III which yielded a total of 230 base pairs (bp). The sequence was compared with the homologous part of 40 extant breeds of Bos taurus and B. indicus and related species, such as Banteng (B. javanicus), Gaur (B. gaurus), the European bison (Bison bonasus) and the aurochs (B. primigenius). A neighbour joining tree was constructed based on the appropriate model of sequence evolution. The control region sequence of the 533/III cattle bone, whose age was determined by radiocarbon dating, clusters close to the extant European breeds, but distinctly apart from the basal aurochs and far distant from the B. indicus group. The archaeological and genetic analyses of Bos Ziegelberg demonstrate that domesticated cattle reached southern Bavaria at least 7000 years ago.

  4. Tenderness enhancement of beef from Bos indicus and Bos taurus cattle following electrical stimulation.

    Science.gov (United States)

    Gursansky, B; O'Halloran, J M; Egan, A; Devine, C E

    2010-11-01

    High voltage electrical stimulation (1130 V peak, 14.28 bidirectional half sinusoidal pulses/s) or low voltage stimulation (45 V peak, 36 alternating square wave pulses/s) was used on cattle: (1) low voltage stimulation applied for 10 or 40 s with fast and slow chilling or high voltage stimulation for 60 s with normal chilling, applied to 100% Bos taurus cattle, (2) low voltage stimulation (40 s) and high voltage stimulation (60 s) with normal chilling applied to mixed Bos indicus and B.taurus cattle, (3) high voltage stimulation (54 s) with normal chilling applied to B. taurus and B. indicus cattle of 0-100% B. indicus composition, and (4) high voltage stimulation (60 s) applied to 100% B. taurus and 100% B. indicus cattle. All stimulation parameters enhanced the tenderness of steaks from M. longissimus thoracis et lumborum (LTL) aged at 1°C up to 28 days compared with non stimulated LTL. Short low voltage stimulation of 10s was marginally more effective than no stimulation and longer durations of 40s were very effective and high voltage stimulation was most effective. The shear force values for non stimulated B. indicus LTL are much greater than for B. taurus, but following high voltage stimulation LTL of B. indicus were similar to B. taurus and all had lower shear force values than from non stimulated carcasses. Thus adequate electrical stimulation removes any toughness of LTL related to B. indicus genetic composition. Copyright © 2010. Published by Elsevier Ltd.

  5. Membrane proteins associated with sperm-oocyte interaction: A proteomic comparison between Kedah Kelantan (Bos indicus) and Mafriwal (Bos taurus × Bos indicus) sperm

    Science.gov (United States)

    Ashrafzadeh, Ali; Nathan, Sheila; Othman, Iekhsan; Yee, Tee Ting; Karsani, Saiful Anuar

    2013-11-01

    Production performance of European cattle breeds has significantly improved through various breeding programs. However, European breeds are more susceptible to heat stress compared to zebu cattle (Bos indicus) as their conception rate can range between 20 to 30% in hot seasons compared to winter. To identify cattle sperm proteins associated with zebu cattle higher fertility and heat tolerance in tropical environments, we utilised a proteomics-based approach to compare sperm from the highly fertile Malaysian indigenous breed, Kedah Kelantan (Bos indicus), with sperm from the sub-fertile crossbreed, Mafriwal (Bos taurus × Bos indicus). Frozen semen of three high performance bulls from each breed was processed to obtain live and pure sperm. Proteins were separated and gel bands were processed by in-gel tryptic digestion. For each breed, mass spectrometry data was acquired over 11 replicates. The analyzed data identified peptides with different expression levels (99% confidence level) and protein identification was determined by targeted MS/MS. Among the identified proteins associated with sperm-oocyte interaction, two proteins were up-regulated in Kedah Kelantan sperm and 7 proteins were up-regulated in or specific to Mafriwal. Our results suggest that the higher fertility of zebu cattle in tropical areas may not be related to more efficient sperm-oocyte interaction. Further analysis of the other regulated proteins in these two breeds may contribute further knowledge on the physiological reason/s for higher fertility and heat tolerance of Zebu cattle in tropical areas.

  6. Comparative Analysis of Mafriwal (Bos taurus × Bos indicus and Kedah Kelantan (Bos indicus Sperm Proteome Identifies Sperm Proteins Potentially Responsible for Higher Fertility in a Tropical Climate

    Directory of Open Access Journals (Sweden)

    Ali Ashrafzadeh

    2013-07-01

    Full Text Available The fertility of zebu cattle (Bos indicus is higher than that of the European purebred (Bos taurus and crossbred (Bos taurus × Bos indicus cattle in tropical areas. To identify proteins related to the higher thermo-tolerance and fertility of Zebu cattle, this study was undertaken to identify differences in sperm proteome between the high fertile Malaysian indigenous zebu cattle (Kedah Kelantan and the sub-fertile crossbred cattle (Mafriwal. Frozen semen from three high performance bulls from each breed were processed to obtain live and pure sperm. Sperm proteins were then extracted, and two-dimensional gel electrophoresis performed to compare proteome profiles. Gel image analysis identified protein spots of interest which were then identified by liquid chromatography mass spectrometry quadrupole time-of-flight (LC MS/MS Q-TOF. STRING network analysis predicted interactions between at least 20 of the identified proteins. Among the identified proteins, a number of motility and energy related proteins were present in greater abundance in Kedah Kelantan. Sperm motility evaluation by Computer Assisted Semen Analysis (CASA confirmed significantly higher motility in Kedah Kelantan. While results from this study do identify proteins that may be responsible for the higher fertility of Kedah Kelantan, functional characterization of these proteins is warranted to reinforce our understanding of their roles in sperm fertility.

  7. Cow/calf preweaning efficiency of Nellore and Bos taurus x Bos indicus crosses.

    Science.gov (United States)

    Calegare, L; Alencar, M M; Packer, I U; Ferrell, C L; Lanna, D P D

    2009-02-01

    The objectives of this study were to determine if percentage Bos taurus (0 or 50%) of the cow had an effect on ME requirements and milk production, and to compare cow/calf efficiency among 3 mating systems. Metabolizable energy requirements were estimated during a feeding trial that encompassed a gestation and lactation feeding trial for each of 2 groups of cows. Cows were 0 or 50% Bos taurus (100 or 50% Nellore) breed type: Nellore cows (NL; n = 10) mated to Nellore bulls, NL cows (n = 9) mated to Angus bulls, Angus x Nellore (ANL; n = 10) and Simmental x Nellore (SNL; n = 10) cows mated to Canchim (5/8 Charolais 3/8 Zebu) bulls. Cows were individually fed a total mixed diet that contained 11.3% CP and 2.23 Mcal of ME/kg of DM. At 14-d intervals, cows and calves were weighed and the amount of DM was adjusted to keep shrunk BW and BCS of cows constant. Beginning at 38 d of age, corn silage was available to calves ad libitum. Milk production at 42, 98, 126, and 180 d postpartum was measured using the weigh-suckle-weigh technique. At 190 d of age, calves were slaughtered and body composition estimated using 9-10-11th-rib section to obtain energy deposition. Regression of BW change on daily ME intake (MEI) was used to estimate MEI at zero BW change. Increase in percentage Bos taurus had a significant effect on daily ME requirements (Mcal/d) during pregnancy (P taurus had a positive linear effect on maintenance requirements of pregnant (P = 0.07) and lactating (P taurus groups, respectively. The 50% B. taurus cows, ANL and SNL, suckling crossbred calves had greater total MEI (4,319 +/- 61 Mcal; P taurus cows suckling NL (3,484 +/- 86 Mcal) or ANL calves (3,600 +/- 91 Mcal). The 0% B. taurus cows suckling ANL calves were more efficient (45.3 +/- 1.6 g/Mcal; P = 0.03) than straightbred NL (35.1 +/- 1.5 g/Mcal) and ANL or SNL pairs (41.0 +/- 1.0 g/Mcal). Under the conditions of this study, crossbreeding improved cow/ calf efficiency and showed an advantage for cows that

  8. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus Genetic Introgression of Bos indicus (Bovidae in Colombian Creole Cattle Bos taurus

    Directory of Open Access Journals (Sweden)

    CARLOS ARTURO SÁNCHEZ ISAZA

    Full Text Available El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.This work evidenced, using a cytogenetics approach, that Bos indicus exerted a genetic introgression of paternal origin on Creole Colombian cattle descendent from Bos taurus. Analysis of chromosome Y morphology was carried out in heparinized blood samples of 67 bulls belonging to seven Colombian breeds. We report 4 sires belonging to the Romosinuano breed (40% and 10 bulls of the Casanareño breed (100% with acrocentric Y chromosome which is characteristic of Bos taurus. This finding indicates a high degree of genetic introgression in these two breeds probably caused by the continuous input of zebu stallions in the Colombian Creole breeds. In other five Creole breeds (Blanco Orejinegro -BON-, Chino Santandereano, Costeño con Cuernos, Hartón del Valle and Sanmartinero, the bulls had a submetacentric Y chromosome characteristic of Bos taurus.

  9. Genetic parameters for growth traits of a Brazilian Bos taurus x Bos indicus beef composite.

    Science.gov (United States)

    Mourão, G B; Ferraz, J B S; Eler, J P; Balieiro, J C C; Bueno, R S; Mattos, E C; Figueiredo, L G G

    2007-12-11

    The genetic analysis of composite data is very complicated, mainly because it is necessary to adjust data to the effects of heterosis and breed complementarity, and because there is usually considerable confounding of these data with several other effects, such as contemporary group effects, breed composition of the animal and maternal breed composition, among others. Data on birth weight (n = 151,083), weaning weight adjusted to 205 days (n = 137,257), yearling weight adjusted to 390 days (n = 61,410), weight gain from weaning to yearling (n = 56,653), and scrotum circumference (n = 23,323) and muscle score (n = 54,770), both adjusted to 390 days, from Bos taurus x Bos indicus composite beef calves born from 1994 to 2003 were analyzed to estimate (co)variance components and genetic parameters of growth traits. The animals belonged to the Montana Tropical program. Estimation was made by three models that approach adjustment to heterozygosis in order to suggest the best model. The RM model included contemporary groups, class of age of dam, outcrossing percentages for direct and maternal effects, and direct and maternal additive genetic breed effects as covariates; the R model was the same as RM, but without additive maternal breed effects, and H was the same as RM, but not considering any additive breed effect. Both R2 values and consistency of genetic parameters indicate that the more complex model (RM), which considers maternal and individual additive genetic breed effect, produces the best estimates when compared to other models. The R model seems to overestimate (co)variance components. The magnitudes of direct and maternal heritability estimates, obtained in this study, would permit genetic improvement for weight and growth traits, as much by selection of direct genetic effects for weight and growth as for the improvement of maternal performance, but in different lineages. Therefore, the correlations between these effects were unfavorable.

  10. Polymorphism and Mobilization of Rransposons in Bos taurus

    DEFF Research Database (Denmark)

    Guldbrandtsen, Bernt; Sahana, Goutam; Lund, Mogens Sandø

    The bovine genome assembly was explored to detect putative retrotransposon sequences. In total 87,310 such sites were detected. Four breeds of dairy cattle (Bos taurus) were examined with respect to the presence, segregation or complete absence of the putative retrotransposon. A total of 10,983 s...

  11. De 10 meest gestelde vragen over koolstofvastlegging in bos

    NARCIS (Netherlands)

    Nabuurs, G.J.; Verkaik, E.

    1999-01-01

    Uitleg en cijfers over de koolstofvoorraden en koolstofvastlegging in het Nederlandse bos, de mogelijkheden om de CO2 uitstoot te compenseren via bosaanplant, de kosteneffectiviteit van dergelijke maatregelen, en het gewenste bostype en bosbeheer om CO2 vast te leggen en de CO2 emissie te reduceren

  12. Employee Acceptance of BOS and BES Performance Appraisals.

    Science.gov (United States)

    Dossett, Dennis L.; Gier, Joseph A.

    Previous research on performance evaluation systems has failed to take into account user acceptance. Employee acceptance of a behaviorally-based performance appraisal system was assessed in a field experiment contrasting user preference for Behavioral Expectations Scales (BES) versus Behavioral Observation Scales (BOS). Non-union sales associates…

  13. Combining ART and FBP for improved fidelity of tomographic BOS

    Science.gov (United States)

    Hartmann, Ulrich; Seume, Joerg R.

    2016-09-01

    Engine component defects along the hot-gas path (HGP) of jet engines influence the density distribution of the flow, and thus result in characteristic patterns in the exhaust jet. These characteristic patterns can be reconstructed with the optical background-oriented schlieren (BOS) method in a tomographic set-up, which in turn allows the identification of defects inside the engine through an exhaust jet analysis. The quality of the tomographic reconstruction strongly influences how easily defects can be detected inside the jet engine. In particular, the presence of high gradients in the reconstruction area has a strong impact on the reconstruction quality. An algebraic reconstruction algorithm (ART) is implemented and compared to a filtered-back projection (FBP) algorithm in terms of the capability of performing high-gradient tomographic BOS reconstructions. A combination of both algorithms is presented which significantly improves the reconstruction quality of high-gradient tomographic BOS in terms of artifact reduction. The combination of both algorithms is applied to both synthetic and real measurement data in this paper, in order to show possible applications and the achievable improvement of high-gradient tomographic BOS reconstructions.

  14. INTROGRESIÓN GENÉTICA DE Bos indicus (BOVIDAE EN BOVINOS CRIOLLOS COLOMBIANOS DE ORIGEN Bos taurus

    Directory of Open Access Journals (Sweden)

    JIMÉNEZ ROBAYO LIGIA MERCEDES

    2008-04-01

    Full Text Available

    El presente trabajo evidencia desde el punto de vista citogenético la introgresión genética, de origen paterno, de Bos indicus en ganado criollo colombiano descendiente de Bos taurus. Para este estudio se realizó el análisis cariológico de la morfología del cromosoma Y a partir de muestras de sangre heparinizada de 67 bovinos machos pertenecientes a siete razas criollas colombianas. Se reporta la presencia de cuatro ejemplares pertenecientes a la raza Romosinuano (40% y 10 toros de la raza Casanareña (100% con cromosoma Y de tipo acrocéntrico característico de Bos indicus, lo cual estaría evidenciando un alto grado de introgresión genética, en estas dos razas, posiblemente originada por la intensiva introducción de sementales de la raza Cebú en la ganadería criolla colombiana. En las otras cinco razas (Blanco Orejinegro (BON, Chino santandereano, Costeño con cuernos, Hartón del valle y Sanmartinero, los toros presentaron el cromosoma Y submetacéntrico, característico de Bos taurus.

  15. MADURACIÓN DEL SOLOMO (Biceps femoris EN VACAS DE DESCARTE Bos indicus Y Bos taurus

    Directory of Open Access Journals (Sweden)

    Roger Alonso Cubero-Rojas

    2013-01-01

    Full Text Available El objetivo de este trabajo fue evaluar el efecto de la maduración sobre la terneza del músculo Biceps femoris en vacas de descarte Bos indicus y Bos taurus. En la planta procesadora de Montecillos R.L., ubicada en Alajuela, se realizó la escogencia y sacrificio de los animales, la maduración y empaque al vacío de la carne. La cocción, determinación de la terneza y evaluación sensorial se llevó a cabo a los 0, 14 y 28 días de maduración, en el Laboratorio de Análisis Sensorial del Centro de Investigaciones en Tecnología de Alimentos de la Universidad de Costa Rica, ubicado en San Pedro de Montes de Oca, San José, en julio del año 2011. De acuerdo con la evaluación instrumental, la especie y la cronometría dental no fueron factores significativos en la determinación de la terneza de la carne, mientras que el tiempo de maduración sí mostró cambios altamente significativos (p>0,001 sobre el mismo parámetro. Los mejores resultados se obtuvieron a los 28 días, donde B. indicus mostró 3,78 kg de fuerza al corte, mientras que para B. taurus se obtuvo 3,88 kg. En la evaluación sensorial, los animales B. indicus se calificaron como más jugosos (p=0,016 y con mejor sabor (p<0,001. Se determinó una relación inversa entre sabor y tiempo de maduración, lo cual indicó que a mayor tiempo de maduración el sabor de la carne se volvió menos agradable al paladar.

  16. Screening of biotechnical parameters for production of bovine inter-subspecies embryonic chimeras by the aggregation of tetraploid Bos indicus and diploid crossbred Bos taurus embryos.

    Science.gov (United States)

    Razza, Eduardo M; Satrapa, Rafael A; Emanuelli, Isabele P; Barros, Ciro M; Nogueira, Marcelo F G

    2016-03-01

    The aggregation of a tetraploid zebu embryo (Bos indicus, a thermotolerant breed) with a diploid taurine embryo (Bos taurus, a thermosensitive breed) should create a complete taurine fetus, whose extra-embryonic components, e.g., the chorion, is derived mainly from the zebu embryo. These zebu-derived extra-embryonic components may interact positively with the taurine embryo/fetus during pregnancy in a tropical environment. We tested different parameters for the production of tetraploid Nelore (Bos indicus) embryos to be combined via aggregation with crossbred Bos taurus (diploid) embryos in order to produce viable chimeric blastocysts. Bovine (Bos indicus or crossbred Bos taurus) embryos were produced in vitro according to standard procedures. Two-cell Bos indicus embryos were submitted to electrofusion with varying numbers of pulses (1 or 2), voltages (0.4, 0.5, 0.75, 1.0, 1.4 and 5.0 kV/cm) and time (20, 25, 50 and 60 μs) to produce tetraploid embryos. Electrofused embryos were cultured with crossbred non-fused embryos to form chimeras that developed until the blastocyst stage. The best fusion parameter was 0.75 kV/cm for 60 μs. Four chimeric blastocysts (tetraploid Nelore with diploid crossbred Holstein) were formed after 31 attempts in 4 replicates (13%). We established an optimal procedure for the production of tetraploid Bos indicus (4n) embryos and embryonic chimeras by aggregation of crossbred Bos taurus (2n) with Bos indicus (4n) embryos. This technique would be valid in applied research, by producing exclusively taurine calves, but with placental elements from the Bos indicus breed, following transfer of these chimeras into recipient cows. Copyright © 2015 Society for Biology of Reproduction & the Institute of Animal Reproduction and Food Research of Polish Academy of Sciences in Olsztyn. Published by Elsevier Urban & Partner Sp. z o.o. All rights reserved.

  17. Effect of monensin inclusion on intake, digestion, and ruminal fermentation parameters by Bos taurus indicus and Bos taurus taurus steers consuming bermudagrass hay

    Science.gov (United States)

    Effects of monensin inclusion and cattle subspecies on utilization of bermudagrass hay (13.7% CP, 77.3% NDF, and 38.8% ADF) were evaluated using ruminally cannulated steers (5 Bos taurus indicus [BI] and 5 Bos taurus taurus [BT]; 398 kg BW). Subspecies were concurrently subjected to a 2-period, 2-t...

  18. Comparison of antral and preantral ovarian follicle populations between Bos indicus and Bos indicus-taurus cows with high or low antral follicles counts.

    Science.gov (United States)

    Silva-Santos, K C; Siloto, L S; Santos, G M G; Morotti, F; Marcantonio, T N; Seneda, M M

    2014-02-01

    The objective was to compare populations of antral and pre-antral ovarian follicles in Bos indicus and Bos indicus-taurus cows with high and low antral follicle counts. Nelore (Bos indicus, n = 20) and Nelore X Angus (1/2 Bos indicus-taurus, n = 20) cows were subjected to follicular aspiration without regard to the stage of their oestrous cycle (day of aspiration = D0) to remove all follicles ≥3 mm and induce growth of a new follicular wave. Ovaries were examined by ultrasonography on D4, D19, D34, D49 and D64, and antral follicles ≥3 mm were counted. Thereafter, cows were assigned to one of two groups: high or low antral follicular count (AFC, ≥30 and ≤15 antral follicles, respectively). After D64, ovaries were collected after slaughter and processed for histological evaluation. There was high repeatability in the numbers of antral follicles for all groups (range 0.77-0.96). The mean (±SD) numbers of antral follicles were 35 ± 9 (Bos indicus) and 38 ± 6 (Bos indicus-taurus) for the high AFC group and 10 ± 3 (Bos indicus) and 12 ± 2 (Bos indicus-taurus) follicles for the low AFC. The mean number of preantral follicles in the ovaries of Bos indicus-taurus cows with high AFC (116 226 ± 83 156 follicles) was greater (p < 0.05) than that of Bos indicus cows (63 032 ± 58 705 follicles) with high AFC. However, there was no significant correlation between numbers of antral and preantral follicles. © 2013 Blackwell Verlag GmbH.

  19. A disparate trace element metabolism in zebu (Bos indicus) and crossbred (Bos indicus × Bos taurus) cattle in response to a copper-deficient diet.

    Science.gov (United States)

    Dermauw, V; De Cuyper, A; Duchateau, L; Waseyehon, A; Dierenfeld, E; Clauss, M; Peters, I R; Du Laing, G; Janssens, G P J

    2014-07-01

    Copper deficiency is a commonly diagnosed problem in cattle around the globe. In Jimma, Ethiopia, 8 zebu (Bos indicus) and 8 zebu ×: Holstein Friesian cross (Bos taurus ×: Bos indicus) heifers were used in an 11-wk study to investigate breed type differences and effects of Cu deficiency on concentrations of trace elements in plasma and edible tissues as well as mRNA expression of Cu-related genes. Heifers were fed a grass diet (6.4 ± 0.2 [SEM] mg Cu/kg DM) supplemented with 1 mg Mo/kg DM in wk 1 to 4 and 2 mg Mo/kg DM in wk 5 to 11, with blood samples collected every 2 wk and tissue collection postmortem. Plasma, liver, kidney, and semitendinosus and cardiac muscle were analyzed for Zn, Cu, Fe, Se, Mo, Co, and Mn. Expression of mRNA Cu-related genes was measured in aorta (lysyl oxidase [LOX]), liver (Cu transporting β-polypeptide [Atp7b], Cu chaperone for superoxide dismutase [CCS], cytochrome c oxidase assembly homolog 17 [Cox17], Cu transporter 1 homolog [Ctr1], and superoxide dismutase 1 [Sod1]), and duodenum (diamine oxidase [DAO] and metallo-thionein-1A [Mt1a]) as well as the Se-related glutathione peroxidase 1 (Gpx1). Zebu cattle maintained initial plasma Cu concentrations just below the threshold value for deficiency, whereas crossbred cattle gradually became severely Cu deficient over time (P taurus ×: B. indicus cattle resulting in greater sensitivity to Cu deficiency in B. taurus crossbred cattle.

  20. Detection of quantitative trait loci in Bos indicus and Bos taurus cattle using genome-wide association studies.

    Science.gov (United States)

    Bolormaa, Sunduimijid; Pryce, Jennie E; Kemper, Kathryn E; Hayes, Ben J; Zhang, Yuandan; Tier, Bruce; Barendse, William; Reverter, Antonio; Goddard, Mike E

    2013-10-29

    The apparent effect of a single nucleotide polymorphism (SNP) on phenotype depends on the linkage disequilibrium (LD) between the SNP and a quantitative trait locus (QTL). However, the phase of LD between a SNP and a QTL may differ between Bos indicus and Bos taurus because they diverged at least one hundred thousand years ago. Here, we test the hypothesis that the apparent effect of a SNP on a quantitative trait depends on whether the SNP allele is inherited from a Bos taurus or Bos indicus ancestor. Phenotype data on one or more traits and SNP genotype data for 10 181 cattle from Bos taurus, Bos indicus and composite breeds were used. All animals had genotypes for 729 068 SNPs (real or imputed). Chromosome segments were classified as originating from B. indicus or B. taurus on the basis of the haplotype of SNP alleles they contained. Consequently, SNP alleles were classified according to their sub-species origin. Three models were used for the association study: (1) conventional GWAS (genome-wide association study), fitting a single SNP effect regardless of subspecies origin, (2) interaction GWAS, fitting an interaction between SNP and subspecies-origin, and (3) best variable GWAS, fitting the most significant combination of SNP and sub-species origin. Fitting an interaction between SNP and subspecies origin resulted in more significant SNPs (i.e. more power) than a conventional GWAS. Thus, the effect of a SNP depends on the subspecies that the allele originates from. Also, most QTL segregated in only one subspecies, suggesting that many mutations that affect the traits studied occurred after divergence of the subspecies or the mutation became fixed or was lost in one of the subspecies. The results imply that GWAS and genomic selection could gain power by distinguishing SNP alleles based on their subspecies origin, and that only few QTL segregate in both B. indicus and B. taurus cattle. Thus, the QTL that segregate in current populations likely resulted from

  1. The correlation between the number of antral follicles and ovarian reserves (preantral follicles) in purebred Bos indicus and Bos taurus cows.

    Science.gov (United States)

    Silva-Santos, Katia Cristina; Santos, Gustavo Martins Gomes Dos; Siloto, Letícia Schmidt; Santos, Joabel Tonellotto Dos; Oliveira, Eduardo Raele de; Machado, Fernanda Zandonadi; Rosa, Camila Oliveira; Seneda, Marcelo Marcondes

    2014-12-30

    The objectives of this study were to compare populations of preantral follicles between purebred Bos indicus and Bos taurus cows with high or low antral follicle counts (AFC) and to correlate the number of preantral follicles with the population of antral follicles. Nelore (Bos indicus, n=100) and Angus (Bos taurus, n=100) cow ovaries were collected at abattoirs and examined using ultrasonography. Antral follicles ≥3mm were counted, and the cows ovaries were assigned to high (G-High) or low (G-Low) AFC groups based on the mean number (±1 SD) of ovarian antral follicles: Bos indicus with high AFC (≥57 follicles, n=8) or low AFC (≤21 follicles, n=8) and Bos taurus with high (≥45 follicles, n=10) or low AFC (≤13 follicles, n=10). The ovaries were processed, and the number of preantral follicles was estimated. Between-groups comparisons were performed using a Kruskal-Wallis test, and the correlation between preantral and antral follicles was evaluated using a Pearson's correlation test (P≤0.05). A large variation in the number of preantral follicles was observed among the animals. Although there was a correlation between the population of preantral follicles and the number of antral follicles, there was no difference between the mean number of preantral follicles in the Bos indicus G-High (48,349±30,149) and G-Low groups (33,037±31,710) or between the Bos taurus G-High (35,050±36,060) and G-Low groups (30,481±43,360). Therefore, the preantral follicle population did not differ between purebred Bos indicus and Bos taurus cattle with high or low AFC but was correlated with the number of antral follicles. In addition to the large within-groups variation in the number of preantral follicles, some cows with high AFC had lower populations of preantral follicles compared to the low AFC group, and the highest population of preantral follicles was observed in both Bos indicus and Bos taurus with low AFC. Copyright © 2014 Elsevier B.V. All rights reserved.

  2. Genetic variation and differentiation of bison (Bison bison) subspecies and cattle (Bos taurus) breeds and subspecies

    Science.gov (United States)

    Genetic variation was quantified at 29 polymorphic microsatellite DNA loci in nine herds of plains bison (Bison bison bison), three herds of wood bison (B. b. athabascae), fourteen breeds of taurine cattle (Bos taurus taurus), and two breeds of indicine cattle (Bos taurus indicus). Genetic distances...

  3. Genetic variation in bison (bison bison) subspecies and cattle (Bos taurus) breeds and subspecies

    Science.gov (United States)

    Genetic variation was quantified at 29 polymorphic microsatellite DNA loci in nine herds of plains bison (Bison bison bison), three herds of wood bison (B.b. athabascae), fourteen breeds of taurine cattle (Bos Taurus Taurus), and two breeds of indicine cattle (Bos Taurus indicus). Genetic distances,...

  4. Complete Genome Sequence of Bos taurus Papillomavirus Type 1, Isolated in Morocco.

    Science.gov (United States)

    Regnard, Guy L; Matiso, Asanda; Mounir, Latif; Embarki, Tarik; Hitzeroth, Inga I; Rybicki, Edward P

    2017-09-21

    Bos taurus papillomaviruses infect cattle, which has both animal health and economic consequences. This is the first report and sequence of Bos taurus papillomavirus type 1 isolated from warts in cattle in Morocco. The double-stranded DNA (dsDNA) genome was 7,945 bp in size, and eight open reading frames were identified. Copyright © 2017 Regnard et al.

  5. Acute and chronic onset of bronchiolitis obliterans syndrome (BOS): are they different entities?

    Science.gov (United States)

    Jackson, Christopher H; Sharples, Linda D; McNeil, Keith; Stewart, Susan; Wallwork, John

    2002-06-01

    Bronchiolitis obliterans syndrome (BOS), defined as an irreversible, staged decline in forced expiratory volume in 1 second (FEV(1)), is an established marker of obliterative bronchiolitis. Potential causes of BOS include sub-clinical chronic rejection and/or exaggerated healing response following acute injury. BOS may thus result from two or more distinct processes, both acute and chronic. A total of 5,916 measurements of FEV(1) from 204 lung transplant recipients surviving at least 6 months after transplantation were analyzed. Follow-up ranged from 6 months to 13 years. By adjusting for the acute effects of rejection, pulmonary infection and measurement variation on FEV(1) trace, patients either had a linear decline characterized by a single acute drop in FEV(1) of >15% at BOS onset, or a chronic linear decline in FEV(1). The fraction having acute onset was estimated. Acute events occurring within the first 6 months were assessed as risk factors for acute onset BOS. Of the 204 patients, 8% died before BOS onset and 18% were BOS-free at analysis. For 18% of patients, BOS onset followed a chronic linear decline in FEV(1) of 3.7% per year, with a median time of BOS onset >99 months. For 56% of patients, BOS onset followed an acute drop in FEV(1) of median 33.8% (95% CI 19.1% to 39.7%), with median onset time of 52 months. During the first 6 months, acute rejection was significantly and independently associated with acute onset of BOS (relative risk = 1.15 per episode, 95% CI [1.03 to 1.29], p = 0.01), whereas pulmonary infection and cytomegalovirus (CMV) infection were not. Acute BOS onset followed a documented acute event in the previous 6 months in 38 of 114 (33%) of cases. BOS likely reflects more than one process. Compared with those who had a slow linear decline in lung function, acute BOS onset was associated with acute rejection in the first 6 months, was often triggered by an acute event and had poor prognosis, with obliterative bronchiolitis (OB) the main

  6. Electrocardiogram of Clinically Healthy Mithun (Bos frontalis): Variation among Strains

    Science.gov (United States)

    Sanyal, Sagar; Das, Pradip Kumar; Ghosh, Probal Ranjan; Das, Kinsuk; Vupru, Kezha V.; Rajkhowa, Chandan; Mondal, Mohan

    2010-01-01

    A study was conducted to establish the normal electrocardiogram in four different genetic strains of mithun (Bos frontalis). Electrocardiography, cardiac electrical axis, heart rate, rectal temperature and respiration rate were recorded in a total of 32 adult male mithun of four strains (n = 8 each). It was found that the respiration and heart rates were higher (P electrocardiogram of mithun revealed that the amplitude and duration of P wave, QRS complex and T wave were different among four different genetic strains of mithun and the electrical axis of QRS complex for Nagamese and Mizoram mithuns are dissimilar to bovine species. PMID:20886013

  7. Physiological Responses and Lactation to Cutaneous Evaporative Heat Loss in Bos indicus, Bos taurus, and Their Crossbreds.

    Science.gov (United States)

    Jian, Wang; Ke, Yang; Cheng, Lu

    2015-11-01

    Cutaneous evaporative heat loss in Bos indicus and Bos taurus has been well documented. Nonetheless, how crossbreds with different fractional genetic proportions respond to such circumstances is of interest. A study to examine the physiological responses to cutaneous evaporative heat loss, also lactation period and milk yield, were conducted in Sahiwal (Bos indicus, n = 10, 444±64.8 kg, 9±2.9 years), Holstein Friesian (Bos taurus, HF100% (n = 10, 488±97.9 kg, 6±2.8 years)) and the following crossbreds: HF50% (n = 10, 355±40.7 kg, 2±0 years) and HF87.5% (n = 10, 489±76.8 kg, 7±1.8 years). They were allocated so as to determine the physiological responses of sweating rate (SR), respiration rate (RR), rectal temperature (RT), and skin temperature (ST) with and without hair from 06:00 h am to 15:00 h pm. And milk yield during 180 days were collected at days from 30 to 180. The ambient temperature-humidity-index (THI) increased from less than 80 in the early morning to more than 90 in the late afternoon. The interaction of THI and breed were highly affected on SR, RR, RT, and ST (p0.05) but did change over time. The ST with and without hair were similar, and was higher in HF100% (37.4°C; 38.0°C) and their crossbred HF50% (35.5°C; 35.5°C) and HF87.5% (37.1°C; 37.9°C) than Sahiwal (34.8°C; 34.8°C) (p<0.01). Moreover, the early lactation were higher at HF100% (25 kg) and 87.5% (25 kg) than HF50% (23 kg) which were higher than Sahiwal (18 kg) while the peak period of lactation was higher at HF100% (35 kg) than crossbreds both HF87.5% and HF50% (32 kg) which was higher than Sahiwal (26 kg) (p<0.05). In conclusion, sweating and respiration were the main vehicle for dissipating excess body heat for Sahiwal, HF and crossbreds, respectively. The THI at 76 to 80 were the critical points where the physiological responses to elevated temperature displayed change.

  8. Evidence of Bos javanicus x Bos indicus hybridization and major QTLs for birth weight in Indonesian Peranakan Ongole cattle.

    Science.gov (United States)

    Hartati, Hartati; Utsunomiya, Yuri Tani; Sonstegard, Tad Stewart; Garcia, José Fernando; Jakaria, Jakaria; Muladno, Muladno

    2015-07-04

    Peranakan Ongole (PO) is a major Indonesian Bos indicus breed that derives from animals imported from India in the late 19(th) century. Early imports were followed by hybridization with the Bos javanicus subspecies of cattle. Here, we used genomic data to partition the ancestry components of PO cattle and map loci implicated in birth weight. We found that B. javanicus contributes about 6-7% to the average breed composition of PO cattle. Only two nearly fixed B. javanicus haplotypes were identified, suggesting that most of the B. javanicus variants are segregating under drift or by the action of balancing selection. The zebu component of the PO genome was estimated to derive from at least two distinct ancestral pools. Additionally, well-known loci underlying body size in other beef cattle breeds, such as the PLAG1 region on chromosome 14, were found to also affect birth weight in PO cattle. This study is the first attempt to characterize PO at the genome level, and contributes evidence of successful, stabilized B. indicus x B. javanicus hybridization. Additionally, previously described loci implicated in body size in worldwide beef cattle breeds also affect birth weight in PO cattle.

  9. Hybridization of banteng (Bos javanicus) and zebu (Bos indicus) revealed by mitochondrial DNA, satellite DNA, AFLP and microsatellites.

    Science.gov (United States)

    Nijman, I J; Otsen, M; Verkaar, E L C; de Ruijter, C; Hanekamp, E; Ochieng, J W; Shamshad, S; Rege, J E O; Hanotte, O; Barwegen, M W; Sulawati, T; Lenstra, J A

    2003-01-01

    Hybridization between wild and domestic bovine species occurs worldwide either spontaneously or by organized crossing. We have analysed hybridization of banteng (Bos javanicus) and zebu (Bos indicus) in south-east Asian cattle using mitochondrial DNA (PCR-RFLP and sequencing), AFLP, satellite fragment length polymorphisms (SFLP or PCR-RFLP of satellite DNA) and microsatellite genotyping. The Indonesian Madura zebu breed is reputed to be of hybrid zebu-banteng origin, but this has never been documented and Bali cattle are considered to be a domesticated form of banteng. The banteng mitochondrial type was found in all animals sampled on the isle of Bali, Indonesia, but only in 35% of the animals from a Malaysian Bali-cattle population. The Madura animals also carried mitochondrial DNA of either zebu and banteng origin. In both populations, zebu introgression was confirmed by AFLP and SFLP. Microsatellite analysis of the Malaysian Bali population revealed for 12 out of 15 loci screened, Bali-cattle-specific alleles, several of which were also found in wild banteng animals. The tools we have described are suitable for the detection of species in introgression studies, which are essential for the genetic description of local breeds and the preservation of their economic and cultural value.

  10. In vivo comparison of susceptibility between Bos indicus and Bos taurus cattle types to Theileria parva infection

    Directory of Open Access Journals (Sweden)

    S.G. Ndungu

    2005-09-01

    Full Text Available The objective of this study was to determine whether Bos taurus cattle differ form Bos indicus in their susceptibility to infection with the Muguga stabilate of Theileria parva and in their resistance to the resultant disease. Ten Friesians (B. taurus, ten improved Borans (B. indicus, ten unimproved Borans (B. indicus and ten Zebus (B. indicus born to dams from an East Coast fever (ECF endemic area were inoculated with an infective dose50 dilution of T. parva Muguga stabilate 147. All the animals except one Friesian and one Zebu developed schizont parasitosis. All the improved Borans, nine of the Friesians, eight of the unimproved Borans and six of the Zebus developed a febrile response. Four of the improved Borans, four of the Friesians and three of the unimproved Borans died of theileriosis. No significant difference (P > 0.05 in the prepatent period occurred between the groups, but the Zebus had a significantly shorter duration of schizont parasitosis (P > 0.05 and took a significantly shorter time to recover (P > 0.05 than the other three groups. There was no significant difference in the two parameters between the other three groups. The study showed that three B. indicus breds and a B. taurus breed are equally susceptible to T. parva infection. However, Zebus born to dams from an ECF endemic area showed a better ability to control the course of disease than cattle from ECF free areas.

  11. Diversity and evolution of 11 innate immune genes in Bos taurus taurus and Bos taurus indicus cattle.

    Science.gov (United States)

    Seabury, Christopher M; Seabury, Paul M; Decker, Jared E; Schnabel, Robert D; Taylor, Jeremy F; Womack, James E

    2010-01-05

    The Toll-like receptor (TLR) and peptidoglycan recognition protein 1 (PGLYRP1) genes play key roles in the innate immune systems of mammals. While the TLRs recognize a variety of invading pathogens and induce innate immune responses, PGLYRP1 is directly microbicidal. We used custom allele-specific assays to genotype and validate 220 diallelic variants, including 54 nonsynonymous SNPs in 11 bovine innate immune genes (TLR1-TLR10, PGLYRP1) for 37 cattle breeds. Bayesian haplotype reconstructions and median joining networks revealed haplotype sharing between Bos taurus taurus and Bos taurus indicus breeds at every locus, and we were unable to differentiate between the specialized B. t. taurus beef and dairy breeds, despite an average polymorphism density of one locus per 219 bp. Ninety-nine tagSNPs and one tag insertion-deletion polymorphism were sufficient to predict 100% of the variation at all 11 innate immune loci in both subspecies and their hybrids, whereas 58 tagSNPs captured 100% of the variation at 172 loci in B. t. taurus. PolyPhen and SIFT analyses of nonsynonymous SNPs encoding amino acid replacements indicated that the majority of these substitutions were benign, but up to 31% were expected to potentially impact protein function. Several diversity-based tests provided support for strong purifying selection acting on TLR10 in B. t. taurus cattle. These results will broadly impact efforts related to bovine translational genomics.

  12. Impact of Parental Bos taurus and Bos indicus Origins on Copy Number Variation in Traditional Chinese Cattle Breeds.

    Science.gov (United States)

    Zhang, Liangzhi; Jia, Shangang; Plath, Martin; Huang, Yongzhen; Li, Congjun; Lei, Chuzhao; Zhao, Xin; Chen, Hong

    2015-08-10

    Copy number variation (CNV) is an important component of genomic structural variation and plays a role not only in evolutionary diversification but also in domestication. Chinese cattle were derived from Bos taurus and Bos indicus, and several breeds presumably are of hybrid origin, but the evolution of CNV regions (CNVRs) has not yet been examined in this context. Here, we of CNVRs, mtDNA D-loop sequence variation, and Y-chromosomal single nucleotide polymorphisms to assess the impact of maternal and paternal B. taurus and B. indicus origins on the distribution of CNVRs in 24 Chinese domesticated bulls. We discovered 470 genome-wide CNVRs, only 72 of which were shared by all three Y-lineages (B. taurus: Y1, Y2; B. indicus: Y3), whereas 265 were shared by inferred taurine or indicine paternal lineages, and 228 when considering their maternal taurine or indicine origins. Phylogenetic analysis uncovered eight taurine/indicine hybrids, and principal component analysis on CNVs corroborated genomic exchange during hybridization. The distribution patterns of CNVRs tended to be lineage-specific, and correlation analysis revealed significant positive or negative co-occurrences of CNVRs across lineages. Our study suggests that CNVs in Chinese cattle partly result from selective breeding during domestication, but also from hybridization and introgression. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  13. Anticorpos em bovinos (Bos indicus e Bos taurus e bubalinos (Bubalus bubalis inoculados com oocistos de Toxoplasma gondii. Estudo comparativo

    Directory of Open Access Journals (Sweden)

    Oliveira F.C.R.

    2000-01-01

    Full Text Available Três animais de cada espécie (Bos indicus, Bos taurus e Bubalus bubalis foram inoculados, via oral, com 2×10(5 oocistos de Toxoplasma gondii. Seis outros animais, dois de cada espécie, foram mantidos como testemunhas. A resposta de anticorpos avaliada por meio da reação de imunofluorescência indireta iniciou-se a partir do quinto dia pós-inoculação (DPI nos zebuínos e bubalinos, e no sétimo DPI nos taurinos. Os títulos sorológicos nos taurinos permaneceram elevados até o final do experimento (70º DPI, alcançando níveis máximos (1:16.384 entre o 42º e 49º DPI. Nos zebuínos e bubalinos o maior título de anticorpos anti-Toxoplasma foi de 1:256. A resposta de anticorpos mais ou menos acentuada não está necessariamente relacionada à sensibilidade ao T. gondii.

  14. The mummified brain of a pleistocene woolly mammoth (Mammuthus primigenius) compared with the brain of the extant African elephant (Loxodonta africana).

    Science.gov (United States)

    Kharlamova, Anastasia S; Saveliev, Sergei V; Protopopov, Albert V; Maseko, Busisiwe C; Bhagwandin, Adhil; Manger, Paul R

    2015-11-01

    This study presents the results of an examination of the mummified brain of a pleistocene woolly mammoth (Mammuthus primigenius) recovered from the Yakutian permafrost in Siberia, Russia. This unique specimen (from 39,440-38,850 years BP) provides the rare opportunity to compare the brain morphology of this extinct species with a related extant species, the African elephant (Loxodonta africana). An anatomical description of the preserved brain of the woolly mammoth is provided, along with a series of quantitative analyses of various brain structures. These descriptions are based on visual inspection of the actual specimen as well as qualitative and quantitative comparison of computed tomography imaging data obtained for the woolly mammoth in comparison with magnetic resonance imaging data from three African elephant brains. In general, the brain of the woolly mammoth specimen examined, estimated to weigh between 4,230 and 4,340 g, showed the typical shape, size, and gross structures observed in extant elephants. Quantitative comparative analyses of various features of the brain, such as the amygdala, corpus callosum, cerebellum, and gyrnecephalic index, all indicate that the brain of the woolly mammoth specimen examined has many similarities with that of modern African elephants. The analysis provided here indicates that a specific brain type representative of the Elephantidae is likely to be a feature of this mammalian family. In addition, the extensive similarities between the woolly mammoth brain and the African elephant brain indicate that the specializations observed in the extant elephant brain are likely to have been present in the woolly mammoth. © 2015 Wiley Periodicals, Inc.

  15. Effects of a high-energy diet on oocyte quality and in vitro embryo production in Bos indicus and Bos taurus cows.

    Science.gov (United States)

    Sales, J N S; Iguma, L T; Batista, R I T P; Quintão, C C R; Gama, M A S; Freitas, C; Pereira, M M; Camargo, L S A; Viana, J H M; Souza, J C; Baruselli, P S

    2015-05-01

    The effects of different dietary energy levels [100 and 170% for maintenance (M) and high energy (1.7M), respectively] on metabolic, endocrine, and reproductive parameters were evaluated in nonlactating Bos indicus (Gir; n=14) and Bos taurus (Holstein; n=14) cows submitted to ultrasound-guided ovum pick-up followed by in vitro embryo production. The oocyte donor cows were housed in a tiestall system and fed twice daily (0800 and 1600 h). Twenty-one days before the beginning of the experiment, the animals were fed with a maintenance diet for adaptation followed by the experimental diets (M and 1.7M), and each cow underwent 9 ovum pick-up procedures 14 d apart. The recovered oocytes were cultured in vitro for 7 d. We measured glucose and insulin concentrations and performed glucose tolerance tests and the relative quantification of transcripts (PRDX1, HSP70.1, GLUT1, GLUT5, IGF1R, and IGF2R) from the oocytes recovered at the end of the experimental period. No interactions were observed between the effects of genetic groups and dietary energy level on the qualitative (viable oocytes, quality grade, and oocyte quality index) and quantitative (oocytes recovered) oocyte variables. There were no effects of dietary energy level on the qualitative and quantitative oocyte variables. However, Bos indicus cows had greater numbers of recovered structures, viable oocytes, and A and B oocyte grades as well as better oocyte quality index scores and lower DNA fragmentation rates compared with Bos taurus donors. In vitro embryo production (cleavage and blastocyst rates and number of embryos) was similar between diets, but the 1.7M diet reduced in vitro embryo production in Bos indicus cows after 60 d of treatment. Moreover, Bos indicus cows on the 1.7M diet showed lower transcript abundance for the HSP70.1, GLUT1, IGF1R, and IGF2R genes. All cows fed 1.7M diets had greater glucose and insulin concentrations and greater insulin resistance according to the glucose tolerance test. In

  16. Genomic divergence of indicine and taurine cattle identified through high-density SNP genotyping

    Science.gov (United States)

    At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically adapted Bos primigenius indicus. Human selection exponentially...

  17. Frequencies of polymorphisms associated with BSE resistance differ significantly between Bos taurus, Bos indicus, and composite cattle

    Directory of Open Access Journals (Sweden)

    Seabury Christopher M

    2008-09-01

    Full Text Available Abstract Background Transmissible spongiform encephalopathies (TSEs are neurodegenerative diseases that affect several mammalian species. At least three factors related to the host prion protein are known to modulate susceptibility or resistance to a TSE: amino acid sequence, atypical number of octapeptide repeats, and expression level. These factors have been extensively studied in breeds of Bos taurus cattle in relation to classical bovine spongiform encephalopathy (BSE. However, little is currently known about these factors in Bos indicus purebred or B. indicus × B. taurus composite cattle. The goal of our study was to establish the frequency of markers associated with enhanced susceptibility or resistance to classical BSE in B. indicus purebred and composite cattle. Results No novel or TSE-associated PRNP-encoded amino acid polymorphisms were observed for B. indicus purebred and composite cattle, and all had the typical number of octapeptide repeats. However, differences were observed in the frequencies of the 23-bp and 12-bp insertion/deletion (indel polymorphisms associated with two bovine PRNP transcription regulatory sites. Compared to B. taurus, B. indicus purebred and composite cattle had a significantly lower frequency of 23-bp insertion alleles and homozygous genotypes. Conversely, B. indicus purebred cattle had a significantly higher frequency of 12-bp insertion alleles and homozygous genotypes in relation to both B. taurus and composite cattle. The origin of these disparities can be attributed to a significantly different haplotype structure within each species. Conclusion The frequencies of the 23-bp and 12-bp indels were significantly different between B. indicus and B. taurus cattle. No other known or potential risk factors were detected for the B. indicus purebred and composite cattle. To date, no consensus exists regarding which bovine PRNP indel region is more influential with respect to classical BSE. Should one particular

  18. Metabolic and endocrine differences between Bos taurus and Bos indicus females that impact the interaction of nutrition with reproduction.

    Science.gov (United States)

    Sartori, Roberto; Gimenes, Lindsay U; Monteiro, Pedro L J; Melo, Leonardo F; Baruselli, Pietro S; Bastos, Michele R

    2016-07-01

    During the last decade, researchers have studied the differences in the reproductive physiology between Bos taurus and Bos indicus breeds. This manuscript focuses on the main aspects of ovarian function and circulating hormones of B. taurus and B. indicus cows and heifers. In general, there is no difference in the number of follicle waves during the estrous cycle, however B. indicus have greater antral follicle count, circulating insulin, and insulin-like growth factor 1 (IGF1) than B. taurus. Moreover, despite of B. taurus having larger ovulatory follicle diameter and maximum CL volume, they have lesser peak circulating estradiol concentrations and lesser circulating progesterone concentrations than B. indicus. We may speculate that there are two main factors related to lesser circulating concentrations of estradiol and progesterone in B. taurus when compared with B. indicus: increased liver metabolism of steroid hormones and lesser production by follicles and CL. Differences between the two genetic groups are also observed with respect to in vitro embryo production because in addition to B. indicus having greater numbers of retrieved oocytes, due to greater antral follicle count, they also have greater percentages of viable oocytes, number of blastocysts, and blastocyst rates when compared with B. taurus. Effects of dietary intake on embryo quality may differ between B. taurus and B. indicus due to different concentrations of circulating insulin and IGF1. For in vivo and in vitro embryo production, an increase in circulating insulin concentrations is negatively associated with oocyte/embryo quality and conception rates. However, this seems to be more pronounced in B. taurus breeds. Differences in ovarian function related or not to nutrition between these two genetic groups are very consistent and may be related to the influence of metabolic hormones such as insulin and IGF1. Copyright © 2016 Elsevier Inc. All rights reserved.

  19. Frequencies of polymorphisms associated with BSE resistance differ significantly between Bos taurus, Bos indicus, and composite cattle.

    Science.gov (United States)

    Brunelle, Brian W; Greenlee, Justin J; Seabury, Christopher M; Brown, Charles E; Nicholson, Eric M

    2008-09-22

    Transmissible spongiform encephalopathies (TSEs) are neurodegenerative diseases that affect several mammalian species. At least three factors related to the host prion protein are known to modulate susceptibility or resistance to a TSE: amino acid sequence, atypical number of octapeptide repeats, and expression level. These factors have been extensively studied in breeds of Bos taurus cattle in relation to classical bovine spongiform encephalopathy (BSE). However, little is currently known about these factors in Bos indicus purebred or B. indicus x B. taurus composite cattle. The goal of our study was to establish the frequency of markers associated with enhanced susceptibility or resistance to classical BSE in B. indicus purebred and composite cattle. No novel or TSE-associated PRNP-encoded amino acid polymorphisms were observed for B. indicus purebred and composite cattle, and all had the typical number of octapeptide repeats. However, differences were observed in the frequencies of the 23-bp and 12-bp insertion/deletion (indel) polymorphisms associated with two bovine PRNP transcription regulatory sites. Compared to B. taurus, B. indicus purebred and composite cattle had a significantly lower frequency of 23-bp insertion alleles and homozygous genotypes. Conversely, B. indicus purebred cattle had a significantly higher frequency of 12-bp insertion alleles and homozygous genotypes in relation to both B. taurus and composite cattle. The origin of these disparities can be attributed to a significantly different haplotype structure within each species. The frequencies of the 23-bp and 12-bp indels were significantly different between B. indicus and B. taurus cattle. No other known or potential risk factors were detected for the B. indicus purebred and composite cattle. To date, no consensus exists regarding which bovine PRNP indel region is more influential with respect to classical BSE. Should one particular indel region and associated genotypes prove more

  20. Genotype x environment interactions for fatty acid profiles in Bos indicus and Bos taurus finished on pasture or grain.

    Science.gov (United States)

    Bressan, M C; Rossato, L V; Rodrigues, E C; Alves, S P; Bessa, R J B; Ramos, E M; Gama, L T

    2011-01-01

    A study was conducted to characterize lipid profiles in the M. longissimus thoracis of commercial Brazilian beef and to assess how those profiles are influenced by finishing system, genetic group, and their interaction. Intramuscular fat (IMF) and fatty acid (FA) profiles were determined in 160 bulls of the Bos taurus (n = 75) and Bos indicus (n = 85) genetic groups, finished on pasture (n = 46) or with grain supplementation (n = 114) and slaughtered in a commercial abattoir. Finishing system had a major impact on the deposition of IMF, as well as on the concentration of SFA, PUFA, and their ratio, but genetic groups showed important differences in the ability to convert SFA into cis-9 MUFA and to convert 16:0 into 18:0. When compared with pasture-finished animals, those finished with grain had greater content of IMF and SFA (P 0.05), and about one-half the amount of PUFA (P taurus had less SFA and greater MUFA than B. indicus (P 0.05). With pasture-finishing, no differences were observed among the 2 genetic groups in SFA and MUFA (P > 0.05), but PUFA were decreased in B. taurus (P taurus had a decreased ability for elongation and B. indicus had a decreased aptitude for desaturation of FA. On the other hand, with pasture-finishing a greater deposition of intermediate FA from ruminal biohydrogenation was observed in B. indicus than in B. taurus. Overall, FA profiles were affected more by finishing system in B. indicus than in B. taurus.

  1. Local immune response against larvae of Rhipicephalus (Boophilus) microplus in Bos taurus indicus and Bos taurus taurus cattle.

    Science.gov (United States)

    Constantinoiu, C C; Jackson, L A; Jorgensen, W K; Lew-Tabor, A E; Piper, E K; Mayer, D G; Venus, B; Jonsson, N N

    2010-06-01

    Bos taurus indicus cattle are less susceptible to infestation with Rhipicephalus (Boophilus) microplus than Bos taurus taurus cattle but the immunological basis of this difference is not understood. We compared the dynamics of leukocyte infiltrations (T cell subsets, B cells, major histocompatibility complex (MHC) class II-expressing cells, granulocytes) in the skin near the mouthparts of larvae of R. microplus in B. t. indicus and B. t. taurus cattle. Previously naïve cattle were infested with 50,000 larvae (B. t. indicus) or 10,000 larvae (B. t. taurus) weekly for 6 weeks. One week after the last infestation all of the animals were infested with 20,000 larvae of R. microplus. Skin punch biopsies were taken from all animals on the day before the primary infestation and from sites of larval attachment on the day after the first, second, fourth and final infestations. Infiltrations with CD3(+), CD4(+), CD8(+) and gammadelta T cells followed the same pattern in both breeds, showing relatively little change during the first four weekly infestations, followed by substantial increases at 7 weeks post-primary infestation. There was a tendency for more of all cell types except granulocytes to be observed in the skin of B. t. indicus cattle but the differences between the two breeds were consistently significant only for gammadelta T cells. Granulocyte infiltrations increased more rapidly from the day after infestation and were higher in B. t. taurus cattle than in B. t. indicus. Granulocytes and MHC class II-expressing cells infiltrated the areas closest to the mouthparts of larvae. A large volume of granulocyte antigens was seen in the gut of attached, feeding larvae. (c) 2010. Published by Elsevier Ltd. All rights reserved.

  2. Inbreeding Pada Populasi Banteng (Bos Javanicus D'Alton 1832) Di Kebun Binatang Surabaya

    OpenAIRE

    Sawitri, Reny; Takandjandji, Mariana

    2012-01-01

    Inbreeding Population of Banteng (Bos javanicus d’Alton 1832) at Surabaya Zoo. Reny Sawitry and Mariana Takandjandji. Banteng (Bos javanicus d’Alton 1832) is one of wildlife that is maintained in Surabaya Zoo, their mating system happened from a couples, and so overlap from generation to next generation. The purposed of this research was to determine effective population size, genetic diversity, and the change of physical and physiological of the herd. The methods used in ...

  3. Physiology and Endocrinology Symposium: influence of cattle genotype (Bos indicus vs. Bos taurus) on oocyte and preimplantation embryo resistance to increased temperature.

    Science.gov (United States)

    Paula-Lopes, F F; Lima, R S; Satrapa, R A; Barros, C M

    2013-03-01

    High environmental temperatures during the hot months of the year reduce reproductive performance in cattle. Summer heat stress depression in fertility is a multifactorial problem; however, there is evidence that the bovine germinal vesicle and maturing oocyte, as well as the early embryo, are major targets of the deleterious effects of heat stress. Such adverse effects are less pronounced in heat-tolerant breeds (Bos indicus) than heat-sensitive breeds (Bos taurus). This genetic variation results from the greater thermoregulatory ability and cellular thermoresistance of heat-tolerant breeds. Heat-induced oocyte cellular damage occurs in both cytoplasmic and nuclear compartments. Heat shock has been shown to reduce oocyte nuclear maturation, induce apoptosis, compromise oocyte cytoskeleton, and impair oocyte mitochondrial function and developmental competence. However, the oocyte cytoplasm is more susceptible to heat shock than the nucleus. This effect is greater for Bos taurus than Bos indicus oocytes. The detrimental effects of heat shock are also critical during the first cleavage divisions when most of the embryonic genome is inactive; however, the bovine embryo becomes more resistant to increased temperature as it proceeds through development. Several studies demonstrated that Bos indicus embryos are more thermotolerant than Bos taurus embryos. Adaptive changes involved in acquisition of thermotolerance are likely derived from changes in gene expression and (or) activity of biochemical molecules that control cellular functions against stress. Recently, molecules such as IGF-I and caspase inhibitor z-DEVD-fmk have been shown to exert a thermoprotective role, rescuing heat-induced oocyte and embryo cellular damage and developmental competence. Therefore, cattle genotype and thermoprotective molecules can be considered as an alternative to modulate the effects of increased temperature in reproductive function.

  4. Background Oriented Schlieren (BOS) measurement in supersonic flow with 4K high-speed camera

    Science.gov (United States)

    Ota, M.; Kurihara, K.; Arimoto, H.; Shida, K.; Inage, T.

    2017-02-01

    The Background Oriented Schlieren (BOS) technique is one of the novel measurement techniques and its application range is very wide. The principle of BOS is similar to that of the conventional schlieren technique, it exploits the bending of light ray caused by a refractive-index change corresponding to the density change in the medium. The BOS technique allows the quantitative measurement of density with very simple experimental setup and proper image analysis. Only a background and a digital camera are required for the experiment, so that even the real scale experiments can be realized. In recent years, the development of the high-speed camera is remarkable and so many high-speed phenomena can now be captured. To realize the precise measurement with BOS technique using high-speed camera, higher resolution (larger number of pixels) is desirable. In this paper, with a technical support from Nobby Tech Ltd., a 4K high-speed camera (4096 × 2160 pixels) is applied to the BOS measurement of the lateral jet/cross flow interaction filed in the supersonic wind tunnel test as a trial of the quantitative density measurement with higher resolution. The measurement system consists of a 4K high-speed camera and a pulsed laser for background illumination. A telecentric optical system is also employed to improve the spatial resolution of the measurement. The measurement results of BOS technique up to 1000 fps with higher resolution are discussed.

  5. PENGELOLAAN DANA BOS PADA SD NEGERI DI UPT PELAYANAN PENDIDIKAN KECAMATAN MOYUDAN KABUPATEN SLEMAN

    Directory of Open Access Journals (Sweden)

    Irene Muryati

    2016-09-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui: (1 perencanaan, (2 pelaksanaan, (3 pengawasan dan evaluasi pengelolaan, serta (4 pelaporan dana Bantuan Operasional Sekolah (BOS pada Sekolah Dasar Negeri dengan jumlah siswa sedikit dan jumlah siswa banyak di wilayah UPT Pelayanan Pendidikan Kecamatan Moyudan. Jenis penelitian ini adalah studi kasus. Responden penelitian ini yaitu kepala sekolah, bendahara, guru, komite sekolah, dan orang tua siswa. Data dikumpulkan melalui wawancara, observasi dan studi dokumen. Hasil penelitian ini menunjukkan bahwa: (1 perencanaan pengelolaan dana BOS diprioritaskan untuk peningkatan mutu, namun partisipasi warga sekolah kurang optimal. (2 Pada pelaksanaan: (a penyaluran dana dilaksanakan di awal triwulan, (b proses pembukuan dilaksanakan secara rutin, dan (c prinsip akuntabilitas dan keterbukaan telah dilaksanakan dengan baik. (3 pengawasan dilakukankan oleh kepala sekolah dan pengawas sekolah dengan memeriksa SPJ BOS; evaluasi dilakukan dengan mengisi angket pelaksanaan sekali dalam setahun oleh TIM Manajemen BOS Kabupaten. (4 Pelaporan penggunaan dana BOS dalam bentuk SPJ dilaksanakan setiap triwulan kepada Tim Manajemen BOS Kabupaten melalui UPT Pelayanan Pendidikan. Kata kunci: Pengelolaan, Dana Bantuan Operasional Sekolah. BOS FUNDS MANAGEMENT ON STATE ELEMENTARY SCHOOLS IN THE DISTRICT MOYUDAN EDUCATION SERVICES UNIT SLEMAN REGENCY Abstract This study aims to reveal: (1 the planning, (2 implementation, (3 monitoring and evaluation, and (4 reporting of the management of School Operational Fund (BOS on public elementary schools whcihhas small and a big number of students in the District Moyudan Education. Respondents were the principals, treasurers, teachers, school committees, and parents of students. Data collection techniques were interviews, observation and document study The results of this study indicate that: (1 the fund was prioritized for student activities to improve the quality of education but

  6. Influence of the breed of bull (Bos taurus indicus vs. Bos taurus taurus) and the breed of cow (Bos taurus indicus, Bos taurus taurus and crossbred) on the resistance of bovine embryos to heat.

    Science.gov (United States)

    Eberhardt, Bruno G; Satrapa, Rafael A; Capinzaiki, Cláudia R L; Trinca, Luzia A; Barros, Ciro M

    2009-08-01

    In vitro studies have shown that Bos taurus indicus (B. t. indicus) embryos submitted to heat shock at early stages of development are better able to survive as compared to Bos taurus taurus embryos. Embryo genotype influences resistance to heat shock thus leading to the question as to whether embryos sired by thermo-tolerant breeds exhibit the same resistance to heat shock. In the present study the influence of both oocyte and semen, on the resistance to heat shock (HS) at early stages of in vitro development, was assessed in B. t. indicus [Nelore (N) breed], B. t. taurus [Holstein (H) and Angus (A) breeds] and crossbreds. In Experiment 1, Nelore and crossbred oocytes were collected from slaughterhouse ovaries and fertilized with spermatozoa from Nelore and Angus bulls. Presumptive embryos were collected and randomly assigned to control (39 degrees C) or HS at 12, 48 or 96 h post insemination (hpi; 41 degrees C for 12h) treatments. The cleavage rates and proportion of embryos developing to the blastocyst and hatched blastocyst stages were recorded on Days 2, 8 and 10, respectively. Heat shock treatment decreased development of both Nelore and crossbred embryos. There was a significant interaction between time (12, 48 or 96 hpi) and temperature for blastocyst rates, i.e., the embryos became more thermotolerant as development proceeded. In Experiment 2, oocytes from Nelore and Holstein cows were fertilized with semen from bulls of either Nelore or Angus breeds, and subjected to 12 h HS at 96 hpi. Heat shock at 96 hpi, decreased embryo development. Additionally, cowxtreatment and bullxtreatment interactions were significant for blastocyst rates, i.e., both breed of cow and breed of bull affected the decline in blastocyst rate caused by heat shock treatment. In conclusion, the present results indicate that Nelore embryos (indicus) are more resistant to heat shock than Holstein (taurus) at early stages of in vitro development, and that embryos become more thermo

  7. Feed intake and weight changes in Bos indicus-Bos taurus crossbred steers following Bovine Viral Diarrhea Virus Type 1b challenge under production conditions

    Science.gov (United States)

    Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366) that were challenge...

  8. Electrophoresis of buffalo (bos bubalis) serum proteins including immunoglobulins.

    Science.gov (United States)

    Satija, K C; Rajpal, S; Pandey, R; Sharma, V K

    1979-05-01

    Antigenic components of buffalo (Bos bubalis) serum, which were also components of buffalo colostrum, seminal plasma, milk whey, saliva, and tears, were investigated by the ager gel diffusion test and immunoelectrophoresis. Immunoglobulins of buffalo serum were identified by immunoelectrophoresis employing rabbit-anti-buffalo serum and rabbit-anti-buffalo gamma-globulin. Based on immunoelectrophoretic patterns immunoglobulin G (IgG), IgGA, and IgM were detected both in the serum and colostrum of buffaloes. Tears contained both IgG and IgM. Cross-reactions of buffalo serum with seminal plasma, saliva, and milk whey were observed only in the IgG region. By polyacrylamide gel electrophoresis, lipoprotein (5.2% +/- 0.41), IgM (11.4% +/- 3.1), IgG (9.4% +/- 0.98), haptoglobin 21.8% +/- 3.73), transferrin (10.4% +/- 2.15), ceruloplasmin (7.8% +/- 1.3), postalbumin (20.8% +/- 2.09), and albumin (13.7% +/- 0.75) were identified provisionally.

  9. Meta-analysis to predict sweating and respiration rates for Bos indicus, Bos taurus, and their crossbreds.

    Science.gov (United States)

    Thompson, V A; Fadel, J G; Sainz, R D

    2011-12-01

    The overall objective of this work was to develop empirical equations from a meta-analysis study to be used to implement initial values in a mechanistic heat balance model. The meta-analysis was conducted to 1) develop prediction equations for sweating and respiration rate (SR, g·m(-2)·h(-1) and RR, breaths·min(-1), respectively) based on skin and body temperature (T(s) and T(b), °C, respectively) for different breed types: Bos indicus, Bos taurus, and their crossbreds, and 2) evaluate the fit of existing SR equations and the SR and RR equations (from objective 1) against independent data sets. Fourteen studies were collected for the SR analysis, 12 for fitting and 2 for evaluation. The fitted SR equations (Thompson model) for the 3 breeds types were B. indicus, SR = 0.085e(0.22·T(s)); B. taurus, SR = 0.75e(0.15·T(s)); and crossbreds, SR = 0.015e(0.25·T(s)). Twenty-three studies were collected for the RR analysis, 20 for fitting and 3 for evaluation. The fitted RR equations for the 3 breed types were B. indicus, RR = -1,660 + 43.8·T(b); B. taurus, RR = -1,385 + 37·T(b); and crossbreds, RR = -2,226 + 59·T(b). Three SR equations (Maia, McArthur, and Gatenby models) from the literature were evaluated against the Thompson model using the 14 studies. The McArthur model predicted SR within the correct range, but with an increased slope bias because the equation was linear and not the correct shape. The Maia model overpredicted SR for all breed types with the greatest overprediction being for crossbreds. The Gatenby model overpredicted SR for B. taurus (root mean square error of prediction = 506 g·m(-2)·h(-1)), but was the best predictor for B. indicus. The Thompson model overpredicted SR for B. indicus (root mean square error of prediction ranged from 134 to 265 g·m(-2)·h(-1)), but was the best predictor for B. taurus and crossbreds. The Thompson model was a good predictor for RR across all breed types. The meta-analysis showed that the Thompson model

  10. Comparative microarray analysis of Rhipicephalus (Boophilus microplus expression profiles of larvae pre-attachment and feeding adult female stages on Bos indicus and Bos taurus cattle

    Directory of Open Access Journals (Sweden)

    Gondro Cedric

    2010-07-01

    Full Text Available Abstract Background Rhipicephalus (Boophilus microplus is an obligate blood feeder which is host specific to cattle. Existing knowledge pertaining to the host or host breed effects on tick transcript expression profiles during the tick - host interaction is poor. Results Global analysis of gene expression changes in whole R. microplus ticks during larval, pre-attachment and early adult stages feeding on Bos indicus and Bos taurus cattle were compared using gene expression microarray analysis. Among the 13,601 R. microplus transcripts from BmiGI Version 2 we identified 297 high and 17 low expressed transcripts that were significantly differentially expressed between R. microplus feeding on tick resistant cattle [Bos indicus (Brahman] compared to R. microplus feeding on tick susceptible cattle [Bos taurus (Holstein-Friesian] (p ≤ 0.001. These include genes encoding enzymes involved in primary metabolism, and genes related to stress, defence, cell wall modification, cellular signaling, receptor, and cuticle formation. Microarrays were validated by qRT-PCR analysis of selected transcripts using three housekeeping genes as normalization controls. Conclusion The analysis of all tick stages under survey suggested a coordinated regulation of defence proteins, proteases and protease inhibitors to achieve successful attachment and survival of R. microplus on different host breeds, particularly Bos indicus cattle. R. microplus ticks demonstrate different transcript expression patterns when they encounter tick resistant and susceptible breeds of cattle. In this study we provide the first transcriptome evidence demonstrating the influence of tick resistant and susceptible cattle breeds on transcript expression patterns and the molecular physiology of ticks during host attachment and feeding. The microarray data used in this analysis have been submitted to NCBI GEO database under accession number GSE20605 http://www.ncbi

  11. Comparative phenotypic profile of subpopulations of peripheral blood leukocytes in European (Bos taurus taurus) and Zebu cattle (Bos taurus indicus).

    Science.gov (United States)

    Macêdo, A A; Marciano, A P V; Rocha, L M; Alves-Júnior, J R F; Faria, A M C; Bittar, J F F; Araújo, M S S; Santos, R L; Martins-Filho, O A

    2013-12-19

    Differences in cellular and humoral immunity in Zebu (Bos taurus indicus) and European (B. taurus taurus) cattle breeds, which may be related to differences in resistance or susceptibility to infectious or parasitic diseases, are largely unknown. This study aimed to perform a comparative analysis of innate and adaptive immunity of European (including Holstein, Brown Swiss, and Hereford) and Zebu (including Gir, Nelore, and Guzera) breeds, by assessing their peripheral blood leukocyte profiles (i.e., monocytes, eosinophils, and lymphocytes, including CD4(+) and CD8(+) T cells, and CD21(+) B cells). Higher frequencies of cells involved in innate immunity were observed in Zebu breeds, particularly monocytes and non-T and non-B cells (13.37 ± 0.9058 and 37.67 ± 1.55, respectively). This finding may contribute to the increased resistance of B. taurus indicus to certain infectious and parasitic diseases. Considering other leukocyte populations in the peripheral blood, among-breed variation was greater than differences between the two subspecies. This study will serve as a basis for further investigations regarding comparative immunology and resistance to infectious and parasitic diseases of cattle.

  12. Molecular characterization and SNP identification in HSPB6 gene in Karan Fries (Bos taurus x Bos indicus) cattle.

    Science.gov (United States)

    Kumar, Rakesh; Gupta, I D; Verma, Archana; Kumari, Ragini; Verma, Nishant

    2017-06-01

    Heat shock proteins (HSPs) act as molecular chaperones which are preferentially transcribed in response to severe perturbations of the cellular homeostasis such as heat stress. The present study was undertaken for molecular characterization and detection of genetic polymorphisms of HSPB6 gene in 100 Karan Fries Cattle. HSPB6 gene was mapped on Bos taurus autosome 18 (BTA 18), comprising three exons and two introns. Four sets of primers for HSPB6 gene were designed using Primer3 software (version 0.4.0). For detecting single nucleotide polymorphisms (SNPs), sequence data was analyzed using BioEdit software (version 7.2). Comparative sequence analysis of HSPB6 gene showed five nucleotide polymorphisms, which included three transitions viz. g.161A > G, g.436G > A and g.2152A > G and two transversions viz. g.1743C > G and g.2417A > T compared to B. taurus (NCBI GenBank: AC_000175.1). HSPB6 gene of Karan Fries cattle exhibited a high percentage of nucleotide identity (47.0-100.0%) with the corresponding mammalian homologue. The present study indicated a high degree of genetic variability in the HSPB6 gene in the Karan Fries cattle populations.

  13. A global survey of banteng (Bos javanicus) housing and husbandry.

    Science.gov (United States)

    Rowden, Lewis J; Rose, Paul E

    2016-11-01

    Banteng (Bos javanicus) are an example of a species of conservation concern without current "best practice" guidance, as they have been the focus of little applied husbandry research. Despite their elevated conservation status, and established, increasing global captive population, zoos do not yet have information on optimal husbandry. To help address this problem, a husbandry survey was distributed to all global holders of banteng. Questions focused on herd demographic structure, exhibit features (including mixed-species exhibition), dietary provision, and behavioral management. Completed surveys from 16 zoos enabled analysis of contemporary practice between institutions. Results indicate differences in enclosure size between zoos, and that herd size is unlikely to predict enclosure size. Herd sizes are smaller than wild examples, and enclosure space (per animal) is significantly smaller than a potential wild range. Banteng are frequently maintained successfully in mixed species exhibits alongside a wide range of other taxa. Nutrient analysis focused on fiber and protein, and although provision of these nutrients appears comparable between zoos, more work is needed on browse and forage intake to determine overall diet suitability. Behavior management shows variation between zoos, with numerous collections providing browse but only a minority undertaking training, and not all providing enrichment. The overall diversity in findings between zoos suggest future research areas that should focus on key aspects of behavioral ecology, such as wild foraging behavior, food plant selection and day/night activity patterns, which may help underpin husbandry guidelines and excellent animal welfare. Zoo Biol. 35:546-555, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  14. Enhanced expression of MYF5 and MYOD1 in fibroblast cells via the forced expression of bos taurus MYF5.

    Science.gov (United States)

    Nie, Yong Wei; Ding, Xiang Bin; Ge, Xiu Guo; Fan, Han Lu; Liu, Zhong Wei; Guo, Hong

    2013-09-01

    The formation of vertebrate skeletal muscles widely thought to be under the control of hierarchy of regulatory genes. MYF5 is one of the myogenic determination gene expressed in the developing mouse dermomyotome which control skeletal muscle differentiation. In the current work, we had obtained the cDNA sequence including the full coding region of the bos taurus myogenic factor MYF5 by reverse transcription polymerase chain reaction. Furthermore, we examined whether fibroblast cell derived from mouse and bos taurus can be transduced using plasmid vectors carrying bos taurus MYF5. Bos taurus MYF5 activates MYF5 and MYOD1 expression after 1 day culture. The concerted upregulation of the myogenic regulatory factors enhanced myosin (skeletal fast) expression. These observation show that MYF5 is essential for myogenic differentiation and provides candidates for regulation bos taurus skeletal muscle development. © 2013 International Federation for Cell Biology.

  15. Background Oriented Schlieren (BOS) and other Flow Visualization Developments and Applications at GRC

    Science.gov (United States)

    Clem, Michelle; Woike, Mark

    2013-01-01

    This is a presentation to be given at an internal NASA Advanced Schlieren Working Group Meeting. The presentation will cover the recent developments and applications of flow visualization methods at GRC. The topics being discussed will include the use of Background Oriented Schlieren (BOS) in the study of screech and its associated shock spacing as well as in the investigation of broadband shock noise reduction in the Jet-Surface Interaction Tests. In addition, other flow visualiztion methods will be discussed in an on-going study comparing schlieren, shadowgraph, BOS, and focusing schlieren.

  16. Identification of a null allele in genetic tests for bovine leukocyte adhesion deficiency in Pakistani Bos indicus × Bos taurus cattle.

    Science.gov (United States)

    Nasreen, Fozia; Malik, Naveed A; Qureshi, Javed A; Raadsma, Herman W; Tammen, Imke

    2012-12-01

    Two clinically healthy mature Pakistani Bos indicus × Bos taurus cattle were genotyped as homozygous affected for the lethal immunodeficiency disorder bovine leukocyte adhesion deficiency (BLAD) using previously described PCR-RFLP based DNA tests which was confirmed by sequencing. Sequencing of Bos taurus and B. indicus × B. taurus genomic DNA surrounding the disease causing mutation (c.383A > G) in the ITGB2 gene identified numerous variations in exonic and intronic regions within and between species, including substantial variation in primer annealing sites for three PCR-RFLP tests for one of the B. indicus allelic variants. These variations in the primer annealing sites resulted in a null allele in the DNA tests causing the misdiagnosis of some heterozygous B. taurus × B. indicus cattle to be classified as homozygous affected. New primers were designed and a modified test was developed which simultaneously identified the disease mutation and the Pakistani B. indicus allelic variant associated with the null allele in the previous test. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Next Generation Sequencing of a Bos taurus indicus (Nellore) animal: Genome Assembly and SNP Analysis

    Science.gov (United States)

    A de novo genome assembly of the Bos taurus indicus sub-species is essential to better evaluate the genetic variation underlying the prototypical beef and dairy cattle of tropical and sub-tropical production environments. A linebred Nelore bull (Futuro) was selected for genome sequencing based on v...

  18. Sequence analysis for a de novo genome assembly of Bos indicus (Nelore) cattle

    Science.gov (United States)

    A second draft sequence assembly of the bovine genome based on the sub-species, Bos indicus, is essential to better evaluate the genetic variation underlying the prototypical beef and dairy cattle in tropical and sub-tropical production environments. A linebred bull (Futuro), two generations remove...

  19. Clotting of cow (Bos taurus) and goat milk ( Capra hircus ) using ...

    African Journals Online (AJOL)

    The ease to locally produce kid rennet contrary to that of calve has led us to compare the proteolytic and clotting activities of these two rennets depending on their action on goat (Capra hircus) milk and cow (Bos taurus) milk. The proteolysis was measured by determining the increase of non-protein nitrogen according to the ...

  20. Sarcocystis heydorni, n. sp. (Apicomplexa: Protozoa) with cattle (Bos taurus) and human (Homo sapiens) cycle

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for four species of Sarcocystis, S. cruzi, S. hirsuta, S. hominis, and S. rommeli. Of these four species, mature sarcocysts of S. cruzi are thin-walled (< 1µm) whereas S. hirsuta, S. hominis, and S. rommeli have thick walls (4 µm or more). Here we describe ...

  1. Measurement of the fluctuating temperature field in a heated swirling jet with BOS tomography

    Science.gov (United States)

    Lang, Henning M.; Oberleithner, Kilian; Paschereit, C. Oliver; Sieber, Moritz

    2017-07-01

    This work investigates the potential of background-oriented schlieren tomography (3D-BOS) for the temperature field reconstruction in a non-isothermal swirling jet undergoing vortex breakdown. The evaluation includes a quantitative comparison of the mean and phase-averaged temperature field with thermocouple and fast-response resistance thermometer as well as a qualitative comparison between the temperature field and the flow field obtained from particle image velocimetry (PIV). Compared to other temperature-measuring techniques, 3D-BOS enables non-invasive capturing of the entire three-dimensional temperature field. In contrast to previous 3D-BOS applications, the present investigation makes use of the special character of the flow, which provides a global instability that leads to a rotational symmetry of the jet. Additionally, the rotational motion of the jet is used to obtain a tomographic reconstruction from a single camera. The quality of 3D-BOS results with respect to the physical setup as well as the numerical procedure is analyzed and discussed. Furthermore, a new approach for the treatment of thin occluding objects in the field of view is presented.

  2. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

    NARCIS (Netherlands)

    Kotterman, M.

    1998-01-01

    Outline of this thesis
    In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations,

  3. 3D reconstruction of a compressible flow by synchronized multi-camera BOS

    Science.gov (United States)

    Nicolas, F.; Donjat, D.; Léon, O.; Le Besnerais, G.; Champagnat, F.; Micheli, F.

    2017-05-01

    This paper investigates the application of a 3D density reconstruction from a limited number of background-oriented schlieren (BOS) images as recently proposed in Nicolas et al. (Exp Fluids 57(1):1-21, 2016), to the case of compressible flows, such as underexpanded jets. First, an optimization of a 2D BOS setup is conducted to mitigate the intense local blurs observed in raw BOS images and caused by strong density gradients present in the jets. It is demonstrated that a careful choice of experimental conditions enables one to obtain sharp deviation fields from 2D BOS images. Second, a 3DBOS experimental bench involving 12 synchronized cameras is specifically designed for the present study. It is shown that the 3DBOS method can provide physically consistent 3D reconstructions of instantaneous and mean density fields for various underexpanded jet flows issued into quiescent air. Finally, an analysis of the density structure of a moderately underexpanded jet is conducted through phase-averaging, highlighting the development of a large-scale coherent structure associated with a jet shear layer instability.

  4. Detection of αS2-casein variants in Chinese yak (Bos grunniens) by ...

    Indian Academy of Sciences (India)

    tic yaks live in the plateau of western China (Wiener et al. 2003; Zhang et al. 2008). The composition of yak's milk is higher than that of the cow's milk (Bos taurus) and goat's milk (Capra hircus) (Wiener et al. 2003; Li et al. 2010). Therefore, in recent years researchers showed more interest in yak's milk and its products ...

  5. Impact of Balance Of System (BOS) costs on photovoltaic power systems

    Science.gov (United States)

    Hein, G. F.; Cusick, J. P.; Poley, W. A.

    1978-01-01

    The Department of Energy has developed a program to effect a large reduction in the price of photovoltaic modules, with significant progress already achieved toward the 1986 goal of 50 cents/watt (1975 dollars). Remaining elements of a P/V power system (structure, battery storage, regulation, control, and wiring) are also significant cost items. The costs of these remaining elements are commonly referred to as Balance-of-System (BOS) costs. The BOS costs are less well defined and documented than module costs. The Lewis Research Center (LeRC) in 1976/77 and with two village power experiments that will be installed in 1978. The costs were divided into five categories and analyzed. A regression analysis was performed to determine correlations of BOS Costs per peak watt, with power size for these photovoltaic systems. The statistical relationship may be used for flat-plate, DC systems ranging from 100 to 4,000 peak watts. A survey of suppliers was conducted for comparison with the predicted BOS cost relationship.

  6. Genetic diversity analysis of DRB3.2 in domestic yak ( Bos grunniens )

    African Journals Online (AJOL)

    DRB3 gene has been extensively evaluated as a candidate marker for association with many bovine disease and immunological traits. A hemi-nested polymerase chain reaction-sequencing method was used to investigate the polymorphisms of DRB3.2 gene from 209 individuals in three different domestic yak (Bos ...

  7. Massive screening of copy number population-scale variation in Bos taurus genome.

    Science.gov (United States)

    Cicconardi, Francesco; Chillemi, Giovanni; Tramontano, Anna; Marchitelli, Cinzia; Valentini, Alessio; Ajmone-Marsan, Paolo; Nardone, Alessandro

    2013-02-26

    Copy number variations (CNVs) represent a significant source of genomic structural variation. Their length ranges from approximately one hundred to millions of base pair. Genome-wide screenings have clarified that CNVs are a ubiquitous phenomenon affecting essentially the whole genome. Although Bos taurus is one of the most important domestic animal species worldwide and one of the most studied ruminant models for metabolism, reproduction, and disease, relatively few studies have investigated CNVs in cattle and little is known about how CNVs contribute to normal phenotypic variation and to disease susceptibility in this species, compared to humans and other model organisms. Here we characterize and compare CNV profiles in 2654 animals from five dairy and beef Bos taurus breeds, using the Illumina BovineSNP50 genotyping array (54001 SNP probes). In this study we applied the two most commonly used algorithms for CNV discovery (QuantiSNP and PennCNV) and identified 4830 unique candidate CNVs belonging to 326 regions. These regions overlap with 5789 known genes, 76.7% of which are significantly co-localized with segmental duplications (SD). This large scale screening significantly contributes to the enrichment of the Bos taurus CNV map, demonstrates the ubiquity, great diversity and complexity of this type of genomic variation and sets the basis for testing the influence of CNVs on Bos taurus complex functional and production traits.

  8. Sarcocystis rommeli, n. sp. (Apicomplexa: Sarcocystidae) from cattle (Bos taurus) and its differentiation from Sarcocystis hominis

    Science.gov (United States)

    Cattle (Bos taurus) are intermediate hosts for three named species of Sarcocystis, S. cruzi, S. hirsuta, and S. hominis. Recently, a fourth species was identified and named S. sinensis. However, S. sinensis originally named a species of Sarcocystis in water buffalo (Bubalus bubalis) in China. Based ...

  9. Bos taurus indicus (Nelore) hybrid assembly improvement using PacBio reads

    Science.gov (United States)

    A de novo genome assembly of Bos taurus indicus sub-species, specifically a Nelore bull, has been developed using a multi-platform sequencing strategy. Genome sequence data for assembly (>120 Gb) was produced from Roche FLX454 and Illumina GAIIx platforms using paired-end reads from long (5 and 20 ...

  10. European bison as a refugee species? Evidence from isotopic data on Early Holocene bison and other large herbivores in northern Europe.

    Science.gov (United States)

    Bocherens, Hervé; Hofman-Kamińska, Emilia; Drucker, Dorothée G; Schmölcke, Ulrich; Kowalczyk, Rafał

    2015-01-01

    According to the refugee species concept, increasing replacement of open steppe by forest cover after the last glacial period and human pressure had together forced European bison (Bison bonasus)--the largest extant terrestrial mammal of Europe--into forests as a refuge habitat. The consequent decreased fitness and population density led to the gradual extinction of the species. Understanding the pre-refugee ecology of the species may help its conservation management and ensure its long time survival. In view of this, we investigated the abundance of stable isotopes (δ13C and δ15N) in radiocarbon dated skeletal remains of European bison and other large herbivores--aurochs (Bos primigenius), moose (Alces alces), and reindeer (Rangifer tarandus)--from the Early Holocene of northern Europe to reconstruct their dietary habits and pattern of habitat use in conditions of low human influence. Carbon and nitrogen isotopic compositions in collagen of the ungulate species in northern central Europe during the Early Holocene showed significant differences in the habitat use and the diet of these herbivores. The values of the δ13C and δ15N isotopes reflected the use of open habitats by bison, with their diet intermediate between that of aurochs (grazer) and of moose (browser). Our results show that, despite the partial overlap in carbon and nitrogen isotopic values of some species, Early Holocene large ungulates avoided competition by selection of different habitats or different food sources within similar environments. Although Early Holocene bison and Late Pleistocene steppe bison utilized open habitats, their diets were significantly different, as reflected by their δ15N values. Additional isotopic analyses show that modern populations of European bison utilize much more forested habitats than Early Holocene bison, which supports the refugee status of the species.

  11. European bison as a refugee species? Evidence from isotopic data on Early Holocene bison and other large herbivores in northern Europe.

    Directory of Open Access Journals (Sweden)

    Hervé Bocherens

    Full Text Available According to the refugee species concept, increasing replacement of open steppe by forest cover after the last glacial period and human pressure had together forced European bison (Bison bonasus--the largest extant terrestrial mammal of Europe--into forests as a refuge habitat. The consequent decreased fitness and population density led to the gradual extinction of the species. Understanding the pre-refugee ecology of the species may help its conservation management and ensure its long time survival. In view of this, we investigated the abundance of stable isotopes (δ13C and δ15N in radiocarbon dated skeletal remains of European bison and other large herbivores--aurochs (Bos primigenius, moose (Alces alces, and reindeer (Rangifer tarandus--from the Early Holocene of northern Europe to reconstruct their dietary habits and pattern of habitat use in conditions of low human influence. Carbon and nitrogen isotopic compositions in collagen of the ungulate species in northern central Europe during the Early Holocene showed significant differences in the habitat use and the diet of these herbivores. The values of the δ13C and δ15N isotopes reflected the use of open habitats by bison, with their diet intermediate between that of aurochs (grazer and of moose (browser. Our results show that, despite the partial overlap in carbon and nitrogen isotopic values of some species, Early Holocene large ungulates avoided competition by selection of different habitats or different food sources within similar environments. Although Early Holocene bison and Late Pleistocene steppe bison utilized open habitats, their diets were significantly different, as reflected by their δ15N values. Additional isotopic analyses show that modern populations of European bison utilize much more forested habitats than Early Holocene bison, which supports the refugee status of the species.

  12. EVALUATION OF UVEITIS ACTIVITY USING BOS24 IN PATIENTS WITH BEHСET'S DISEASE

    Directory of Open Access Journals (Sweden)

    T. A. Lisitsyna

    2016-01-01

    Full Text Available Objective: to estimate changes of uveitis activity using BOS24 (Behсet's disease Ocular attack Score 24 during antiinflammatory and immunosuppressive therapy in patients with Behcet's disease (BD.Subjects and methods. 103 (75.6% of the 138 patients with BD fulfilled the 1990 International Study Group for Behсet's Disease (ISGBD criteria had eye lesions; 55 (53.4% of the 103 patients had an exacerbation of uveitis. 55 patients with an exacerbation of uveitis were found to have active inflammation in 94 eyes. The activity of uveitis was monitored during anti-inflammatory and immunosuppressive therapy, by using BOS24 that consists of 6 parameters with maximal possible value 24.Results and discussion. The mean BOS24 for 94 eyes with active uveitis at baseline was 9.33±0.91. The most pronounced inflammatory changes were found in the posterior chamber of the eye, mainly in the area of the peripheral retina, rarely in the area of the fovea and in the optic disc. All the patients with an exacerbation of uveitis received systemic therapy with glucocorticoids, cyclosporine and/or azathioprine. After 8.92±3.47 months of treatment, the mean BOS2 decreased significantly (p < 0.001 to 2.20±1.02. The most substantial positive changes were noted in the anterior chamber of the eye (p = 0.03, vitreous humor (p < 0.01, and peripheral retina (p < 0.001.Conclusion. BOS24 is a reliable tool to quantify uveitis activity in patients with BD and its dynamics during antiinflammatory and immunosuppressive therapy.

  13. Bill E. Kunkle Interdisciplinary Beef Symposium: Temperament and acclimation to human handling influence growth, health, and reproductive responses in Bos taurus and Bos indicus cattle.

    Science.gov (United States)

    Cooke, R F

    2014-12-01

    Temperament in cattle is defined as the fear-related behavioral responses when exposed to human handling. Our group evaluates cattle temperament using 1) chute score on a 1 to 5 scale that increases according to excitable behavior during restraint in a squeeze chute, 2) exit velocity (speed of an animal exiting the squeeze chute), 3) exit score (dividing cattle according to exit velocity into quintiles using a 1 to 5 scale where 1=cattle in the slowest quintile and 5=cattle in the fastest quintile), and 4) temperament score (average of chute and exit scores). Subsequently, cattle are assigned a temperament type of adequate temperament (ADQ; temperament score≤3) or excitable temperament (EXC; temperament score>3). To assess the impacts of temperament on various beef production systems, our group associated these evaluation criteria with productive, reproductive, and health characteristics of Bos taurus and Bos indicus-influenced cattle. As expected, EXC cattle had greater plasma cortisol vs. ADQ cattle during handling, independent of breed type (B. indicus×B. taurus, Ptaurus, Ptaurus, P=0.03; B. indicus, P=0.05). Moreover, B. taurus EXC cows also had decreased calving rate (P=0.04), weaning rate (P=0.09), and kilograms of calf weaned/cow exposed to breeding (P=0.08) vs. ADQ cohorts. In regards to feedlot cattle, B. indicus EXC steers had reduced ADG (P=0.02) and G:F (P=0.03) during a 109-d finishing period compared with ADQ cohorts. Bos taurus EXC cattle had reduced weaning BW (P=0.04), greater acute-phase protein response on feedlot entry (P≤0.05), impaired feedlot receiving ADG (P=0.05), and reduced carcass weight (P=0.07) vs. ADQ cohorts. Acclimating B. indicus×B. taurus or B. taurus heifers to human handling improved temperament (P≤0.02), reduced plasma cortisol (Ptaurus and B. indicus-influenced cattle.

  14. Large-scale in vitro embryo production and pregnancy rates from Bos taurus, Bos indicus, and indicus-taurus dairy cows using sexed sperm.

    Science.gov (United States)

    Pontes, J H F; Silva, K C F; Basso, A C; Rigo, A G; Ferreira, C R; Santos, G M G; Sanches, B V; Porcionato, J P F; Vieira, P H S; Faifer, F S; Sterza, F A M; Schenk, J L; Seneda, M M

    2010-11-01

    Herein we describe a large-scale commercial program for in vitro production of embryos from dairy Bos taurus, Bos indicus, and indicus-taurus donors, using sexed sperm. From 5,407 OPU, we compared the number of recovered oocytes (n = 90,086), viable oocytes (n = 64,826), and embryos produced in vitro from Gir (Bos indicus, n = 617), Holstein (Bos taurus, n = 180), 1/4 Holstein × 3/4 Gir (n = 44), and 1/2 Holstein-Gir (n = 37) crossbred cows, and the pregnancy rate of recipient cows. Viable oocytes were in vitro matured (24 h at 38.8 °C, 5% CO(2) in air) and fertilized by incubating them for 18 to 20 h with frozen-thawed sexed sperm (X-chromosome bearing) from Gir (n = 8) or Holstein (n = 7) sires (2 × 10(6) sperm/dose). Embryos were cultured in similar conditions of temperature and atmosphere as for IVM, with variable intervals of culture (between Days 2 and 5) completed in a portable incubator. All embryos were transferred fresh, after 24 to 72 h of transportation (up to 2,000 km). On average, 16.7 ± 6.3 oocytes (mean ± SEM) were obtained per OPU procedure and 72.0% were considered viable. Total and viable oocytes per OPU procedure were 17.1 ± 4.5 and 12.1 ± 3.9 for Gir cows, 11.4 ± 3.9 and 8.0 ± 2.7 for Holstein cows, 20.4 ± 5.8 and 16.8 ± 5.0 for 1/4 Holstein × 3/4 Gir, and 31.4 ± 5.6 and 24.3 ± 4.7 for 1/2 Holstein-Gir crossbred females (P taurus breeds and demonstrated the efficiency of sexed sperm for in vitro embryo production. Culturing embryos during long distance transportation was successful, with potential for international movement of embryos. Copyright © 2010 Elsevier Inc. All rights reserved.

  15. Recent Status of Banteng (Bos javanicus Conservation in East Java and Its Perspectives on Ecotourism Planning

    Directory of Open Access Journals (Sweden)

    Luchman Hakim

    2015-09-01

    Full Text Available The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threats may be categorized into two factors, socio-economic and ecological factors. Socio-economic problems lead to the increase of habitat disturbance, poaching, and illegal hunting. Ecological aspect was ranging from invasion of exotic plant species, competitors, predators, drought, forest fire and vegetation changes. Lack of habitat management also recognized as an important factor to drive Bos javanicus decline and extinction. Ecotourism in the national park may become one of the significant and effective stimuli to support Banteng conservation.

  16. Genetic variation and differentiation of bison (Bison bison) subspecies and cattle (Bos taurus) breeds and subspecies.

    Science.gov (United States)

    Cronin, Matthew A; MacNeil, Michael D; Vu, Ninh; Leesburg, Vicki; Blackburn, Harvey D; Derr, James N

    2013-01-01

    The genetic relationship of American plains bison (Bison bison bison) and wood bison (Bison bison athabascae) was quantified and compared with that among breeds and subspecies of cattle. Plains bison from 9 herds (N = 136), wood bison from 3 herds (N = 65), taurine cattle (Bos taurus taurus) from 14 breeds (N = 244), and indicine cattle (Bos taurus indicus) from 2 breeds (N = 53) were genotyped for 29 polymorphic microsatellite loci. Bayesian cluster analyses indicate 3 groups, 2 of which are plains bison and 1 of which is wood bison with some admixture, and genetic distances do not show plains bison and wood bison as distinct groups. Differentiation of wood bison and plains bison is also significantly less than that of cattle breeds and subspecies. These and other genetic data and historical interbreeding of bison do not support recognition of extant plains bison and wood bison as phylogenetically distinct subspecies.

  17. A randomised controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation

    Science.gov (United States)

    Corris, Paul A; Ryan, Victoria A; Small, Therese; Lordan, James; Fisher, Andrew J; Meachery, Gerard; Johnson, Gail; Ward, Chris

    2015-01-01

    Background We conducted a placebo-controlled trial of azithromycin therapy in bronchiolitis obliterans syndrome (BOS) post lung transplantation. Methods We compared azithromycin (250 mg alternate days, 12 weeks) with placebo. Primary outcome was FEV1 change at 12 weeks. Results 48 patients were randomised; (25 azithromycin, 23 placebo). It was established, post randomisation that two did not have BOS. 46 patients were analysed as intention to treat (ITT) with 33 ‘Completers’. ITT analysis included placebo patients treated with open-label azithromycin after study withdrawal. Outcome The ITT analysis (n=46, 177 observations) estimated mean difference in FEV1 between treatments (azithromycin minus placebo) was 0.035 L, with a 95% CI of −0.112 L to 0.182 L (p=0.6). Five withdrawals, who were identified at the end of the study as having been randomised to placebo (four with rapid loss in FEV1, one withdrawn consent) had received rescue open-label azithromycin, with improvement in subsequent FEV1 at 12 weeks. Study Completers showed an estimated mean difference in FEV1 between treatment groups (azithromycin minus placebo) of 0.278 L, with 95% CI for the mean difference: 0.170 L to 0.386 L (p=azithromycin group had ≥10% gain in FEV1 from baseline. No patients in the placebo group had ≥10% gain in FEV1 from baseline while on placebo (p=0.002). Seven serious adverse events, three azithromycin, four in the placebo group, were deemed unrelated to study medication. Conclusions Azithromycin therapy improves FEV1 in patients with BOS and appears superior to placebo. This study strengthens evidence for clinical practice of initiating azithromycin therapy in BOS. Trial registration number EU-CTR, 2006-000485-36/GB. PMID:25714615

  18. Recent Status of Banteng (Bos Javanicus) Conservation in East Java and Its Perspectives on Ecotourism Planning

    OpenAIRE

    Hakim, Luchman; Guntoro, Dodit Ari; Waluyo, Joko; Sulastini, Dian; Hartanto, Lugi; Nakagoshi, Nokukazu

    2015-01-01

    The aims of this article are to examine the recent status of Banteng Bos javanicus conservation in East Java, identify the roots of conservation problems and propose the non-consumptive and sustainable uses of Banteng by implementing ecotourism. Recently, Banteng population distributes in Alas Purwo, Meru Betiri, and Baluran National Parks. The population in Alas Purwo and Meru Betiri were relatively stable yearly. Rapid population decrease found in Baluran National Park. The roots of threa...

  19. Genome-Wide Detection and Characterization of Endogenous Retroviruses in Bos taurus ▿

    OpenAIRE

    Garcia-Etxebarria, Koldo; Jugo, Begoña Marina

    2010-01-01

    Endogenous retroviruses (ERVs) are the proviral phase of exogenous retroviruses that become integrated into a host germ line. They can play an important role in the host genome. Bioinformatic tools have been used to detect ERVs in several vertebrates, primarily primates and rodents. Less information is available regarding ERVs in other mammalian groups, and the source of this information is basically experimental. We analyzed the genome of the cow (Bos taurus) using three different methods. A...

  20. Polycyclic aromatic hydrocarbon degradation by the white rot fungus Bjerkandera sp. strain BOS55

    OpenAIRE

    Kotterman, M.

    1998-01-01

    Outline of this thesis
    In this thesis the conditions for optimal PAH oxidation by the white rot fungus Bjerkandera sp. strain BOS55 were evaluated. In Chapter 2, culture conditions like aeration and cosubstrate concentrations, which influenced the oxidation of the PAH compound anthracene and the ligninolytic indicator dye Poly R-478 by the white rot fungus, were studied. Two parameters were identified as the most important P...

  1. Bosreservaat Bos Ter Rijst (Heikruis): basisrapport:situering, standplaats, historiek en onderzoek

    OpenAIRE

    Baeté, Hans; Christiaens, Bart; De Keersmaeker, Luc; Esprit, Marc; Van de Kerckhove, Peter; Vandekerkhove, Kris; Walleyn, Ruben

    2006-01-01

    This report is a reference report linked to the monitoring of forest reserve Bos Ter Rijst in Heikruis/Hautecroix near Edingen/Enghien in central Belgium (bilingual region across a linguistic, regional and provincial frontier). It covers various topics:administrative situation and protective status of the reserveits location, soil characteristics and habitatshistorical ecology of the seignory Ter Rijst/Risoir, Ter Rijst/Risoir Wood and the Strijdhout/Strihoux Forestthe reserve's management hi...

  2. Occurrence of the Rumen Ciliate Oligoisotricha bubali in Domestic Cattle (Bos taurus) †

    Science.gov (United States)

    Dehority, B. A.; Damron, W. S.; McLaren, J. B.

    1983-01-01

    Oligoisotricha bubali, previously observed twice in water buffalo, was detected in rumen contents of domestic cattle (Bos taurus) in two different areas of Tennessee. Concentrations ranged from <1 to 35% of the total protozoa in unweaned calves and up to 72% in older animals in feedlot. In contrast to the other genera of holotrichs, both total numbers and percent composition of O. bubali increased when animals were fed a corn silage-concentrate diet. Images PMID:16346277

  3. Application of background-oriented schlieren (BOS) technique to a laser-induced underwater shock wave

    CERN Document Server

    Yamamoto, Shota; Kameda, Masaharu

    2015-01-01

    We build an ultra-high-speed imaging system based on the background-oriented schlieren (BOS) technique in order to capture a laser-induced underwater shock wave. This BOS technique is able to provide two-dimensional density-gradient field of fluid and requires a simple setup. The imaging system consists of an ultra-high speed video camera, a laser stroboscope, and a patterned background. This system takes images every 0.2 $\\mu$s. Furthermore, since the density change of water disturbed by the shock is exceedingly small, the system has high spatial resolution $\\sim$ 10 $\\mu$m/pixel. Using this BOS system, we examine temporal position of a shock wave. The position agrees well with that measured by conventional shadowgraph, which indicates that the high-speed imaging system can successfully capture the instantaneous position of the underwater shock wave that propagates with the speed of about 1500 m/s. The local density gradient can be determined up to $O$(10$^3$ kg/m$^4$), which is confirmed by the gradient est...

  4. Constructing a comprehensive gene co-expression based interactome in Bos taurus.

    Science.gov (United States)

    Chen, Yan; Liu, Yining; Du, Min; Zhang, Wengang; Xu, Ling; Gao, Xue; Zhang, Lupei; Gao, Huijiang; Xu, Lingyang; Li, Junya; Zhao, Min

    2017-01-01

    Integrating genomic information into cattle breeding is an important approach to exploring genotype-phenotype relationships for complex traits related to diary and meat production. To assist with genomic-based selection, a reference map of interactome is needed to fully understand and identify the functional relevant genes. To this end, we constructed a co-expression analysis of 92 tissues and this represents the systematic exploration of gene-gene relationship in Bos taurus. By using robust WGCNA (Weighted Gene Correlation Network Analysis), we described the gene co-expression network of 5,000 protein-coding genes with majority variations in expression across 92 tissues. Further module identifications found 55 highly organized functional clusters representing diverse cellular activities. To demonstrate the re-use of our interaction for functional genomics analysis, we extracted a sub-network associated with DNA binding genes in Bos taurus. The subnetwork was enriched within regulation of transcription from RNA polymerase II promoter representing central cellular functions. In addition, we identified 28 novel linker genes associated with more than 100 DNA binding genes. Our WGCNA-based co-expression network reconstruction will be a valuable resource for exploring the molecular mechanisms of incompletely characterized proteins and for elucidating larger-scale patterns of functional modulization in the Bos taurus genome.

  5. Nutritive value and meat quality of domestic cattle (Bos taurus, zubron (Bos taurus × Bison bonasus and European bison (Bison bonasus meat

    Directory of Open Access Journals (Sweden)

    Andrzej Łozicki

    2017-10-01

    Full Text Available The objective of the experiment was to study the nutritive value and meat quality aspects of domestic cattle (Bos taurus, zubron (Bos taurus × Bison bonasus and European bison (Bison bonasus meat. The bulls and zubrons were fattened to 600–650 kg of body weight using the same feeding regimen. The European bison meat was from selective shooting of males. The meat was analysed for chemical composition, fatty acid composition, meat quality characteristics and thiobarbituric acid reactive substance (TBARS value. Compared to beef, zubron and European bison meat had a lower content of crude fat, crude ash and a higher moisture content. The meat of the zubrons and European bison showed a lower content of saturated fatty acids and a higher content of polyunsaturated fatty acids compared to beef. The shear force of meat was highest for European bison meat and lowest for beef. Higher a* and b* colour parameters were established in European bison and zubron meat. The highest TBARS value was found in beef.

  6. Comparative proteomic analysis of Taurine, Indicine, and crossbred (Bos taurus × Bos indicus) bull spermatozoa for identification of proteins related to sperm malfunctions and subfertility in crossbred bulls.

    Science.gov (United States)

    Muhammad Aslam, Munchakkal Kather; Kumaresan, Arumugam; Rajak, Shailendra Kumar; Tajmul, Md; Datta, Tirtha Kumar; Mohanty, Tushar Kumar; Srinivasan, Alagiri; Yadav, Savita

    2015-09-01

    Subfertility is one of the most common problems observed among Taurine × Indicine crossbred bulls in tropical countries; however, the etiology remain unknown in most of the cases. In present study, we compared the proteomic profile of spermatozoa from crossbred bulls (Bos taurus × Bos indicus) against their purebred parent lines (Holstein Friesian [Taurine] and Tharparkar [Indicine]) to find out alteration in expressions of proteins, if any. The proteomic profiles of freshly ejaculated spermatozoa from these breeds were compared by two-dimensional difference gel electrophoresis, and differentially expressed proteins were identified through mass spectrometry. It was observed that compared to Holstein Friesian, nine proteins were underexpressed and eight proteins were overexpressed (P < 0.05) in the spermatozoa of crossbred bulls. Similarly, four proteins were overexpressed and four proteins were underexpressed (P < 0.05) in the spermatozoa of crossbred bulls compared to Tharparkar bulls. In concurrent three breed comparison, 14 proteins were found to be differentially expressed (P < 0.05) between these breeds. From the findings of the study, it is apparent that the expression levels of several functionally significant proteins are either upregulated or downregulated in spermatozoa of crossbred bulls, which might be related to high incidence of subfertility in these bulls. Copyright © 2015 Elsevier Inc. All rights reserved.

  7. Monocyte-derived macrophages from Zebu (Bos taurus indicus) are more efficient to control Brucella abortus intracellular survival than macrophages from European cattle (Bos taurus taurus).

    Science.gov (United States)

    Macedo, A A; Costa, E A; Silva, A P C; Paixão, T A; Santos, R L

    2013-02-15

    Brucellosis is one of the most important zoonotic diseases in the world. Considering its strict zoonotic nature, understanding of the pathogenesis and immunity of Brucella spp. in natural animal hosts is essential to prevent human infections. Natural resistance against brucellosis has been demonstrated in cattle, and it is associated with the ability of macrophages to prevent intracellular replication of Brucella abortus. Identification of breeds that are resistant to B. abortus may contribute for controlling and eradicating brucellosis in cattle. This study aimed to compare macrophages from Nelore (Bos taurus indicus) or Holstein (Bos taurus taurus) regarding their resistance to B. abortus infection. Macrophages from Nelore were significantly more efficient in controlling intracellular growth of B. abortus when compared to Holstein macrophages even under intralysosomal iron restricting conditions. Furthermore, Nelore macrophages had higher transcription levels of inducible nitric oxide synthase (iNOS) and TNF-α at 12h post-infection (hpi) and higher levels of IL-12 at 24 hpi when compared to Holstein macrophages. Conversely, Holstein macrophages had higher levels of IL-10 transcripts at 24 hpi. Macrohages from Nelore also generated more nitric oxide (NO) in response to B. abortus infection when compared to Holstein macrophages. In conclusion, cultured Nelore macrophages are more effective in controlling intracellular replication of B. abortus, suggesting that Nelore cattle is likely to have a higher degree of natural resistance to brucellosis than Holstein. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. The effect of season on semen characteristics and freezability in Bos indicus and Bos taurus bulls in the southeastern region of Brazil.

    Science.gov (United States)

    Koivisto, M B; Costa, M T A; Perri, S H V; Vicente, W R R

    2009-08-01

    The objectives of this study were to evaluate the effects of season in southeast of Brazil comparing genotypes on semen characteristics, freezability and peripheral plasma concentrations of testosterone. Ejaculates of five Bos indicus bulls and six Bos taurus bulls were evaluated over a period of 27 months, which was divided into winter (July, August, September), spring (October, November, December), summer (January, February, March) and autumn (April, May, June). Semen was evaluated according to standard procedures for ejaculate volume, sperm concentration, gross-motility, progressive motility and sperm morphology. After preparing and freezing the ejaculates according to commercial procedures, the straws were stored in liquid N(2) until post-thaw evaluation. Ejaculate volume, sperm concentration, gross-motility, progressive sperm motility, vigor and morphological sperm defects were significantly influenced by season and genotype (p taurus bulls characterized by lower values of sperm abnormalities throughout the observation period. The highest values were recorded for abnormal heads followed by cytoplasmatic droplets in B. taurus bulls. The proportion of ejaculates which were eliminated before freezing for reasons of bad quality was lower in the B. indicus bulls. Temporal changes in peripheral plasma testosterone concentrations were higher in B. indicus bulls than in B. taurus bulls not revealing seasonal influences. The results of this study show clear genotype differences regarding semen quality. Freezability of B. taurus semen varies considerably throughout the year, leading to a high proportion of eliminated ejaculates. Collecting semen from B. taurus bulls during the summer in an artificial insemination centre may not be profitable.

  9. Pregnancy rate and birth rate of calves from a large-scale IVF program using reverse-sorted semen in Bos indicus, Bos indicus-taurus, and Bos taurus cattle.

    Science.gov (United States)

    Morotti, F; Sanches, B V; Pontes, J H F; Basso, A C; Siqueira, E R; Lisboa, L A; Seneda, M M

    2014-03-15

    Obtaining sexed sperm from previously frozen doses (reverse-sorted semen [RSS]) provides an important advantage because of the possibility of using the semen of bulls with desired genetic attributes that have died or have become infertile but from whom frozen semen is available. We report the efficiency of RSS on the pregnancy rate and birth rate of calves in a large-scale program using ovum pick-up and in vitro embryo production (IVEP) from Bos indicus, Bos indicus-taurus, and Bos taurus cattle. From 645 ovum pick-up procedures (Holstein, Gir, and Nelore), 9438 viable oocytes were recovered. A dose of frozen semen (Holstein, Nelore, Brahman, Gir, and Braford) was thawed, and the sperm were sex-sorted and cooled for use in IVF. Additionally, IVF with sperm from three Holstein bulls with freeze-thawed, sex-sorted (RSS) or sex-sorted, freeze-thawed (control) was tested. A total of 2729 embryos were produced, exhibiting a mean blastocyst rate of 29%. Heifers and cows selected for adequate body condition, estrus, and health received 2404 embryos, and 60 days later, a 41% average pregnancy rate was observed. A total of 966 calves were born, and 910 were of a predetermined sex, with an average of 94% accuracy in determining the sex. Despite the lower blastocyst rate with freeze-thawed, sex-sorted semen compared with sex-sorted semen, (P 0.05) and sex-sorted efficiency (bull I, 93% vs. 98%; II, 96% vs. 94%; and III, 96% vs. 97% for RSS and control, respectively; P > 0.05) were similar for each of the three bulls regardless of the sperm type used in the IVF. The sexing of previously frozen semen, associated with IVEP, produces viable embryos with a pregnancy rate of up to 40%, and calves of the desired sex are born even if the paternal bull has acquired some infertility, died, or is located a long distance from the sexing laboratory. Furthermore, these data show the feasibility of the process even when used in a large-scale IVEP program. Copyright © 2014 Elsevier Inc. All

  10. Trace element distribution in selected edible tissues of zebu (Bos indicus cattle slaughtered at Jimma, SW Ethiopia.

    Directory of Open Access Journals (Sweden)

    Veronique Dermauw

    Full Text Available The amount of trace elements present in edible bovine tissues is of importance for both animal health and human nutrition. This study presents data on trace element concentrations in semitendinosus and cardiac muscles, livers and kidneys of 60 zebu (Bos indicus bulls, sampled at Jimma, Ethiopia. From 28 of these bulls, blood samples were also obtained. Deficient levels of copper were found in plasma, livers, kidneys and semitendinosus muscles. Suboptimal selenium concentrations were found in plasma and semitendinosus muscles. Semitendinosus muscles contained high iron concentrations. Trace elements were mainly stored in the liver, except for iron and selenium. Cardiac muscles generally contained higher concentrations of trace elements than semitendinous muscles except for zinc. A strong association was found between liver and kidney concentrations of copper, iron, cobalt and molybdenum. Liver storage was well correlated with storage in semitendinosus muscle for selenium and with cardiac muscle for cobalt and selenium. Plasma concentrations of copper, selenium, cobalt were well related with their respective liver concentrations and for cobalt and selenium, also with cardiac muscle concentrations. The data suggest multiple trace element deficiencies in zebu cattle in South-West Ethiopia, with lowered tissue concentrations as a consequence. Based on the comparison of our data with other literature, trace element concentrations in selected edible tissues of Bos indicus seem quite similar to those in Bos taurus. However, tissue threshold values for deficiency in Bos taurus cattle need to be refined and their applicability for Bos indicus cattle needs to be evaluated.

  11. Trace Element Distribution in Selected Edible Tissues of Zebu (Bos indicus) Cattle Slaughtered at Jimma, SW Ethiopia

    Science.gov (United States)

    Dermauw, Veronique; Lopéz Alonso, Marta; Duchateau, Luc; Du Laing, Gijs; Tolosa, Tadele; Dierenfeld, Ellen; Clauss, Marcus; Janssens, Geert Paul Jules

    2014-01-01

    The amount of trace elements present in edible bovine tissues is of importance for both animal health and human nutrition. This study presents data on trace element concentrations in semitendinosus and cardiac muscles, livers and kidneys of 60 zebu (Bos indicus) bulls, sampled at Jimma, Ethiopia. From 28 of these bulls, blood samples were also obtained. Deficient levels of copper were found in plasma, livers, kidneys and semitendinosus muscles. Suboptimal selenium concentrations were found in plasma and semitendinosus muscles. Semitendinosus muscles contained high iron concentrations. Trace elements were mainly stored in the liver, except for iron and selenium. Cardiac muscles generally contained higher concentrations of trace elements than semitendinous muscles except for zinc. A strong association was found between liver and kidney concentrations of copper, iron, cobalt and molybdenum. Liver storage was well correlated with storage in semitendinosus muscle for selenium and with cardiac muscle for cobalt and selenium. Plasma concentrations of copper, selenium, cobalt were well related with their respective liver concentrations and for cobalt and selenium, also with cardiac muscle concentrations. The data suggest multiple trace element deficiencies in zebu cattle in South-West Ethiopia, with lowered tissue concentrations as a consequence. Based on the comparison of our data with other literature, trace element concentrations in selected edible tissues of Bos indicus seem quite similar to those in Bos taurus. However, tissue threshold values for deficiency in Bos taurus cattle need to be refined and their applicability for Bos indicus cattle needs to be evaluated. PMID:24465529

  12. Effect of the g.98535683A>G SNP in the CAST gene on meat traits of Nellore beef cattle (Bos indicus) and their crosses with Bos taurus.

    Science.gov (United States)

    Enriquez-Valencia, Cruz Elena; Pereira, Guilherme Luis; Malheiros, Jessica Moraes; de Vasconcelos Silva, Josineudson Augusto I I; Albuquerque, Lúcia Galvão; de Oliveira, Henrique Nunes; Chardulo, Luis Artur Loyola; Curi, Rogério Abdallah

    2017-01-01

    The objective of this study was to estimate allele frequencies of the g.98535683A>G:BTAU7 SNP in the CAST gene in different genetic groups of beef cattle produced in Brazil (Nellore and their crosses with Bos taurus), and to evaluate associations between this polymorphism and meat traits. Five hundred animals from six different genetic groups were genotyped and phenotyped for shear force (SF), myofibrillar fragmentation index (MFI), rib eye area, backfat thickness, and total lipids. Alleles A and G of the SNP were detected in all genetic groups and the frequency of A was higher than G. Significant association (Ptaurus. Copyright © 2016 Elsevier Ltd. All rights reserved.

  13. Differences in Beef Quality between Angus (Bos taurus taurus and Nellore (Bos taurus indicus Cattle through a Proteomic and Phosphoproteomic Approach.

    Directory of Open Access Journals (Sweden)

    Rafael Torres de Souza Rodrigues

    Full Text Available Proteins are the major constituents of muscle and are key molecules regulating the metabolic changes during conversion of muscle to meat. Brazil is one of the largest exporters of beef and most Brazilian cattle are composed by zebu (Nellore genotype. Bos indicus beef is generally leaner and tougher than Bos taurus such as Angus. The aim of this study was to compare the muscle proteomic and phosphoproteomic profile of Angus and Nellore. Seven animals of each breed previously subjected the same growth management were confined for 84 days. Proteins were extracted from Longissimus lumborum samples collected immediately after slaughter and separated by two-dimensional electrophoresis. Pro-Q Diamond stain was used in phosphoproteomics. Proteins identification was performed using matrix assisted laser desorption/ionization time-of-flight mass spectrometry. Tropomyosin alpha-1 chain, troponin-T, myosin light chain-1 fragment, cytoplasmic malate dehydrogenase, alpha-enolase and 78 kDa glucose-regulated protein were more abundant in Nellore, while myosin light chain 3, prohibitin, mitochondrial stress-70 protein and heat shock 70 kDa protein 6 were more abundant in Angus (P<0.05. Nellore had higher phosphorylation of myosin regulatory light chain-2, alpha actin-1, triosephosphate isomerase and 14-3-3 protein epsilon. However, Angus had greater phosphorylation of phosphoglucomutase-1 and troponin-T (P<0.05. Therefore, proteins involved in contraction and muscle organization, myofilaments expressed in fast or slow-twitch fibers and heat shock proteins localized in mitochondria or sarcoplasmic reticulum and involved in cell flux of calcium and apoptosis might be associated with differences in beef quality between Angus and Nellore. Furthermore, prohibitin appears to be a potential biomarker of intramuscular fat in cattle. Additionally, differences in phosphorylation of myofilaments and glycolytic enzymes could be involved with differences in muscle

  14. Eficácia do tratamento Ovsynch associado à inseminação artificial prefixada em rebanhos Bos taurus e Bos indicus

    Directory of Open Access Journals (Sweden)

    Alvarez Rafael Herrera

    2003-01-01

    Full Text Available O presente trabalho objetivou avaliar a eficácia do tratamento Ovsynch associado à inseminação artificial em tempo prefixado em vacas Bos taurus e Bos indicus. Foram utilizados rebanhos das raças Holandesa, Caracu, Nelore e Mantiqueira. Também foi incluído um rebanho de vacas Gir, com problemas de fertilidade. Cada rebanho foi dividido em três grupos. O grupo 1 recebeu o tratamento Ovsynch e foi inseminado em tempo prefixado. O grupo 2 foi inseminado no cio induzido com cloprostenol. O grupo 3 foi inseminado no cio natural. As taxas de concepção e de prenhez foram determinadas por ultra-sonografia. Não existiu interação significativa das variáveis reprodutivas analisadas para rebanho, idade, período pós-parto, número de parição e presença do bezerro. A taxa de concepção não diferiu (P>0,05 entre os grupos, ao passo que a taxa de prenhez foi superior (P<0,05 nos grupos 1 e 2 em comparação ao grupo 3. No rebanho Gir, o tratamento Ovsynch não alterou a taxa de concepção nem a de prenhez. Independentemente da raça, os tratamentos Ovsynch e cloprostenol não afetam a taxa de concepção, mas melhoram a taxa de prenhez. O tratamento Ovsynch não aumenta a fertilidade de vacas com problemas reprodutivos inespecíficos.

  15. Differences in Beef Quality between Angus (Bos taurus taurus) and Nellore (Bos taurus indicus) Cattle through a Proteomic and Phosphoproteomic Approach.

    Science.gov (United States)

    Rodrigues, Rafael Torres de Souza; Chizzotti, Mario Luiz; Vital, Camilo Elber; Baracat-Pereira, Maria Cristina; Barros, Edvaldo; Busato, Karina Costa; Gomes, Rafael Aparecido; Ladeira, Márcio Machado; Martins, Taiane da Silva

    2017-01-01

    Proteins are the major constituents of muscle and are key molecules regulating the metabolic changes during conversion of muscle to meat. Brazil is one of the largest exporters of beef and most Brazilian cattle are composed by zebu (Nellore) genotype. Bos indicus beef is generally leaner and tougher than Bos taurus such as Angus. The aim of this study was to compare the muscle proteomic and phosphoproteomic profile of Angus and Nellore. Seven animals of each breed previously subjected the same growth management were confined for 84 days. Proteins were extracted from Longissimus lumborum samples collected immediately after slaughter and separated by two-dimensional electrophoresis. Pro-Q Diamond stain was used in phosphoproteomics. Proteins identification was performed using matrix assisted laser desorption/ionization time-of-flight mass spectrometry. Tropomyosin alpha-1 chain, troponin-T, myosin light chain-1 fragment, cytoplasmic malate dehydrogenase, alpha-enolase and 78 kDa glucose-regulated protein were more abundant in Nellore, while myosin light chain 3, prohibitin, mitochondrial stress-70 protein and heat shock 70 kDa protein 6 were more abundant in Angus (P<0.05). Nellore had higher phosphorylation of myosin regulatory light chain-2, alpha actin-1, triosephosphate isomerase and 14-3-3 protein epsilon. However, Angus had greater phosphorylation of phosphoglucomutase-1 and troponin-T (P<0.05). Therefore, proteins involved in contraction and muscle organization, myofilaments expressed in fast or slow-twitch fibers and heat shock proteins localized in mitochondria or sarcoplasmic reticulum and involved in cell flux of calcium and apoptosis might be associated with differences in beef quality between Angus and Nellore. Furthermore, prohibitin appears to be a potential biomarker of intramuscular fat in cattle. Additionally, differences in phosphorylation of myofilaments and glycolytic enzymes could be involved with differences in muscle contraction force

  16. Select Synch and Co-Synch protocols using a CIDR yield similar pregnancy rates after a fixed-time insemination in suckled Bos indicus × Bos taurus cows.

    Science.gov (United States)

    Esterman, Regina D; Alava, Erin N; Austin, Brad R; Hersom, Matthew J; Yelich, Joel V

    2016-03-15

    Primiparous and multiparous suckled Bos indicus × Bos taurus cows were used to compare a Select Synch + controlled internal drug release (CIDR) and timed artificial insemination (AI) protocol (SSC) to a modified CO-Synch + CIDR protocol (COS). Five separate groups of cows were utilized (n = 659) and within a group, cows were allotted to two treatments on the basis of body condition score (BCS) taken 10 days before and days postpartum at CIDR insertion (Day 0). Blood samples were collected on Day -10 and 0 for assessment of circulating concentrations of progesterone to determine estrous cycling status. Cows in both treatments received intramuscular (im) GnRH (100 μg) and a CIDR inserted on Day 0. On Day 7, the SSC treatment had CIDR removed and received im PGF2α (25 mg), whereas COS treatment had CIDR removed and received im PGF2α (25 mg) on Day 7.5. In the SSC treatment, estrus was detected daily at 0700 and 1700 hours for 72 hours after PGF2α administration, and cows were artificially inseminated 8 to 12 hours after a detected estrus. Cows failing to exhibit estrus were subjected to timed-AI and received im GnRH (100 μg) 76 ± 4 hours after PGF2α administration. In the COS treatment, cows received im GnRH (100 μg) and were fixed-time artificially inseminated at 64 ± 4 hours after PGF2α administration. Although group differences (P 0.05) for SSC (49.4%; n = 164 of 332) and COS (47.1%; n = 154 of 327). Estrous cycling status and days postpartum did not (P > 0.05) influence synchronized AI pregnancy rates but BCS did (P taurus cows. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. Cryotolerance and global gene-expression patterns of Bos taurus indicus and Bos taurus taurus in vitro- and in vivo-produced blastocysts.

    Science.gov (United States)

    Sudano, Mateus J; Caixeta, Ester S; Paschoal, Daniela M; Martins, Alicio; Machado, Rui; Buratini, José; Landim-Alvarenga, Fernanda D C

    2014-10-01

    In a 2×2 factorial experimental design, embryo development, cryotolerance and global gene expression of Nellore (Bos taurus indicus) and Simmental (Bos taurus taurus) blastocysts produced in vitro (IVP) and in vivo (multiple ovulation derived embryo, MODE) were assessed. Blastocyst production was higher in Nellore than in Simmental (47.7±2.0% vs 27.0±2.0%) cows. The total numbers of ova or embryos recovered (5.5±0.9 vs 3.7±0.8) and transferable embryos (3.8±1.0 vs 2.3±0.8) per cow were not different between breeds. Simmental and MODE (34.6% and 38.5%, n=75 and 70) blastocysts had higher survival rates after cryopreservation compared with Nellore and IVP (20.2% and 18.1%, n=89 and 94) embryos, respectively. Differences between transcriptomes were addressed by principal-component analysis, which indicated that gene expression was affected by subspecies (158 genes), origin (532 genes) and interaction between both subspecies and origin (53 genes). Several functional processes and pathways relevant to lipid metabolism and embryo viability involving differentially expressed genes were identified. The lipid metabolism-related genes were upregulated in Simmental (AUH and ELOVL6) and IVP (ACSL3 and ACSL6) blastocysts. The expression profiles of genes related to mitochondrial metabolism (ATP5B), oxidative stress (GPX4), apoptosis (DAD1, DAP, PRDX2), heat shock (HSPA5), pregnancy (IFNT2, PAG2) and cell differentiation (KRT18) varied between experimental groups.

  18. Phosphatidylcholine and sphingomyelin profiles vary in Bos taurus indicus and Bos taurus taurus in vitro- and in vivo-produced blastocysts.

    Science.gov (United States)

    Sudano, Mateus J; Santos, Vanessa G; Tata, Alessandra; Ferreira, Christina R; Paschoal, Daniela M; Machado, Rui; Buratini, José; Eberlin, Marcos N; Landim-Alvarenga, Fernanda D C

    2012-06-01

    Lipid droplets, subspecies (Bos taurus indicus vs. Bos taurus taurus), and in vitro culture are known to influence cryopreservation of bovine embryos. Limited information is available regarding differences in membrane lipids in embryo, such as phosphatidylcholines (PC) and sphingomyelins (SM). The objective of the present study was to compare the profiles of several PC and SM species and relate this information to cytoplasmic lipid levels present in Nellore (B. taurus indicus) and Simmental (B. taurus taurus) blastocysts produced in vitro (IVP) or in vivo (ET). Simmental and IVP embryos had more cytoplasmic lipid content than Nellore and ET embryos (n = 30). Blastocysts were submitted to matrix-assisted laser desorption/ionization mass spectrometry. Differences in the PC profile were addressed by principal component analysis. The lipid species with PC (32:1) and PC (34:1) had higher ion abundances in Nellore embryos, whereas PC (34:2) was higher in Simmental embryos. IVP embryos had less abundant ions of PC (32:1), PC (34:2), and PC (36:5) compared to ET embryos. Moreover, ion abundance of PC (32:0) was higher in both Nellore and Simmental IVP embryos compared to ET embryos. Therefore, mass spectrometry profiles of PC and SM species significantly differ with regard to unsaturation level and carbon chain composition in bovine blastocysts due to subspecies and in vitro culture conditions. Because PC abundances of Nellore and Simmental embryos were distinct (34:1 vs. 34:2), as were those of IVP and ET embryos (32:0 vs. 36:5), they are potential markers of postcryopreservation embryonic survival.

  19. Karyotype analysis of mithun (Bos frontalis) and mithun bull x Brahman cow hybrids.

    Science.gov (United States)

    Qu, K-X; He, Z-X; Nie, W-H; Zhang, J-C; Jin, X-D; Yang, G-R; Yuan, X-P; Huang, B-Z; Zhang, Y-P; Zan, L-S

    2012-01-19

    We examined the cytogenetics of mithun (Bos frontalis), a domesticated version of the Asian gaur, and hybrids (F(1) generation) produced by artificial insemination of Brahman cows (Bos indicus) with mithun semen. Reproductive potential was also examined in the F(1) generation and a backcrossed heifer for utilization of heterosis. Metaphase chromosome spreads were examined by conventional staining and fluorescence in situ hybridization hybridized with the entire chromosome 1 of mithun as a specific probe. Chromosome 1 of mithun was found to be equivalent to Bos taurus chromosomes 2 and 28. The karyotype of the female mithun (N = 4) comprised 58 chromosomes, including 54 acrocentric and four large submetacentric chromosomes, without the four acrocentric chromosomes found in the domesticated species B. indicus. However, one of the four female mithuns with a normal mithun phenotype had an abnormal karyotype (2n = 59), indicating introgression from B. taurus or B. indicus. The F(1) karyotypes (N = 6, 3♂3♀) of the mithun bull × Brahman cow cross had 2n = 59, intermediate between their parents; they were consistent heterozygous carriers with a centric fusion involving rob(2;28), as expected. Two pronounced red signals were seen in the mithun karyotypes, three red signals in the mithun × Brahman hybrids, and four red signals in the Brahman cattle, in good agreement with centric fusion of bovine rob(2;28). The female backcross hybrid (N = 1) with 2n = 59 had a similar chromosome configuration to the F(1) karyotypes and had rob(2;28). Such female backcross hybrids normally reproduce; however, the F(1) bulls (N = 3) had not yet generated normal sperm at 24 months.

  20. Analysis of Bos taurus and Sus scrofa X and Y chromosome transcriptome highlights reproductive driver genes.

    Science.gov (United States)

    Khan, Faheem Ahmed; Liu, Hui; Zhou, Hao; Wang, Kai; Qamar, Muhammad Tahir Ul; Pandupuspitasari, Nuruliarizki Shinta; Shujun, Zhang

    2017-08-15

    The biology of sperm, its capability of fertilizing an egg and its role in sex ratio are the major biological questions in reproductive biology. To answer these question we integrated X and Y chromosome transcriptome across different species: Bos taurus and Sus scrofa and identified reproductive driver genes based on Weighted Gene Co-Expression Network Analysis (WGCNA) algorithm. Our strategy resulted in 11007 and 10445 unique genes consisting of 9 and 11 reproductive modules in Bos taurus and Sus scrofa, respectively. The consensus module calculation yields an overall 167 overlapped genes which were mapped to 846 DEGs in Bos taurus to finally get a list of 67 dual feature genes. We develop gene co-expression network of selected 67 genes that consists of 58 nodes (27 down-regulated and 31 up-regulated genes) enriched to 66 GO biological process (BP) including 6 GO annotations related to reproduction and two KEGG pathways. Moreover, we searched significantly related TF (ISRE, AP1FJ, RP58, CREL) and miRNAs (bta-miR-181a, bta-miR-17-5p, bta-miR-146b, bta-miR-146a) which targeted the genes in co-expression network. In addition we performed genetic analysis including phylogenetic, functional domain identification, epigenetic modifications, mutation analysis of the most important reproductive driver genes PRM1, PPP2R2B and PAFAH1B1 and finally performed a protein docking analysis to visualize their therapeutic and gene expression regulation ability.

  1. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

    2016-06-15

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

  2. Banteng (Bos javanicus) embryos and pregnancies produced by interspecies nuclear transfer.

    Science.gov (United States)

    Sansinena, M J; Hylan, D; Hebert, K; Denniston, R S; Godke, R A

    2005-03-01

    The banteng (Bos javanicus), a member of the bovidae family, is currently listed as threatened by the IUCN Red List and it is estimated the total world population is banteng fibroblasts and a total of 103 bovine oocytes were parthenogenically activated as a control (Treatment C). There was no significant difference in fusion rate (68 versus 77%) between Treatments A and B. Of fused couplets, those in Treatment A had greater (P banteng karyoplasts, and was capable of reprogramming the nucleus to achieve blastocyst stage embryos and pregnancies in exotic bovids.

  3. Cryosurvival and pregnancy rates after exposure of IVF-derived Bos indicus embryos to forskolin before vitrification.

    Science.gov (United States)

    Sanches, B V; Marinho, L S R; Filho, B D O; Pontes, J H F; Basso, A C; Meirinhos, M L G; Silva-Santos, K C; Ferreira, C R; Seneda, M M

    2013-09-01

    In vitro-produced (IVP) bovine embryos are more sensitive to cryopreservation than their in vivo counterparts due to their higher lipid concentrations, whereas Bos indicus IVP embryos are even more sensitive than Bos taurus IVP embryos. To examine the effects of a lipolytic agent, before vitrification of Bos indicus IVP embryos, on embryo survival, viability, and pregnancy rates, two experiments were conducted. In experiment 1, Bos indicus (Nelore) embryos were produced from abattoir-derived ovaries and allocated into two groups. In the treatment group, 10 μM of forskolin was added to the in vitro culture medium on Day 5 and incubated for 48 hours. On Day 7 of culture, IVP-expanded blastocysts from both the control (n = 101) and treatment (n = 112) groups were vitrified with ethylene glycol and DMSO via the Cryotop procedure. Although there was no significant difference between the rates of blastocoel reexpansion and hatching of the embryos exposed to forskolin (87.5% and 70.5%, respectively) compared with the control embryos (79.2% and 63.3%, respectively), the numerically superior rates of the embryos exposed to forskolin led to another experiment. In experiment 2, blastocysts produced from the ovum pick up were exposed or not exposed to the lipolytic agent and vitrified as in experiment 1. Embryos treated with forskolin had higher pregnancy rates than the control group (48.8% vs. 18.5%). In view of these results, 1908 Bos indicus embryos were produced from ovum pick up, exposed to the lipolytic agent, and blastocysts were transferred to recipients, and the pregnancy rates of the embryos of various breeds were compared. The mean pregnancy rate obtained was 43.2%. All data were analyzed by chi-square or by binary logistic regression (P ≤ 0.05). In conclusion, treatment with forskolin before vitrification improved cryotolerance of Bos indicus IVP embryos, resulting in good post-transfer pregnancy rates. Copyright © 2013 Elsevier Inc. All rights reserved.

  4. Color stability of Bos indicus bull steaks in modified atmosphere packaging (MAP

    Directory of Open Access Journals (Sweden)

    Priscila Robertina dos Santos

    2016-01-01

    Full Text Available Evaluations of meat quality, including color, influence purchasing decisions and can be affected by type of fresh meat the packaging system.In thisstudy,fresh steaks from Bos indicusbull were packaged in the vacuum (vacuum, 75% O2/25% CO2(HiOx-MAP and 40% CO2/0.4% CO/59.6% N2(CO-MAP. Emphasis is placed on the color and lipid oxidation of bull beef steaks. Results reveal that the steaks stored in CO-MAP and HiOx-MAPexhibited similar or brighter red color than fresh steaks (exposed only to oxygen or vacuum. The red color of the LD bull beef steaks packaged in CO-MAP was more intense than the color of meat stored in HiOx-MAP after the 14thday of storage. Vacuum packing dramatically impaired the color of the LD bull steaks, which were severely discolored (brown after all storage times. Bos indicussteaks of all treatments showed extremely low TBARS values in all storage times. The results suggested that HiOx-MAP or CO-MAP may be utilized to stabilize or improve the red color of fresh steaks from bull of so appreciated by the consumer.

  5. Mis-Assembled “Segmental Duplications” in Two Versions of the Bos taurus Genome

    Science.gov (United States)

    Zimin, Aleksey V.; Kelley, David R.; Roberts, Michael; Marçais, Guillaume; Salzberg, Steven L.; Yorke, James A.

    2012-01-01

    We analyzed the whole genome sequence coverage in two versions of the Bos taurus genome and identified all regions longer than five kilobases (Kbp) that are duplicated within chromosomes with >99% sequence fidelity in both copies. We call these regions High Fidelity Duplications (HFDs). The two assemblies were Btau 4.2, produced by the Human Genome Sequencing Center at Baylor College of Medicine, and UMD Bos taurus 3.1 (UMD 3.1), produced by our group at the University of Maryland. We found that Btau 4.2 has a far greater number of HFDs, 3111 versus only 69 in UMD 3.1. Read coverage analysis shows that 39 million base pairs (Mbp) of sequence in HFDs in Btau 4.2 appear to be a result of a mis-assembly and therefore cannot be qualified as segmental duplications. UMD 3.1 has only 0.41 Mbp of sequence in HFDs that are due to a mis-assembly. PMID:22880081

  6. Isolation and characteristics of the melanocortin 1 receptor gene (MC1R) in the Chinese yakow (Bos grunniens×Bos taurus).

    Science.gov (United States)

    Xi, Dongmei; Wu, Min; Fan, Yueyuan; Huo, Yinqiang; Leng, Jing; Gou, Xiao; Mao, Huaming; Deng, Weidong

    2012-05-01

    The Chinese yakow is the offspring of yak (Bos grunniens) and Yellow cattle (Bos taurus). The melanocortin 1receptor gene (MC1R) plays a crucial role in determining coat colour of mammals. To investigate the relationship of polymorphism of the MC1R with coat colour in the Chinese yakow, the coding sequence (CDS) and the flanking region of MC1R were sequenced from 84 Chinese yakow samples and compared with the sequences of the MC1R from other bovid species. A fragment of 1134 base pair (bp) sequences including the full CDS (954bp) and parts of the 5'- and 3'-untranslated regions (162 and 18bp, respectively) of the Chineseyakow MC1R were obtained. A total of 13 single nucleotide polymorphisms (SNPs) including 4 SNPs (T-129C, A-127C, C-106T, G-1A) in the 5'-untranslated region and 9 SNPs (C201T, T206C, C340A, C375T, T663C, G714C, C870T, G871A and T890C) in the CDS were identified, revealing high genetic variability. Four novel SNPs including T206C, G714C, C870T and T890C, which have not been reported previously in bovid species, were retrieved. Within 9 coding SNPs, C201T, C375T, T663C and C870T were silent mutations, while T206C, C340A, G714C, G871A and T890C were mis-sense mutations, corresponding to amino acid changes p.L69P, p.Q114K, p.K238N, p.A291N and p.I297T, respectively. Amino acid sequences alignment showed a more than 96% similarity with other ruminates. However, three classical bovine MC1R loci the E(D), E(+) and e were not retrieved in the Chinese yakow, indicating other genes or factors could be involved in affecting coat colour in this species. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. The effect of circulating progesterone on magnitude of the GnRH-induced LH surge: Are there any differences between Bos indicus and Bos taurus heifers?

    Science.gov (United States)

    Batista, E O S; Del Valle, T A; Ortolan, M D D V; Rennó, F P; Nogueira, G P; Souza, A H; Baruselli, P S

    2017-12-01

    This study evaluated the effects of differing circulating progesterone (P4) levels on the luteinizing hormone (LH) surge profile following treatment with gonadotropin releasing hormone (GnRH) in B. indicus (Nelore, n = 13) and B. taurus (Holstein, n = 16) heifers. All heifers were synchronized with a hormonal protocol to induce either a Low or High circulating P4 environment at the time of GnRH treatment. Heifers were randomly assigned to a 2 × 2 factorial design composed by two genetic groups (B. indicus and B. taurus) and two levels of circulating P4 concentrations (Low or High). Blood samples were collected every 30 min from -30 to 210 min and at 270 min after GnRH treatment. As expected, mean P4 concentration was greater for cows in the High than in the Low P4 group (P = 0.0008) and in Bos indicus than in Bos taurus heifers (P = 0.06). Despite genetic group, the area under the curve of LH release was greater in the Low-P4 than in High-P4 concentration group (P < 0.0001). Interestingly, it appears that High P4 concentrations had a more pronounced effect on LH peak in B. indicus than in B. taurus heifers, as indicated by the interaction (P = 0.01) between genetic group and P4 levels. In conclusion, circulating P4 concentration have a great impact on the GnRH-induced LH surge of both B. indicus and B. taurus heifers, but it does not explain the much lower LH peak in B. indicus with low circulating P4. Thus, more studies are essential to uncover some of the underlying physiological factors other than circulating P4 that are limiting LH release following a GnRH treatment in B. indicus cattle. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Plasma anti-Müllerian hormone as a predictive endocrine marker to select Bos taurus (Holstein) and Bos indicus (Nelore) calves for in vitro embryo production.

    Science.gov (United States)

    Batista, E O S; Guerreiro, B M; Freitas, B G; Silva, J C B; Vieira, L M; Ferreira, R M; Rezende, R G; Basso, A C; Lopes, R N V R; Rennó, F P; Souza, A H; Baruselli, P S

    2016-01-01

    This study evaluated the association between plasma anti-Müllerian hormone (AMH) concentrations and in vitro embryo production in Bos indicus (Nelore; experiment 1) and Bos taurus (Holstein; experiment 2) calves superstimulated or not with 140 mg of porcine follicle-stimulating hormone (pFSH; 4 decreasing doses twice daily). Oocytes were recovered from calves aged 2 to 4 mo after receiving gonadotropin stimulation (Nelore, n = 15; Holstein, n = 12) or not (Nelore, n = 15; Holstein, n = 12). Cycling heifers formed a positive control group (n = 15 for Nelore [aged 18-24 mo], n = 10 for Holstein [aged 14-16 mo]). All the calves underwent laparoscopic ovum pickup, and cycling heifers underwent a regular transvaginal ultrasound-guided ovum pickup for oocyte recovery. Immediately before oocyte retrieval, blood samples were taken for subsequent AMH determination (ng/mL). Regardless of the genetic group, calves that received pFSH (3.6 ± 1.1 in Nelore and 4.6 ± 1.2 in Holstein) or did not receive pFSH (3.2 ± 1.0 in Nelore and 2.5 ± 0.8 in Holstein) had greater plasma AMH concentrations (P = 0.01 in Nelore and P = 0.003 in Holstein) than cycling heifers (1.1 ± 0.2 in Nelore and 0.6 ± 0.07 in Holstein). AMH concentrations in calves with or without pFSH were similar in both genetic groups (3.6 ± 1.1 vs 3.2 ± 1.0 in Nelore; 4.6 ± 1.2 vs 2.5 ± 0.8 in Holstein). In calves, positive correlations were observed between plasma AMH concentrations and the numbers of follicles >2 mm (r = 0.86, P taurus calves. Therefore, AMH is a promising tool for selecting oocyte donor calves to maximize results during in vitro embryo production. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Chemical compositions, free amino acid contents and antioxidant activities of Hanwoo (Bos taurus coreanae) beef by cut

    Science.gov (United States)

    The objective of this study was to evaluate chemical compositions, free amino acid contents, and antioxidant activities of different cuts of Hanwoo (Bos taurus coreanae) beef. Beef preferences and prices in the Korean market depend on cut. Therefore, comparisons were made between high-preference (gr...

  10. The major cow milk allergen Bos d 5 manipulates T-helper cells depending on its load with siderophore-bound iron.

    Directory of Open Access Journals (Sweden)

    Franziska Roth-Walter

    Full Text Available The mechanisms of allergic sensitization to milk are still elusive. The major allergen Bos d 5 belongs to the lipocalin-family and thus is able to transport numerous ligands. In this study we investigated its ability to bind to iron-siderophore complexes and tested the immune-modulatory properties of Bos d 5 in either forms. Structural and in silico docking analysis of Bos d 5 revealed that Bos d 5 is able to bind to iron via catechol-based flavonoids (quercetin, myricetin, luteolin that act as siderophores as confirmed by spectral-analysis and iron staining. Calculated dissociation constants of docking analyses were below 1 µM by virtual addition of iron. When incubated with human peripheral blood mononuclear cells (PBMCs, only the apo-form of Bos d 5 led to an increase of CD4+positive cells and significantly elevated IL13 and IFNγ-levels. In contrast, holo-Bos d 5 decreased numbers of CD4 expressing cells and induced apoptosis. Taken together, our data give evidence that Bos d 5 is capable of binding iron via siderophores. Moreover, our data support for the first time the notion that the form of application (apo- or holo-form is decisive for the subsequent immune response. The apo-form promotes Th2 cells and inflammation, whereas the holo-form appears to be immunosuppressive.

  11. Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions.

    Science.gov (United States)

    Runyan, Chase A; Downey-Slinker, Erika D; Ridpath, Julia F; Hairgrove, Thomas B; Sawyer, Jason E; Herring, Andy D

    2017-12-12

    Bovine viral diarrhea virus (BVDV) has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers ( n = 366) that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV), killed, (KV) or no vaccine (NON). Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05), and interacted with day ( p gain (ADG) and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104%) and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI ( p < 0.001), and a sire by time period interaction affected ADG ( p = 0.03) and total feed intake ( p = 0.03). This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

  12. Feed Intake and Weight Changes in Bos indicus-Bos taurus Crossbred Steers Following Bovine Viral Diarrhea Virus Type 1b Challenge Under Production Conditions

    Directory of Open Access Journals (Sweden)

    Chase A. Runyan

    2017-12-01

    Full Text Available Bovine viral diarrhea virus (BVDV has major impacts on beef cattle production worldwide, but the understanding of host animal genetic influence on illness is limited. This study evaluated rectal temperature, weight change and feed intake in Bos indicus crossbred steers (n = 366 that were challenged with BVDV Type 1b, and where family lines were stratified across three vaccine treatments of modified live (MLV, killed, (KV or no vaccine (NON. Pyrexia classification based on 40.0 °C threshold following challenge and vaccine treatment were investigated for potential interactions with sire for weight change and feed intake following challenge. Pyrexia classification affected daily feed intake (ADFI, p = 0.05, and interacted with day (p < 0.001 for ADFI. Although low incidence of clinical signs was observed, there were marked reductions in average daily gain (ADG and cumulative feed intake during the first 14 day post-challenge; ADG (CV of 104% and feed efficiency were highly variable in the 14-day period immediately post-challenge as compared to the subsequent 14-day periods. A sire × vaccine strategy interaction affected ADFI (p < 0.001, and a sire by time period interaction affected ADG (p = 0.03 and total feed intake (p = 0.03. This study demonstrates that different coping responses may exist across genetic lines to the same pathogen, and that subclinical BVDV infection has a measurable impact on cattle production measures.

  13. Bos frontalis

    African Journals Online (AJOL)

    Nishant-3

    In exon-3 at 72nd codon, one silent mutation (CCG/CCA) was also identified. This preliminary study of existing gene variants can be used for further association studies, thereby establishing conservation of mithun germplasm. Key words: Leptin gene, mithun, phylogeny, single nucleotide polymorphisms (SNPs).

  14. Bos grunniens

    Indian Academy of Sciences (India)

    trast to the milk of dairy cattle and goat, yak's milk con- tains a higher percentage of protein, organic calcium, and conjugated linoleic acid (Wiener et al. 2003; Li et al. 2010). β-lactoglobulin (β-LG) is an important protein that con- stitutes approximately up to 65% of the total whey pro- tein of bovine milk. β-LG is coded by LGB ...

  15. Bos grunniens

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-06

    Mar 6, 2009 ... Recombinant mouse OB protein: evidence for a peripheral signal linking adiposity and central neural networks. Science, 269: 546-. 549. Chilliard Y, Ferlay A, Mansbridge RM, Doreau M (2000). Ruminant milk fat plasticity: nutritional control of saturated, polyunsaturated, trans and conjugated fatty acids.

  16. Bos sondaicus

    African Journals Online (AJOL)

    SND

    2012-01-26

    Jan 26, 2012 ... To avoid protein precipitation, polymers, buffer, salt and ddW were mixed before adding saliva. The pH of ... Optical density (Abs) at. 600 nm was observed at zero hour of incubation, then the ... Abs of control S. aureus – Abs of treated S. aureus. Inhibition (%) = × 100%. Abs of control S. aureus. RESULTS ...

  17. Evaluation of the 14-d CIDR-PG and 9-d CIDR-PG protocols for synchronization of estrus in Bos indicus-influenced and Bos taurus beef heifers.

    Science.gov (United States)

    Thomas, J M; Locke, J W C; Bishop, B E; Abel, J M; Ellersieck, M R; Yelich, J V; Poock, S E; Smith, M F; Patterson, D J

    2017-04-01

    Two long-term, CIDR-based estrus synchronization protocols were evaluated among Bos indicus-influenced and Bos taurus beef heifers. Treatments were evaluated on the basis of estrous response and pregnancy rate resulting from fixed-time artificial insemination (FTAI), and these outcomes were analyzed retrospectively relative to reproductive tract score (RTS; Scale 1-5) at treatment initiation. Estrus was synchronized for 1139 heifers in three locations, and heifers were assigned to one of two treatments within each location based on RTS. Heifers assigned to the 14-d CIDR-PG protocol received a controlled internal drug release (CIDR) insert (1.38 g progesterone) on Day 0, CIDR removal on Day 14, administration of prostaglandin F2α (PG; 25 mg im) on Day 30, and administration of gonadotropin-releasing hormone (GnRH; 100 μg im) concurrent with FTAI on Day 33, 66 h after PG. Heifers assigned to the 9-d CIDR-PG protocol received administration of PG concurrent with CIDR insertion on Day 5, administration of PG concurrent with CIDR removal on Day 14, administration of PG on Day 30, and administration of GnRH concurrent with FTAI on Day 33, 66 h after PG. Estrus detection aids were applied at CIDR removal on Day 14 and at PG on Day 30 to evaluate estrous response rate. Mean RTS differed (P taurus heifers (72%; 416/574) than among Bos indicus-influenced heifers (27%; 150/565). The proportion of heifers expressing estrus following CIDR removal was greater (P = 0.01) among heifers assigned to the 14-d CIDR-PG treatment (88%; 492/559) compared to the 9-d CIDR-PG treatment (83%; 480/580). Estrous response following CIDR removal was also higher (P taurus (95%; 547/574) compared to Bos indicus-influenced (75%; 425/565) heifers. Rate of estrous response prior to FTAI did not differ significantly based on treatment but was higher (P taurus heifers (60%; 344/574) than among Bos indicus-influenced heifers (45%; 253/565). However, the effect of biological type on estrous

  18. Complete mitochondrial genomes of the tooth of a poached Bornean banteng (Bos javanicus lowi; Cetartiodactyla, Bovidae).

    Science.gov (United States)

    Ishige, Taichiro; Gakuhari, Takashi; Hanzawa, Kei; Kono, Tomohiro; Sunjoto, Indra; Sukor, Jum Rafiah Abdul; Ahmad, Abdul Hamid; Matsubayashi, Hisashi

    2016-07-01

    Here we report the complete mitochondrial genome of the Bornean banteng Bos javanicus lowi (Cetartiodactyla, Bovidae), which was determined using next-generation sequencing. The mitochondrial genome is 16,344 bp in length containing 13 protein-coding genes, 21 tRNAs and 2 rRNAs. It shows the typical pattern of bovine mitochondrial arrangement. Phylogenetic tree analysis of complete mtDNA sequences showed that Bornean banteng is more closely related to gaur than to other banteng subspecies. Divergence dating indicated that Bornean banteng and gaur diverged from their common ancestor approximately 5.03 million years ago. These results suggest that Bornean banteng might be a distinct species in need of conservation.

  19. Cloning of an endangered species (Bos gaurus) using interspecies nuclear transfer.

    Science.gov (United States)

    Lanza, R P; Cibelli, J B; Diaz, F; Moraes, C T; Farin, P W; Farin, C E; Hammer, C J; West, M D; Damiani, P

    2000-01-01

    Approximately 100 species become extinct a day. Despite increasing interest in using cloning to rescue endangered species, successful interspecies nuclear transfer has not been previously described, and only a few reports of in vitro embryo formation exist. Here we show that interspecies nuclear transfer can be used to clone an endangered species with normal karyotypic and phenotypic development through implantation and the late stages of fetal growth. Somatic cells from a gaur bull (Bos gaurus), a large wild ox on the verge of extinction, (Species Survival Plan cloned animals was gaurus in origin. The gaur nuclei were shown to direct normal fetal development, with differentiation into complex tissue and organs, even though the mitochondrial DNA (mtDNA) within all the tissue types evaluated was derived exclusively from the recipient bovine oocytes. These results suggest that somatic cell cloning methods could be used to restore endangered, or even extinct, species and populations.

  20. Fetal calf serum enhances in vitro production of Bos taurus indicus embryos.

    Science.gov (United States)

    Leivas, F G; Brum, D S; Fialho, S S; Saliba, W P; Alvim, M T T; Bernardi, M L; Rubin, M I B; Silva, C A M

    2011-02-01

    The objective of this study was to determine the effect of fetal calf serum (FCS) on the quality of in vitro produced bovine embryos. Cumulus oocyte-complexes (COCs, n = 2 449) recovered by ovum pick-up from Bos taurus indicus donors were randomly assigned to experimental groups. Sperm selected by Percoll gradient was used for in vitro fertilization (insemination = Day 0). In Experiment 1 (n = 1 745 COCs), zygotes were cultured in vitro in Synthetic Oviduct Fluid + 4 mg/mL of bovine serum albumin (BSA), or BSA + 2% FCS (BSA+FCS). In Experiment 2 (n = 704 COCs), the COCs were cultured in SOF + BSA, BSA + 2% FCS, or BSA + 2% FCS on D4 (BSA + FCSD4). In Experiment 1, blastocyst yield (51%) and Quality I blastocysts (41%) at Day 7 were higher (P bovine embryos. Copyright © 2011 Elsevier Inc. All rights reserved.

  1. Aktivitas Manusia dan Distribusi Banteng (Bos Javanicus D’alton 1832 di Taman Nasional Alas Purwo

    Directory of Open Access Journals (Sweden)

    Muhammad Ali Imron

    2013-01-01

    Full Text Available Human Activities and Distribution of Banteng (Bos Javanicus D’alton 1832 in Alas Purwo National Park This study aims to comprehend whether human activities contribute to the presence of banteng (Bos sundaicus d’Alton 1836 in the Alas Purwo National Park (APNP. We laid continuous strip line transects from centre of human activities to the direction of core area of APNP. Three locations were selected: Sadengan grazing area, Giri Salaka Hinduism praying area, and Kutorejo village; representing low to high human disturbance respectively. We collected both direct and indirect presence of banteng as well as human activities within 20 metre strip lines with 10 metre width. Data were compiled each 100 metres and analyzed with means comparison to observe difference among locations. Correlation analyses were used to assess the relation between distance from centre of human activities, human activities and banteng presence. Regression analysis was used when  significant correlations found. Our non parametric test showed that human disturbances are significantly different among sites (Kruskal Wallis Test; df 2 = 6.220, p< 0.05. In similar tendency but different manner, it is showed that the different levels of human disturbance conveyed significant difference in number of banteng’s tracks (Kruskal Wallis Test; df 2 = 18.888, p< 0.05. The distance from centre of human activities is negatively related to number of human tracks (Spearman rho; r2= -0.307 N= 64, p<0.05* and also to number of banteng’s tracks (Spearman rho, r2= -0.728 N= 30, p<0.05**. The regression analysis showed that number of human tracks explained 18.6% of total variation on number of Banteng’s tracks, while distance from centre of human activities explained 59%.

  2. Has the kouprey (Bos sauveli Urbain, 1937) been domesticated in Cambodia?

    Science.gov (United States)

    Hassanin, Alexandre; Ropiquet, Anne; Cornette, Raphaël; Tranier, Michel; Pfeffer, Pierre; Candegabe, Philippe; Lemaire, Michèle

    2006-02-01

    The kouprey (Bos sauveli Urbain, 1937) is a very rare bovid species of Cambodia, which may be extinct in the wild, as no living specimen has been observed for a long time. Here, we describe a complete taxidermy mount, which presents astonishing morphological similarities with the kouprey. The animal was mounted in 1871 at the National Museum of Natural History in Paris, where it was referenced as No. 1871-576. It was deposited at the Natural History Museum of Bourges, France, in 1931, where it is still conserved today. To clarify the taxonomic status of the specimen of Bourges, DNA was extracted from a piece of bone taken on the mandible, and two different fragments of the mitochondrial cytochrome b gene were independently amplified and sequenced. The phylogenetic analyses show that the specimen of Bourges is robustly associated with the holotype of the kouprey, and that both are related to other wild species of Bos found in Indochina, i.e., banteng (B. javanicus) and gaur (B. frontalis). Because of doubts for sexing the animal, we applied a molecular test based on the PCR amplification of a DNA fragment specific to the Y chromosome. The results indicate that the specimen of Bourges is a male. The comparisons with male kouprey previously described in the literature reveal important differences concerning the body size, general coloration and horns. As these differences involve phenotypic traits that are strongly selected in case of domestication, we suggest that the specimen of Bourges was a domestic ox. This implies therefore that the kouprey may have been domesticated in Cambodia, and that several extant local races may be directly related to the kouprey.

  3. Fine mapping of a calving QTL on Bos taurus autosome 18 in Holstein cattle.

    Science.gov (United States)

    Mao, X; Kadri, N K; Thomasen, J R; De Koning, D J; Sahana, G; Guldbrandtsen, B

    2016-06-01

    Decreased calving performance not only directly impacts the economic efficiency of dairy cattle farming but also influences public concern for animal welfare. Previous studies have revealed a QTL on Bos taurus autosome (BTA) 18 that has a large effect on calving traits in Holstein cattle. In this study, fine mapping of this QTL was performed using imputed high-density SNP chip (HD) genotypes followed by imputed next-generation sequencing (NGS) variants. BTA18 was scanned for seven direct calving traits in 6113 bulls with imputed HD genotypes. SNP rs136283363 (BTA18: 57 548 213) was consistently the most significantly associated SNP across all seven traits [e.g. p-value = 2.04 × 10(-59) for birth index (BI)]. To finely map the QTL region and to explore pleiotropic effects, we studied NGS variants within the targeted region (BTA18: 57 321 450-57 625 355) for associations with direct calving traits and with three conformation traits. Significant variants were prioritized, and their biological relevance to the traits was interpreted. Considering their functional relationships with direct calving traits, SIGLEC12, CD33 and CEACAM18 were proposed as candidate genes. In addition, pleiotropic effects of this QTL region on direct calving traits and conformation traits were observed. However, the extent of linkage disequilibrium combined with the lack of complete annotation and potential errors in the Bos taurus genome assembly hampered our efforts to pinpoint the causal mutation. © 2015 Blackwell Verlag GmbH.

  4. Immunogenetic factors driving formation of ultralong VH CDR3 in Bos taurus antibodies.

    Science.gov (United States)

    Deiss, Thaddeus C; Vadnais, Melissa; Wang, Feng; Chen, Patricia L; Torkamani, Ali; Mwangi, Waithaka; Lefranc, Marie-Paule; Criscitiello, Michael F; Smider, Vaughn V

    2017-12-04

    The antibody repertoire of Bos taurus is characterized by a subset of variable heavy (VH) chain regions with ultralong third complementarity determining regions (CDR3) which, compared to other species, can provide a potent response to challenging antigens like HIV env. These unusual CDR3 can range to over seventy highly diverse amino acids in length and form unique β-ribbon 'stalk' and disulfide bonded 'knob' structures, far from the typical antigen binding site. The genetic components and processes for forming these unusual cattle antibody VH CDR3 are not well understood. Here we analyze sequences of Bos taurus antibody VH domains and find that the subset with ultralong CDR3 exclusively uses a single variable gene, IGHV1-7 (VHBUL) rearranged to the longest diversity gene, IGHD8-2. An eight nucleotide duplication at the 3' end of IGHV1-7 encodes a longer V-region producing an extended F β-strand that contributes to the stalk in a rearranged CDR3. A low amino acid variability was observed in CDR1 and CDR2, suggesting that antigen binding for this subset most likely only depends on the CDR3. Importantly a novel, potentially AID mediated, deletional diversification mechanism of the B. taurus VH ultralong CDR3 knob was discovered, in which interior codons of the IGHD8-2 region are removed while maintaining integral structural components of the knob and descending strand of the stalk in place. These deletions serve to further diversify cysteine positions, and thus disulfide bonded loops. Hence, both germline and somatic genetic factors and processes appear to be involved in diversification of this structurally unusual cattle VH ultralong CDR3 repertoire.Cellular and Molecular Immunology advance online publication, 4 December 2017; doi:10.1038/cmi.2017.117.

  5. Efecto de la proporción de genes Bos indicus x Bos taurus sobre peso al destete y edad a primer parto en una población multirracial

    Directory of Open Access Journals (Sweden)

    Hugo O. Toledo Alvarado

    2015-01-01

    Full Text Available Se analizaron 1,289 registros de hembras de primer parto con diversas proporciones de genes Bos indicus y Bos taurus (Charolais, Suizo, Simmental, Holstein Friesian y Salers. Tanto animales puros y cruzados de un hato comercial, ubicado en el municipio de Hueytamalco, Puebla, nacidas entre 1966 a 2006, con el objetivo de estimar la combinación óptima de genes Cebú y la retención de heterosis (RVH sobre las características de peso al destete ajustado a 270 días (PD y edad a primer parto (EPP. A partir de modelos de regresión múltiple se identificó la proporción de Cebú con el mejor comportamiento para las dos características de acuerdo al coeficiente de determinación (R 2 y al estadístico de Mallow (CP. La mejor respuesta para PD se encontró en el rango de 42 a 70 % de genes Bos indicus ; mientras que las menores EPP se establecieron entre 27 al 40 % de proporción Cebú. La retención de heterosis que mostró mayor potencial para PD fue de 76 a 78 % y para EPP de 79 a 92 %. Estos resultados manifiestan la importancia de los efectos no aditivos en ambas características, así como la necesidad de realizar cruzamientos dirigidos.

  6. Hvordan påvirker indvandrernes integration, ressourcer og diaspora deres bosætningspræferencer?

    DEFF Research Database (Denmark)

    Andersen, Hans Skifter

    Etniske minoriteters boligønsker må i vid udstrækning antages, at have de samme årsager, som generelt er fundet i forbindelse med studier af boligvalg i Danmark og andre europæiske lande. Men indvandreres bosætning i Danmark og andre lande afviger så meget fra den indfødte befolknings, at den ikke...

  7. The Brain of the Domestic Bos taurus: Weight, Encephalization and Cerebellar Quotients, and Comparison with Other Domestic and Wild Cetartiodactyla.

    Science.gov (United States)

    Ballarin, Cristina; Povinelli, Michele; Granato, Alberto; Panin, Mattia; Corain, Livio; Peruffo, Antonella; Cozzi, Bruno

    2016-01-01

    The domestic bovine Bos taurus is raised worldwide for meat and milk production, or even for field work. However the functional anatomy of its central nervous system has received limited attention and most of the reported data in textbooks and reviews are derived from single specimens or relatively old literature. Here we report information on the brain of Bos taurus obtained by sampling 158 individuals, 150 of which at local abattoirs and 8 in the dissecting room, these latter subsequently formalin-fixed. Using body weight and fresh brain weight we calculated the Encephalization Quotient (EQ), and Cerebellar Quotient (CQ). Formalin-fixed brains sampled in the necropsy room were used to calculate the absolute and relative weight of the major components of the brain. The data that we obtained indicate that the domestic bovine Bos taurus possesses a large, convoluted brain, with a slightly lower weight than expected for an animal of its mass. Comparisons with other terrestrial and marine members of the order Cetartiodactyla suggested close similarity with other species with the same feeding adaptations, and with representative baleen whales. On the other hand differences with fish-hunting toothed whales suggest separate evolutionary pathways in brain evolution. Comparison with the other large domestic herbivore Equus caballus (belonging to the order Perissodactyla) indicates that Bos taurus underwent heavier selection of bodily traits, which is also possibly reflected in a comparatively lower EQ than in the horse. The data analyzed suggest that the brain of domestic bovine is potentially interesting for comparative neuroscience studies and may represents an alternative model to investigate neurodegeneration processes.

  8. Sperm DNA assays and their relationship to sperm motility and morphology in bulls (Bos Taurus).

    Science.gov (United States)

    Serafini, Rosanna; Romano, Juan E; Varner, Dickson D; Di Palo, Rossella; Love, Charles C

    2015-08-01

    The relationship among sperm DNA assays in bulls with different sperm motility and morphology measures has not been reported. The objectives of the present study were to (1) describe Comet assay measures and examine their repeatability (inter- and intra-assay); (2) compare sperm DNA quality assays (i.e., Sperm Chromatin Structure Assay-SCSA; alkaline and neutral Comet assays and Sperm Bos Halomax assay-SBH) in two groups of bulls selected on either greater and lesser sperm motility and morphology (greater compared with lesser); (3) determine the relationship among DNA assays and sperm motility and morphology values. Inter-assay repeatability was greater for the neutral Comet assay as compared to the alkaline Comet assay. Intra-assay repeatability was greater than inter-assay repeatability for both Comet assays. Comet assay dimension measures and percentage tail DNA were the most repeatable for both Comet assays. Among sperm DNA quality assays, only SCSA measures and neutral Comet assay Ghosts (% Ghosts), head diameter and area, and comet area were different between greater and lesser sperm quality groups (PComet head measures (diameter, area, and intensity) and positively with percentage Ghosts (Psperm morphology and sperm motility. The neutral Comet assay was more appropriate for sperm evaluation than the alkaline Comet assay for distinguishing among groups with different sperm quality. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore Cattle Are Modulators of Growth.

    Directory of Open Access Journals (Sweden)

    Anirene G T Pereira

    Full Text Available Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS, were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1 as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1, IGF2 (insulin like growth factor 2, GH1 (growth hormone 1, IGF1R (insulin like growth factor 1 receptor and GHR (growth hormone receptor, suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

  10. Pleiotropic Genes Affecting Carcass Traits in Bos indicus (Nellore) Cattle Are Modulators of Growth.

    Science.gov (United States)

    G T Pereira, Anirene; Utsunomiya, Yuri T; Milanesi, Marco; Torrecilha, Rafaela B P; Carmo, Adriana S; Neves, Haroldo H R; Carvalheiro, Roberto; Ajmone-Marsan, Paolo; Sonstegard, Tad S; Sölkner, Johann; Contreras-Castillo, Carmen J; Garcia, José F

    2016-01-01

    Two complementary methods, namely Multi-Trait Meta-Analysis and Versatile Gene-Based Test for Genome-wide Association Studies (VEGAS), were used to identify putative pleiotropic genes affecting carcass traits in Bos indicus (Nellore) cattle. The genotypic data comprised over 777,000 single-nucleotide polymorphism markers scored in 995 bulls, and the phenotypic data included deregressed breeding values (dEBV) for weight measurements at birth, weaning and yearling, as well visual scores taken at weaning and yearling for carcass finishing precocity, conformation and muscling. Both analyses pointed to the pleomorphic adenoma gene 1 (PLAG1) as a major pleiotropic gene. VEGAS analysis revealed 224 additional candidates. From these, 57 participated, together with PLAG1, in a network involved in the modulation of the function and expression of IGF1 (insulin like growth factor 1), IGF2 (insulin like growth factor 2), GH1 (growth hormone 1), IGF1R (insulin like growth factor 1 receptor) and GHR (growth hormone receptor), suggesting that those pleiotropic genes operate as satellite regulators of the growth pathway.

  11. Observation of fresh Bos indicus embryos comparing stereoscopic and phase contrast microscopy.

    Science.gov (United States)

    Gutiérrez, M E; Galina, C S; Moreno-Mendoza, N; Alarcón, M A; Godínez, B; Lammoglia, M A

    2014-05-01

    Summary The precision of embryo evaluation using stereoscopic microscopy (SM) and inverted phase contrast microscopy (PCM) was compared in 20 Bos indicus cows superovulated at two different times of the year. In total, 118 embryos were collected and classified according to their developmental stage and quality by two independent evaluators using SM and inverted PCM. Cohen's kappa coefficient was used to determine concordance between SM and PCM observations. A good level of agreement (k = 0.616) was found for quality level, and a moderate one (k = 0.464) for developmental stage, particularly at the morula stage. Using the TUNEL (terminal deoxynucleotidyl transferase dUTP nick-end labelling) technique, concordance level was deemed to be low with the SM (k = 0.169), and poor with the PCM (k = 0.217). Differences in concordance levels were also found between observations made at the two times of year, 78 embryos were evaluated in the rainy season when concordance level was good (k = 0.68), in contrast to the 40 embryos evaluated in the dry season when agreement was found to be poor (k = 0.24). In conclusion, inverted PCM was somewhat more effective for evaluating embryos, particularly at the morula stage. However, considering the high cost of an inverted PCM, the differences observed do not justify its purchase for routine embryo evaluation.

  12. Iberian Odonata distribution: data of the BOS Arthropod Collection (University of Oviedo, Spain)

    Science.gov (United States)

    Torralba-Burrial, Antonio; Ocharan, Francisco J.

    2013-01-01

    Abstract Odonata are represented from the Iberian Peninsula by 79 species. However, there exists a significant gap in accessible knowledge about these species,especially regarding their distribution. This data paper describes the specimen-based Odonata data of the Arthropod Collection of the Department of Biología de Organismos y Sistemas (BOS), University of Oviedo, Spain. The specimens were mainly collected from the Iberian Peninsula (98.63% of the data records), especially the northern region. The earliest specimen deposited in the collection dates back to 1950, while the 1980’s and 2000’s are the best-represented time periods. Between 1950 and 2009, 16, 604 Odonata specimens were deposited and are documented in the dataset. Approximately 20% of the specimens belong to the families Coenagrionidae and Calopterygidae. Specimens include the holotype and paratypes of the Iberian subspecies Calopteryx haemorrhoidalis asturica Ocharan, 1983 and Sympetrum vulgatum ibericum Ocharan, 1985. The complete dataset is also provided in Darwin Core Archive format. PMID:23794917

  13. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki: A preliminary study

    Directory of Open Access Journals (Sweden)

    M.S. Khairiah

    2012-10-01

    Full Text Available The Malayan gaur (Bos gaurus hubbacki or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN. The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM and electroejaculation (EEJ technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur.

  14. DGAT1 and ABCG2 polymorphism in Indian cattle (Bos indicus and buffalo (Bubalus bubalis breeds

    Directory of Open Access Journals (Sweden)

    Mishra Bina

    2006-11-01

    Full Text Available Abstract Background Indian cattle (Bos indicus and riverine buffalo (Bubalus bubalis give a poor yield of milk but it has a high fat and protein percentage compared to taurine cattle. The identification of QTLs (Quantitative Trait Loci on BTA14 and BTA6 and its subsequent fine mapping has led to identification of two non conservative mutations affecting milk production and composition. Our objective was to estimate the frequency of K232A (DGAT1 – diacylglycerol – acyltransferase 1 and Y581S (ABCG2 – ATP binding cassette sub family G member 2 polymorphisms in diverse cattle and buffalo breeds of India having large variation in terms of milk production. Results We screened the reported missense mutations in six cattle and five buffalo breeds. The DGAT1K and ABCG2Y alleles were found to be fixed in Indian cattle and buffalo breeds studied. Conclusion This study provides an indirect evidence that all the Indian cattle and buffalo breeds have fixed alleles with respect to DGAT1 and ABCG2 genes reported to be responsible for higher milk fat yield, higher fat and protein percent.

  15. Foot-and-mouth disease virus carrier status in Bos grunniens yaks

    Science.gov (United States)

    2013-01-01

    Background The carrier status of foot-and-mouth disease virus (FMDV) is complicated, and the role of carrier animals in virus transmission is controversial. To investigate the carrier status of FMDV in animals that live in high altitude, Bos grunniens yaks were infected experimentally with FMDV O/Akesu/58. Results All of the yaks showed clinical signs of foot-and-mouth disease (FMD). Total antibody levels against FMDV measured by liquid-phase blocking enzyme-linked immunosorbent assay (LPB-ELISA) and antibody levels against nonstructural proteins (NSP) showed dynamic changes. Three of the five yaks were indentified as carrier animals by RT-PCR method, and the OP fluids from carrier yaks can cause cytopathic effect (CPE) on BHK-21 cells. At last, five persistent infection strains were isolated. Nucleotide mutations of VP1 gene were analyzed. Conclusions After infected with FMDV, all of the yaks showed typical clinical signs. Yaks can keep carrier status for at least 8 months. Total antibody levels against FMDV measured by LPB-ELISA and antibody levels against NSP were at high level for carrier yaks. Sequence alignment of the five isolated strains showed obvious gene and protein mutations. PMID:23497369

  16. In vivo Efficacy of Vernonia amygdalina (Compositae Against Natural Helminth Infection in Bunaji (Bos indicus Calves

    Directory of Open Access Journals (Sweden)

    C. B. I. Alawa ab*, A. M. Adamu, J. O. Gefub, O. J. Ajanusic, P. A. Abdud and N. P. Chiezeyb

    2010-10-01

    Full Text Available Fifteen Bunaji calves (Bos indicus averaging 105±12.5 Kg liveweight and approximately nine months of age with natural helminth infection were distributed into three treatment groups of five animals each. Animals were either treated orally with aqueous extract of Vernonia amygdalina at a dose concentration of 1.1g/Kg body weight, a conventional anthelmintic or left untreated. V. amygdalina treatment produced 59.5% reduction in eggs per gram (EPG of faeces which was significantly different (P<0.001 from the untreated control (-17.24%, whereas levamisol hydrochloride treatment produced 100% reduction in EPG. A total of six genera of helminths were recovered from the gastrointestinal tracts and liver of experimental animals. These were Haemonchus contortus, Trichostrongylus spp, Bunostomum spp, Oesophagostomum spp, Fasciola spp and Dicrocoelium spp. There was significant difference (P<0.001 in worm load between the different treatment groups. Except for Haemonchus spp, animals in the untreated group had significantly (P<0.001 higher worm load for all the genera of helminth recovered than those of the V. amygdalina treated group, indicating that V. amygdalina had no effect on Haemonchus contortus.

  17. Seasonality of Oxygen isotope composition in cow (Bos taurus) hair and its model interpretation

    Science.gov (United States)

    Chen, Guo; Schnyder, Hans; Auerswald, Karl

    2017-04-01

    Oxygen isotopes in animal and human tissues are expected to be good recorders of geographical origin and migration histories based on the isotopic relationship between hair oxygen and annual precipitation and the well-known spatial pattern of oxygen isotope composition in meteoric water. However, seasonal variation of oxygen isotope composition may diminish the origin information in the tissues. Here the seasonality of oxygen isotope composition in tail hair was investigated in a domestic suckler cow (Bos taurus) that underwent different ambient conditions, physiological states, and keeping and feeding strategies during five years. A detailed mechanistic model involving in ambient conditions, soil properties and animal physiology was built to explain this variation. The measured oxygen isotope composition in hair was significantly related (panalysis. Modelling suggested that this relation was only partly derived from the direct influence of feed moisture. Ambient conditions (temperature, moisture) did not only influence the isotopic signal of precipitation but also affected the animal itself (drinking water demand, transcutaneous vapor etc.). The clear temporal variation thus resulted from complex interactions with multiple influences. The twofold influence of ambient conditions via the feed and via the animal itself is advantageous for tracing the geographic origin because the oxygen isotope composition is then less influenced by variations in moisture uptake; however, it is unfavorable for indicating the production system, e.g. to distinguish between milk produced from fresh grass or from silage.

  18. Harvestmen of the BOS Arthropod Collection of the University of Oviedo (Spain) (Arachnida, Opiliones)

    Science.gov (United States)

    Merino-Sáinz, Izaskun; Anadón, Araceli; Torralba-Burrial, Antonio

    2013-01-01

    Abstract There are significant gaps in accessible knowledge about the distribution and phenology of Iberian harvestmen (Arachnida: Opiliones). Harvestmen accessible datasets in Iberian Peninsula are unknown, an only two other datasets available in GBIF are composed exclusively of harvestmen records. Moreover, only a few harvestmen data from Iberian Peninsula are available in GBIF network (or in any network that allows public retrieval or use these data). This paper describes the data associated with the Opiliones kept in the BOS Arthropod Collection of the University of Oviedo, Spain (hosted in the Department of Biología de Organismos y Sistemas), filling some of those gaps. The specimens were mainly collected from the northern third of the Iberian Peninsula. The earliest specimen deposited in the collection, dating back to the early 20th century, belongs to the P. Franganillo Collection. The dataset documents the collection of 16,455 specimens, preserved in 3,772 vials. Approximately 38% of the specimens belong to the family Sclerosomatidae, and 26% to Phalangidae; six other families with fewer specimens are also included. Data quality control was incorporated at several steps of digitisation process to facilitate reuse and improve accuracy. The complete dataset is also provided in Darwin Core Archive format, allowing public retrieval, use and combination with other biological, biodiversity of geographical variables datasets. PMID:24146596

  19. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinheiro Araldi

    2015-01-01

    Full Text Available Bovine papillomavirus (BPV is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1 E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA and comet assay (CA. Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control. Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  20. Mutagenic Potential ofBos taurus Papillomavirus Type 1 E6 Recombinant Protein: First Description.

    Science.gov (United States)

    Araldi, Rodrigo Pinheiro; Mazzuchelli-de-Souza, Jacqueline; Modolo, Diego Grando; de Souza, Edislane Barreiros; de Melo, Thatiana Corrêa; Spadacci-Morena, Diva Denelle; Magnelli, Roberta Fiusa; de Carvalho, Márcio Augusto Caldas Rocha; de Sá Júnior, Paulo Luis; de Carvalho, Rodrigo Franco; Beçak, Willy; Stocco, Rita de Cassia

    2015-01-01

    Bovine papillomavirus (BPV) is considered a useful model to study HPV oncogenic process. BPV interacts with the host chromatin, resulting in DNA damage, which is attributed to E5, E6, and E7 viral oncoproteins activity. However, the oncogenic mechanisms of BPV E6 oncoprotein per se remain unknown. This study aimed to evaluate the mutagenic potential of Bos taurus papillomavirus type 1 (BPV-1) E6 recombinant oncoprotein by the cytokinesis-block micronucleus assay (CBMNA) and comet assay (CA). Peripheral blood samples of five calves were collected. Samples were subjected to molecular diagnosis, which did not reveal presence of BPV sequences. Samples were treated with 1 μg/mL of BPV-1 E6 oncoprotein and 50 μg/mL of cyclophosphamide (positive control). Negative controls were not submitted to any treatment. The samples were submitted to the CBMNA and CA. The results showed that BPV E6 oncoprotein induces clastogenesis per se, which is indicative of genomic instability. These results allowed better understanding the mechanism of cancer promotion associated with the BPV E6 oncoprotein and revealed that this oncoprotein can induce carcinogenesis per se. E6 recombinant oncoprotein has been suggested as a possible vaccine candidate. Results pointed out that BPV E6 recombinant oncoprotein modifications are required to use it as vaccine.

  1. Assessment of Ruminal Bacterial and Archaeal Community Structure in Yak (Bos grunniens).

    Science.gov (United States)

    Zhou, Zhenming; Fang, Lei; Meng, Qingxiang; Li, Shengli; Chai, Shatuo; Liu, Shujie; Schonewille, Jan Thomas

    2017-01-01

    The aim of this study was to determine the microbial community composition in the rumen of yaks under different feeding regimes. Microbial communities were assessed by sequencing bacterial and archaeal 16S ribosomal RNA gene fragments obtained from yaks (Bos grunniens) from Qinghai-Tibetan Plateau, China. Samples were obtained from 14 animals allocated to either pasture grazing (Graze), a grazing and supplementary feeding regime (GSF), or an indoor feeding regime (Feed). The predominant bacterial phyla across feeding regimes were Bacteroidetes (51.06%) and Firmicutes (32.73%). At genus level, 25 genera were shared across all samples. The relative abundance of Prevotella in the graze and GSF regime group were significantly higher than that in the feed regime group. Meanwhile, the relative abundance of Ruminococcus was lower in the graze group than the feed and GSF regime groups. The most abundant archaeal phylum was Euryarchaeota, which accounted for 99.67% of the sequences. Ten genera were detected across feeding regimes, seven genera were shared by all samples, and the most abundant was genus Methanobrevibacter (91.60%). The relative abundance of the most detected genera were similar across feeding regime groups. Our results suggest that the ruminal bacterial community structure differs across yak feeding regimes while the archaeal community structures are largely similar.

  2. Collection, analysis and cryopreservation of semen from Malayan gaur (Bos gaurus hubbacki): A preliminary study

    Science.gov (United States)

    Iswadi, M.I.; Ann, Z.F.; Hafiz, M.M.; Hafiz, M.D.; Fahrul, F.J.; Hajarian, H.; Wahid, H.; Zawawi, I.; Khairiah, M.S.; Mazni, O.A.

    2012-01-01

    The Malayan gaur (Bos gaurus hubbacki) or Seladang is classified as vulnerable by the International Union for Conservation of Nature and Natural Resources (IUCN). The Malayan gaur is mainly distributed in the tropical woodlands of Peninsular Malaysia and Southern Thailand. The aim of this study was to collect, analyze and cryopreserve the semen of wild Malayan gaur. Transrectal massage (TM) and electroejaculation (EEJ) technique was applied in semen collection of the Malayan gaur. The semen was then cryopreserved in liquid nitrogen using slow freezing technique. Makler counting chamber was used to evaluate sperm concentration and motility, while the sperm viability and morphology of fresh and post-thaw sperm was determined using eosin-nigrosin staining protocol. As a result, we have successfully collected the Malayan gaur semen using EEJ technique. Sperm motility, viability and morphological changes of the post-thaw semen of Malayan gaur were found undesirable due to the complication of the cryopreservation process. On the basis of current study it can be concluded that Malayan gaur bulls semen can be obtain by EEJ with no evidence of rectal trauma. Optimization of the process of cryopreservation for Malayan gaur sperm is needed to maintain the cryoviability of the good sperm quality. The data generated in this study would be useful in conservation of genetic diversity program for Malayan gaur. PMID:26623302

  3. A whole-genome assembly of the domestic cow, Bos taurus

    Science.gov (United States)

    Zimin, Aleksey V; Delcher, Arthur L; Florea, Liliana; Kelley, David R; Schatz, Michael C; Puiu, Daniela; Hanrahan, Finnian; Pertea, Geo; Van Tassell, Curtis P; Sonstegard, Tad S; Marçais, Guillaume; Roberts, Michael; Subramanian, Poorani; Yorke, James A; Salzberg, Steven L

    2009-01-01

    Background The genome of the domestic cow, Bos taurus, was sequenced using a mixture of hierarchical and whole-genome shotgun sequencing methods. Results We have assembled the 35 million sequence reads and applied a variety of assembly improvement techniques, creating an assembly of 2.86 billion base pairs that has multiple improvements over previous assemblies: it is more complete, covering more of the genome; thousands of gaps have been closed; many erroneous inversions, deletions, and translocations have been corrected; and thousands of single-nucleotide errors have been corrected. Our evaluation using independent metrics demonstrates that the resulting assembly is substantially more accurate and complete than alternative versions. Conclusions By using independent mapping data and conserved synteny between the cow and human genomes, we were able to construct an assembly with excellent large-scale contiguity in which a large majority (approximately 91%) of the genome has been placed onto the 30 B. taurus chromosomes. We constructed a new cow-human synteny map that expands upon previous maps. We also identified for the first time a portion of the B. taurus Y chromosome. PMID:19393038

  4. The Reference Intervals of Hair Trace Element Content in Hereford Cows and Heifers (Bos taurus).

    Science.gov (United States)

    Miroshnikov, Sergey A; Zavyalov, Oleg A; Frolov, Alexey N; Bolodurina, Irina P; Kalashnikov, Valery V; Grabeklis, Andrei R; Tinkov, Alexey A; Skalny, Anatoly V

    2017-11-01

    The objective of the present study was to assess hair trace element content in Hereford heifers and cows (Bos taurus) living in South Ural region and calculate the site-specific reference intervals. Hair trace element content in 150 cows and heifers farmed in the Southern Urals of Russia was assessed using inductively coupled plasma mass-spectrometry. Dietary trace element content corresponded to the adequate values as estimated by recommendations of USSR State Agriculture Committee and U.S. National Research Council. Comparative analysis demonstrated that heifers are characterized by significantly higher hair Se (3-fold), Hg (4-fold), and Sn (46%) content, whereas cows had significantly higher levels of hair Co (56%), I (33%), Si (2-fold), V (27%), B (55%), Cd (19%), Pb (47%), and Sr (23%). At the same time, no significant group difference in hair Cr, Cu, Fe, Li, Mn, Zn, As, and Ni was detected between Hereford cows and heifers. The reference intervals and 90% confidence intervals for the lower and upper limits were calculated in agreement with the American Society for Veterinary Clinical Pathology Quality Assurance and Laboratory Standard Guidelines.

  5. Distribution and extinction of ungulates during the Holocene of the southern Levant.

    Directory of Open Access Journals (Sweden)

    Ella Tsahar

    Full Text Available BACKGROUND: The southern Levant (Israel, Palestinian Authority and Jordan has been continuously and extensively populated by succeeding phases of human cultures for the past 15,000 years. The long human impact on the ancient landscape has had great ecological consequences, and has caused continuous and accelerating damage to the natural environment. The rich zooarchaeological data gathered at the area provide a unique opportunity to reconstruct spatial and temporal changes in wild species distribution, and correlate them with human demographic changes. METHODOLOGY: Zoo-archaeological data (382 animal bone assemblages from 190 archaeological sites from various time periods, habitats and landscapes were compared. The bone assemblages were sorted into 12 major cultural periods. Distribution maps showing the presence of each ungulate species were established for each period. CONCLUSIONS: The first major ungulate extinction occurred during the local Iron Age (1,200-586 BCE, a period characterized by significant human population growth. During that time the last of the largest wild ungulates, the hartebeest (Alcelaphus buselaphus, aurochs (Bos primigenius and the hippopotamus (Hippopotamus amphibius became extinct, followed by a shrinking distribution of forest-dwelling cervids. A second major wave of extinction occurred only in the 19th and 20th centuries CE. Furthermore, a negative relationship was found between the average body mass of ungulate species that became extinct during the Holocene and their extinction date. It is thus very likely that the intensified human activity through habitat destruction and uncontrolled hunting were responsible for the two major waves of ungulate extinction in the southern Levant during the late Holocene.

  6. Effects of sexed semen and interactive effects on commercial in vitro embryo production when oocytes are collected from cows of Bos indicus, and Bos taurus breeding and crossbred cows of these subspecies.

    Science.gov (United States)

    Lopez, William Omar Contreras; Alvis-Miranda, Hernando Raphael; Gamarra, Andres Felipe; Rendon, Bibiana; Borda, Diego Armando Vega; Albicker, Ulrich; Fonoff, Erich Talamoni; Martinez-Diaz, Mario

    2015-05-01

    A large scale commercial in vitro embryo production and in vitro fertilization record is reported when there was use of oocytes from Bos taurus (BT), Bos indicus (BI), and Bos Taurus/indicus (BT/BI) crossbred subspecies fertilized with sexed (SS) and conventional (CS) semen. The aim of the study was to analyze the impacts of use SS in a commercial embryo production center in Colombia. Non-pregnant (n=800), healthy, and estrous cycling BT, BI, and BI/BT crossbred cows were selected to be used as oocyte donors. Viable oocytes from 733 ovum pick up sessions in cows of the BT (4663) and BI (7305), BT/BI (3605) groups were matured and fertilized with frozen thawed semen from commercial sires. Of all cultured oocytes (n=15,573), 52.3% of the embryos (n=8607) underwent cleavage while 3062 (19.7%) developed to the blastocyst stage. For cows of the BT, SS and CS groups, there were similar cleavage rates; however, use of SS decreased blastocyst formation (15.6% versus 18.9%). In the BI group, use of SS increased cleavage rates (59.1% versus 53%, respectively) although there was no effect on blastocyst rate development (22.9% versus 21.9). In the BI/BT groups, use of SS decreased cleavage (44.4% versus 57.1%, respectively) and blastocyst rate development compared with the CS group (15.3% versus 20.1%, respectively). Data from this study indicate embryos from cows of the BT purebred or BI/BT crossbred had less in vitro developmental capacity compared to embryos derived from oocytes of cows that were purebred BI in tropical-subtropical regions. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Haemoglobin, serum albumin and transferrin variants of Bali (Banteng) cattle, Bos (Bibos) javanicus.

    Science.gov (United States)

    Bell, K; McKenzie, H A; Shaw, D C

    1990-01-01

    1. Individual blood samples from 144 Bali (Banteng) cattle [Bos (Bibos) javanicus] in the Northern Territory of Australia and from 61 Bali cross cattle, were examined by zone electrophoresis to determine the variants of haemoglobin, serum albumin and transferrin that are present. 2. Of the common cattle haemoglobin variants (A and B) only variant B occurs in the Bali cattle samples. A second variant, designated CBali, occurs in Bali cattle either as the heterozygote (B CBali) or as the homozygote, the frequencies of occurrence indicating a two-allele system of inheritance without dominance. The CBali cross samples may exhibit the homozygous or heterozygous A variant. 3. The CBali variant has an electrophoretic mobility intermediate between those of the A and B variants at pH 8.6 and 9.1 but closer to B than to A (B greater than C greater than A). It appears to be similar in mobility to the C variants found in Indian Khillan (CKhillan) by Naik, Sukumaran and Sanghvi (Anim. Prodn, 1965 I, 275-277), and in Asian cattle by Oishi, Abe and Namikama (Immunogenet. Lett., 1968 5, 170-173) and Abe, Mogi, Oishi, Tanaka and Suzuki (Proc. XIIth Europ. Conf. Anim. Blood Groups Biochem. Polymorphisms 1972, pp. 225-228), but appreciably different from those in Kenyan and Rhodesian cattle (CRhodesia) found by Braend (Anim. Blood Grps Biochem. Genet., 1971 2, 15-21) and Carr (Rhod. J. agric. Res., 1964 3, 62-62A), respectively. It is also different in mobility from the C variant found by Winter, Mayr, Schleger, Dworak, Krutzler and Burger (Res. vet. Sci., 1984 36, 276-283) in the mithun.(ABSTRACT TRUNCATED AT 250 WORDS)

  8. Distribution patterns of muscle fibre types in major muscles of the bull (Bos taurus).

    Science.gov (United States)

    Totland, G K; Kryvi, H

    1991-01-01

    The study describes the variations in distribution and cross-sectional area (fibre size) of three muscle fibre types (I, IIA, IIB) in 34 of the largest muscles of the bull (Bos taurus). The animals had been kept strictly unexercised for one year before slaughter. Representative sampling was done at 15 positions within each muscle, and from 2700 to 4500 fibres were analysed in each muscle. Different intermuscular patterns are described. The overall volume fraction (%) of type I fibres was about 10% higher in the forepart muscles than in the hindpart muscles (41% and 31%, respectively), while the mean content of type IIB fibres was similar. Type I fibres were particularly abundant in antigravity muscles. Of these, the hindlimb muscles contained 50% more type I fibres (by weight) than those of the forelimb. Typical antigravity antagonists contained very few type I fibres. In the thigh cross-section the proportion of type I fibres was highest in the anterior and medial parts, while the IIB fibres tended to be concentrated in the superficial and posterior parts. Intramuscular patterns were revealed, with type I fibres becoming gradually more abundant from superficial to deep regions, while IIB fibres had an opposite distribution. This was particularly evident in the thigh proper and in the scapular region. Within each fasciculus of all the muscles, the muscle fibre types formed a general spatial pattern. Type I fibres in the muscles of the forepart were on average about 15% larger than those of the muscles in the hindpart. The IIB fibres were on average about 10% larger in the hindpart than in the forepart muscles. A covariation between the proportion of type I and IIB fibres and their cross-sectional area was indicated.

  9. Evaluation of foot and mouth vaccination for yak (Bos grunniens) in Pakistan.

    Science.gov (United States)

    Mortenson, J A; Khan, E H Haq; Ali, I; Manzoor, S; Jamil, A; Abubakar, M; Afzal, M; Hussain, M

    2017-04-01

    In northern Pakistan, many farming communities rely on domestic yak (Bos grunniens) as a principle source of income. A 2006 participatory disease surveillance report from this region indicated that foot-and-mouth disease (FMD) is the most prevalent annual disease of yak. Our objectives of this study were to determine exposure levels of yak to FMD virus; implement a vaccination program based on current, regional FMD virus serotypes and subtypes; and quantify immune responses following vaccination. Blood samples were used to determine pre-vaccination exposure of animals to FMD virus by antibody presence to non-structural proteins of FMD virus using a 3-ABC trapping indirect ELISA. Vaccine used consisted of FMD serotypes 'O' (PanAsia-2), 'A' (Iran-05), and 'Asia-1' (Shamir), but changed later during the study to match newly circulating viruses in the country ('O'-PanAsia-2; 'A'-Turk-06 and Asia-1-Sindh-08). Three hundred sixty-three blood samples were tested from selected villages to determine pre-vaccination FMD virus exposure in yak with an average of 37.7%. Immune responses from initial vaccination and booster dose 30 days later showed clear protective levels (as mean percent inhibition) of antibodies against structural proteins of serotypes 'O,' 'A,' and 'Asia-1.' These responses remained above threshold positive level even at day 210 following initial vaccination. Results of sero-surveillance and anecdotal information of repeated FMD outbreaks demonstrate the persistence of FMD virus of yak in northern Pakistan. Laboratory results and field observations clearly indicated that yak can be protected against FMD with a good quality vaccine with FMD serotype(s) matching current, regionally circulating FMD virus.

  10. Comparison of carfentanil-xylazine and thiafentanil-medetomidine in electroejaculation of captive gaur (Bos gaurus).

    Science.gov (United States)

    Napier, Julia E; Loskutoff, Naida M; Simmons, Lee G; Armstrong, Douglas L

    2011-09-01

    Carfentanil citrate and thiafentanil oxalate have been used successfully to immobilize captive and free-ranging ungulates. The objective of this study was to compare the efficacy and certain physiologic parameters of protocols by using the 2 opioids in gaur (Bos gaurus). Eight adult gaur bulls were immobilized for electroejaculation at Omaha's Henry Doorly Zoo (Omaha, Nebraska, USA). All the animals were immobilized twice, by using each of the following protocols one time: 10 mg carfentanil combined with 100 mg xylazine (CX), reversed with 1,000 mg naltrexone and 24 mg yohimbine; and 12 mg thiafentanil combined with 20 mg medetomidine (TM), reversed with 120 mg naltrexone and 100 mg atipamezole. Immobilization drugs were delivered intramuscularly into the shoulder area via pole syringe. Electroejaculation was carried out by a standardized protocol to duplicate procedural stimulation on each animal. Induction and recovery times, initial rectal temperature, heart rate, respiratory rate, anesthetic depth, oxygen saturation, indirect blood pressure, and arterial blood gases were recorded at the time of initial handling, before ejaculation, and after ejaculation. Antagonists were administered 1/4 i.v. and 3/4 s.q. Both protocols require a small volume of drug for a large ungulate, provide smooth induction, and adequate anesthesia. Both protocols produced a significant hypoxemia, although the animals on CX showed slightly better blood gas values (based on lower partial pressure of carbon dioxide) and numerically lower blood pressure values. Animals on TM had better muscle relaxation and smoother recoveries, with no renarcotization noted. The results of the present study indicate the TM and CX protocols used for immobilizing gaur result in similar quality ejaculates that can be used for fertility examination as well as for assisted reproduction such as artificial insemination. Additional immobilizations need to take place to further compare these 2 combinations in this

  11. Computational prediction of MHC class I epitopes for most common viral diseases in cattle (Bos taurus).

    Science.gov (United States)

    Sahu, Tanmaya Kumar; Rao, A R; Meher, Prabina Kumar; Sahoo, Bishnu Charan; Gupta, Satakshi; Rai, Anil

    2015-02-01

    Viral diseases like foot-and-mouth disease (FMD), calf scour (CS), bovine viral diarrhea (BVD), infectious bovine rhinotracheitis (IBR) etc. affect the growth and milk production of cattle (Bos taurus) causing severe economic loss. Epitope-based vaccine designing have been evolved to provide a new strategy for therapeutic application of pathogen-specific immunity in animals. Therefore, identification of major histocompatibility complex (MHC) binding peptides as potential T-cell epitopes is widely applied in peptide vaccine designing and immunotherapy. In this study, MetaMHCI tool was used with seven different algorithms to predict the potential T-cell epitopes for FMD, BVD, IBR and CS in cattle. A total of 54 protein sequences were filtered out from a total set of 6351 sequences of the pathogens causing the said diseases using bioinformatics approaches. These selected protein sequences were used as the key inputs for MetaMHCI tool to predict the epitopes for the BoLA-All MHC class I allele of B. taurus. Further, the epitopes were ranked based on a proposed principal component analysis based epitope score (PbES). The best epitope for each disease based on its predictability through maximum number of predictors and low PbES was modeled in PEP-FOLD server and docked with the BoLA-A11 protein for understanding the MHC-epitope interaction. Finally, a total of 78 epitopes were predicted, out of which 27 were for FMD, 25 for BVD, 12 for CS and 14 for IBR. These epitopes could be artificially synthesized and recommended to vaccinate the cattle for the considered diseases. Besides, the methodology adapted here could also be used to predict and analyze the epitopes for other microbial diseases of important animal species.

  12. IBN AL-JAZZAR ON FEVERS A CRITICAL EDITION OF ZAD AL-MUSAFIR WA QUT AL-HADIR BY GERRIT BOS

    Directory of Open Access Journals (Sweden)

    Lina Kushidayati

    2014-08-01

    Full Text Available This writing discusses critical edition on book 6 of the Zad by Gerrit Bos. The book is entitled Ibn al-Jazzar on Sexual Diseases and their Treatment. Gerrit Bos writes that Ibn al-Jazzar on fever is a critical edition of Zad al-musafir wa qut al-hadir. This study focuses on how Gerrit Bos’ work is. The method of this research is library research by analyzing some literatures such as books and journal articles. The results of this study shows that the critical edition of book 7 chapter 1-2 by Gerrit Bos presents comprehensive information about one of al-Jazzar work. There are many inconveniences in reading the text such as consulting the English translation to the Arabic text but this critical edition is a great contribution in the academic world and magnificent since this is the first critical edition dealing with fever that has been published.

  13. Contribution of stable isotopes (C,N,S) in collagen of late Pleistocene large mammal trophic ecology and landscape use: a case study in Goyet and Scladina cave (30-40,000 years BP)

    Science.gov (United States)

    Bocherens, Hervé; Germonpré, Mietje

    2010-05-01

    Two Belgian caves yielded very rich large mammal associations dating around 30 to 40,000 years ago: Goyet and Scladina cave (layer 1A). These sites are only 5 km apart but the cave entrances open on different valleys, in a quite diverse landscape ranging between open, unprotected uplands, steep cliffs and sheltered sun-exposed gorges, with the larger Meuse valley nearby. This mosaic scenery permitted during the Last Glacial a rich diversity of fossil flora and fauna. The faunal association includes a large diversity of taxa including Aurochs Bos primigenius, steppe bison Bison priscus, reindeer Rangifer tarandus, giant deer Megaloceros giganteus, horse Equus ferus, woolly rhinoceros Coelodonta antiquitatis, woolly mammoth Mammuthus primigenius, cave bear Ursus spelaeus, brown bear Ursus arctos, wolf Canis lupus, cave lion Panthera leo spelaea, and cave hyaena Crocuta crocuta spelaea. All the 90 studied bones and teeth yielded collagen with excellent collagen preservation, allowing reliable investigations of carbon, nitrogen and sulfur isotopic biogeochemistry. The combination of three different isotopic tracers allows to deciphering the effects of food selection and landscape use by different herbivorous and carnivorous taxa. This is the first study to include sulfur isotopic signatures in the study of late Quaternary large mammal palaeobiology. This new tracer yields evidence on mobility and differences in pasture areas, as different geological bedrock may exhibit various sulfur isotopic signatures that will pass on the herbivores and further on their predators. Using this feature in addition to the trophic information provided by carbon and nitrogen isotopic signatures, it appears that for some species present in both sites, such as horse and woolly rhinoceros, the individuals found in each site probably did not use the same pasture areas. This seems to also the case for the overwhelmingly vegetarian cave bears. In addition, individuals from the same species

  14. Objective measures for the assessment of post-operative pain in bos indicus bull calves following castration

    DEFF Research Database (Denmark)

    Musk, Gabrielle C.; Jacobsen, Stine; Hyndman, Timothy H.

    2017-01-01

    The aim of the study was to assess pain in Bos indicus bull calves following surgical castration. Forty-two animals were randomised to four groups: no castration (NC, n = 6); castration with pre-operative lidocaine (CL, n = 12); castration with pre-operative meloxicam (CM, n = 12); and, castration...... in the concentrations of SAA, haptoglobin, and fibrinogen in all of the groups from day 0 to 3. Iron concentrations were not different at the time points it was measured. The results of this study suggest that animals rest for longer periods after the pre-operative administration of meloxicam. The other objective...

  15. Chemical compositions, free amino acid contents and antioxidant activities of Hanwoo (Bos taurus coreanae) beef by cut.

    Science.gov (United States)

    Oh, Mirae; Kim, Eun-Kyung; Jeon, Byong-Tae; Tang, Yujiao; Kim, Moon S; Seong, Hye-Jin; Moon, Sang-Ho

    2016-09-01

    The objective of this study was to evaluate chemical compositions, free amino acid contents, and antioxidant activities of different cuts of Hanwoo (Bos taurus coreanae) beef. Beef preferences and prices in the Korean market depend on cut. Therefore, comparisons were made between high-preference cuts (group 1 [G1], including loin, tenderloin, and rib) and low-preference cuts (group 2 [G2], including brisket, topside, and shank). Meat samples were collected from 10 fattened cows. Crude fat content was significantly higher in G1 than in G2 (pbeef products and further promote increased consumption of low-preference beef cuts. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Analysis of the Plant bos1 Mutant Highlights Necrosis as an Efficient Defence Mechanism during D. dadantii/Arabidospis thaliana Interaction

    Science.gov (United States)

    Patrit, Oriane; Simond-Côte, Elizabeth; Hermand, Victor; Van Gijsegem, Frédérique

    2011-01-01

    Dickeya dadantii is a broad host range phytopathogenic bacterium provoking soft rot disease on many plants including Arabidopsis. We showed that, after D. dadantii infection, the expression of the Arabidopsis BOS1 gene was specifically induced by the production of the bacterial PelB/C pectinases able to degrade pectin. This prompted us to analyze the interaction between the bos1 mutant and D. dadantii. The phenotype of the infected bos1 mutant is complex. Indeed, maceration symptoms occurred more rapidly in the bos1 mutant than in the wild type parent but at a later stage of infection, a necrosis developed around the inoculation site that provoked a halt in the progression of the maceration. This necrosis became systemic and spread throughout the whole plant, a phenotype reminiscent of that observed in some lesion mimic mutants. In accordance with the progression of maceration symptoms, bacterial population began to grow more rapidly in the bos1 mutant than in the wild type plant but, when necrosis appeared in the bos1 mutant, a reduction in bacterial population was observed. From the plant side, this complex interaction between D. dadantii and its host includes an early plant defence response that comprises reactive oxygen species (ROS) production accompanied by the reinforcement of the plant cell wall by protein cross-linking. At later timepoints, another plant defence is raised by the death of the plant cells surrounding the inoculation site. This plant cell death appears to constitute an efficient defence mechanism induced by D. dadantii during Arabidopsis infection. PMID:21533045

  17. Molecular Characterization and Expression Analysis of Insulin-like Growth Factor-1 and Insulin-like Growth Factor Binding Protein-1 Genes in Qinghai-Tibet Plateau Bos grunniens and Lowland Bos taurus.

    Science.gov (United States)

    Chen, Ya-Bing; Fu, Mei; Lan, Dao-Liang; Li, Jian

    2015-01-01

    Insulin-like growth factor-1 (IGF-1) and insulin-like growth factor binding protein-1 (IGFBP-1) play a pivotal role in regulating cellular hypoxic response. In this study, we cloned and characterized the genes encoding IGF-1 and IGFBP-1 to improve the current knowledge on their roles in highland Bos grunniens (Yak). We also compared their expression levels in the liver and kidney tissues between yaks and lowland cattle. We obtained full-length 465 bp IGF-1 and 792 bp IGFBP-1, encoding 154 amino acids (AA) IGF-1, and 263 AA IGFBP-1 protein, respectively using reverse transcriptase-polyerase chain reaction (RT-PCR) technology. Analysis of their corresponding amino acid sequences showed a high identity between B. grunniens and lowland mammals. Moreover, the two genes were proved to be widely distributed in the examined tissues through expression pattern analysis. Real-time PCR results revealed that IGF-1 expression was higher in the liver and kidney tissues in B. grunniens than in Bos taurus (ptaurus than B. grunniens, but it has a similar expression level in the kidneys of the two species. These results indicated that upregulated IGF-1 and downregulated IGFBP-1 are associated with hypoxia adaptive response in B. grunniens.

  18. Energetic efficiency of protein and body fat retention in crossbred Bos indicus and Bos Taurus × Bos indicus raised under tropical conditions Eficiência energética de retenção de proteína e gordura corporal em zebuínos e mestiços Europeu × Zebu mantidos em clima tropical

    Directory of Open Access Journals (Sweden)

    Douglas Sampaio Henrique

    2009-08-01

    Full Text Available The efficiency of fat and protein retention by Bos indicus and its cross-breds was estimated from data obtained in the literature to verify possible differences between these animals and Bos taurus. After estimating the efficiencies, a correction factor was used to discount the metabolizable energy fraction that was spent in the maintenance and support metabolism processes. The efficiencies were then estimated again, assuming that all the remaining energy would correspond to the metabolizable energy available for body mass retention. The correction value used was considered satisfactory to discount energetic losses for maintenance and support. The efficiency values of partial body fat and protein retention in Bos indicus and its cross-bred were very similar to values reported by other authors who researched Bos taurus exclusively.A eficiência com que animais zebuínos e seus cruzamentos transformam a energia metabolizável consumida em gordura e proteína corporal foi estimada a partir de informações obtidas na literatura no intuito de verificar se existem diferenças entre esses animais e os de raças europeias. Após a estimativa das eficiências, usou-se uma correção para descontar a porção da energia metabolizável gasta na manutenção da massa corporal e no metabolismo de suporte. Posteriormente à aplicação da correção, as eficiências foram estimadas novamente, partindo-se do pressuposto de que o montante de energia restante corresponderia à energia metabolizável utilizada para acúmulo de massa corporal. O valor de correção utilizado foi considerado suficiente para descontar as perdas energéticas para mantença e suporte. Os valores de eficiência de retenção parcial de gordura e proteína corporal em animais zebuínos e mestiços Europeu × Zebu são muito próximos dos encontrados por outros autores em pesquisas com animais exclusivamente europeus.

  19. Molecular Cloning, Bioinformatics Analysis and Expression of Insulin-Like Growth Factor 2 from Tianzhu White Yak, Bos grunniens

    Directory of Open Access Journals (Sweden)

    Quanwei Zhang

    2014-01-01

    Full Text Available The IGF family is essential for normal embryonic and postnatal development and plays important roles in the immune system, myogenesis, bone metabolism and other physiological functions, which makes the study of its structure and biological characteristics important. Tianzhu white yak (Bos grunniens domesticated under alpine hypoxia environments, is well adapted to survive and grow against severe hypoxia and cold temperatures for extended periods. In this study, a full coding sequence of the IGF2 gene of Tianzhu white yak was amplified by reverse transcription PCR and rapid-amplification of cDNA ends (RACE for the first time. The cDNA sequence revealed an open reading frame of 450 nucleotides, encoding a protein with 179 amino acids. Its expression in different tissues was also studied by Real time PCR. Phylogenetic tree analysis indicated that yak IGF2 was similar to Bos taurus, and 3D structure showed high similarity with the human IGF2. The putative full CDS of yak IGF2 was amplified by PCR in five tissues, and cDNA sequence analysis showed high homology to bovine IGF2. Moreover the super secondary structure prediction showed a similar 3D structure with human IGF2. Its conservation in sequence and structure has facilitated research on IGF2 and its physiological function in yak.

  20. Satellite DNA methylation status and expression of selected genes in Bos indicus blastocysts produced in vivo and in vitro.

    Science.gov (United States)

    Urrego, R; Bernal-Ulloa, S M; Chavarría, N A; Herrera-Puerta, E; Lucas-Hahn, A; Herrmann, D; Winkler, S; Pache, D; Niemann, H; Rodriguez-Osorio, N

    2017-04-01

    Bovine embryos produced in vivo and in vitro differ with respect to molecular profiles, including epigenetic marks and gene expression profiles. This study investigated the CpG methylation status in bovine testis satellite I (BTS) and Bos taurus alpha satellite I (BTαS) DNA sequences, and concomitantly the relative abundance of transcripts, critically involved in DNA methylation (DNMT1 and DNMT3A), growth and development (IGF2R) and pluripotency (POU5F1) in Bos indicus embryos produced in vitro or in vivo. Results revealed that methylation of BTS were higher (P vitro compared with their in vivo produced counterparts, while the methylation status of BTαS was similar in both groups. There were no significant differences in transcript abundance for DNMT3A, IGF2R and POU5F1 between blastocysts produced in vivo and in vitro. However, a significantly lower amount of DNMT1 transcripts was found in the in vitro cultured embryos (P vitro embryo production system.

  1. Characterizing emergence and divergence in the first follicular wave in a tropically adapted Bos taurus breed.

    Science.gov (United States)

    Dorneles Tortorella, Rodrigo; Nogueira, Guilherme de Paula; Modesto, Mairon Rocha; Passoni Silva, Priscilla Cristine; da Silva, Joseane Padilha; Neves, Jairo Pereira; Ramos, Alexandre Floriani

    2017-01-15

    Tropically adapted Bos taurus breeds are descended from the cattle which were brought from the Iberian Peninsula to Latin America by the colonizers and which adapted over time to local conditions. These breeds have become a genetic treasure that must be preserved. The objective of this study was to characterize ovarian follicular emergence and divergence in tropically adapted B. taurus cows and heifers. Cyclic heifers (n = 11) and nonlactating, multiparous cows (n = 11) were examined at 8-hour intervals using ultrasonography starting on the day following the final application of PGF2α, which was used to synchronize the estrous cycle, and ending 5 days after ovulation. Blood samples were collected immediately following the ultrasonographic examinations in order to evaluate FSH and estradiol-17β (E2) concentrations. The interval between ovulation and follicular wave emergence (11.6 ± 3.3 hours vs. 20.3 ± 2.5 hours, P  0.05). The mean number of small (≤4 mm, 7.2 ± 5.1) and medium (4 to ≤ 8 mm, 6.8 ± 3.5) follicles was greater than that of large follicles (≥8 mm, 0.6 ± 0.5) from ovulation until 5 days after ovulation. The DF diameter (8.1 ± 1 mm) did not differ (P = 0.09) from SF diameter (7.6 ± 0.9 mm) at the time of follicular divergence (around 45 hours after follicular emergence). The DF and SF growth rates were similar (P > 0.05) until follicular divergence, at which point the SF growth rate decreased, whereas the DF growth rate remained constant. Serum E2 concentrations did not change (P > 0.05) during the divergence period, whereas FSH concentrations decreased between 48 and 32 hours before follicular wave divergence. In conclusion, cows and heifers differed only in the interval from ovulation to follicular wave emergence and divergence, which was confirmed by the different patterns of FSH and E2 concentrations. Copyright © 2016 Elsevier Inc. All rights reserved.

  2. Behavioral characteristics of Hanwoo (Bos taurus coreanae) steers at different growth stages and seasons.

    Science.gov (United States)

    Kim, Na Yeon; Kim, Seong Jin; Jang, Se Young; Oh, Mi Rae; Tang, Yu Jiao; Seong, Hye Jin; Yun, Yeong Sik; Moon, Sang Ho

    2017-10-01

    This research analyzed behavioral characteristics of Hanwoo (Bos taurus coreanae) steers during each season and growth stage to enable measurement of the animals' welfare level for precision livestock farming. A hundred-eight beef steers were divided into three equal groups at a Hanwoo farm according to their growth stage: growing stage (GS), 8 months; early-fattening stage (EFS), 19 months; and late-fattening stage (LFS), 30 months. Twelve behavioral categories were continuously recorded for 13 day-time hours in each four seasons with three replications. Time spent standing was found to be significantly longer in summer at all growth stages (p<0.05). Hanwoos at the GS spent significantly longer standing time in spring and summer than those at the EFS and LFS (p<0.05). Lying time in summer was the shortest for all growth stages (p<0.05). Steers at the LFS spent significantly longer lying time than that at the GS (p<0.05) in summer. For GS and EFS, time spent eating in spring and autumn were longer than in summer and winter (p<0.05). Eating time was the longest for the GS in spring, autumn, and winter, excluding for the LFS in winter (p<0.05). Regarding ruminating, steers at the LFS spent significantly shorter time than those at other stages in all seasons (p<0.05). GS and EFS steers showed the longest walking time in summer compared with other seasons (p<0.05). At GS and LFS, drinking time in summer was the longest of all seasons (p<0.05). Sleeping time was significantly shorter in summer compared with the other seasons (p<0.05). Self-grooming time was the longest in winter for all growth stages (p<0.05). Steers were found to have more variable behavioral patterns during summer and the GS and less active behaviors during the LFS, thus extra care seems necessary during the GS, LFS, and summer period.

  3. Measuring Learning Styles with Questionnaires versus Direct Observation of Preferential Choice Behavior in Authentic Learning Situations: The Visualizer/Verbalizer Behavior Observation Scale (VV-BOS).

    Science.gov (United States)

    Leutner, Detlev; Plass, Jan L.

    1998-01-01

    Describes the development of the VV-BOS (Visualizer/Verbalizer Behavior Observation Scale), a computer-based instrument for direct observation of students' preferences for visual or verbal learning material. Results of a study with second-language learners indicated a high degree of reliability as an alternative to conventional questionnaires.…

  4. Heat-tolerant versus heat-sensitive Bos taurus cattle: Influence of air temperature and breed on the acute phase response to a provocative immune challenge

    Science.gov (United States)

    The difference in the response of a heat-tolerant and a heat-sensitive Bos taurus breed to lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kilograms body weight) and Romosinuano (RO; heat-tolerant; n = 10; 31...

  5. COMPORTAMIENTO REPRODUCTIVO Y PRODUCTIVO DE VACAS Bos indicus, Bos taurus Y SUS CRUCES EN UN SISTEMA DE PRODUCCIÓN VACA:CRÍA EN YUCATÁN, MÉXICO

    Directory of Open Access Journals (Sweden)

    Gilberto Timoteo Mejía Bautista

    2009-11-01

    Full Text Available El objetivo de este estudio fue comparar el comportamiento reproductivo y productivo de vacas Bos indicus, Bos taurus y sus cruces en un sistema vaca:cría en Yucatán, México. Se utilizó la información de 310 vacas Brahman (Br, 191 Nelore (Ne, 140 Cebú Comercial (CC, 49 Suizo Pardo (SP y 69 cruzadas con SP (Cz que parieron durante un periodo de 20 años. Los indicadores estudiados fueron edad al primer parto (EPP, intervalo entre partos (IEP, peso al destete a 205 días (PDA205 y peso al destete por día de interparto (PDA/IEP. Se utilizaron modelos fijos para determinar los efectos de año de nacimiento (AN o parto (AP, época de nacimiento (EN o parto (EP, número de parto (NP, sexo de la cría (SX y grupo racial de la vaca (GRV sobre los indicadores y modelos mixtos para la repetibilidad calculada mediante los componentes de varianza entre y dentro de vaca. Las medias generales y desviaciones estándar para EPP, IEP, PDA205 y PDA/IEP fueron, 1091.7±137.9 días, 432.9±96.9 días, 164.3±25.5 kg y 401±159 g, respectivamente. El AN y EN afectaron la EPP; el AP, EP y NP afectaron al IEP, PDA205 y PDA/IEP (P

  6. Dinâmica folicular e taxa de prenhez em novilhas receptoras de embrião (Bos taurus indicus x Bos taurus taurus tratadas com o protocolo "Ovsynch" para inovulação em tempo fixo

    Directory of Open Access Journals (Sweden)

    Pietro Sampaio Baruselli

    2003-01-01

    Full Text Available Objetivou-se avaliar a eficiência da sincronização da ovulação para inovulação em tempo fixo em novilhas Bos taurus indicus x Bos taurus taurus receptoras de embrião. No Experimento 1, a dinâmica folicular foi acompanhada durante o protocolo "Ovsynch" (G1; n=35 e após a aplicação de PGF2alfa (G2; n=34. No Experimento 2, os mesmos tratamentos foram realizados a campo em 168 (G1 e 177 (G2 novilhas. No D6, colheu-se sangue para dosagem de P4 e se realizaram exames ultra-sonográficos. No D7, realizou-se a inovulação. No Experimento 1, 45,7% dos animais ovularam após o 1º GnRH (P;0,05. Ao final, a taxa de prenhez no Gl foi de 35,7% e no G2 de 25,4% (P<0,05. Foram detectadas em estro 53,7% das novilhas do G2 e 33,3% do Gl (P<0,05. Os corpos lúteos com maior área determinaram maiores concentrações de P4 e taxa de concepção (P<0,05. A sincronização da ovulação para inovulação em tempo fixo aumentou as taxas de ovulação, de aproveitamento e de prenhez em novilhas receptoras de embrião.

  7. Novel SNP identification in exon 3 of HSP90AA1 gene and their association with heat tolerance traits in Karan Fries (Bos taurus × Bos indicus) cows under tropical climatic condition.

    Science.gov (United States)

    Kumar, Rakesh; Gupta, Ishwar Dayal; Verma, Archana; Singh, Sohan Vir; Verma, Nishant; Vineeth, M R; Magotra, Ankit; Das, Ramendra

    2016-04-01

    Heat shock proteins (HSPs) act as molecular chaperones those are preferentially transcribed in respose to heat stress and the polymorphism in HSP genes associated with heat tolerance traits in cows. HSP90AA1 gene has been mapped on Bos taurus autosome 21 (BTA-21) and spans nearly 5368 bp comprising of 11 exons out of which the first exon does not translate. The present study was done on Karan Fries (5/8 HF × 3/8 Tharparkar) cows reared in tropical climate with the objectives of identifying single-nucleotide polymorphisms (SNPs) in targeted regions (exon 3) of HSP90AA1 gene and analyzing their association with heat tolerance traits in Karan Fries cows. Respiration rate (RR) and rectal temperature (RT) were recorded once daily for four consecutive days during probable extreme hours in different seasons or temperature humidity index (THI), viz., winter, spring, and summer. For detecting single-nucleotide polymorphisms, sequence data were analyzed using BioEdit software (version 7.2). Comparative sequence analysis of HSP90AA1 gene showed point mutation, viz., g.1209A>G (exon 3) as compared to Bos taurus (NCBI Ref Seq: AC_000178.1). Association analysis indicated that THI was influenced (P G were categorized into three genotypes, i.e., AA, AG, and GG, and the least squares means (LSMEANS) of RR, RT, and HTC for GG (homozygous) genotype were significantly lower (P < 0.01) than AA (homozygous) and AG (heterozygous) genotypes. These findings may partly suggest that cows with GG genotypes were favored for heat tolerance trait, which can be used as an aid to selection for thermo-tolerance Karan Fries cows for better adaptation in subtropical and tropical hot climate.

  8. A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

    Science.gov (United States)

    Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

    2015-08-28

    The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

  9. Vaccine-induced rabies case in a cow (Bos taurus): Molecular characterisation of vaccine strain in brain tissue.

    Science.gov (United States)

    Vuta, Vlad; Picard-Meyer, Evelyne; Robardet, Emmanuelle; Barboi, Gheorghe; Motiu, Razvan; Barbuceanu, Florica; Vlagioiu, Constantin; Cliquet, Florence

    2016-09-22

    Rabies is a fatal neuropathogenic zoonosis caused by the rabies virus of the Lyssavirus genus, Rhabdoviridae family. The oral vaccination of foxes - the main reservoir of rabies in Europe - using a live attenuated rabies virus vaccine was successfully conducted in many Western European countries. In July 2015, a rabies vaccine strain was isolated from the brain tissues of a clinically suspect cow (Bos taurus) in Romania. The nucleotide analysis of both N and G gene sequences showed 100% identity between the rabid animal, the GenBank reference SAD B19 strain and five rabies vaccine batches used for the national oral vaccination campaign targeting foxes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Genetic variation in PLAG1 associates with early life body weight and peripubertal weight and growth in Bos taurus.

    Science.gov (United States)

    Littlejohn, M; Grala, T; Sanders, K; Walker, C; Waghorn, G; Macdonald, K; Coppieters, W; Georges, M; Spelman, R; Hillerton, E; Davis, S; Snell, R

    2012-10-01

    Variation at the pleiomorphic adenoma gene 1 (PLAG1) locus has recently been implicated in the regulation of stature and weight in Bos taurus. Using a population of 942 outbred Holstein-Friesian dairy calves, we report confirmation of this effect, demonstrating strong association of early life body weight with PLAG1 genotype. Peripubertal body weight and growth rate were also significantly associated with PLAG1 genotype. Growth rate per kilogram of body weight, daily feed intake, gross feed efficiency and residual feed intake were not significantly associated with PLAG1 genotype. This study supports the status of PLAG1 as a key regulator of mammalian growth. Further, the data indicate the utility of PLAG1 polymorphisms for the selection of animals to achieve enhanced weight gain or conversely to aid the selection of animals with lower mature body weight and thus lower maintenance energy requirements. © 2011 The Authors, Animal Genetics © 2011 Stichting International Foundation for Animal Genetics.

  11. Comparison of proximate chemical composition and texture of cupim, Rhomboideus m. and lombo, Longissimus dorsi m. of Nelore (Bos indicus

    Directory of Open Access Journals (Sweden)

    Mayka Reghiany Pedrão

    2009-06-01

    Full Text Available The proximate chemical composition of hump, known in Brazil as cupim, Rhomboideus m. (RB, of Nelore (Bos indicus aged 24 months revealed it to be a unique beef muscle. It presents a lipid fraction 14-fold as high as that of Longissimus dorsi m. (LD taken from the same animal (pA composição química percentual aproximada do cupim m. Rhomboideus (RB derivado de Nelore (Bos indicus de 24 meses de idade mostrou ser um músculo diferenciado. Há uma maior fração de material lipídico em RB chegando a ser 14 vezes proporcionalmente maior em comparação ao m. Longissimus dorsi (LD (p<0,05 a maior quantidade de gordura relatada em amostras de carne em literatura científica. Esse fato foi também observado pela avaliação histológica. Há proporcionalmente maior concentração da fração protéica e menor quantidade de umidade em RB. O teor de colágeno foi de 22,9% mais concentrado em RB enquanto que a quantidade da sua ligação cruzada, hidroxilisilpiridinolina (HP foi 14 vezes maior indicando que cupim seria mais rígido. Contrariando essa expectativa, a maciez da carne crua avaliada pelo texturômetro mostrou valores de 8.05 e 5.81 kg/F para LD e RB, respectivamente (p<0.05. Tais resultados mostram que em músculo contendo abundante gordura esta funciona como lubrificante para a lamina penetrar sem muita resistência através do cupim a despeito dar quantidade e qualidade das fibras de colágeno.

  12. Bos taurus genome sequence reveals the assortment of immunoglobulin and surrogate light chain genes in domestic cattle

    Directory of Open Access Journals (Sweden)

    Liljavirta Jenni

    2009-04-01

    Full Text Available Abstract Background The assortment of cattle immunoglobulin and surrogate light chain genes has been extracted from the version 3.1 of Bos taurus genome sequence as a part of an international effort to sequence and annotate the bovine genome. Results 63 variable lambda chain and 22 variable kappa chain genes were identified and phylogenetically assigned to 8 and 4 subgroups, respectively. The specified phylogenetic relationships are compatible with the established ruminant light chain variable gene families or subgroups. Because of gaps and uncertainties in the assembled genome sequence, the number of genes might change in the future versions of the genome sequence. In addition, three bovine surrogate light chain genes were identified. The corresponding cDNAs were cloned and the expression of the surrogate light chain genes was demonstrated from fetal material. Conclusion The bovine kappa gene locus is compact and simple which may reflect the preferential use of the lambda chain in cattle. The relative orientation of variable and joining genes in both loci are consistent with a deletion mechanism in VJ joining. The orientation of some variable genes cannot be determined from the data available. The number of functional variable genes is moderate when compared to man or mouse. Thus, post-recombinatorial mechanisms might contribute to the generation of the bovine pre-immune antibody repertoire. The heavy chains probably contribute more to recombinational immunoglobulin repertoire diversity than the light chains but the heavy chain locus could not be annotated from the version 3.1 of Bos taurus genome.

  13. The interval between the emergence of pharmacologically synchronized ovarian follicular waves and ovum pickup does not significantly affect in vitro embryo production in Bos indicus, Bos taurus, and Bubalus bubalis.

    Science.gov (United States)

    Gimenes, Lindsay U; Ferraz, Márcio L; Fantinato-Neto, Paulo; Chiaratti, Marcos R; Mesquita, Lígia G; Sá Filho, Manoel F; Meirelles, Flávio V; Trinca, Luzia A; Rennó, Francisco P; Watanabe, Yeda F; Baruselli, Pietro S

    2015-02-01

    The aim of the present study was to determine the optimal phase of the follicular wave to perform ovum pickup (OPU) for in vitro embryo production (IVEP) in various genetic groups. For this purpose, 27 heifers-nine Bos taurus (Holstein), nine Bos indicus (Nelore), and nine Bubalus bubalis (Mediterranean)-were maintained under the same nutritional, management, and environmental conditions. Heifers within each genetic group were submitted to six consecutive OPU trials with 14-day intersession intervals, at three different phases of the pharmacologically synchronized follicular wave (Day 1, 3, or 5 after follicular wave emergence), in a 3 × 3 crossover design. When OPU was performed at different phases of the pharmacologically synchronized follicular wave (Day 1, 3, or 5), no differences were found in the percent of oocytes recovered (70.5 ± 3.1%, 75.0 ± 3.1%, 76.0 ± 3.2%, respectively; P = 0.41) or blastocyst production rates (19.4 ± 2.9%, 16.6 ± 2.9%, 15.9 ± 2.6%, respectively; P = 0.36). Comparing genetic groups, B indicus showed a higher blastocyst rate (28.3(a) ± 2.8%; P taurus and B bubalis (14.1(b) ± 2.9% and 10.2(b) ± 2.0%, respectively). However, only B indicus heifers showed a variation in the number of visualized follicles and the total and viable oocytes along consecutive OPU sessions. In conclusion, different phases of the pharmacologically synchronized ovarian follicular wave did not affect OPU-IVEP in B indicus, B taurus, and B bubalis heifers. Additionally, B indicus heifers showed greater OPU-IVEP efficiency than did the other genetic groups, under the same management conditions. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Chromosome evolution in the subtribe Bovina (Mammalia, Bovidae): the karyotype of the Cambodian banteng (Bos javanicus birmanicus) suggests that Robertsonian translocations are related to interspecific hybridization.

    Science.gov (United States)

    Ropiquet, Anne; Gerbault-Seureau, Michèle; Deuve, Jane L; Gilbert, Clément; Pagacova, Eva; Chai, Norin; Rubes, Jiri; Hassanin, Alexandre

    2008-01-01

    Three subspecies of banteng (Bos javanicus) have been described: B. j. javanicus in Java, B. j. lowi in Borneo, and B. j. birmanicus in Cambodia, Lao PDR, Myanmar, Thailand and Vietnam. In this paper we provide the first description of the karyotype of the Cambodian banteng. The chromosomal complement of B. j. birmanicus differs from that of B. j. javanicus, which was previously found to be similar to that of cattle, Bos taurus (2n = 60). The Cambodian banteng karyotype has a diploid number of 2n = 56 (FN = 62) and the karyotype consists of 26 pairs of acrocentric chromosomes and two pairs of submetacentric chromosomes. Comparisons with other species of the subtribe Bovina show that the two pairs of bi-armed chromosomes resulted from two centric fusions involving the equivalent of cattle chromosomes 1 and 29, and 2 and 28, respectively. Cross-species fluorescence in-situ hybridization (FISH) with B. taurus whole chromosome paints and satellite DNA I probes was used to identify the chromosomes involved in the translocations, and their orientation. We suggest that Robertsonian translocations (1;29) and (2;28) have been fixed in the common ancestor of Cambodian banteng as a consequence of hybridization with the kouprey (Bos sauveli) during the Pleistocene epoch.

  15. Shiga toxin-producing Escherichia coli in yaks (Bos grunniens from the Qinghai-Tibetan Plateau, China.

    Directory of Open Access Journals (Sweden)

    Xiangning Bai

    Full Text Available Shiga toxin (Stx-producing Escherichia coli (STEC are recognized as important human pathogens of public health concern. Many animals are the sources of STEC. In this study we determined the occurrence and characteristics of the STEC in yaks (Bos grunniens from the Qinghai-Tibetan plateau, China. A total of 728 yak fecal samples was collected from June to August, 2012 and was screened for the presence of the stx 1 and stx 2 genes by TaqMan real-time PCR after the sample was enriched in modified Tryptone Soya Broth. Of the 138 (18.96% stx 1 and/or stx 2-positive samples, 85 (61.59% were confirmed to have at least 1 STEC isolate present by culture isolation, from which 128 STEC isolates were recovered. All STEC isolates were serotyped, genotyped by pulsed-field gel electrophoresis (PFGE and characterized for the presence of 16 known virulence factors. Fifteen different O serogroups and 36 different O:H serotypes were identified in the 128 STEC isolates with 21 and 4 untypable for the O and H antigens respectively. One stx 1 subtype (stx 1a and 5 stx 2 subtypes (stx 2a, stx 2b, stx 2c, stx 2d and stx 2g were present in these STEC isolates. Apart from lpfA O157/OI-141, lpfA O157/OI-154, lpfA O113, katP and toxB which were all absent, other virulence factors screened (eaeA, iha, efa1, saa, paa, cnf1, cnf2, astA, subA, exhA and espP were variably present in the 128 STEC isolates. PFGE were successful for all except 5 isolates and separated them into 67 different PFGE patterns. For the 18 serotypes with 2 or more isolates, isolates of the same serotypes had the same or closely related PFGE patterns, demonstrating clonality of these serotypes. This study was the first report on occurrence and characteristics of STEC isolated from yaks (Bos grunniens from the Qinghai-Tibetan plateau, China, and extended the genetic diversity and reservoir host range of STEC.

  16. Testicular, semen and blood parameters in adapted and nonadapted Bos taurus bulls in the semi-arid tropics.

    Science.gov (United States)

    Wildeus, S; Hammond, A C

    1993-08-01

    Two experiments were conducted to evaluate differences in testicular, seminal and hematological characteristics in adapted (Senepol) and nonadapted (Holstein) Bos taurus bulls under the semi-arid environmental conditions of St. Croix, Virgin Islands (17 degrees N, 64 degrees W). In Experiment 1 mature, sexually-rested Senepol (n=10) and Holstein (n=9) bulls of similar age (37 months) and body weight (715 kg) and grazing on adjacent native pastures, were tested on the same day in July (28.8 degrees C mean ambient temperature, 81.5% humidity). Senepol bulls had lower (PSenepol compared to Holstein bulls. Ejaculates, obtained by electroejaculation, contained 3.2x10(9) more spermatozoa with fewer abnormal tails and detached acrosomes in Senepol than in Holstein bulls (PSenepol (n=42) and Holstein (n=30) bulls, representing 3 beef and 5 dairy farms, were evaluated during the summer (August/September) and winter (February/March). Again, scrotal circumference was larger (PSenepol than in Holstein bulls, with no effect of season. Seminal fructose was higher (PSenepol than in Holstein bulls and decreased (PSenepol bulls. The data point to differences between the adapted and nonadapted breed type in testicular and ejaculate characteristics, but also suggest that season has only a limited impact on bull reproductive function under the environmental conditions in St. Croix.

  17. Evolutionary process of Bos taurus cattle in favourable versus unfavourable environments and its implications for genetic selection.

    Science.gov (United States)

    O'Neill, Christopher J; Swain, David L; Kadarmideen, Haja N

    2010-09-01

    The evolutionary processes that have enabled Bos taurus cattle to establish around the globe are at the core to the future success of livestock production. Our study focuses on the history of cattle domestication including the last 60 years of B. taurus breeding programmes in both favourable and unfavourable environments and its consequences on evolution and fitness of cattle. We discuss the emergence of 'production diseases' in temperate production systems and consider the evolutionary genetics of tropical adaptation in cattle and conclude that the Senepol, N'Dama, Adaptaur and Criollo breeds, among others with similar evolutionary trajectories, would possess genes capable of improving the productivity of cattle in challenging environments. Using our own experimental evidence from northern Australia, we review the evolution of the Adaptaur cattle breed which has become resistant to cattle tick. We emphasize that the knowledge of interactions between genotype, environment and management in the livestock systems will be required to generate genotypes for efficient livestock production that are both economically and environmentally sustainable. Livestock producers in the 21st century will have less reliance on infrastructure and veterinary products to alleviate environmental stress and more on the animal's ability to achieve fitness in a given production environment.

  18. Bayesian inference on field data for genetic parameters for some reproductive and related traits of Nellore cattle (Bos indicus

    Directory of Open Access Journals (Sweden)

    Carina Ubirajara de Faria

    2007-03-01

    Full Text Available We used Gibbs sampling in single and two-trait animal models to estimate genetic parameters for some reproductive and related traits of Nellore cattle (Bos indicus. Female traits were age at first calving (AFC, cumulative productivity (CP and adult weight (AW. For males, scrotal circumferences at 365 and 450 days of age were analyzed. Gibbs sampling using the ‘Multiple Trait using Gibbs Sampling under Animal Model’ (MTGSAM program of Van Tassel and Van Vleck was used to estimate the (covariance components of the traits and conduct genetic analyses. Heritabilities were AFC = 0.26, AW = 0.36 and CP = 0.25 under the single-trait animal model. The mean, mode and median estimates for genetic parameters obtained from the marginal posterior distributions were similar for all traits except AW, which presented lower values for the mode than the mean and median. However, the marginal posterior distributions for the traits studied presented a tendency toward normality. Favorable, but low, negative genetic correlations were found between male scrotal circumference and female age at first calving. The reproductive traits showed medium-magnitude heritabilities, which indicates that these traits should respond to selection and therefore should be included in genetic improvement programs.

  19. Seroprevalence and risk factors of bovine viral diarrhoea virus (BVDV) infection in yaks (Bos grunniens) in northwest China.

    Science.gov (United States)

    Ma, Jian-Gang; Cong, Wei; Zhang, Fu-Heng; Feng, Sheng-Yong; Zhou, Dong-Hui; Wang, Yi-Ming; Zhu, Xing-Quan; Yin, Hong; Hu, Gui-Xue

    2016-12-01

    Bovine viral diarrhoea virus (BVDV), a member of the Pestivirus genus, is an important pathogen of cattle worldwide, causing reproductive disorders in adult cattle and mucosal disease in calves. However, limited information about BVDV infection in yaks (Bos grunniens) in China is available, especially in white yaks which is a unique yak breed that only lives in Tianzhu Tibetan Autonomous County (TTAC), Gansu Province, northwest China. Therefore, we conducted a cross-sectional study to estimate the seroprevalence and risk factors associated with BVDV infection in 1584 yaks in Gansu province, northwest China, between April 2013 and March 2014 using an indirect ELISA test. The overall seroprevalence of BVDV in yaks was 37.56 % (595/1584), with 45.08 % (275/610) in black yaks and 32.85 % (320/974) in white yaks. Moreover, positive yaks were found in all four regions, varied from 33.22 to 40.31 %. Male yaks had a similar seroprevalence (37.84 %) with that of the female yaks (37.11 %). Season, species and geographical origins of yaks were considered as risk factors analyzed by logistic regression model. To our knowledge, this is the first report of seroprevalence and risk factors associated with BVDV infection in white yaks in China.

  20. [Mobilization of Ca2+ from intracellular stores of spermatozoa of Bos taurus depending on their functional status].

    Science.gov (United States)

    Denisenko, V Yu; Boytseva, E N; Kuzmina, T I

    2015-01-01

    On the basis of inhibitory analysis by using a fluorescence probe chlortetracycline, calcium transduction pathway in spermatozoa of Bos taurus has been examined. Additional release of Ca2+ from intracellular stores of sperm was found after combiened action of prolactin and GTP, which took place under influence of protein kinase C inhibitor (compound Ro 31-8220); the combined effect of theophylline and GDP also stimulated additional release of Ca2+ from intracellular stores, which was missing when adding inhibitor of protein kinase A, compound H-89. Using chlortetracycline test (analysis localization of chlortetracycline fluorescence in spermatozoa), we have shown the combined action of prolactin and GTP increases the number of sperm with acrosome reaction, which is reduced after influence of Ro 31-8220; the combined effect of theophylline and GDP increases the percentage of capacitated spermatozoa, which was decreased in the presence of H-89. According with the data obtained, we propose the hypothesis that the transduction of Ca2+ between intracellular stores in bull spermatozoa stimulated by the combined action of prolactin and GTP, or theophylline and GDP, determines the functional status of the spermatozoa. Namely: the transduction of Ca2+ between intracellular stores in bull spermatozoa stimulated by the combined action of prolactin and GTP is involved in the regulation of acrosomal processes, while sperm capacitation is mediated by the transduction of calcium between intracellular stores activated by the combined influence of theophylline and GDP.

  1. REVIEW: The Characteristics of Genetic Resource of Bali Cattle (Bos-bibos banteng and the Alternative of It's Conservation Methods

    Directory of Open Access Journals (Sweden)

    ACHMAD NUR CHAMDI

    2005-01-01

    Full Text Available Bali cattle is an Indonesian native beef cattle, the result of domestication of Banteng (Bos-bibos banteng. The main problem faced in the development of Bali cattle is the low quality of breed, which is predicted as the effect of inbreeding or raising management. The affects of genetic and cross breeding which usually inflict a loss are the decreasing of cattle’s endurance, fertility and birth weight. Seeing the fact, the government effort to introduce a quality bull to the breed source areas, the determination of cattle release including the controll on the cutting of productive female cattle, and to exactly count the number of Bali cattle which can be released in order to do not disturb its population balance, so it is necessary to do conservation attempt by in-situ and ex-situ. The result of this study shows that the characteristics on genetic resource of Bali cattle which comprises documentation, evaluation on reproduction and production, and attempt in increasing Bali cattle’s genetic quality in Indonesia have been done, eventhough those are still limited.

  2. Effect of Vitamin E and Polyunsaturated Fatty Acids on Cryopreserved Sperm Quality in Bos taurus Bulls Under Testicular Heat Stress.

    Science.gov (United States)

    Losano, João D A; Angrimani, Daniel S R; Dalmazzo, Andressa; Rocha, Carolina C; Brito, Maíra M; Perez, Eduardo G A; Tsunoda, Roberta H; Góes, Paola A A; Mendes, Camilla M; Assumpção, Mayra E O A; Barnabe, Valquiria H; Nichi, Marcilio

    2018-04-03

    Taurine bulls are highly susceptible to heat stress, leading to increased oxidative stress (OS) and impaired sperm viability. Polyunsaturated fatty acids (PUFAs) supplementation can be an alternative to improve semen quality, which also results in more sperm susceptibility to lipid peroxidation. Moreover, this deleterious effect can be exacerbated in animals affected by heat stress. Vitamin E is a key antioxidant that counteracts lipid peroxidation of sperm membrane caused by OS. Thus, combining PUFAs with vitamin E may improve sperm quality. In this context, this study aimed to evaluate the effect of interaction between PUFAs and vitamin E on sperm quality in Bos taurus bulls under testicular heat stress. Sixteen taurine bulls under testicular heat stress were randomly assigned in four groups: Control, Vitamin E, PUFA, and PUFA + Vitamin E. All groups lasted for 60 days. Samples were cryopreserved/thawed and analyzed for motility variables (CASA), membrane and acrosome integrity, mitochondrial activity, susceptibility to oxidative stress, DNA integrity, and sperm-binding capacity. Results showed that vitamin E had a beneficial effect on some sperm characteristics, whereas PUFA supplementation had an adverse effect when the two treatments were evaluated separately. Finally, the association between PUFAs and vitamin E did not improve sperm quality.

  3. Morphology, Molecular Characteristics, and Demonstration of a Definitive Host for Sarcocystis rommeli from Cattle (Bos taurus) in China.

    Science.gov (United States)

    Hu, J J; Huang, S; Wen, T; Esch, G W; Liang, Y; Li, H L

    2017-10-01

    Sarcocysts of Sarcocystis rommeli were found for the first time in 6 of 34 (17.6%) cattle (Bos taurus) in China. With light microscopy, sarcocysts of S. rommeli were up to 1,130 μm long, with a striated, 4-8-μm-thick cyst wall. Using transmission electron microscopy, the villar protrusions (vp) were 4.7-5.2 × 0.2-0.3 μm, and 0.3-0.5 μm apart from each other. The vp contained microtubules extending from the top of the vp to the middle of the ground substance layer (gsl). A BLAST search of the near full-length 18S rRNA and partial mitochondrial cox1 sequences of S. rommeli revealed 98.7% identity and 99.2% identity with sequences of Sarcocystis bovini in GenBank, respectively. Two domestic cats (Felis catus) fed sarcocysts of S. rommeli shed oocysts/sporocysts in their feces with a prepatent period of 14 to 15 days; the partial mitochondrial cox1 sequences of these oocysts/sporocysts shared the high identities, that is, 99.4% and 99.5%, with cox1 sequences of S. rommeli sarcocysts and S. bovini sarcocysts, respectively. This is the first demonstration of a definitive host for S. rommeli.

  4. Candidate SNPs for carcass and meat traits in Nelore animals and in their crosses with Bos taurus

    Directory of Open Access Journals (Sweden)

    Rogério Abdallah Curi

    2012-02-01

    Full Text Available The objective of this work was to evaluate the effects of single-nucleotide polymorphisms (SNPs in the genes IGF1 (AF_017143.1:g.198C>T, MSTN (AF_320998.1:g.433C>A, MYOD1 (NC_007313:g.1274A>G and MYF5 (NC_007303:g.1911A>G on carcass and meat traits in Nelore (Bos indicus and Nelore x B. taurus. A total of 300 animals were genotyped and phenotyped for rib eye area (REA, backfat thickness (BT, intramuscular fat (IF, shear force (SF and myofibrillar fragmentation index (MFI. The effects of allele substitution for each SNP were estimated by regression of the evaluated phenotypes on the number of copies of a particular allele using the general linear model. The polymorphism at IGF1 was non-informative in Nelore animals. In crossbred animals, the IGF1 C allele was associated with greater REA. However, this relation was not significant after Bonferroni correction for multiple testing. The A allele of the MSTN polymorphism was absent in Nelore cattle and was only found in two crossbred animals. The polymorphisms of MYOD1 and MYF5 were little informative in Nelore animals with G allele frequency of 0.097 and A allele frequency of 0.031, respectively. These markers show no association with the analyzed traits in the total sample of evaluated animals.

  5. Model explanation of the seasonal variation of δ18O in cow (Bos taurus) hair under temperate conditions.

    Science.gov (United States)

    Chen, Guo; Schnyder, Hans; Auerswald, Karl

    2017-03-23

    Oxygen isotopes (δ18O) in animal and human tissues are expected to be good recorders of geographical origin and migration histories. However, seasonal variation of δ18O may diminish the origin information in the tissues. Here the seasonality of δ18O in tail hair was investigated in a domestic suckler cow (Bos taurus) that underwent different ambient conditions, physiological states, keeping and feeding during five years. A detailed mechanistic model was built to explain this variation. The measured δ18O in hair significantly related (p < 0.05) to the δ18O in meteoric water in a regression analysis. Modelling suggested that this relation was only partly derived from the direct influence of feed moisture. Ambient conditions (temperature, moisture) also affected the animal itself (drinking water demand, transcutaneous vapor etc.). The clear temporal variation thus resulted from complex interactions with multiple influences. The twofold influence of ambient conditions via the feed and via the animal itself is advantageous for tracing the geographic origin because δ18O is then less influenced by variations in moisture uptake; however, it is unfavorable for indicating the production system, e.g. to distinguish between milk produced from fresh grass or from silage. The model is versatile but needs testing under a wider range of conditions.

  6. Fine mapping of a quantitative trait locus for bovine milk fat composition on Bos taurus autosome 19.

    Science.gov (United States)

    Bouwman, Aniek C; Visker, Marleen H P W; van Arendonk, Johana M; Bovenhuis, Henk

    2014-02-01

    A major quantitative trait locus (QTL) for milk fat content and fatty acids in both milk and adipose tissue has been detected on Bos taurus autosome 19 (BTA19) in several cattle breeds. The objective of this study was to refine the location of the QTL on BTA19 for bovine milk fat composition using a denser set of markers. Opportunities for fine mapping were provided by imputation from 50,000 genotyped single nucleotide polymorphisms (SNP) toward a high-density SNP panel with up to 777,000 SNP. The QTL region was narrowed down to a linkage disequilibrium block formed by 22 SNP covering 85,007 bp, from 51,303,322 to 51,388,329 bp on BTA19. This linkage disequilibrium block contained 2 genes: coiled-coil domain containing 57 (CCDC57) and fatty acid synthase (FASN). The gene CCDC57 is minimally characterized and has not been associated with bovine milk fat previously, but is expressed in the mammary gland. The gene FASN has been associated with bovine milk fat and fat in adipose tissue before. This gene is a likely candidate for the QTL on BTA19 because of its involvement in de novo fat synthesis. Future studies using sequence data of both CCDC57 and FASN, and eventually functional studies, will have to be pursued to assign the causal variant(s). Copyright © 2014 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  7. Alcelaphine gammaherpesvirus 1-induced malignant catarrhal fever in a Watusi ( Bos taurus africanus) steer in a North American game park.

    Science.gov (United States)

    Bildfell, Robert J; Li, Hong; Alcantar, Benjamin E; Cunha, Cristina W; Bradway, Dan S; Thomas, Kirsten S

    2017-07-01

    A 10-y-old Watusi ( Bos taurus africanus) steer housed at a drive-through game park in Winston, Oregon developed severe clinical illness including fever, marked nasal discharge, injected scleral and conjunctival membranes, plus oral hemorrhages and erosions. The animal responded poorly to supportive treatment and was euthanized. Additional gross findings at postmortem examination included papules and erosive lesions on the tongue, hemorrhagic large intestine, and multifocal cardiac hemorrhages. Histopathologic findings included multifocal lymphoplasmacytic vasculitis plus fibrin exudation in heart and tongue. Total DNA obtained from the splenic samples was positive for alcelaphine gammaherpesvirus 1 (AlHV-1) as tested by a multiplex PCR for malignant catarrhal fever (MCF) viruses. The AlHV-1 detection was further confirmed by amplification and sequencing of a viral DNA polymerase gene fragment, which was identical to AlHV-1 sequences in GenBank. This was the first diagnosis of clinical wildebeest-associated MCF on these premises, although wildebeest have been held at the park for over 25 y. This disease is sporadic in North America and should be considered as a differential diagnosis for febrile illness with ulcerative oral lesions in ruminants.

  8. Rumen ciliates of domestic cattle (Bos taurus taurus) in Kastamonu, Turkey, with the description of a new species.

    Science.gov (United States)

    Gürelli, Gözde

    2016-10-01

    Species composition and distribution of ciliates were investigated in the rumen contents of 25 domestic cattle (Bos taurus taurus L.) living in Kastamonu, Turkey. Forty-seven species and 37 morphotypes representing 15 genera were identified. Of them, a new species of Ostracodinium was recognized and described as Ostracodinium anatolicum n. sp. This new species has two caudal lobes. The dorsal lobe is small and rounded and the ventral lobe is triangular shaped and bent toward the dorsal side like a thick hook. Furthermore, the anterior end of the macronucleus (1/5 of the length) is bent toward the left like a hook. The density of rumen ciliates in cattle was 96.8±43.3×104cellsmL-1 and the mean number of ciliate species per host was 14.2±4.4. Entodinium longinucleatum, E. nanellum, E. simulans and Isotricha prostoma were the most abundant species, each with a prevalence of 88%. Entodinium chatterjeei, E. bifidum m. monospinosum, Hsiungia triciliata, Oligoisotricha bubali, Ostracodinium dogieli, O. mammosum and O. munham are new host records for cattle from Turkey. Copyright © 2016 Elsevier GmbH. All rights reserved.

  9. Evolutionary process of Bos taurus cattle in favourable versus unfavourable environments and its implications for genetic selection

    Science.gov (United States)

    O'Neill, Christopher J; Swain, David L; Kadarmideen, Haja N

    2010-01-01

    The evolutionary processes that have enabled Bos taurus cattle to establish around the globe are at the core to the future success of livestock production. Our study focuses on the history of cattle domestication including the last 60 years of B. taurus breeding programmes in both favourable and unfavourable environments and its consequences on evolution and fitness of cattle. We discuss the emergence of ‘production diseases’ in temperate production systems and consider the evolutionary genetics of tropical adaptation in cattle and conclude that the Senepol, N'Dama, Adaptaur and Criollo breeds, among others with similar evolutionary trajectories, would possess genes capable of improving the productivity of cattle in challenging environments. Using our own experimental evidence from northern Australia, we review the evolution of the Adaptaur cattle breed which has become resistant to cattle tick. We emphasize that the knowledge of interactions between genotype, environment and management in the livestock systems will be required to generate genotypes for efficient livestock production that are both economically and environmentally sustainable. Livestock producers in the 21st century will have less reliance on infrastructure and veterinary products to alleviate environmental stress and more on the animal's ability to achieve fitness in a given production environment. PMID:25567936

  10. Genomic divergence of zebu and taurine cattle identified through high-density SNP genotyping

    Science.gov (United States)

    Natural selection has molded the evolution across all taxa. At an arguable date of around 330,000 years ago there were already at least two different types of cattle that became ancestors of nearly all modern cattle, the Bos primigenius taurus more adapted to temperate climates and the tropically ad...

  11. Respiratory Complex I in Bos taurus and Paracoccus denitrificans Pumps Four Protons across the Membrane for Every NADH Oxidized.

    Science.gov (United States)

    Jones, Andrew J Y; Blaza, James N; Varghese, Febin; Hirst, Judy

    2017-03-24

    Respiratory complex I couples electron transfer between NADH and ubiquinone to proton translocation across an energy-transducing membrane to support the proton-motive force that drives ATP synthesis. The proton-pumping stoichiometry of complex I (i.e. the number of protons pumped for each two electrons transferred) underpins all mechanistic proposals. However, it remains controversial and has not been determined for any of the bacterial enzymes that are exploited as model systems for the mammalian enzyme. Here, we describe a simple method for determining the proton-pumping stoichiometry of complex I in inverted membrane vesicles under steady-state ADP-phosphorylating conditions. Our method exploits the rate of ATP synthesis, driven by oxidation of NADH or succinate with different sections of the respiratory chain engaged in catalysis as a proxy for the rate of proton translocation and determines the stoichiometry of complex I by reference to the known stoichiometries of complexes III and IV. Using vesicles prepared from mammalian mitochondria (from Bos taurus) and from the bacterium Paracoccus denitrificans, we show that four protons are pumped for every two electrons transferred in both cases. By confirming the four-proton stoichiometry for mammalian complex I and, for the first time, demonstrating the same value for a bacterial complex, we establish the utility of P. denitrificans complex I as a model system for the mammalian enzyme. P. denitrificans is the first system described in which mutagenesis in any complex I core subunit may be combined with quantitative proton-pumping measurements for mechanistic studies. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  12. Características de ovários de fêmeas zebu (Bos taurus indicus, colhidos em abatedouros

    Directory of Open Access Journals (Sweden)

    Neves M.M.

    2002-01-01

    Full Text Available The ovarian characteristics of pregnant and non pregnant zebu cows (Bos taurus indicus were studied. The ovaries were obtained in slaughterhouses, identified and divided into: group I, non pregnant animals (GI, n=43 and group II, pregnant animals (GII, n=43. The ovaries were measured and cut in their lenght for measuring and evaluation of the corpus luteum (CL characteristics. For the GI the measures for the left ovary were 2.5 ± 0.70, 1.61 ± 0.32 and 1.22 ± 0.39cm, respectively for length, width and thickness, and 2.62 ± 0.54, 1.71 ± 0.36 and 1.21 ± 0.31cm for the right ovary. For the GII the measures for the left ovary were 2.78 ± 0.48, 1.80 ± 0.33 and 1.23 ± 0.35cm, respectively for length, width and thickness and 2.84 ± 0.50, 1.74 ± 0.45 and 1.21 ± 0.40cm for the right one. Both groups presented 51.2% of CL in the left ovary and 48.8% in the right one, with high incidence of CL enclosed and without cavity. The mean for the diameter of the CL was 1.59±0.32cm for GI e 1.82±0.35cm for GII. The results suggest the need to consider carefully the size of the ovary and the enclosed characteristics of the CL when performing gynecological examination of zebu cows via rectal palpation.

  13. Concentração de testosterona em um bovino Bos Indicus com varicocele bilateral: relato de caso

    Directory of Open Access Journals (Sweden)

    Marion Burkhardt Koivisto

    2002-01-01

    Full Text Available Um reprodutor bovino, Bos indicus, com varicocele bilateral detectado por palpação e ultra-sonografia foi acompanhado por um período de 24 meses quanto à biometria testicular, valores espermáticos e concentração de testosterona comparados entre as estações do ano e outros animais da mesma espécie. As alterações morfológicas dos defeitos maiores e menores não variaram entre o touro com a patologia e os demais touros, no entanto, durante o verão o touro com varicocele apresentou maior percentual de defeitos totais se comparado aos demais touros da mesma espécie (49,86%±6,9 e 27,91%±2,9. O animal apresentou maior percentual de defeitos maiores no verão se comparado às outras estações do ano. Os achados de necrópsia confirmaram o diagnóstico clínico. Pode-se concluir que esta patologia, caracterizada por trombose nos vasos do cordão espermático, comprometeu a termoregulação determinando degeneração testicular severa. O aumento das concentrações de testosterona sérica sugerem a diminuição da retenção de esteroides nos testículos pelo plexo pampiniforme, a produção espermática estava anormal.

  14. Composite Selection Signals for Complex Traits Exemplified Through Bovine Stature Using Multibreed Cohorts of European and African Bos taurus

    Science.gov (United States)

    Randhawa, Imtiaz A. S.; Khatkar, Mehar S.; Thomson, Peter C.; Raadsma, Herman W.

    2015-01-01

    Understanding the evolution and molecular architecture of complex traits is important in domestic animals. Due to phenotypic selection, genomic regions develop unique patterns of genetic diversity called signatures of selection, which are challenging to detect, especially for complex polygenic traits. In this study, we applied the composite selection signals (CSS) method to investigate evidence of positive selection in a complex polygenic trait by examining stature in phenotypically diverse cattle comprising 47 European and 8 African Bos taurus breeds, utilizing a panel of 38,033 SNPs genotyped on 1106 animals. CSS were computed for phenotypic contrasts between multibreed cohorts of cattle by classifying the breeds according to their documented wither height to detect the candidate regions under selection. Using the CSS method, clusters of signatures of selection were detected at 26 regions (9 in European and 17 in African cohorts) on 13 bovine autosomes. Using comparative mapping information on human height, 30 candidate genes mapped at 12 selection regions (on 8 autosomes) could be linked to bovine stature diversity. Of these 12 candidate gene regions, three contained known genes (i.e., NCAPG-LCORL, FBP2-PTCH1, and PLAG1-CHCHD7) related to bovine stature, and nine were not previously described in cattle (five in European and four in African cohorts). Overall, this study demonstrates the utility of CSS coupled with strategies of combining multibreed datasets in the identification and discovery of genomic regions underlying complex traits. Characterization of multiple signatures of selection and their underlying candidate genes will elucidate the polygenic nature of stature across cattle breeds. PMID:25931611

  15. Cow allergen (Bos d2) and endotoxin concentrations are higher in the settled dust of homes proximate to industrial-scale dairy operations.

    Science.gov (United States)

    Williams, D' Ann L; McCormack, Meredith C; Matsui, Elizabeth C; Diette, Gregory B; McKenzie, Shawn E; Geyh, Alison S; Breysse, Patrick N

    2016-01-01

    Airborne contaminants produced by industrial agricultural facilities contain chemical and biological compounds that can impact the health of residents living in close proximity. Settled dust can be a reservoir for these contaminants and can influence long-term exposures. In this study, we sampled the indoor- and outdoor-settled dust from 40 homes that varied in proximity to industrial-scale dairies (ISD; industrial-scale dairy, a term used in this paper to describe a large dairy farm and adjacent waste sprayfields, concentrated animal feeding operation or animal feeding operation, that uses industrial processes) in the Yakima Valley, Washington. We analyzed settled dust samples for cow allergen (Bos d2, a cow allergen associated with dander, hair, sweat and urine, it is a member of the lipocalin family of allergens associated with mammals), mouse allergen (Mus m1; major mouse allergen, a mouse urinary allergen, in the lipocalin family), dust mite allergens (Der p1 (Dermatophagoides pteronissinus 1) and Der f1 (Dermatophagoides farinae 1)), and endotoxin (a component of the cell walls of gram negative bacteria, lipopolysaccharide, which can be found in air and dust and can produce a strong inflammatory response). A concentration gradient was observed for Bos d2 and endotoxin measured in outdoor-settled dust samples based on proximity to ISD. Indoor-settled dust concentrations of Bos d2 and endotoxin were also highest in proximal homes. While the associated health effects of exposure to cow allergen in settled dust is unknown, endotoxin at concentrations observed in these proximal homes (100 EU/mg) has been associated with increased negative respiratory health effects. These findings document that biological contaminants emitted from ISDs are elevated in indoor- and outdoor-settled dust samples at homes close to these facilities and extend to as much as three miles (4.8 km) away.

  16. Heat tolerance in two tropically adapted Bos taurus breeds, Senepol and Romosinuano, compared with Brahman, Angus, and Hereford cattle in Florida.

    Science.gov (United States)

    Hammond, A C; Olson, T A; Chase, C C; Bowers, E J; Randel, R D; Murphy, C N; Vogt, D W; Tewolde, A

    1996-02-01

    Two trials were conducted with heifers to determine heat tolerance among temperate Bos taurus (Angus, Hereford), Bos indicus (Brahman), tropical Bos taurus (Senepol, Romosinuano), and the reciprocal crosses of Hereford and Senepol. Differences among breeds in temperament score, circulating concentrations of cortisol, and blood packed cell volume were also investigated. Trial 1 used 43 Angus, 28 Brahman, 12 Hereford, 23 Romosinuano, 16 Senepol, 5 Hereford x Senepol (H x S), and 5 Senepol x Hereford (S x H) heifers. Trial 2 used 36 Angus, 31 Brahman, 9 Hereford, 14 Senepol, 19 H x S, and 10 S x H heifers. On the hottest summer date in Trial 1, rectal temperature of Angus was greater (P Senepol, or Romosinuano. Rectal temperature and plasma cortisol were significantly less in Senepol than in Brahman, suggesting that the differences in rectal temperature between these breeds may be due to differences in stress response possibly related to differences in temperament. Reciprocal crosses of Hereford and Senepol had rectal temperatures nearly as low as that of Senepol and displayed substantial heterosis (-9.4%, P Senepol heifers, and Brahman had significantly slower respiration rates than Romosinuano or Senepol. On the hottest summer date in Trial 2, rectal temperature in Angus heifers was greater (P Senepol had rectal temperatures similar to that of Senepol, or heterosis for log10 rectal temperature was similar to that in Trial 1 (-9.8%, P Senepol, except that plasma cortisol was not different between Brahman and Senepol on the hottest summer date. On this date, rectal temperature did not differ between Brahman and Senepol, which supports the hypothesis that there is a relationship between response to stress and rectal temperature that helps explain differences in rectal temperature between Brahman and Senepol. The results of these trials demonstrate heat tolerance of the Senepol and Romosinuano, two Bos taurus breeds. Furthermore, the results suggest a substantial level

  17. Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

    OpenAIRE

    Norberto Villa-Duque; Claudia Marcela Amaya-Torres; Darwin García-Rojas; Natalia Nieto-Omeara; Natalia Terán-Acuña

    2016-01-01

    En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander). El estudio consis...

  18. Polymorphisms in the bovine hemoglobin-beta gene provide evidence for gene-flow between wild species of Bos (Bibos) and domestic cattle in Southeast Asia.

    Science.gov (United States)

    Tanaka, Kazuaki; Takizawa, Tatsuya; Dorji, Tashi; Amano, Takashi; Mannen, Hideyuki; Maeda, Yoshizane; Yamamoto, Yoshio; Namikawa, Takao

    2011-02-01

    The electrophoretic variation in bovine hemoglobin-beta (HBB) is one of the most investigated genetic markers. The presence of a unique HBB variant, HBB(X), in Southeast Asian cattle has been reputed as a sign of gene-flow from wild bovine species. In this study, we analyzed the DNA sequences of HBB genes in domestic and wild bovine species to verify this belief. Isoelectric focusing of HBB chain revealed that the HBB(X) in domestic cattle had dimorphism and was separated into HBB(X1) and HBB(X2). The HBB(X1) had the same DNA sequence of the common HBB variant in gayal (Bos gaurus frontalis), while some of the HBB(X2) were identical with that of Cambodian banteng (Bos javanicus birmanicus). As a result, we confirmed that the bovine HBB variants can be a good indicator of introgression between wild and domestic cattle. The HBB(X1) was always predominant to HBB(X2) in the continental populations, suggesting that the gaur had contributed to the gene pool of domestic cattle in this region much more than the banteng. On the other hand, the mitochondrial DNA analysis could not detect gene-flow from wild species. Autosomal markers that can trace the phylogeny between alleles are suitable for the assessment of bovine interspecific introgression. © 2010 The Authors. Journal compilation © 2010 Japanese Society of Animal Science.

  19. Bovine alpha-lactalbumin C and alpha S1-, beta- and kappa-caseins of Bali (Banteng) cattle, bos (Bibos) javanicus.

    Science.gov (United States)

    Bell, K; Hopper, K E; McKenzie, H A

    1981-01-01

    An electrophoretic examination is made of mild samples taken from eight Bali (banteng) cattle, Bos (bibos) javanicus, at Beatrice Hills, Northern territory, Australia. Starch-gel electrophoresis at pH 9.5 (NaOH-H3BO3 buffer) and filter-paper electrophoresis at pH 8.6 (diethylbarbiturate buffer) indicate that all samples contain a new alpha-lactalbumin variant, designated alpha-lactalbumin C. The order of mobility for bovine variants is / greater than B greater than C. The C variant differs from the common B variant in having one more amide residue (substitution or Gln for Glu). Examination of milk samples by urea-starch-gel electrophoresis at alkaline pH indicates that there is a new alpha S1-casein variant, designated alpha S1-casein EBali, present in some samples. No new kappa-casein variant is detected by this method (all samples typing as kappa-casein B). A new variant of beta-casein, designated A4, is detected by urea-starch-gel electrophoresis at low pH. The variants of milk proteins observed in this paper and in Bell et al. (1981) are discussed in relation to those of other members of the Bovinae, especially the yak, bos (Poephagus) grunniens.

  20. Altas concentrações de FSH-p na maturação in vitro de oócitos Bos indicus High concentrations of FSH-p on the in vitro maturation of Bos indicus oocytes

    Directory of Open Access Journals (Sweden)

    Joana D'Arc Rocha Alves

    2001-08-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de diferentes concentrações de um FSH-p comercial sobre a maturação nuclear de oócitos Bos indicus, clivagem e desenvolvimento in vitro de embriões até estádios de blastocisto. Após seleção e transferência para o meio TCM 199/HEPES suplementado com diferentes concentrações de FSH-p (T1 = 10mg/m ; T2 = 20mg/m ; T3 = 40mg/m, os oócitos foram incubados, durante 24 horas, a 39ºC em atmosfera úmida contendo 5% de CO2. Parte dos oócitos foram retirados para análise da maturação nuclear e os demais foram transferidos para o meio de fecundação (mDM. Após 18 horas de incubação nas mesmas condições atmosféricas mencionadas para os oócitos, os presumíveis zigotos foram distribuídos no meio de desenvolvimento embrionário (KSOM contendo monocamada de células da granulosa. As porcentagens de metáfase II, de clivagem e de blastocisto foram, respectivamente, de 81,8/62,5/17,6% (T1; 55,6/64,0/19,5% (T2 e 50,0/65,0/16,3% (T3. A análise estatística revelou que uma menor porcentagem (P £ 0,05 de oócitos tratados com 20mg/m e 40mg/m de FSH-p alcançou o estádio de metáfase II e que as taxas de clivagem e blastocisto não diferiram (P ³ 0,05 entre os tratamentos. Os resultados permitem concluir que a adição de 20mg/m e 40mg/m de FSH-p ao meio de cultura interfere no processo de maturação nuclear, mas todas as concentrações testadas podem ser utilizadas sem prejuízo aparente para a clivagem e o posterior desenvolvimento embrionário.The aim of this work was to evaluate the efficiency of different concentrations of a commercial FSH-p on the nuclear maturation of Bos indicus oocytes, cleavage and in vitro development of embryos until blastocyst stages. The oocytes were selected and transferred to the maturation medium (TCM 199/25 mM HEPES supplemented with different concentrations of FSH-p (T1 = 10mg/m ; T2 - 20mg/m ; T3 - 40mg/m and after 24 hours of incubation, at 39º

  1. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle.

    Science.gov (United States)

    Ali, Abdirahman A; O'Neill, Christopher J; Thomson, Peter C; Kadarmideen, Haja N

    2012-07-27

    Infectious bovine keratoconjunctivitis (IBK) or 'pinkeye' is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species) eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre

  2. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    Directory of Open Access Journals (Sweden)

    Ali Abdirahman A

    2012-07-01

    Full Text Available Abstract Background Infectious bovine keratoconjunctivitis (IBK or ‘pinkeye’ is an economically important ocular disease that significantly impacts animal performance. Genetic parameters for IBK infection and its genetic and phenotypic correlations with cattle tick counts, number of helminth (unspecified species eggs per gram of faeces and growth traits in Australian tropically adapted Bos taurus cattle were estimated. Methods Animals were clinically examined for the presence of IBK infection before and after weaning when the calves were 3 to 6 months and 15 to 18 months old, respectively and were also recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive for the post-weaning dataset. Genetic correlations between tick and helminth eggs counts were moderate and positive for both datasets. Phenotypic correlations of IBK incidence with helminth eggs per gram of faeces were moderate and positive for both datasets, but were close to zero for both datasets with tick counts. Conclusions Our results suggest that genetic selection against IBK incidence in tropical cattle is feasible and that calves genetically prone to acquire IBK infection could also be genetically prone to have a slower growth. The positive genetic correlations among weight traits and between tick and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects. Genetic correlations between IBK incidence

  3. Effects of calcium salts of soybean oil on factors that influence pregnancy establishment in Bos indicus beef cows.

    Science.gov (United States)

    Cooke, R F; Cappellozza, B I; Guarnieri Filho, T A; Depner, C M; Lytle, K A; Jump, D B; Bohnert, D W; Cerri, R L A; Vasconcelos, J L M

    2014-05-01

    The objective of this experiment was to compare fatty acid (FA) concentrations in plasma and reproductive tissues as well as hormones and expression of genes associated with pregnancy establishment in beef cows supplemented or not with Ca salts of soybean oil (CSSO) beginning after timed AI. Ninety nonlactating multiparous Nelore (Bos indicus) cows were timed inseminated on d 0 of the experiment and divided into 18 groups of 5 cows/group. Groups were randomly assigned to receive (as-fed basis) 100 g of a protein-mineral mix plus 100 g of ground corn per cow daily in addition to 1) 100 g/cow daily of CSSO (n = 9) or 2) 100 g/cow daily of kaolin (CON; rumen-inert indigestible substance; n = 9). All groups were maintained in a single Brachiaria brizanta pasture (24 ha) with ad libitum access to forage and water. However, groups were segregated daily and offered treatments individually at the working facility during the experimental period (d 0 to 18). Blood samples were collected and transrectal ultrasonography was performed to verify ovulation and estimate corpus luteum (CL) volume immediately before AI (d 0) and on d 7 and 18 of the experiment. On d 19, 36 cows (18 cows/treatment; 2 cows/group) diagnosed without the presence of a CL on d 0 but with a CL greater than 0.38 cm(3) in volume on d 7 and 18 were slaughtered for collection of conceptus, uterine luminal flushing, and tissue samples from the CL and endometrium. Cows receiving CSSO had greater concentrations of linoleic and other ω-6 FA in plasma (P < 0.01), endometrium (P ≤ 0.05), CL (P ≤ 0.05), and conceptus (P ≤ 0.08) compared to CON. On d 7 of the experiment, CSSO-supplemented cows had greater plasma progesterone concentrations (P < 0.01) and CL volume (P = 0.02) compared to CON, whereas no treatment effects were detected (P ≥ 0.15) for these parameters on d 18 (treatment × day interaction; P < 0.01). Cows receiving CSSO tended (P = 0.09) to have greater concentrations of interferon-tau in the

  4. Social relationships enhance the time spent eating and intake of a novel diet in pregnant Hanwoo (Bos taurus coreanae) heifers.

    Science.gov (United States)

    Shin, Dong-Han; Kang, Hyun-Min; Seo, Seongwon

    2017-01-01

    The objective of this study was to evaluate the effects of social relationships on the feed intake, eating behavior, and growth, upon exposure to a novel diet, in Hanwoo (Bos taurus coreanae) heifers during pregnancy. Twenty-four pregnant Hanwoo heifers, averaging 438 ± 27.8 kg in weight, 21 months in age, and 194 ± 8.5 days in pregnancy, were involved in a two-month (eight weeks) experiment. The heifers were randomly assigned to either the single housing group (SG; one individual per pen, n = 12), or the paired housing group (PG; two individuals per pen, n = 12). All pens were of the same size (5 × 5 m) and provided with one feed bin, which automatically recorded the individual feed intake and eating behavior. As the experiment began, the diet of the heifers was switched from a total mixed ration (TMR; 250 g/kg ryegrass straw and 750 g/kg concentrate mix) to a forage-only diet (mixed hay cubes composed of 500 g/kg alfalfa, 250 g/kg timothy, and 250 g/kg blue grass hay). The heifers were fed ad libitum twice a day. The individual feed intake and eating behavior were recorded daily throughout the experiment, and body weights (BWs) were measured every four weeks before the morning feeding. PG animals visited the feed bin 22% less often than SG. PG, however, stayed 39% longer in the feed bin and consumed 40% more feed per visit, compared with SG. Consequently, PG heifers spent 23% more time in eating and had 16% more daily dry matter intake than SG during the experiment. Average daily gain during the experimental period tended to be greater in PG than in SG. When pregnant Hanwoo heifers encountered a novel diet, social relationships (i.e., presence of a pen-mate) enhanced their time spent eating and feed intake. Social interactions, even with an unfamiliar individual, may be helpful for pregnant Hanwoo heifers cope with a diet challenge compared to solitary situation.

  5. Comportamento diário e reprodutivo de fêmeas bovinas mestiças (Zebu x Holandesa portadoras de dermatite digital = Daily and reproductive behavior of female crossbred (Bos indicus x Bos taurus cattle bearing digital dermatitis

    Directory of Open Access Journals (Sweden)

    Luiz Antônio Franco da Silva

    2009-04-01

    Full Text Available No presente estudo avaliaram-se aspectos relacionados ao comportamentodiário e reprodutivo de fêmeas bovinas mestiças (Zebu x Holandesa portadoras de dermatite digital, durante um período de 24 meses. Os bovinos foram distribuídos em três grupos (GI, GII, GIII, compostos por dez animais cada. No GI foram alocadas fêmeas bovinas portadoras de dermatite digital na forma erosiva, no GII na forma verrucosa eo GIII composto por animais clinicamente saudáveis. No comportamento diário e alimentar, os animais foram observados no piquete e durante a ordenha. Avaliaram-se a atitude do animal, se em posição quadrupedal ou decúbito, período de alimentação, frequência de ingestão de água, tempo de ruminação e ócio. Quanto ao comportamento reprodutivo, estudaram-se o período de serviço, presença de cisto ovariano, retenção de envoltórios fetais, metrite, sinaisexternos de cio, consistência dos ovários e do útero, número de serviços, prenhez e parto. Ao final do estudo, concluiu-se que a dermatite digital bovina, especialmente do tipo verrucosa, alterou de forma negativa o comportamento diário e alimentar de fêmeas bovinasmestiças (Zebu x Holandesa, observadas em diferentes situações. Com relação ao comportamento reprodutivo, ao relacioná-lo à presença ou ausência de dermatite digital, não foi possível observar diferenças entre os grupos, em relação aos parâmetros avaliados.This present study aimed to evaluate aspects related to daily and reproductive behavior of female crossbred (Bos indicus x Bostaurus cattle bearing digital dermatitis, raised semi-extensively, during 24 months. The animals were distributed in three groups (GI, GII, and GIII with ten animals each. GI received cows bearing the erosive type of digital dermatitis, whilst GII received those ofverroucous type and GIII received clinically healthy animals. Animals were observed during milking and grassing for daily and feeding behavior. Animal

  6. Bos taurus genome assembly.

    Science.gov (United States)

    Liu, Yue; Qin, Xiang; Song, Xing-Zhi Henry; Jiang, Huaiyang; Shen, Yufeng; Durbin, K James; Lien, Sigbjørn; Kent, Matthew Peter; Sodeland, Marte; Ren, Yanru; Zhang, Lan; Sodergren, Erica; Havlak, Paul; Worley, Kim C; Weinstock, George M; Gibbs, Richard A

    2009-04-24

    We present here the assembly of the bovine genome. The assembly method combines the BAC plus WGS local assembly used for the rat and sea urchin with the whole genome shotgun (WGS) only assembly used for many other animal genomes including the rhesus macaque. The assembly process consisted of multiple phases: First, BACs were assembled with BAC generated sequence, then subsequently in combination with the individual overlapping WGS reads. Different assembly parameters were tested to separately optimize the performance for each BAC assembly of the BAC and WGS reads. In parallel, a second assembly was produced using only the WGS sequences and a global whole genome assembly method. The two assemblies were combined to create a more complete genome representation that retained the high quality BAC-based local assembly information, but with gaps between BACs filled in with the WGS-only assembly. Finally, the entire assembly was placed on chromosomes using the available map information.Over 90% of the assembly is now placed on chromosomes. The estimated genome size is 2.87 Gb which represents a high degree of completeness, with 95% of the available EST sequences found in assembled contigs. The quality of the assembly was evaluated by comparison to 73 finished BACs, where the draft assembly covers between 92.5 and 100% (average 98.5%) of the finished BACs. The assembly contigs and scaffolds align linearly to the finished BACs, suggesting that misassemblies are rare. Genotyping and genetic mapping of 17,482 SNPs revealed that more than 99.2% were correctly positioned within the Btau_4.0 assembly, confirming the accuracy of the assembly. The biological analysis of this bovine genome assembly is being published, and the sequence data is available to support future bovine research.

  7. Bos taurus genome assembly

    Directory of Open Access Journals (Sweden)

    Sodergren Erica

    2009-04-01

    Full Text Available Abstract Background We present here the assembly of the bovine genome. The assembly method combines the BAC plus WGS local assembly used for the rat and sea urchin with the whole genome shotgun (WGS only assembly used for many other animal genomes including the rhesus macaque. Results The assembly process consisted of multiple phases: First, BACs were assembled with BAC generated sequence, then subsequently in combination with the individual overlapping WGS reads. Different assembly parameters were tested to separately optimize the performance for each BAC assembly of the BAC and WGS reads. In parallel, a second assembly was produced using only the WGS sequences and a global whole genome assembly method. The two assemblies were combined to create a more complete genome representation that retained the high quality BAC-based local assembly information, but with gaps between BACs filled in with the WGS-only assembly. Finally, the entire assembly was placed on chromosomes using the available map information. Over 90% of the assembly is now placed on chromosomes. The estimated genome size is 2.87 Gb which represents a high degree of completeness, with 95% of the available EST sequences found in assembled contigs. The quality of the assembly was evaluated by comparison to 73 finished BACs, where the draft assembly covers between 92.5 and 100% (average 98.5% of the finished BACs. The assembly contigs and scaffolds align linearly to the finished BACs, suggesting that misassemblies are rare. Genotyping and genetic mapping of 17,482 SNPs revealed that more than 99.2% were correctly positioned within the Btau_4.0 assembly, confirming the accuracy of the assembly. Conclusion The biological analysis of this bovine genome assembly is being published, and the sequence data is available to support future bovine research.

  8. El bosón de Higgs no te va a hacer la cama la física como nunca te la han contado

    CERN Document Server

    Santaolalla, Javier

    2016-01-01

    Viajes en el tiempo, agujeros negros, motores de antimateria, aceleración del universo… La física moderna suena a película, pero es ciencia, de la de verdad verdadera, la que nos cuenta una historia fascinante de descubrimientos y sueños cumplidos, de luchas y disputas, de pasión por comprender la naturaleza. Este divertido libro te ayudará a entender de una vez por todas lo que nos rodea, desde lo más pequeño a lo más grande, y a saber que el bosón de Higgs no te va a hacer la cama, ¡ni aunque le insistas!

  9. Absolute configuration of a hydroxyfuranoid acid from the pelage of the genus Bos, 18-(6S,9R,10R)-bovidic acid.

    Science.gov (United States)

    Ishii, Hideki; Krane, Sonja; Itagaki, Yasuhiro; Berova, Nina; Nakanishi, Koji; Weldon, Paul J

    2004-08-01

    Pelage extracts of the banteng (Bos javanicus), the domestic cattle (B. taurus), the gaur (B. frontalis), and the yak (B. grunniens) were investigated by FABMS and NMR. An 18-carbon hydroxyfuranoid acid, 1 (10-hydroxy-6,9-oxidooctadecanoic acid), first reported from the wool of the domestic sheep (Ovis aries) was confirmed in B. frontalis; we suspend judgment on the occurrence of this compound in the other species we examined. The stereochemistry of 1, determined by Mosher NMR and CD tweezer methods, was assigned as 6S, 9R, 10R. We propose the name bovidic acid for this and homologous alpha-hydroxylated 2,5-tetrahydrofuranoid carboxylic acids, in reference to the family Bovidae, which represents their sole known natural source.

  10. Seminal plasma proteins and their relationship with percentage of morphologically normal sperm in 2-year-old Brahman (Bos indicus) bulls.

    Science.gov (United States)

    Boe-Hansen, G B; Rego, J P A; Crisp, J M; Moura, A A; Nouwens, A S; Li, Y; Venus, B; Burns, B M; McGowan, M R

    2015-11-01

    The objective was to determine the relationship between seminal plasma proteins and sperm morphology in Bos indicus bulls of the Brahman breed. Fifty-six 24-month-old Australian Brahman bulls were electroejaculated and samples were examined to determine the percentage of morphologically normal sperm (PNS24) and the seminal plasma protein composition was identified and quantified by 2-D gel electrophoresis. The total integrated optical density of 152 seminal plasma protein spots (SPPs) across all gels was determined using the PDQuest software version 8.0 (Bio Rad, USA). Using a single regression mixed model with the density of individual spots as a covariate for PNS24, 17 SPPs were significantly associated with PNS24 (psperm morphology. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Polycyclic aromatic hydrocarbon oxidation by the white-rot fungus Bjerkandera sp. strain BOS55 in the presence of nonionic surfactants.

    Science.gov (United States)

    Kotterman, M J; Rietberg, H J; Hage, A; Field, J A

    1998-01-20

    The effect of nonionic surfactants on the polycyclic aromatic hydrocarbon (PAH) oxidation rates by the extracellular ligninolytic enzyme system of the white-rot fungus Bjerkandera sp. strain BOS55 was investigated. Various surfactants increased the rate of anthracene, pyrene, and benzo[a]pyrene oxidation by two to fivefold. The stimulating effect of surfactants was found to be solely due to the increased bioavailability of PAH, indicating that the oxidation of PAH by the extracellular ligninolytic enzymes is limited by low compound bioavailability. The surfactants were shown to improve PAH dissolution rates by increasing their aqueous solubility and by decreasing the PAH precipitate particle size. The surfactant Tween 80 was mineralized by Bjerkandera sp. strain BOS55; as a result both the PAH solubilizing activity of Tween 80 and its stimulatory effect on anthracene and pyrene oxidation rates were lost within 24 h after addition to 6-day-old cultures. It was observed that the surfactant dispersed anthracene precipitates recrystallized into larger particles after Tween 80 was metabolized. However, benzo[a]pyrene precipitates remained dispersed, accounting for a prolonged enhancement of the benzo[a]pyrene oxidation rates. Because the endogenous production of H2O2 is also known to be rate limiting for PAH oxidation, the combined effect of adding surfactants and glucose oxidase was studied. The combined treatment resulted in anthracene and benzo[a]pyrene oxidation rates as high as 1450 and 450 mg L-1 d-1, respectively, by the extracellular fluid of 6-day-old fungal cultures. Copyright 1998 John Wiley & Sons, Inc.

  12. GENETIC VARIABILITY OF THE ZEBU CATTLE BREED (Bos indicus IN THE DEPARTAMENT OF HUILA, COLOMBIA USING MICROSATELLITE MOLECULAR MARKERS Variabilidad genética de Zebú (Bos indicus en el departamento del Huila, Colombia, usando marcadores moleculares por microsatélites

    Directory of Open Access Journals (Sweden)

    CARLOS HERNÁNDEZ ESCOBAR

    Full Text Available The polymorphism of 11 microsatellites from zebu cattle (Bos indicus was studied using a commercial multiplex system to estimate genetic variability. Allele frequencies polymorphism information content and heterozygosis were calculated. Allele frequencies revealed that in the analyzed sample the markers were not equally polymorphic. The average allele was 14.2 with the highest values for the TGLA122 microsatellites. The mean heterozygocity was 0.7056 and the polymorphism information content was 0.668. This multiplex analysis could be used for pedigree information and for adequate genetic improvements in breeding programs and paternity test.Para estimar la variabilidad genética, el polimosfismo de 11 microsatélites de vacunos zebú (Bos indicus fue estudiado mediante el sistema comercial multiplex system. Se calcularon frecuencias alélicas, contenido de información polimórfica y heterocigosis. Las frecuencias alélicas de la muestra analizada revelan que los marcadores no fueron equitativamente polimórficos. El alelo promedio fue 14,2 con el mayor valor para los microsatélites TGLA122. El promedio de heterocigosidad fue 0,7056 y el contenido de información polimórfica de 0,668. Este tipo de análisis puede ser usado para información de pedigrí y mejoramiento genético en programas de cría y pruebas de paternidad.

  13. Effects on performance and carcass and meat quality attributes following immunocastration with the gonadotropin releasing factor vaccine Bopriva or surgical castration of Bos indicus bulls raised on pasture in Brazil.

    Science.gov (United States)

    Amatayakul-Chantler, S; Hoe, F; Jackson, J A; Roca, R O; Stegner, J E; King, V; Howard, R; Lopez, E; Walker, J

    2013-09-01

    Bos indicus bulls 20 months of age grazed on pasture in Minas Gerais, Brazil either received 2 doses of the GnRF vaccine Bopriva at d0 and d91 (group IC, n=144) or were surgically castrated on d91 (group SC, n=144). Slaughter on d280, was 27 weeks after castration. Adverse safety issues in 8% of group SC bulls following surgery contrasted with 0% in group IC bulls. At d105 testosterone levels were suppressed to similar levels in both groups. Importantly, group IC bulls had higher live weight, hot carcass weight, ADG (Pnegative effects on carcass or meat quality traits, thus immunocastration was concluded to offer a safe and effective method that provides production gains, and improves animal welfare in Bos indicus beef bulls without impacting meat and carcass quality. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  14. Avaliação das concentrações plasmáticas de cortisol e progesterona em vacas nelore (Bos taurus indicus) submetidas a manejo diário ou manejo semanal

    OpenAIRE

    Maziero, Rosiára Rosária Dias [UNESP; Martin, Ian [UNESP; Mattos, Maria Clara Costa; Ferreira, João Carlos Pinheiro [UNESP

    2012-01-01

    This study evaluates the plasma concentration of progesterone and cortisol in cows submitted to daily or weekly handling. For this experiment, seven primiparous or multiparous Nelore cows (Bos taurus indicus) were monitored for 21 days (experiment 1) and 9 weeks (experiment 2) through rectal palpation and ultrasonographic examination of the female reproductive tract, as well as jugular venipuncture. Plasma concentration of progesterone and cortisol (ng/mL) was determined by radioimmunoassay f...

  15. Proteomic analysis of a 14.2 kDa protein isolated from Bali cattle (Bos sondaicus/javanicus saliva using 1-D SDS-PAGE gel and MALDITOF-TOF mass spectrometer

    Directory of Open Access Journals (Sweden)

    Sulaiman N. Depamede

    2013-07-01

    Full Text Available A 14.2 kDa protein isolated from Bali cattle (Bos sondaicus/javanicus saliva has been reported to have a bactericidal activity. The aim of this study was to analyse the nature of a 14.2 kDa protein using single dimension (1-D sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE and matrix-assisted laser desorption ionization time-of-flight tandem mass spectrometer (MALDI TOF/TOF. The protein was isolated by means of polyethylene glycol (PEG/sodium sulfate aqueous two-phase system, and then determined by 12.5% SDS-PAGE. A band of 14.2 kDa was sliced and analysed by MALDI TOF/TOF mass spectrometer using a 5800 proteomics analyzer. Mascot search and National Center for Biotechnology Information (NCBI Blast search revealed that the spot of 1-D SDS-PAGE consisted of three proteins: zymogen granule protein 16 homologue B, pancreatic adenocarcinoma upregulated factor-like, and prolactin-inducible protein homologue precursor. The three proteins have been observed in Bos taurus and other species such as mouse. The actual nature of the proteins and their function in Bali cattle (Bos sondaicus/javanicus, as well as the connection with the evolution of bovines need further analysis.

  16. Alginate encapsulation preserves the quality and fertilizing ability of Mediterranean Italian water buffalo (Bubalus bubalis) and Holstein Friesian (Bos taurus) spermatozoa after cryopreservation.

    Science.gov (United States)

    Perteghella, Sara; Gaviraghi, Alessandro; Cenadelli, Silvia; Bornaghi, Valeria; Galli, Andrea; Crivelli, Barbara; Vigani, Barbara; Vigo, Daniele; Chlapanidas, Theodora; Faustini, Massimo; Torre, Maria Luisa

    2017-03-30

    The use of artificial insemination (AI) in buffalo (Bubalus bubalis) is limited by poor ovarian activity during the hot season, seasonal qualitative patterns in semen, low resistance of sperm cells in the female tract, difficulties in estrus detection, and variable estrus duration. Although AI procedures are commonly used in bovine, use of AI has been limited in buffalo. In the zootechnical field, different studies have been conducted to develop techniques for improvement of fertilizing ability of buffalo spermatozoa after AI. In this study, for the first time, the use of alginate encapsulation and cryopreservation of buffalo spermatozoa is described, and the same procedure was performed with Holstein Friesian (Bos taurus) semen. Results obtained from in vitro analyses indicate that the encapsulation process does not have detrimental effects (compared to controls) on quality parameters (membrane integrity, progressive motility, path average velocity) in either species. Similarly, there were no detrimental effects after cryopreservation in either species. The fertilizing potential of encapsulated and cryopreserved semen was evaluated after AI in 25 buffalo and 113 bovine females. Pregnancy rates were not affected in either species. The results of this study show proof of concept for the use of frozen semen controlled-release devices in buffalo.

  17. Bacterial diversity in the rumen of Gayals (Bos frontalis), Swamp buffaloes (Bubalus bubalis) and Holstein cow as revealed by cloned 16S rRNA gene sequences.

    Science.gov (United States)

    Yang, Shuli; Ma, Songcheng; Chen, Jing; Mao, Huaming; He, Yiduo; Xi, Dongmei; Yang, Liangyu; He, Tianbao; Deng, Weidong

    2010-04-01

    Libraries of rumen bacterial 16S rRNA gene sequences of Gayals (Bos frontalis) and Swamp buffaloes (Bubalus bubalis) were cloned and sequenced in the present work to compare the bacterial diversity with the third published library of Holstein cow. Sequence similarity of 97% was used as the definition of operational taxonomic unit (OTU). The majority of the 470 sequences retrieved fell into the phyla of low G + C subdivision (329 sequences) and Cytophaga-Flexibacter-Bacteroides (CFB, 123 sequences) with the percentages of 70 and 26.2, respectively. The remaining clones belonged to the phyla of Proteobacter, high G + C gram positive bacteria (HGCGPB) and Spirochaetes, accounting for 3.8% totally. Only 73 clones (25 OTUs, 15.5%) could be closely related to cultured representatives. However, a larger fraction was related to uncultured representatives. Holstein cow may have more representatives of cultural bacteria and there were more uncultured clones for Gayals. The percentage of cultural representatives was 24, 13.3 and 9.5 for Holstein cow, Swamp buffaloes and Gayals, respectively. Twenty-three OTUs of the 236 ones appeared in more than one library, five of which were cultural. Selenomonas ruminantium, Ruminococcus flavefaciens and Butyrivibrio fibrisolvens were found in two different libraries, while Succiniclasticum ruminis and Pseudobutyrivibrio ruminis were found in all three libraries. Some of the animal-specific bacteria that had not been described previously in the ruminal ecosystem, e.g. Allisonella histaminiformans for Gayals and Staphylococcus sciuri for Swamp buffaloes were also recovered.

  18. Bacterial community composition and fermentation in the rumen of Xinjiang brown cattle (Bos taurus), Tarim red deer (Cervus elaphus yarkandensis), and Karakul sheep (Ovis aries).

    Science.gov (United States)

    Qian, Wenxi; Li, ZhiPeng; Ao, Weiping; Zhao, Guangyong; Li, Guangyu; Wu, JianPing

    2017-05-01

    The rumen microbiota plays a major role in the metabolism and absorption of indigestible food sources. Xinjiang brown cattle (Bos taurus), Tarim red deer (Cervus elaphus yarkandensis), and Karakul sheep (Ovis aries) are important ruminant species for animal husbandry in the Tarim Basin. However, the microbiota and rumen fermentation of these animals are poorly understood. Here, we apply high-throughput sequencing to examine the bacterial community in the rumen of cattle, red deer, and sheep and measured rumen fermentation products. Overall, 548 218 high-quality sequences were obtained and then classified into 6034 operational taxonomic units. Prevotella spp., Succiniclasticum spp., and unclassified bacteria within the families Succinivibrionaceae, Lachnospiraceae, and Veillonellaceae were the dominant bacteria in the rumen across the 3 hosts. Principal coordinate analysis identified significant differences in the bacterial communities across the 3 hosts. Pseudobutyrivibrio spp., Oscillospira spp., and Prevotella spp. were more prevalent in the rumen of the cattle, red deer, and sheep, respectively. Among the 3 hosts, the red deer rumen had the greatest amounts of acetate and butyrate and the lowest pH value. These results showed that Prevotella spp. are the dominant bacteria in the rumen of the cattle, red deer, and sheep, providing new insight into the rumen fermentation of ruminants distributed in the Tarim Basin.

  19. More efficient mastication allows increasing intake without compromising digestibility or necessitating a larger gut: comparative feeding trials in banteng (Bos javanicus) and pygmy hippopotamus (Hexaprotodon liberiensis).

    Science.gov (United States)

    Schwarm, Angela; Ortmann, Sylvia; Wolf, Christian; Streich, W Jürgen; Clauss, Marcus

    2009-04-01

    The digestion of plant material in mammalian herbivores basically depends on the chemical and structural composition of the diet, the mean particle size to which the forage is processed, and the ingesta retention time. These different factors can be influenced by the animal, and they can presumably compensate for each other. The pygmy hippopotamus, a non-ruminating foregut fermenter, has longer mean retention times than ruminants; however hippos do not achieve higher (fibre) digestibilities on comparable diets, which could be due to ineffective mastication. We performed feeding trials with six pygmy hippos (Hexaprotodon liberiensis) and six banteng cattle (Bos javanicus) on a grass diet. As predicted, both species achieved similar dry matter, organic matter, crude protein and gross energy digestibilities. However, neutral and acid detergent fibre digestibility was lower in pygmy hippos. Apparently, in these species, fibre digestibility was more influenced by particle size, which was larger in pygmy hippos compared to banteng, than by retention time. In spite of their higher relative food intake, the banteng in this study did not have greater relative gut fills than the hippos. Ruminants traditionally appear intake-limited when compared to equids, because feed particles above a certain size cannot leave the rumen. But when compared to nonruminating foregut fermenters, rumination seems to free foregut fermenters from an intrinsic food intake limitation. The higher energy intakes and metabolic rates in wild cattle compared to hippos could have life-history consequences, such as a higher relative reproductive rate.

  20. Magnetically frustrated double perovskites: synthesis, structural properties, and magnetic order of Sr{sub 2}BOsO{sub 6} (B = Y, In, Sc)

    Energy Technology Data Exchange (ETDEWEB)

    Paul, Avijit Kumar; Sarapulova, Angelina; Adler, Peter; Kanungo, Sudipta; Mikhailova, Daria; Schnelle, Walter; Hu, Zhiwei; Kuo, Changyang; Yan, Binghai; Felser, Claudia; Tjeng, Liu Hao [Max-Planck-Institut fuer Chemische Physik fester Stoffe,Dresden (Germany); Reehuis, Manfred [Helmholtz-Zentrum Berlin fuer Materialien und Energie, Berlin (Germany); Siruguri, Vasudeva; Rayaprol, Sudhindra [UGC-DAE Consortium for Scientific Research (CSR), Mumbai Centre, Mumbai (India); Soo, Yunlian [Department of Physics, National Tsing Hua University, Hsinchu (China); Jansen, Martin [Max-Planck-Institut fuer Chemische Physik fester Stoffe,Dresden (Germany); Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)

    2015-02-15

    Double perovskites Sr{sub 2}BOsO{sub 6} (B = Y, In, and Sc) were prepared from the respective binary metal oxides, and their structural, magnetic, and electronic properties were investigated. At room temperature all these compounds crystallize in the monoclinic space group P2{sub 1}/n. They contain magnetic osmium (Os{sup 5+}, t{sub 2g}{sup 3}) ions and are antiferromagnetic insulators with Neel temperatures T{sub N} = 53 K, 26 K, and 92 K for B = Y, In, and Sc, respectively. Powder neutron diffraction studies on Sr{sub 2}YOsO{sub 6} and Sr{sub 2}InOsO{sub 6} showed that the crystal structures remain unchanged down to 3 K. The Y and In compounds feature a type I antiferromagnetic spin structure with ordered Os moments of 1.91 μ{sub B} and 1.77 μ{sub B}, respectively. The trend in T{sub N} does not simply follow the development of the lattice parameters, which suggests that d{sup 0} compared to d{sup 10} ions on the B site favor a somewhat different balance of exchange interactions in the frustrated Os{sup 5+} fcc-like lattice. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  1. Isolation, identification and retrospective study of foot-and-mouth disease virus from affected Mithun (Bos frontalis) in north-eastern India.

    Science.gov (United States)

    Borah, B; Deka, P; Sharma, K; Baro, S; Hazarika, A K; Das, C; Garam, G B; Boro, P; Ltu, K

    2017-07-14

    Foot-and-mouth disease (FMD) is a contagious disease of cloven-hoofed animals that causes substantial and perpetual economic loss. Apart from the contagious nature of the disease, the FMD virus can establish in a "carrier state" among all cloven-hoofed animals. The Mithun (Bos frontalis), popularly called the "Cattle of Mountain," is found in the geographically isolated, hilly region of north-east India: Arunachal Pradesh, Nagaland, Manipur and Mizoram. Despite the geographical inaccessibility, infection by FMD virus has emerged as the single most devastating disease among Mithun after the eradication of rinderpest from this region. Samples from outbreaks of FMD in Mithun were analysed by sandwich ELISA, multiplex RT-PCR (MRT-PCR) and liquid-phase blocking enzyme-linked immunosorbent assay and isolated in the BHK-21 cell line. The results indicate the presence of FMDV serotype "O." The sequencing and molecular phylogenies have revealed close relationships in the lineage of type "O" isolates from Bangladesh. The findings will provide useful information for further research and development of a sustainable programme for the progressive control of FMD in the Mithun population. © 2017 Blackwell Verlag GmbH.

  2. Identity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus) and the suppression of Sarcocystis sinensis as a nomen nudum.

    Science.gov (United States)

    Dubey, J P; Fayer, R; Rosenthal, B M; Calero-Bernal, R; Uggla, A

    2014-09-15

    There are uncertainties concerning the identity and host species specificity of Sarcocystis species of the water buffalo (Bubalus bubalis) and cattle (Bos taurus). Currently, in cattle three species are recognized with known endogenous stages, viz.: S. cruzi (with canine definitive host), S. hirsuta (feline definitive host), and S. hominis (primate definitive host). Recently, a fourth Sarcocystis species with an unknown life cycle has been reported from cattle. In the water buffalo, four species of Sarcocystis have been described: S. fusiformis (feline definitive host), S. buffalonis (feline definitive host), S. levinei (canine definitive host), and S. dubeyi (definitive host unknown but not cat or dog). Besides, there are studies of Sarcocystis infections in buffalo and cattle from China with results that are difficult to interpret and validate. For example, some of the studies report transmission of Sarcocystis species between cattle and buffalo, but steps to preclude exogenous exposures were not reported. A species of the water buffalo, 'S. sinensis', was proposed at a Chinese national conference in 1990, and published as an abstract without figures and with no archived type specimens for verification. The International Code of Zoological Nomenclature Articles 9 and 10 state that "abstracts of articles, papers, posters, text of lectures, and similar material when issued primarily to participants at meetings, symposia, colloquia or congress does not constitute published work"; therefore, S. sinensis is a nomen nudum. Published by Elsevier B.V.

  3. in silico identification of cross affinity towards Cry1Ac pesticidal protein with receptor enzyme in Bos taurus and sequence, structure analysis of crystal proteins for stability.

    Science.gov (United States)

    Ebenezer, King Solomon; Nachimuthu, Ramesh; Thiagarajan, Prabha; Velu, Rajesh Kannan

    2013-01-01

    Any novel protein introduced into the GM crops need to be evaluated for cross affinity on living organisms. Many researchers are currently focusing on the impact of Bacillus thuringiensis cotton on soil and microbial diversity by field experiments. In spite of this, in silico approach might be helpful to elucidate the impact of cry genes. The crystal a protein which was produced by Bt at the time of sporulation has been used as a biological pesticide to target the insectivorous pests like Cry1Ac for Helicoverpa armigera and Cry2Ab for Spodoptera sp. and Heliothis sp. Here, we present the comprehensive in silico analysis of Cry1Ac and Cry2Ab proteins with available in silico tools, databases and docking servers. Molecular docking of Cry1Ac with procarboxypeptidase from Helicoverpa armigera and Cry1Ac with Leucine aminopeptidase from Bos taurus has showed the 125(th) amino acid position to be the preference site of Cry1Ac protein. The structures were compared with each other and it showed 5% of similarity. The cross affinity of this toxin that have confirmed the earlier reports of ill effects of Bt cotton consumed by cattle.

  4. Late Mesolithic hunting of a small female aurochs in the valley of the River Tjonger (the Netherlands) in the light of Mesolithic aurochs hunting in NW Europe

    NARCIS (Netherlands)

    Prummel, W.; Niekus, M.J.L.Th.

    The valley of the River Tjonger, situated in the Province of Friesland (the Netherlands), is rich in prehistoric organic remains. The fill of the valley, consisting of waterlogged sediments (peat, gyttja and sands), presents favourable conditions for the preservation of bone, antler and botanical

  5. Species-specific and differential expression of BSP-5 and other BSP variants in normozoospermic and asthenozoospermic buffalo (Bubalus bubalis) and cattle (Bos taurus) seminal plasma.

    Science.gov (United States)

    Divyashree, B C; Roy, Sudhir C

    2018-01-15

    Binder of sperm-5 (BSP-5) is one of the fertility-associated proteins of cattle seminal plasma. Binding of sperm to the oviductal epithelium is mediated by BSP group of proteins. However, it is not clear, whether this protein is also involved in sperm motility. In the present study, attempts were made to characterize BSP-5 protein in both normozoospermic (NS) and asthenozoospermic (AS) Murrah buffalo (n = 18; Bubalus bubalis), Holstein Friesian (n = 8, Bos taurus) and Jersey cattle (n = 8; Bos taurus) bull seminal plasma and also study its expression pattern in these species. 1-D Western blot demonstrated three major BSP-5 immunoreactive protein bands (24.2 kDa, 20.5 kDa, and 12.3 kDa) in buffalo seminal plasma. Of these, the intensities of 24.2 and 20.5 kDa protein bands reduced significantly (P ≤ 0.05) in seminal plasma of AS group compared to that of NS group. On the contrary, the expression of 12.3 kDa protein band did not vary significantly between the groups. In Holstein Friesian seminal plasma, at least six BSP-5 immunoreactive protein bands (25.1, 23.6, 19.5, 13.8, 13.1 and 12.3 kDa) could be detected. Of these, the intensities of 23.6, 13.8/13.1 and 12.3 kDa protein bands decreased (P = 0.058, 0.111, 0.053) in AS group bulls compared to NS bulls. Holstein Friesian bull seminal plasma demonstrated a BSP-5 immunoreactive duplex protein band of 13.8/13.1 kDa, which was not evident in buffalo seminal plasma. In 2-D Western blot, a train of five BSP-5 immunoreactive duplex protein spots (Mr 21.0-27.6 kDa, pI of ∼3.9-5.1) was detected. Mass spectrometry of one of the representative duplex spot confirmed that these were BSP-5 and BSP-3 proteins, respectively. Indirect immunofluorescence studies showed that BSP-5 is primarily localized to the mid-piece/mitochondrial region of buffalo spermatozoa. To conclude, the findings of the present study could establish the significance and association of BSP-5 proteins in sperm motility and how their

  6. Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the acute phase response to a provocative immune challenge.

    Science.gov (United States)

    Carroll, J A; Burdick Sanchez, N C; Chaffin, R; Chase, C C; Coleman, S W; Spiers, D E

    2013-10-01

    The difference in the acute phase response of a heat-tolerant and a heat-sensitive Bos taurus breed to a lipopolysaccharide (LPS) challenge when housed at different air temperatures (Ta) was studied. Angus (ANG; heat-sensitive; n = 11; 306 ± 26 kg BW) and Romosinuano (RO; heat-tolerant; n = 10; 313 ± 32 kg BW) heifers were transported from the USDA Agricultural Research Service SubTropical Agricultural Research Station in Florida to the Brody Environmental Chambers at the University of Missouri, Columbia. Heifers were housed in stanchions in 4 temperature-controlled environmental chambers. Initially, Ta in the 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 of the 4 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. On day 19, heifers were fitted with jugular catheters and rectal temperature (RT) recording devices. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), sickness behavior scores (SBSs) were recorded, and blood samples were collected at 0.5-h intervals from -2 to 8 h and again at 24 h relative to LPS challenge at 0 h. Serum was isolated and stored at -80°C until analyzed for cortisol and cytokine concentrations. A breed by Ta interaction (P heat-tolerant RO and heat-sensitive ANG heifers under different Ta which may aid in elucidating differences in productivity, disease resistance, and longevity among cattle breeds. Published by Elsevier Inc.

  7. Heat-tolerant versus heat-sensitive Bos taurus cattle: influence of air temperature and breed on the metabolic response to a provocative immune challenge.

    Science.gov (United States)

    Burdick Sanchez, N C; Chaffin, R; Carroll, J A; Chase, C C; Coleman, S W; Spiers, D E

    2013-11-01

    The response of the immune and stress systems have been assessed in response to a lipopolysaccharide (LPS) challenge, yet the role of metabolism in mediating energy requirements during the acute phase response has not been sufficiently studied. This study tested heat-tolerant (Romosinuano [RO]) and heat-sensitive (Angus [ANG]) Bos taurus breeds at different ambient temperatures (Ta) to determine differential metabolic responses to LPS challenge. Twenty-one heifers (ANG: n = 11, 306 ± 26 kg BW; RO: n = 10, 313 ± 32 kg BW) were housed in stanchions in 4 temperature-controlled chambers. Initially, Ta in all 4 chambers was cycling at thermoneutrality (TN; 18.5°C-23.5°C) for a 1-wk adjustment period, followed by an increase in 2 chambers to cycling heat stress (HS; 24°C-38°C) for 2 wk. Five ANG and 5 RO heifers were housed at TN, whereas 6 ANG and 5 RO heifers were housed at HS. On day 19, heifers were fitted with jugular catheters. On day 20, heifers were challenged with LPS (0.5 μg/kg BW; 0 h), and blood samples were collected from -2 to 8 h and at 24 h relative to LPS challenge. Serum was analyzed for glucose, insulin, and NEFA concentrations. In addition, feed intake was measured 3 d before and on the day of the challenge. Feed intake decreased over time (P heat-sensitive ANG heifers in response to LPS challenge, thus providing physiological evidence that may explain differences observed in the acute phase response between heat-sensitive ANG and heat-tolerant RO cattle breeds. Published by Elsevier Inc.

  8. Hydrogen Peroxide Production as a Limiting Factor in Xenobiotic Compound Oxidation by Nitrogen-Sufficient Cultures of Bjerkandera sp. Strain BOS55 Overproducing Peroxidases.

    Science.gov (United States)

    Kotterman, M; Wasseveld, R A; Field, J A

    1996-03-01

    The overproduction of ligninolytic peroxidase by the N-deregulated white rot fungus Bjerkandera sp. strain BOS55 under nitrogen-sufficient conditions had no noteworthy effect on the oxidation of anthracene or the decolorization of the polymeric aromatic dye Poly R-478 in 6-day-old cultures. Only when the endogenous production of H(inf2)O(inf2) was increased by the addition of extra oxygen and glucose could a 2.5-fold increase in the anthracene oxidation rate and a 6-fold increase in the Poly R-478 decolorization rate be observed in high-N cultures with 10- to 35-fold higher peroxidase activities than N-limited cultures. Further increase of the H(inf2)O(inf2) generation rate in high-N cultures with glucose oxidase led to an additional 3.5-fold increase in the anthracene oxidation rate (350 mg liter(sup-1) day(sup-1)) and a 10-fold increase in the Poly R-478 decolorization rate. These results indicate that xenobiotic compound oxidation by white rot fungi cannot be improved by overproducing peroxidases without increasing the endogenous production of H(inf2)O(inf2). The absence of Mn, which decreased the manganese peroxidase titers and increased the lignin peroxidase titers, was associated with up to 95% improvements in the anthracene oxidation rate. The simultaneous presence of Mn and veratryl alcohol was observed to have a synergistic negative effect on the oxidation of anthracene and the decolorization of Poly R-478.

  9. Efecto de la manipulación del semen criopreservado de bovinos Bos Taurus sobre la integridad espermática

    Directory of Open Access Journals (Sweden)

    Norberto Villa-Duque

    2016-01-01

    Full Text Available En el estudio se evaluó el efecto de descongelar y aplicar semen de bovinos Bos Taurus en 33 ganaderías del Magdalena Medio colombiano, y se estudió in vitro el efecto de la injuria encontrada sobre la integridad de las membranas espermáticas. La información en fincas se recopiló mediante formulario específico, mientras que el estudio in vitro se ejecutó en el laboratorio de Biotecnología Reproductiva Animal del Instituto Universitario de la Paz (Barrancabermeja, Santander. El estudio consistió en someter pajillas comerciales de 0.5 ml de toros Holstein y Pardo Suizo a la técnica convencional y a tres modificaciones de esta (injurias mediante un diseño randomizado. Ninguna de las fincas evaluadas aplicó correctamente la práctica de la inseminación artificial; errores notorios fueron: exceso de tiempo durante la extracción de la pajilla, descongelación en la región axilar y no combinación correcta entre tiempo y temperatura. Los resultados evidenciaron diferencia significativa (P<0.05 por efecto de la raza para la integridad y resistencia de las membranas espermáticas, para la integridad de las membranas por efecto de los tratamientos cuando la pajilla se descongelo a temperatura corporal en la región axilar y para la integridad de la membrana acrosomal cuando la extracción de la pajilla se realizó en forma incorrecta. El semen de la raza Holstein evidencia una ligera tendencia a ser más resistente que el de la raza Pardo Suizo.

  10. Chemical and sensory meat characteristics of Nellore cattle (Bos indicus finished with different levels of backfat thickness in the longissimus thoracis muscle

    Directory of Open Access Journals (Sweden)

    Jéssica Moraes Malheiros

    2016-01-01

    Full Text Available The objective of this study was to evaluate the effect of backfat thickness (BFT on the meat quality of feedlot-finished Nellore bulls (Bos indicus. Seventy-two animals were feedlot finished for about 100 days. For this study, 24 animals were sampled according to BFT in the longissimus thoracis muscle after slaughter: 12 animals with BFT up to 3.0 mm (class BFT-3 and 12 animals with BFT > 6.0 mm (class BFT-6. Chemical (myofibrillar fragmentation index, intramuscular fat content, and unsaturated and saturated fatty acids and physical (cold carcass weight, rib eye area, and marbling score characteristics of the meat were evaluated. Additionally, shear force and sensory characteristics (aroma, flavor, tenderness, chewiness, and juiciness were analyzed. Marbling score and intramuscular fat content were considered low for the two BFT classes. The mean values of the characteristics studied did not differ (P>0.05 between BFT classes, except for fatty acids, with the observation of higher unsaturated fatty acid levels in the BFT-6 class. There was no difference (P>0.05 in sensory characteristics between BFT classes. The most consistent relationship was observed between the myofibrillar fragmentation index and tenderness, measured as shear force, in animals with greater BFT (BFT-6 class compared to animals with lower BFT (BFT-3 class, suggesting possible tenderness problems in animals with a leaner carcass. The observation of a higher concentration of unsaturated fatty acids in animals with greater BFT suggests an increase in the sensory perception of meat, especially flavor.

  11. Excretion patterns of fluid and different sized particle passage markers in banteng (Bos javanicus) and pygmy hippopotamus (Hexaprotodon liberiensis): two functionally different foregut fermenters.

    Science.gov (United States)

    Schwarm, Angela; Ortmann, Sylvia; Wolf, Christian; Streich, W Jürgen; Clauss, Marcus

    2008-05-01

    Processing of ingesta particles plays a crucial role in the digestive physiology of herbivores. In the ruminant forestomach different sized particles are stratified into a small and a large particle fraction and only the latter is regurgitated and remasticated to smaller, easier-to-digest particles. In contrast, it has been suggested that in non-ruminating foregut fermenters, such as hippopotamuses, larger particles should be selectively excreted since they tend to be digested at a slower rate and hence can be considered intake-limiting bulk. In our study we determined the mean retention time (MRT) of fluids and different sized particles (2 mm and 10 mm) in six pygmy hippos (Hexaprotodon liberiensis) and six banteng (Bos javanicus) on a diet of fresh grass at two intake levels. We used cobalt ethylendiamintetraacetate (Co-EDTA) as fluid and chromium (Cr)-mordanted fibre (2 mm) and cerium (Ce)-mordanted fibre (10 mm) as particle markers, mixed in the food. Average total tract MRT for fluid, small and large particles at the high intake level was 32, 76 and 73 h in pygmy hippos and 25, 56 and 60 h in banteng, and at the low intake level 39, 109, and 105 h in pygmy hippos and 22, 51 and 58 h in banteng, respectively. In accordance with the prediction, large particles moved faster than, or as fast as the small particles, through the gut of pygmy hippos. In contrast, large particles were excreted slower than the small particles in the ruminant of this study, the banteng. Pygmy hippos had longer retention times than the banteng, which probably compensate for the less efficient particle size reduction. Although the results were not as distinct as expected, most likely due to the fact that ingestive mastication of the larger particle marker could not be prevented, they confirm our hypothesis of a functional difference in selective particle retention between ruminating and non-ruminating foregut fermenters.

  12. Mitogenomes from Egyptian Cattle Breeds: New Clues on the Origin of Haplogroup Q and the Early Spread of Bos taurus from the Near East

    Science.gov (United States)

    Olivieri, Anna; Gandini, Francesca; Achilli, Alessandro; Fichera, Alessandro; Rizzi, Ermanno; Bonfiglio, Silvia; Battaglia, Vincenza; Brandini, Stefania; De Gaetano, Anna; El-Beltagi, Ahmed; Lancioni, Hovirag; Agha, Saif; Semino, Ornella; Ferretti, Luca; Torroni, Antonio

    2015-01-01

    Background Genetic studies support the scenario that Bos taurus domestication occurred in the Near East during the Neolithic transition about 10 thousand years (ky) ago, with the likely exception of a minor secondary event in Italy. However, despite the proven effectiveness of whole mitochondrial genome data in providing valuable information concerning the origin of taurine cattle, until now no population surveys have been carried out at the level of mitogenomes in local breeds from the Near East or surrounding areas. Egypt is in close geographic and cultural proximity to the Near East, in particular the Nile Delta region, and was one of the first neighboring areas to adopt the Neolithic package. Thus, a survey of mitogenome variation of autochthonous taurine breeds from the Nile Delta region might provide new insights on the early spread of cattle rearing outside the Near East. Methodology Using Illumina high-throughput sequencing we characterized the mitogenomes from two cattle breeds, Menofi (N = 17) and Domiaty (N = 14), from the Nile Delta region. Phylogenetic and Bayesian analyses were subsequently performed. Conclusions Phylogenetic analyses of the 31 mitogenomes confirmed the prevalence of haplogroup T1, similar to most African cattle breeds, but showed also high frequencies for haplogroups T2, T3 and Q1, and an extremely high haplotype diversity, while Bayesian skyline plots pointed to a main episode of population growth ~12.5 ky ago. Comparisons of Nile Delta mitogenomes with those from other geographic areas revealed that (i) most Egyptian mtDNAs are probably direct local derivatives from the founder domestic herds which first arrived from the Near East and the extent of gene flow from and towards the Nile Delta region was limited after the initial founding event(s); (ii) haplogroup Q1 was among these founders, thus proving that it underwent domestication in the Near East together with the founders of the T clades. PMID:26513361

  13. Genome-wide identification, classification, and functional analysis of the basic helix-loop-helix transcription factors in the cattle, Bos Taurus.

    Science.gov (United States)

    Li, Fengmei; Liu, Wuyi

    2017-06-01

    The basic helix-loop-helix (bHLH) transcription factors (TFs) form a huge superfamily and play crucial roles in many essential developmental, genetic, and physiological-biochemical processes of eukaryotes. In total, 109 putative bHLH TFs were identified and categorized successfully in the genomic databases of cattle, Bos Taurus, after removing redundant sequences and merging genetic isoforms. Through phylogenetic analyses, 105 proteins among these bHLH TFs were classified into 44 families with 46, 25, 14, 3, 13, and 4 members in the high-order groups A, B, C, D, E, and F, respectively. The remaining 4 bHLH proteins were sorted out as 'orphans.' Next, these 109 putative bHLH proteins identified were further characterized as significantly enriched in 524 significant Gene Ontology (GO) annotations (corrected P value ≤ 0.05) and 21 significantly enriched pathways (corrected P value ≤ 0.05) that had been mapped by the web server KOBAS 2.0. Furthermore, 95 bHLH proteins were further screened and analyzed together with two uncharacterized proteins in the STRING online database to reconstruct the protein-protein interaction network of cattle bHLH TFs. Ultimately, 89 bHLH proteins were fully mapped in a network with 67 biological process, 13 molecular functions, 5 KEGG pathways, 12 PFAM protein domains, and 25 INTERPRO classified protein domains and features. These results provide much useful information and a good reference for further functional investigations and updated researches on cattle bHLH TFs.

  14. Different doses of equine chorionic gonadotropin on ovarian follicular growth and pregnancy rate of suckled Bos taurus beef cows subjected to timed artificial insemination protocol.

    Science.gov (United States)

    Pessoa, G A; Martini, A P; Carloto, G W; Rodrigues, M C C; Claro Júnior, I; Baruselli, P S; Brauner, C C; Rubin, M I B; Corrêa, M N; Leivas, F G; Sá Filho, M F

    2016-03-15

    This study evaluated the effect of different doses of eCG (control, 300 or 400 IU) administered at progesterone (P4) device removal in suckled Bos taurus beef cows undergoing a timed artificial insemination (TAI) protocol. A total of 966 cows received a P4 insert and 2.0 mg intramuscular estradiol benzoate at the onset of the synchronization. After 9 days, P4 insert was removed, and 12.5 mg of dinoprost tromethamine and 1 mg of estradiol cypionate were administered, followed by TAI 48 hours later. Then, the cows received one of three treatments as follows: control (n = 323), 300 (n = 326), or 400 IU of eCG (n = 317). A subset (n = 435) of cows in anestrus had their ovaries evaluated using ultrasound at the time of P4 removal and at TAI. Data were analyzed by orthogonal contrasts (C): C1 (eCG effect) and C2 (eCG dose effect). Estrous occurrence (control = 53.7%, 300 IU = 70.6%, and 400 IU = 77.0%) and pregnancy per artificial insemination (control = 29.7%, 300 IU = 44.8%, and 400 IU = 47.6%) were improved by eCG treatment (C1; P = 0.0004 and P 0.15). In conclusion, the eCG treatment administered at the time of P4 removal increased the occurrence of estrus, the larger follicles at TAI, and pregnancy per artificial insemination of suckled B taurus beef cows. Despite the greater occurrence of estrus in noncyclic cows receiving 400 IU of eCG, both eCG doses (300 and 400 IU) were equally efficient to improve pregnancy to artificial insemination. Copyright © 2016 Elsevier Inc. All rights reserved.

  15. Description of Mycobacterium chelonae subsp. bovis subsp. nov., isolated from cattle (Bos taurus coreanae), emended description of Mycobacterium chelonae and creation of Mycobacterium chelonae subsp. chelonae subsp. nov.

    Science.gov (United States)

    Kim, Byoung-Jun; Kim, Ga-Na; Kim, Bo-Ram; Jeon, Che Ok; Jeong, Joseph; Lee, Seon Ho; Lim, Ji-Hun; Lee, Seung-Heon; Kim, Chang Ki; Kook, Yoon-Hoh; Kim, Bum-Joon

    2017-10-01

    Three rapidly growing mycobacterial strains, QIA-37T, QIA-40 and QIA-41, were isolated from the lymph nodes of three separate Korean native cattle, Hanwoo (Bos taurus coreanae). These strains were previously shown to be phylogenetically distinct but closely related to Mycobacterium chelonae ATCC 35752T by taxonomic approaches targeting three genes (16S rRNA, hsp6 and rpoB) and were further characterized using a polyphasic approach in this study. The 16S rRNA gene sequences of all three strains showed 99.7 % sequence similarity with that of the M. chelonae type strain. A multilocus sequence typing analysis targeting 10 housekeeping genes, including hsp65 and rpoB, revealed a phylogenetic cluster of these strains with M. chelonae. DNA-DNA hybridization values of 78.2 % between QIA-37T and M. chelonae indicated that it belongs to M. chelonae but is a novel subspecies distinct from M. chelonae. Phylogenetic analysis based on whole-genome sequences revealed a 95.44±0.06 % average nucleotide identity (ANI) value with M. chelonae, slightly higher than the 95.0 % ANI criterion for determining a novel species. In addition, distinct phenotypic characteristics such as positive growth at 37 °C, at which temperature M. chelonae does not grow, further support the taxonomic status of these strains as representatives of a novel subspecies of M. chelonae. Therefore, we propose an emended description of Mycobacterium chelonae, and descriptions of M. chelonae subsp. chelonae subsp. nov. and M. chelonae subsp. bovis subsp. nov. are presented; strains ATCC 35752T(=CCUG 47445T=CIP 104535T=DSM 43804T=JCM 6388T=NCTC 946T) and QIA-37T (=KCTC 39630T=JCM 30986T) are the type strains of the two novel subspecies.

  16. A Novel Mutation in the Maternally Imprinted PEG3 Domain Results in a Loss of MIMT1 Expression and Causes Abortions and Stillbirths in Cattle (Bos taurus)

    Science.gov (United States)

    Flisikowski, Krzysztof; Venhoranta, Heli; Nowacka-Woszuk, Joanna; McKay, Stephanie D.; Flyckt, Antti; Taponen, Juhani; Schnabel, Robert; Schwarzenbacher, Hermann; Szczerbal, Izabela; Lohi, Hannes; Fries, Ruedi; Taylor, Jeremy F.; Switonski, Marek; Andersson, Magnus

    2010-01-01

    Congenital malformations resulting in late abortions and stillbirths affect the economic wellbeing of producers and the welfare of cattle in breeding programs. An extremely high incidence of stillbirths of “half-sized” calves of normal karyotype and uninflated lungs was diagnosed in the progeny of the Finnish Ayrshire (Bos taurus) bull - YN51. No other visible anatomical abnormalities were apparent in the stillborn calves. We herein describe the positional identification of a 110 kb microdeletion in the maternally imprinted PEG3 domain that results in a loss of paternal MIMT1 expression and causes late term abortion and stillbirth in cattle. Using the BovineSNP50 BeadChip we performed a genome-wide half-sib linkage analysis that identified a 13.3 Mb associated region on BTA18 containing the maternally imprinted PEG3 domain. Within this cluster we found a 110 kb microdeletion that removes a part of the non-protein coding MER1 repeat containing imprinted transcript 1 gene (MIMT1). To confirm the elimination of gene expression in calves inheriting this deletion, we examined the mRNA levels of the three maternally imprinted genes within the PEG3 domain, in brain and cotyledon tissue collected from eight fetuses sired by the proband. None of the fetuses that inherited the microdeletion expressed MIMT1 in either tissue. The mutation, when inherited from the sire, is semi-lethal for his progeny with an observed mortality rate of 85%. The survival of 15% is presumably due to the incomplete silencing of maternally inherited MIMT1 alleles. We designed a PCR-based assay to confirm the existence of the microdeletion in the MIMT1 region that can be used to assist cattle breeders in preventing the stillbirths. PMID:21152099

  17. An interpretive review of selective sweep studies in Bos taurus cattle populations: identification of unique and shared selection signals across breeds

    Science.gov (United States)

    Gutiérrez-Gil, Beatriz; Arranz, Juan J.; Wiener, Pamela

    2015-01-01

    This review compiles the results of 21 genomic studies of European Bos taurus breeds and thus provides a general picture of the selection signatures in taurine cattle identified by genome-wide selection-mapping scans. By performing a comprehensive summary of the results reported in the literature, we compiled a list of 1049 selection sweeps described across 37 cattle breeds (17 beef breeds, 14 dairy breeds, and 6 dual-purpose breeds), and four different beef-vs.-dairy comparisons, which we subsequently grouped into core selective sweep (CSS) regions, defined as consecutive signals within 1 Mb of each other. We defined a total of 409 CSSs across the 29 bovine autosomes, 232 (57%) of which were associated with a single-breed (Single-breed CSSs), 134 CSSs (33%) were associated with a limited number of breeds (Two-to-Four-breed CSSs) and 39 CSSs (9%) were associated with five or more breeds (Multi-breed CSSs). For each CSS, we performed a candidate gene survey that identified 291 genes within the CSS intervals (from the total list of 5183 BioMart-extracted genes) linked to dairy and meat production, stature, and coat color traits. A complementary functional enrichment analysis of the CSS positional candidates highlighted other genes related to pathways underlying behavior, immune response, and reproductive traits. The Single-breed CSSs revealed an over-representation of genes related to dairy and beef production, this was further supported by over-representation of production-related pathway terms in these regions based on a functional enrichment analysis. Overall, this review provides a comparative map of the selection sweeps reported in European cattle breeds and presents for the first time a characterization of the selection sweeps that are found in individual breeds. Based on their uniqueness, these breed-specific signals could be considered as “divergence signals,” which may be useful in characterizing and protecting livestock genetic diversity. PMID:26029239

  18. Genome-wide association study for birth weight in Nellore cattle points to previously described orthologous genes affecting human and bovine height

    Science.gov (United States)

    2013-01-01

    Background Birth weight (BW) is an economically important trait in beef cattle, and is associated with growth- and stature-related traits and calving difficulty. One region of the cattle genome, located on Bos primigenius taurus chromosome 14 (BTA14), has been previously shown to be associated with stature by multiple independent studies, and contains orthologous genes affecting human height. A genome-wide association study (GWAS) for BW in Brazilian Nellore cattle (Bos primigenius indicus) was performed using estimated breeding values (EBVs) of 654 progeny-tested bulls genotyped for over 777,000 single nucleotide polymorphisms (SNPs). Results The most significant SNP (rs133012258, PGC = 1.34 × 10-9), located at BTA14:25376827, explained 4.62% of the variance in BW EBVs. The surrounding 1 Mb region presented high identity with human, pig and mouse autosomes 8, 4 and 4, respectively, and contains the orthologous height genes PLAG1, CHCHD7, MOS, RPS20, LYN, RDHE2 (SDR16C5) and PENK. The region also overlapped 28 quantitative trait loci (QTLs) previously reported in literature by linkage mapping studies in cattle, including QTLs for birth weight, mature height, carcass weight, stature, pre-weaning average daily gain, calving ease, and gestation length. Conclusions This study presents the first GWAS applying a high-density SNP panel to identify putative chromosome regions affecting birth weight in Nellore cattle. These results suggest that the QTLs on BTA14 associated with body size in taurine cattle (Bos primigenius taurus) also affect birth weight and size in zebu cattle (Bos primigenius indicus). PMID:23758625

  19. Withers height of pig - Sus scrofa domestica L. 1758, domestic cow - Bos taurus L. 1758 and sheep - Ovis aries L. 1758 at the “Gornja šuma” archaeological site (Novi Sad

    Directory of Open Access Journals (Sweden)

    Radmanović Darko P

    2016-01-01

    Full Text Available In spring 2012, osteological material was collected at the “Gornja Šuma” site (site no. 47, located in the territory of Novi Sad, and it was dated to the early 9th century. The withers heights of pig - Sus scrofa domestica, domestic cow - Bos taurus and sheep - Ovis aries, as the three most dominant species at this archaeological site, were analysed based on the length of bones and according to various authors [Boessneck 1956; Zalkin 1960; Matolcsi 1970; Teichert 1975]. It was determined that in these three species the withers heights mostly corresponded to the data from the Middle Ages.

  20. Incidence and transplacental transmission of Neospora caninum in primiparous females from Bos indicus slaughtered in Presidente Prudente, São Paulo, Brazil / Incidência e transmissão transplacentária de Neospora caninum em fêmeas primíparas da raça Bos indicus abatidos em Presidente Prudente, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Sergio do Nascimento Kronka

    2008-08-01

    Full Text Available To produce an epidemiological map of neosporosis in Brazil and identify the types of transmission of this disease, the present study evaluated the occurrence of Neospora caninum in Nelore cattle (Bos indicus in Presidente Prudent, west region of Sao Paulo state; its vertical transmission; and the early stage in which fetuses are infected. To achieve this, serum samples from 518 slaughtered pregnant heifers and their fetuses were tested by ELISA technique and fetal brain tissues subjected to PCR. One hundred and three heifers (19.88% had antibodies to N. caninum, as well as 38 (36.8% of fetuses from 4 months of gestation. The conventional PCR failed to detect N. caninum DNA. These findings show that neosporosis occurs in the area studied and that it may be transmitted the transplacental route, althought N. caninum had not detected in brain tissue from non-aborted fetuses. The use of nested PCR it would be applied to increase the sensitivy of test.Para produzir um mapa epidemiológico da neosporose no Brasil e identificar os tipos de transmissão dessa doença, o presente estudo avaliou a ocorrência de Neospora caninum em fêmea Nelore (Bos Indicus em Presidente Prudente, região oeste do Estado de São Paulo e o risco de infecção fetal nos estágios iniciais da gestação. Para a realização deste estudo, amostras de soro de 518 novilhas prenhas abatidas e seus fetos foram testadas pela técnica de ELISA e para avaliação de transmissão vertical, tecido cerebral fetal foi submetido à reação da polimerase em cadeia (PCR. Dessas novilhas, 103 (19,88% tinham anticorpos para N. caninum dos quais 38 (36,8% estavam no 4 mês de gestação. Esses achados mostram que a Neosporose ocorre na área estudada e que pode ser transmitido pela via placentária, embora o N. caninum não tenha sido detectado em tecido cerebral de fetos não abortado. O uso de nested PCR poderia ser aplicado como forma de aumentar a sensibilidade do teste.

  1. Evaluation of pregnancy rates of Bos indicus cows subjected to different synchronization ovulation protocols using injectable progesterone or an intravaginal device

    Directory of Open Access Journals (Sweden)

    Jefferson Tadeu Campos

    2016-12-01

    Full Text Available This study evaluated the pregnancy rate in Nelore cows (Bos indicus that were subjected to fixed-time artificial insemination (FTAI using different protocols consisting of injectable progesterone (P4 or an intravaginal device (impregnated with P4. Multiparous cows 72-84 months in age, 30-45 days postpartum, were selected on the basis of the absence of a corpus luteum (CL and follicles < 8 mm after transrectal palpation and ultrasound examinations. On a random day of the estrus cycle (D0, the selected animals (n = 135 were randomly assigned to one of three experimental groups (n = 45 each. Group I (injectable P4/FTAI 36 hours received 250 mg of injectable P4 and 2 mg EB on D0; on D7, they received 500 µg of cloprostenol; on D8, 300 IU of eCG and 1 mg of EB were administered; and finally, FTAI was performed 36 hours after the application of EB. Group II (injectable P4/FTAI 48 hours received the same protocol as Group I, except that the FTAI was performed 48 hours after ovulation induction. The animals of Group III (Control/CIDR received a conventional protocol for FTAI using an intravaginal device (D0: P4 and 2 mg EB; D8: device removal, 500 µg cloprostenol, 300 IU eCG, 1 mg EB; and FTAI performed 48 hours after removal of the device. The results showed that cows synchronized with the conventional protocol for FTAI (Control/CIDR had a higher pregnancy rate (60 %, 27/45 than those synchronized with an injectable P4/FTAI 36 hours (33.33 %; 15/45, P = 0.010. However, the group receiving injectable P4 group/FTAI 48 hours had a similar pregnancy rate (48.9 %; 22/45; P = 0.290 when compared to both the group receiving the conventional protocol and that receiving injectable P4/FTAI 36 hours (P = 0.134. Although the injectable P4 may affect pregnancy rate with the FTAI performed in 36 hours, we found similar pregnancy rates from cows inseminated 48 hours after induction ovulation, considering injectable or intravaginal P4. Therefore, we suggest that

  2. Successive mineralization and detoxification of benzo[a]pyrene by the white rot fungus Bjerkandera sp. strain BOS55 and indigenous microflora.

    Science.gov (United States)

    Kotterman, M J; Vis, E H; Field, J A

    1998-08-01

    White rot fungi can oxidize high-molecular-weight polycyclic aromatic hydrocarbons (PAH) rapidly to polar metabolites, but only limited mineralization takes place. The objectives of this study were to determine if the polar metabolites can be readily mineralized by indigenous microflora from several inoculum sources, such as activated sludge, forest soils, and PAH-adapted sediment sludge, and to determine if such metabolites have decreased mutagenicity compared to the mutagenicity of the parent PAH. 14C-radiolabeled benzo[a]pyrene was subjected to oxidation by the white rot fungus Bjerkandera sp. strain BOS55. After 15 days, up to 8.5% of the [14C]benzo[a]pyrene was recovered as 14CO2 in fungal cultures, up to 73% was recovered as water-soluble metabolites, and only 4% remained soluble in dibutyl ether. Thin-layer chromatography analysis revealed that many polar fluorescent metabolites accumulated. Addition of indigenous microflora to fungal cultures with oxidized benzo[a]pyrene on day 15 resulted in an initially rapid increase in the level of 14CO2 recovery to a maximal value of 34% by the end of the experiments (>150 days), and the level of water-soluble label decreased to 16% of the initial level. In fungal cultures not inoculated with microflora, the level of 14CO2 recovery increased to 13.5%, while the level of recovery of water-soluble metabolites remained as high as 61%. No large differences in 14CO2 production were observed with several inocula, showing that some polar metabolites of fungal benzo[a]pyrene oxidation were readily degraded by indigenous microorganisms, while other metabolites were not. Of the inocula tested, only PAH-adapted sediment sludge was capable of directly mineralizing intact benzo[a]pyrene, albeit at a lower rate and to a lesser extent than the mineralization observed after combined treatment with white rot fungi and indigenous microflora. Fungal oxidation of benzo[a]pyrene resulted in rapid and almost complete elimination of its high

  3. Impact of Equine Chorionic Gonadotropin Associated with Temporary Weaning, Estradiol Benzoate, or Estradiol Cypionate on Timed Artificial Insemination in Primiparous Bos Indicus Cows

    Directory of Open Access Journals (Sweden)

    Andre Luis Bastos Souza

    Full Text Available The study aimed to determine the impact of equine chorionic gonadotropin (eCG associated with different timed artificial insemination (TAI protocols on the pregnancy rate (PR in Bos indicus cows previously treated with progesterone. Five hundred and fifty-seven primiparous cows were subjected to the following treatments: on day 0 (d0, GeCGTW (group equine Chorionic Gonadotropin+Temporary Weaning;n=178 received 0,558 g intravaginal progesterone (P4+1.0 mg of estradiol benzoate (EB (IM; on d8 (P4 removal+0,075 mg D-cloprostenol + 400 IU eCG + TW for 48 h; on d10, TAI + calves return to dam; GeCGEB (group equine Chorionic Gonadotropin+Estradiol benzoate; n=176 the same as GeCGTW without TW + application of 1.0 mg of EB on d9; GeCGEC (group equine Chorionic Gonadotropin+Estradiol Cypionate; n=203, the same as GeCGTW without TW+1.5 mg EC (IM. On d35, post TAI, pregnancy diagnosis (PD was performed. Non-pregnant animals remained under clean-up bulls for 90 days. After this period, the animals were subjected to PD using ultrasound. The PR of TAI was 51.1%, 47.1%, and 47.8% for GeCGTW, GeCGEB24, and GeCGEC (P>0.05 respectively. The PR under clean-up bulls was 88.3%, 47.3%, and 31.1% (P<0.05. The final PR (TAI+clean-up bulls of the groups was 94.4%, 72.1%, and 64.0%, respectively (P<0.05. It was concluded that no differences in PR among the protocols related to TAI were detected; PR in the GeCGTW protocol under clean-up bulls was higher compared to others (P<0.05; the overall PR of cows subjected to TAI+clean-up bulls was significantly higher in GeCGTW than in the other groups.

  4. A deterministic simulation study of embryo marker-assisted selection for age at first calving in Nellore (Bos indicus beef cattle

    Directory of Open Access Journals (Sweden)

    Artur J.M. Rosa

    2007-01-01

    Full Text Available We used deterministic simulation of four alternative multiple ovulation and embryo manipulation (MOET closed nucleus schemes to investigate the benefits of using marker-assisted selection (MAS of Nellore (Bos indicus beef cattle embryos prior to transplantation to reduce the age at first calving (AFC. We found that MAS resulted in increased genetic gain as compared to selection without AFC quantitative trait loci (AFC-QTL information. With single-stage selection the genetic response (GR increased as follows: GR = 0.68% when the AFC-QTL explained 0.02 of the AFC additive genetic variance (sigma2A; GR = 1.76% for AFC-QTL explaining 0.05 sigma2A; GR = 3.7% for AFC-QTL explaining 0.1 sigma2A; and GR = 55.76% for AFC-QTL explaining 0.95 sigma2A. At the same total selected proportion, two-stage selection resulted in less genetic gain than single stage MAS at two-years of age. A single stage selection responses of > 95% occurred with pre-selected proportions of 0.4 (0.1 sigma2A explained by AFC-QTL, 0.2 (0.3 sigma2A explained by AFC-QTL and 0.1 (0.5 sigma2A explained by AFC-QTL, indicating that the combined use of MAS and pre-selection can substantially reduce the cost of keeping recipient heifers in MOET breeding schemes. When the number of recipients was kept constant, the benefit of increasing embryo production was greater for the QTL explaining a higher proportion of the additive genetic variance. However this advantage had a diminishing return especially for QTL explaining a small proportion of the additive genetic variance. Thus, marker assisted selection of embryos can be used to achieve increased genetic gain or a similar genetic response at reduced expense by decreasing the number of recipient cows and number of offspring raised to two-years of age.

  5. Pregnancy rate in lactating Bos indicus cows subjected to fixed-time artificial insemination and treated with different follicular growth inducers

    Directory of Open Access Journals (Sweden)

    Ériklis Nogueira

    2014-07-01

    Full Text Available The objective of this experiment was to evaluate the effects of replacing eCG with FSH or FSH/LH on the diameter of ovulatory follicles (DOF and the pregnancy rates (PR of lactating Bos indicus cows subjected to a synchronization of ovulation protocol and fixed-time artificial insemination (FTAI based on progesterone, estradiol benzoate (EB, PGF2α, and estradiol cypionate (EC. On day 0, primiparous and multiparous Nellore cows (n = 329 at 68 days postpartum were body condition scored (BCS and received a P4 implant (PRIMER 1.0 g P4 plus 2 mg EB intramuscularly (IM. At day 8, the implant was removed, and 250 μg cloprostenol were injected IM along with 0.5 mg EC. At the time of implant removal, the animals were divided into one of four treatments: cows received (G1 1 mL of saline solution IM (Control; n = 80; (G2 300 IU eCG IM (ECG300; n = 84; (G3 15 mg FSH IM (Folltropin; n = 82; and (G4 30 IU FSH/LH IM (Pluset; n = 83; all cows were subjected to FTAI 48-54 h after implant removal (day 10. Transrectal ultrasonography was performed to measure the DOF to FTAI and to estimate the pregnancy rate on day 35. A statistical analysis examined the effects of the treatment, technician, semen, BCS, calf age and parity on PR to FTAI. There was no significant difference in PR and DOF among the treatment groups (G1, 41.3%, 13.1 mm; G2, 46.4%, 14.5 mm; G3, 46.3%, 14.2 mm; and G4, 48.2%, 14.3 mm, but PR was higher in multiparous than in primiparous cows. Commercial FSH solutions (Pluset or Folltropin do not promote increases in PR or DOF of lactating Nellore cows and are equal to eCG in promoting growth in preovulatory follicles and elevating the PR in Nellore cows with a moderate BCS subjected to a progesterone-based FTAI protocol with EC.

  6. Severe diarrhea outbreak in beef calves (Bos indicus caused by G6P[11], an emergent genotype of bovine rotavirus group A

    Directory of Open Access Journals (Sweden)

    Thais N.S. Medeiros

    2014-08-01

    Full Text Available The episodes of diarrhea caused by neonatal bovine rotavirus group A (BoRVA constitute one of the major health problems in the calf rearing worldwide. The main G (VP7 and P (VP4 genotypes of BoRVA strains involved in the etiology of diarrhea in calves are G6P[1], G10P[11], G6P[5], and G8P[1]. However, less frequently, other G and P genotypes have been described in BoRVA strains identified in diarrheic fecal samples of calves. This study describes the identification and molecular characterization of an emerging genotype (G6P[11] in BoRVA strains involved in the etiology of a diarrhea outbreak in beef calves in a cattle herd of high production in extensive management system. The diarrhea outbreak, which showed high morbidity (60% and lethality (7% rates, occurred in calves (n= 384 Nelore (Bos indicus up to 30-day-old from the State of Mato Grosso do Sul, Brazil. BoRVA was identified in 80% (16/20 of the fecal samples analyzed by polyacrylamide gel electrophoresis (PAGE technique. In all PAGE-positive fecal samples were amplified products with 1,062-bp and 876-bp in the RT-PCR assays for VP7 (G type and VP4 (VP8* (P type of BoRVA, respectively. The nucleotide sequence analysis of VP7 and VP4 genes of four wild-type BoRVA strains showed G6-III P[11]-III genotype/lineage. The G6P[11] genotype has been described in RVA strains of human and animal hosts, however, in calves this genotype was only identified in some cross-sectional studies and not as a single cause of diarrhea outbreaks in calves with high morbidity and lethality rates as described in this study. The monitoring of the G and P genotypes of BoRVA strains involved in diarrhea outbreaks in calves is important for both animal and public health by allowing the identification of the most frequent genotypes, the characterization of novel genotypes and to identify reassortments with genotypes described in animal and human hosts. The results of this study show the importance of the monitoring of

  7. Comparative expression profiling of insulin-like growth factor binding protein-5 in milk of Bos indicus and Bubalus bubalis during lactation.

    Science.gov (United States)

    Mohapatra, S K; Singh, S; Kumar, S; Dang, A K; Datta, T K; Das, S K; Mohanty, T K; Kaushik, J K; Mohanty, A K

    2015-04-01

    Insulin-like growth factor binding protein-5 (IGFBP-5) is a key molecule in mammary gland development, which facilitates the removal of mammary epithelial cells (MECs) by apoptosis that takes place during remodeling of the mammary gland during involution. IGFBP-5 binds with IGFs for their bioavailability. IGFBP-5 has been reported to perform pleiotropic roles such as cellular apoptosis, proliferation and differentiation. To understand the role of IGFBP-5 during lactation and clinical mastitis, expression profiling of IGFBP-5 at the protein level was performed in both indigenous cows (Bos indicus) and buffaloes (Bubalus bubalis) belonging to two different breeds - Sahiwal cows and Murrah buffaloes. Reverse-transcriptase PCR (RT-PCR) of IGFBP-5 mRNA confirmed its expression in milk somatic cells and MECs of Sahiwal cows. ELISA was performed for quantitative measurement of IGFBP-5 concentrations in milk during different days (0, 50, 100, 150, 200, 250 and 300) of lactation, during the involution period and in animals exhibiting short lactation and clinical mastitis. The highest concentration of IGFBP-5 in milk was observed during the involution period followed by colostrum, late and early lactation, respectively, in both cattle and buffaloes. No significant difference in the concentration of IGFBP-5 was observed during the first 150 days of lactation between cows and buffaloes. However, higher concentration of IGFBP-5 was observed in cows during late lactation (200 to 300 days) in comparison with buffaloes. To validate the ELISA data, quantitative real-time PCR was performed in MECs of Sahiwal cows. The relative mRNA abundance of IGFBP-5 was found to be significantly (Plactation in case of Sahiwal cows. Highest mRNA expression of IGFBP-5 was observed around 300 days of lactation followed by 200 and 250 days (Plactation in ELISA. Animals having history of short lactation length (short lactating animals) showed higher levels of IGFBP-5 expression (at protein level) in

  8. Back-breeding the aurochs: the Heck brothers, National Socialism and imagined geographies for nonhuman Lebensraum

    NARCIS (Netherlands)

    Driessen, C.P.G.; Lorimer, J.

    2016-01-01

    This chapter investigates the bio-geographical imaginations behind the animal 'back-breeding' programs carried out by Lutz and Heinz Heck - two influential German zoologists who ran Berlin and Munich zoos. Partly with close connections to and patronage from the National Socialist elite, the Heck

  9. Comportamento diário e reprodutivo de fêmeas bovinas mestiças (Zebu x Holandesa portadoras de dermatite digital - DOI: 10.4025/actascianimsci.v31i2.499 Daily and reproductive behavior of female crossbred (Bos indicus x Bos taurus cattle bearing digital dermatitis - DOI: 10.4025/actascianimsci.v31i2.499

    Directory of Open Access Journals (Sweden)

    Anna Carolina da Costa

    2009-08-01

    Full Text Available No presente estudo avaliaram-se aspectos relacionados ao comportamento diário e reprodutivo de fêmeas bovinas mestiças (Zebu x Holandesa portadoras de dermatite digital, durante um período de 24 meses. Os bovinos foram distribuídos em três grupos (GI, GII, GIII, compostos por dez animais cada. No GI foram alocadas fêmeas bovinas portadoras de dermatite digital na forma erosiva, no GII na forma verrucosa eo GIII composto por animais clinicamente saudáveis. No comportamento diário e alimentar, os animais foram observados no piquete e durante a ordenha. Avaliaram-se a atitude do animal, se em posição quadrupedal ou decúbito, período de alimentação, frequência de ingestão de água, tempo de ruminação e ócio. Quanto ao comportamento reprodutivo, estudaram-se o período de serviço, presença de cisto ovariano, retenção de envoltórios fetais, metrite, sinais externos de cio, consistência dos ovários e do útero, número de serviços, prenhez e parto. Ao final do estudo, concluiu-se que a dermatite digital bovina, especialmente do tipo verrucosa, alterou de forma negativa o comportamento diário e alimentar de fêmeas bovinas mestiças (Zebu x Holandesa, observadas em diferentes situações. Com relação ao comportamento reprodutivo, ao relacioná-lo à presença ou ausência de dermatite digital, não foi possível observar diferenças entre os grupos, em relação aos parâmetros avaliadosThis present study aimed to evaluate aspects related to daily and reproductive behavior of female crossbred (Bos indicus x Bos taurus cattle bearing digital dermatitis, raised semi-extensively, during 24 months. The animals were distributed in three groups (GI, GII, and GIII with ten animals each. GI received cows bearing the erosive type of digital dermatitis, whilst GII received those of verroucous type and GIII received clinically healthy animals. Animals were observed during milking and grassing for daily and feeding behavior. Animal

  10. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Directory of Open Access Journals (Sweden)

    Daniela Bebbere

    Full Text Available The insulin-like growth factor 2 receptor (IGF2R is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle differed significantly (P<0.05 from endodermal tissues (liver, lung. The placenta showed partial imprinting with allelic bias of 22.9-34.7% and differed significantly (P<0.001 from all other tissues. Four informative fetuses were generated by in-vitro fertilization (IVF with embryo culture and two individuals displayed fetal overgrowth. However, there was no evidence for changes in imprinting or DNA methylation after IVF, or correlations between allelic bias and fetal weight. In conclusion, imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest

  11. How to Implement Blue Ocean Strategy (BOS in B2B Sector Kaip įgyvendinti žydrųjų vandenynų strategiją (ŽVS sektoriuje „verslas – verslui“

    Directory of Open Access Journals (Sweden)

    Andrejs Čirjevskis

    2011-11-01

    Full Text Available The aim of research is to confirm the hypothesis that BOS is viable in the B2B sectors. The objects of research are two business entities: world’s lead­ing suppliers of construction chemicals and manufacturer of purification equip­ment. Authors posed first research question is BOS a suitable within construction chemicals and purification equipment manufacturers’ industries? Second research question was about how to evaluate acceptability of new strategic choice on BOS? Third research question was how to diagnosis organisational hurdles on BOS implementation? Research has confirmed the hypothesis and suggested application of innovation value chain to diagnosing company’s ability to implement value in­novation.

    Tyrimo tikslas patvirtina hipotezę, kad ŽVS yra gyvybinga B2B sektoriuose. Tyrimo objektai yra du verslo subjektai: pasaulyje pirmaujantys statybos chemikalų tiekėjai ir valymo įrenginių gamintojai. Autorių keliamas pirmasis mokslinių tyrimų klausimas – ar ŽVS yra tinkama statybos chemikalų ir valymo įrenginių gamintojų pramonei? Antrasis mokslinių tyrimų klausimas – apie tai, kaip įvertinti naujo strateginio pasirinkimo

  12. Tissue-specific and minor inter-individual variation in imprinting of IGF2R is a common feature of Bos taurus Concepti and not correlated with fetal weight.

    Science.gov (United States)

    Bebbere, Daniela; Bauersachs, Stefan; Fürst, Rainer W; Reichenbach, Horst-Dieter; Reichenbach, Myriam; Medugorac, Ivica; Ulbrich, Susanne E; Wolf, Eckhard; Ledda, Sergio; Hiendleder, Stefan

    2013-01-01

    The insulin-like growth factor 2 receptor (IGF2R) is essential for prenatal growth regulation and shows gene dosage effects on fetal weight that can be affected by in-vitro embryo culture. Imprinted maternal expression of murine Igf2r is well documented for all fetal tissues excluding brain, but polymorphic imprinting and biallelic expression were reported for IGF2R in human. These differences have been attributed to evolutionary changes correlated with specific reproductive strategies. However, data from species suitable for testing this hypothesis are lacking. The domestic cow (Bos taurus) carries a single conceptus with a similar gestation length as human. We identified 12 heterozygous concepti informative for imprinting studies among 68 Bos taurus fetuses at Day 80 of gestation (28% term) and found predominantly maternal IGF2R expression in all fetal tissues but brain, which escapes imprinting. Inter-individual variation in allelic expression bias, i.e. expression of the repressed paternal allele relative to the maternal allele, ranged from 4.6-8.9% in heart, 4.3-10.2% in kidney, 6.1-11.2% in liver, 4.6-15.8% in lung and 3.2-12.2% in skeletal muscle. Allelic bias for mesodermal tissues (heart, skeletal muscle) differed significantly (Ptaurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy. Common minor inter-individual variation in allelic bias and absence of imprinting abnormalities in IVF fetuses suggest changes in IGF2R expression in overgrown fetuses could be modulated through other mechanisms than changes in imprinting.

  13. AVALIAÇÕES DA PARASITEMIA, DO HEMATÓCRITO E DOS NÍVEIS BIOQUÍMICOS SÉRICOS, DE BEZERROS NELORE (Bos indicus, INOCULADOS COM ISOLADOS DE Babesia bigemina (Smith & Kilborne, 1893 DAS REGIÕES SUL, SUDESTE, CENTRO-OESTE, NORDESTE E NORTE DO BRASIL

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Schenki

    2006-10-01

    Full Text Available Avaliaram-se a parasitemia, o hematócrito e os níveis séricos de bilirrubina total, creatinina, uréia e colesterol de bezerros Nelore (Bos indicus inoculados com isolados de Babesia bigemina das cinco regiões fisiográficas do Brasil. Constatou-se que os diferentes isolados desenvolveram baixa parasitemia, nos animais experimentalmente inoculados, diminuição do colesterol sérico, e que não houve variações nos níveis de bilirrubina, creatinina e uréia sérica. PALAVRAS-CHAVE: Bos indicus, Babesia bigemina, parasitemia, bioquímica sérica.

  14. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on the disease phenotypes of dairy cows with experimentally induced Escherichia coli mastitis

    DEFF Research Database (Denmark)

    Khatun, Momena; Sørensen, Peter; Jørgensen, Hanne Birgitte Hede

    2013-01-01

    Several quantitative trait loci (QTL) affecting mastitis incidence and mastitis-related traits such as somatic cell score exist in dairy cows. Previously, QTL haplotypes associated with susceptibility to Escherichia coli mastitis in Nordic Holstein-Friesian (HF) cows were identified on Bos taurus...... in leukocyte kinetics, with low-susceptibility cows having faster blood PMNL recruitment and SCC recovery and a tendency for a milder clinical response than the high-susceptibility cows did....... motility; and the paraclinical parameters: bacterial counts, somatic cell count (SCC), and milk amyloid A levels in milk; and white blood cell count, polymorphonuclear neutrophilic leukocyte (PMNL) count, and serum amyloid A levels in blood were recorded at different time points post-E. coli inoculation....... Escherichia coli inoculation changed the clinical and paraclinical parameters in all cows except one that was not infected. Clinically, the HH group tended to have higher body temperature and heart rate than the HL group did. Paraclinically, the HL group had faster PMNL recruitment and SCC recovery than...

  15. Proteomic analysis of seminal plasma from locally-adapted "Curraleiro Pé-Duro bulls" (Bos taurus): identifying biomarkers involved in sperm physiology in endangered animals for conservation of biodiversity.

    Science.gov (United States)

    Menezes, E B; de Oliveira, R V; van Tilburg, M F; Barbosa, E A; Nascimento, N V; Velho, A L M C S; Moreno, F B; Moreira, R A; Monteiro-Moreira, A C O; Carvalho, G M C; Ramos, A F; Memili, E; Moura, A A

    2017-08-01

    The present study was aimed at evaluating the seminal plasma proteins and sperm parameters of Curraleiro Pé-Duro bulls. Semen was collected from 10 bulls by electroejaculation, and sperm parameters were evaluated in fresh and frozen-thawed semen. Seminal plasma proteins were analyzed by 2-D SDS-PAGE and mass spectrophotometry. Tools in computational biology were used to generate bioinformatic knowledge and evaluate gene ontology, protein-protein interactions, phylogenetic trees and multiple sequence alignments. Sperm motility in fresh and frozen-thawed semen was 78.8±1.8% and 21.2±1.6%, respectively. Pearson's correlations were evaluated (ptaurus, and other domestic species were similar. Phylogenetic tree analysis demonstrated that clusterin from Bos taurus was related to Ovis aries and domains of clusterin, spermadhesin 1, BSP 1 and inhibitor of carbonic anhydrase were conserved as well. In summary, specific seminal proteins are associated with sperm parameters of locally-adapted bulls. Use of the endangered mammalian as a model may assist in understanding aspects of evolutionary adaptations and could improve assisted reproductive biotechnologies. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Identification of nontuberculous mycobacteria isolated from Hanwoo (Bos taurus coreanae) in South Korea by sequencing analysis targeting hsp65, rpoB and 16S rRNA genes.

    Science.gov (United States)

    Kim, Bo-Ram; Kim, Jae Myung; Kim, Byoung-Jun; Jang, Yunho; Ryoo, Soyoon; Kook, Yoon-Hoh; Kim, Bum-Joon

    2014-10-10

    Combinatorial molecular taxonomic approaches targeting 3 genes, 16S rRNA (1.2-1.3kbp), hsp65 (603-bp), and rpoB genes (711-bp) were applied to 43 non-tuberculous mycobacteria (NTM) strains isolated from a Korean native cattle from bronchial lymph nodes and lung, Hanwoo (Bos taurus coreanae) in South Korea. Of 43 NTM isolates, Mycobacterium avium complex strains (MAC) were isolated with the highest frequency (31 strains, 72.1%). Contrary to other reports, M. intracellulare strains (23 strains, 53.5%) of MACs were more prevalent than M. avium strains (8 strains, 18.6%). Further separation of isolated M. intracellulare into genotype level by hsp65 analysis showed that isolates of the HG-1 genotype (60.9%, 14/23 isolates), known to be specific to Korean patients, was more prevalent than the HG-2 type (17.4%, 4/23 strains), which include the type strain, M. intracellulare ATCC 13950(T). Compared to NTM infections of Korean human patients, the pronounced difference found in this study is that no M. abscessus infections in Hanwoo were found. In conclusion, our data showed that the isolated species frequency of NTMs, particularly MACs from Hanwoo, was very comparable to that obtained from Korean human infection, suggesting that humans and Korean native cattle may share common environmental sources for NTM infections. Copyright © 2014 Elsevier B.V. All rights reserved.

  17. Anatomy, death, and preservation of a woolly mammoth (Mammuthus primigenius) calf, Yamal Peninsula, northwest Siberia

    NARCIS (Netherlands)

    Fisher, Daniel C.; Tikhonov, Alexei N.; Kosintsev, Pavel A.; Rountrey, Adam N.; Buigues, Bernard; van der Plicht, Johannes

    2012-01-01

    A well-preserved woolly mammoth calf found in northwest Siberia offers unique opportunities to investigate mammoth anatomy, behavior, life history and taphonomy. Analysis of the fluvial setting where the specimen was found suggests it was derived from eroding bluffs during ice-out flooding in June

  18. Woolly mammoth ( Mammuthus primigenius Blum.) and its environment in northern Europe during the last glaciation

    Science.gov (United States)

    Ukkonen, P.; Aaris-Sørensen, K.; Arppe, L.; Clark, P. U.; Daugnora, L.; Lister, A. M.; Lõugas, L.; Seppä, H.; Sommer, R. S.; Stuart, A. J.; Wojtal, P.; Zupiņš, I.

    2011-03-01

    Woolly mammoths were large, herbivorous, cold-adapted mammals of the Late Pleistocene. The diet and habitat requirements of the species set certain constraints on the palaeoenvironments it could occupy. The relationship between the mammoth's shifting range and changing environments can be explored using independent data on ice sheet configuration, temperature, and vegetation, provided the locality and age of the fossil remains can be validated. Here we present a comprehensive record of occurrence of the woolly mammoth in the circum-Baltic region of northern Europe during the last glaciation, based on a compilation of radiocarbon-dated remains. The record shows that the mammoth was widespread in northern and north-eastern Europe during Marine Isotope Stage 3 (MIS 3), at 50,000-30,000 calibrated years ago (50-30 ka). The presence of the species up to 65°N latitude supports the restriction of the Scandinavian Ice Sheet (SIS) during MIS 3. The widest distribution range round 30 ka was followed by a decline that led to the disappearance of mammoths from the area during the maximum extent of the SIS, from 22 to 18 ka. The woolly mammoth re-colonized the Baltic region and southern Scandinavia after the onset of the late-glacial deglaciation at 17 ka. The late-glacial record suggests a markedly fluctuating population changing its range in tune with the rapid environmental changes. The last appearance of mammoth in our study region was in Estonia during the Younger Dryas (Greenland Stadial 1; GS1) at about 12 ka. The two major periods of occurrence during MIS 3 and the late-glacial stadial suggest that mammoth had a wide tolerance of open to semi-open tundra and steppe-tundra habitats with intermediately cold climate, whereas the 22-18 ka disappearance suggests a major southward and/or eastward retreat in response to extremely cold, glacial conditions near the SIS margin. The final regional extinction correlates with the re-forestation during the rapid warming at the Younger Dryas-Holocene boundary.

  19. An examination of positive selection and changing effective population size in Angus and Holstein cattle populations (Bos taurus using a high density SNP genotyping platform and the contribution of ancient polymorphism to genomic diversity in Domestic cattle

    Directory of Open Access Journals (Sweden)

    Hayes Ben

    2009-04-01

    Full Text Available Abstract Background Identifying recent positive selection signatures in domesticated animals could provide information on genome response to strong directional selection from domestication and artificial selection. With the completion of the cattle genome, private companies are now providing large numbers of polymorphic markers for probing variation in domestic cattle (Bos taurus. We analysed over 7,500 polymorphic single nucleotide polymorphisms (SNP in beef (Angus and dairy (Holstein cattle and outgroup species Bison, Yak and Banteng in an indirect test of inbreeding and positive selection in Domestic cattle. Results Outgroup species: Bison, Yak and Banteng, were genotyped with high levels of success (90% and used to determine ancestral and derived allele states in domestic cattle. Frequency spectrums of the derived alleles in Angus and Holstein were examined using Fay and Wu's H test. Significant divergences from the predicted frequency spectrums expected under neutrality were identified. This appeared to be the result of combined influences of positive selection, inbreeding and ascertainment bias for moderately frequent SNP. Approximately 10% of all polymorphisms identified as segregating in B. taurus were also segregating in Bison, Yak or Banteng; highlighting a large number of polymorphisms that are ancient in origin. Conclusion These results suggest that a large effective population size (Ne of approximately 90,000 or more existed in B. taurus since they shared a common ancestor with Bison, Yak and Banteng ~1–2 million years ago (MYA. More recently Ne decreased sharply probably associated with domestication. This may partially explain the paradox of high levels of polymorphism in Domestic cattle and the relatively small recent Ne in this species. The period of inbreeding caused Fay and Wu's H statistic to depart from its expectation under neutrality mimicking the effect of selection. However, there was also evidence for selection

  20. An examination of positive selection and changing effective population size in Angus and Holstein cattle populations (Bos taurus) using a high density SNP genotyping platform and the contribution of ancient polymorphism to genomic diversity in Domestic cattle.

    Science.gov (United States)

    MacEachern, Sean; Hayes, Ben; McEwan, John; Goddard, Mike

    2009-04-24

    Identifying recent positive selection signatures in domesticated animals could provide information on genome response to strong directional selection from domestication and artificial selection. With the completion of the cattle genome, private companies are now providing large numbers of polymorphic markers for probing variation in domestic cattle (Bos taurus). We analysed over 7,500 polymorphic single nucleotide polymorphisms (SNP) in beef (Angus) and dairy (Holstein) cattle and outgroup species Bison, Yak and Banteng in an indirect test of inbreeding and positive selection in Domestic cattle. Outgroup species: Bison, Yak and Banteng, were genotyped with high levels of success (90%) and used to determine ancestral and derived allele states in domestic cattle. Frequency spectrums of the derived alleles in Angus and Holstein were examined using Fay and Wu's H test. Significant divergences from the predicted frequency spectrums expected under neutrality were identified. This appeared to be the result of combined influences of positive selection, inbreeding and ascertainment bias for moderately frequent SNP. Approximately 10% of all polymorphisms identified as segregating in B. taurus were also segregating in Bison, Yak or Banteng; highlighting a large number of polymorphisms that are ancient in origin. These results suggest that a large effective population size (N(e)) of approximately 90,000 or more existed in B. taurus since they shared a common ancestor with Bison, Yak and Banteng ~1-2 million years ago (MYA). More recently N(e) decreased sharply probably associated with domestication. This may partially explain the paradox of high levels of polymorphism in Domestic cattle and the relatively small recent N(e) in this species. The period of inbreeding caused Fay and Wu's H statistic to depart from its expectation under neutrality mimicking the effect of selection. However, there was also evidence for selection, because high frequency derived alleles tended to

  1. An examination of positive selection and changing effective population size in Angus and Holstein cattle populations (Bos taurus) using a high density SNP genotyping platform and the contribution of ancient polymorphism to genomic diversity in Domestic cattle

    Science.gov (United States)

    MacEachern, Sean; Hayes, Ben; McEwan, John; Goddard, Mike

    2009-01-01

    Background Identifying recent positive selection signatures in domesticated animals could provide information on genome response to strong directional selection from domestication and artificial selection. With the completion of the cattle genome, private companies are now providing large numbers of polymorphic markers for probing variation in domestic cattle (Bos taurus). We analysed over 7,500 polymorphic single nucleotide polymorphisms (SNP) in beef (Angus) and dairy (Holstein) cattle and outgroup species Bison, Yak and Banteng in an indirect test of inbreeding and positive selection in Domestic cattle. Results Outgroup species: Bison, Yak and Banteng, were genotyped with high levels of success (90%) and used to determine ancestral and derived allele states in domestic cattle. Frequency spectrums of the derived alleles in Angus and Holstein were examined using Fay and Wu's H test. Significant divergences from the predicted frequency spectrums expected under neutrality were identified. This appeared to be the result of combined influences of positive selection, inbreeding and ascertainment bias for moderately frequent SNP. Approximately 10% of all polymorphisms identified as segregating in B. taurus were also segregating in Bison, Yak or Banteng; highlighting a large number of polymorphisms that are ancient in origin. Conclusion These results suggest that a large effective population size (Ne) of approximately 90,000 or more existed in B. taurus since they shared a common ancestor with Bison, Yak and Banteng ~1–2 million years ago (MYA). More recently Ne decreased sharply probably associated with domestication. This may partially explain the paradox of high levels of polymorphism in Domestic cattle and the relatively small recent Ne in this species. The period of inbreeding caused Fay and Wu's H statistic to depart from its expectation under neutrality mimicking the effect of selection. However, there was also evidence for selection, because high frequency

  2. (Bos grunniens) in Qinghai-Tibetan Plateau

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2012-10-30

    Oct 30, 2012 ... Gu W, Zhou T, Ma J, Sun X, Lu Z (2004). The relationship between synonymous codon usage and protein structure in Escherichia coli and Homo sapiens. Biosystems 73:89-97. Hall TA (1999). BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl.

  3. Toxoplasma gondii in experimentally infected Bos taurus and Bos indicus semen and tissues Toxoplasma gondii em semen e tecidos de Bos taurus and Bos indicus experimentalmente infectados

    Directory of Open Access Journals (Sweden)

    Leslie Scarpelli

    2009-01-01

    Full Text Available Eighteen young steers were inoculated with Toxoplasma gondii and randomly distributed into three groups of six animals each: GI, 2.5x10(5 "P" strain oocysts, GII, 5.0x10(6 "RH" strain tachyzoites, and GIII (Control. Clinical, serological and parasitemia exams were realized. Parasite investigation by bioassay and PCR was realized on semen and fragments of skeletal musculature, lymph nodes, brain, retina, spleen, liver, lung, testicle, epididymis and seminal vesicle. Blood and semen samples were collected on days -2, -1, 1, 3, 5, 7, 14 and weekly thereafter, up to postinfection day (PID 84. The inoculated steers (GI and GII presented hyperthermia from PID 3 to 16. Antibodies against T. gondii were detected through the indirect fluorescence antibody test (IFAT on PID 5 (1:16 in both inoculated groups (oocysts and tachyzoites, reaching peaks of 1:4096 on PID 7. Parasitemia outbursts occurred in all infected bovines, principally from PID 7 to 28, independent of the strain and inoculate used. Bioassays revealed the presence of parasites in semen samples of animals infected with oocysts (GI and tachyzoites (GII on several experimental days between PID 7 and 84. Tissue parasitism by T. gondii was diagnosed by bioassay and the PCR technique in several organ and tissue fragments. These findings suggest the possibility of sexual transmission of T. gondii in the bovine species.Dezoito bovinos foram inoculados com Toxoplasma gondii e distribuídos aleatoriamente em três grupos de seis bovinos cada: GI (2,5x10(5 oocistos da cepa "P", GII (5,0x10(6 taquizoítos da cepa "RH" e GIII (controle. Exames clínicos, sorológicos e parasitêmicos foram realizados. Pesquisas do parasito, por meio da bioprova e pela técnica de Reação em Cadeia pela Polimerase (PCR, foram realizadas no sêmen e em fragmentos de musculatura esquelética, linfonodos, cérebro, retina, baço, fígado, pulmão, testículo, epidídimo e vesícula seminal. Amostras de sangue e sêmen foram colhidas nos dias -2, -1, 1, 3, 5, 7, 14 e, semanalmente, até o 84º dia pós-infecção (DPI. Os bovinos inoculados (GI e GII apresentaram hipertermia do 3º ao 16º DPI. Anticorpos contra T. gondii foram detectados (IFI no 5º DPI (1:16, em ambos grupos inoculados (oocistos e taquizoítos, atingindo picos de 1:4096 no 7º DPI. Surtos parasitêmicos ocorreram em todos os bovinos infectados, principalmente do 7º ao 28º DPI, independente da cepa e inóculo utilizados. O bioensaio revelou a presença do parasito em amostras seminais dos bovinos infectados com oocistos (GI e taquizoítos (GII, em diversas datas experimentais, entre o 7º e 84º DPI. Parasitismo tissular por T. gondii foi diagnosticado por meio da bioprova e pela técnica da PCR, em vários fragmentos de tecidos e/ou órgãos. Os achados sugerem a possibilidade da ocorrência da transmissão sexual do T. gondii na espécie bovina.

  4. Etniske minoriteters bosætning

    DEFF Research Database (Denmark)

    Børresen, Sølvi Karin

    Etniske minoriteter synes at samles i bestemte dele af boligbestanden og i bestemte boligområder. Hvorfor forholder det sig sådan? Forskningen viser, at forklaringerne er sammensatte. I denne rapport gøres rede for udvalgte danske og udenlandske undersøgelser vedrørende etniske minoriteters...

  5. PREWEANING GROWTH OF BRTTISH. BOS INDICUS ...

    African Journals Online (AJOL)

    Depnrtment ol' Livt'sttx'k St'ience, Universitl' of. Prt' t o ri^a, Sou t lt A frt ca. 2. Stockowner's Co-operative, How,ic'k, Nutal, South. A I'rica. Materials and Methods. The Johannesburg City Council operates 2 beef cattle farms on the Tranwaal highveld utilizing the sewerage effluent emanating from the Johannesburg sewerage.

  6. Avaliação da técnica de aspiração ovocitária transvaginal (Ovum Pick Up) e produção in vitro de embriões da raça nelore (Bos taurus indicus) oriundos de doadoras com alterações da fertilidade

    OpenAIRE

    SOUSA, Alysson Jorge de Oliveira

    2008-01-01

    Este experimento teve como objetivo avaliar a possibilidade da utilização de fêmeas zebuínas de elevada qualidade genética, com problemas de fertilidade, adquiridos após um programa de transferência convencional de embriões, como doadoras de ovócitos em um programa de Ovum Pick Up e Produção In Vitro de embriões. Fêmeas da raça Nelore (n=16) (Bos taurus indicus), com idade média de 11 anos e 7 meses, foram submetidas às mesmas condições de ambiente, alimentação e manejo. Estes animais f...

  7. Collection of radiocarbon dates on the mammoths ( Mammuthus primigenius) and other genera of Wrangel Island, northeast Siberia, Russia

    Science.gov (United States)

    Vartanyan, Sergey L.; Arslanov, Khikmat A.; Karhu, Juha A.; Possnert, Göran; Sulerzhitsky, Leopold D.

    2008-07-01

    We present and discuss a full list of radiocarbon dates for woolly mammoth and other species of the Mammoth fauna available from Wrangel Island, northeast Siberia, Russia. Most of the radiocarbon dates are published here for the first time. Of the124 radiocarbon dates on mammoth bone, 106 fall between 3700 and 9000 yr ago. We believe these dates bracket the period of mammoth isolation on Wrangel Island and their ultimate extinction, which we attribute to natural causes. The absence of dates between 9-12 ka probably indicates a period when mammoths were absent from Wrangel Island. Long bone dimensions of Holocene mammoths from Wrangel Island indicate that these animals were comparable in size to those on the mainland; although they were not large animals, neither can they be classified as dwarfs. Occurrence of mammoth Holocene refugia on the mainland is suggested. Based on other species of the Mammoth fauna that have also been radiocarbon on Wrangel Island, including horse, bison, musk ox and woolly rhinoceros, it appears that the mammoth was the only species of that fauna that inhabited Wrangel Island in the mid-Holocene.

  8. Freezing, thawing and aging effects on beef tenderness from Bos indicus and Bos taurus cattle.

    Science.gov (United States)

    Aroeira, Carolina N; Torres Filho, Robledo A; Fontes, Paulo Rogério; Gomide, Lúcio Alberto M; Ramos, Alcinéia L S; Ladeira, Márcio M; Ramos, Eduardo M

    2016-06-01

    The objective of this study was to determine the effects of freezing prior to aging on the meat tenderness of young Nellore and Aberdeen Angus bulls. Samples of the longissimus thoracis muscle were submitted to two treatments: conventional aging and freezing (-20°C for 40 days) followed by thawing and aging periods. The meats were evaluated after 0, 7, 14 and 21 aging days (1°C). Freezing increased (PFreezing increased proteolysis during aging in the meats of both breeds, but reduced shear force was found (Pfreezing prior to aging may contribute to meat tenderness in the first weeks of aging, but it is dependent on the animal breed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Differences of skin morphology in Bos indicus, Bos taurus, and their crossbreds.

    Science.gov (United States)

    Jian, Wang; Duangjinda, M; Vajrabukka, C; Katawatin, Suporn

    2014-08-01

    Cutaneous evaporation is the main avenue by which cattle dissipate heat via the involvement of sweat glands and other skin components. The difference in skin morphology between B. indicus and B. taurus has been recognized, as well as differences in their ability to tolerate heat. The objective of this study was to compare skin morphology between B. indicus, B. taurus, and their crossbreds. Skin samples of Sahiwal (B. indicus) (n=10, reddish brown skin) and Holstein Friesian (HF) (B. taurus) (n=10, black and white skin) and crossbred of HF75% (n=10, black and white skin) and HF87.5 % (n=10, black and white skin) were biopsied for histological study, followed by measurement of skin components. The results indicated that breed significantly affected sweat gland morphology. The shape of the sweat gland, as indicated by the ratio of length/diameter, in Sahiwal was baggier in shape compared to HF (5.99 and 9.52) while values for crossbreds were intermediate (7.82, 8.45). The density and volume of sweat glands in Sahiwal (1,058 glands/cm(2); 1.60 μ(3) × 10(-6)) were higher than in HF (920 glands/cm(2); 0.51 μ(3)x10(-6)) and crossbreds, both HF 75 % (709 glands/cm(2); 0.68 μ(3) × 10(-6)) and HF 87.5 % (691 glands/cm(2); 0.61 μ(3) × 10(-6)) respectively. However, capillary surface area was greater for HF (2.07 cm(2)) compared to Sahiwal (1.79 cm(2)); accordingly, the lower genetic fraction of HF in crossbred cattle showed less capillary surface area (1.83 and 1.9 cm(2) for HF75% and HF87.5 %) (Ptaurus and their crossbreds, with these differences being more or less related to the genetic fraction of HF. This may imply that capability for cutaneous evaporative heat loss and tolerance to heat in crossbred cattle could be related to skin morphology.

  10. [DNA-fingerprinting of representatives of Bovinae subfamilies using the telomere markers (TTAGGG)4].

    Science.gov (United States)

    Semenova, S K; Vasil'ev, V A; Steklenev, E P; Prosniak, M I; Ryskov, A P

    1999-01-01

    The (TTAGGG)4 oligonucleotide homologous to telomeric tandem repeats of human chromosomes was used for the first time as a multilocus hybridization probe for the analysis of genome variability in the two genera (Bos and Bison) of the Bovinae subfamily. DNA profiles for cattle, banteng, aurochs, and bison were obtained. Hybridization spectra were represented by the discrete individual- and species-specific bands characterized by codominant inheritance. For comparison, DNA profiles of the same samples obtained using the bacteriophage M13 DNA probe are presented. The usefulness of the microsatellite examined for the testing of pedigrees, description of intra- and interbreed variability as well as for determining relationships and the origins of the species of the Bovinae subfamily is discussed.

  11. The multifaceted origin of taurine cattle reflected by the mitochondrial genome.

    Directory of Open Access Journals (Sweden)

    Alessandro Achilli

    Full Text Available A Neolithic domestication of taurine cattle in the Fertile Crescent from local aurochsen (Bos primigenius is generally accepted, but a genetic contribution from European aurochsen has been proposed. Here we performed a survey of a large number of taurine cattle mitochondrial DNA (mtDNA control regions from numerous European breeds confirming the overall clustering within haplogroups (T1, T2 and T3 of Near Eastern ancestry, but also identifying eight mtDNAs (1.3% that did not fit in haplogroup T. Sequencing of the entire mitochondrial genome showed that four mtDNAs formed a novel branch (haplogroup R which, after the deep bifurcation that gave rise to the taurine and zebuine lineages, constitutes the earliest known split in the mtDNA phylogeny of B. primigenius. The remaining four mtDNAs were members of the recently discovered haplogroup Q. Phylogeographic data indicate that R mtDNAs were derived from female European aurochsen, possibly in the Italian Peninsula, and sporadically included in domestic herds. In contrast, the available data suggest that Q mtDNAs and T subclades were involved in the same Neolithic event of domestication in the Near East. Thus, the existence of novel (and rare taurine haplogroups highlights a multifaceted genetic legacy from distinct B. primigenius populations. Taking into account that the maternally transmitted mtDNA tends to underestimate the extent of gene flow from European aurochsen, the detection of the R mtDNAs in autochthonous breeds, some of which are endangered, identifies an unexpected reservoir of genetic variation that should be carefully preserved.

  12. Desenvolvimento folicular no pós-parto de vacas da raça Gir tratadas com acetato de buserelina (GnRH ou gonadotrofina coriônica humana (hCG Follicular development in Gir breed cows (Bos indicus treated with buserelin acetate or human chorionic gonadotrophin during the postpartum period

    Directory of Open Access Journals (Sweden)

    Álan Maia Borges

    2004-12-01

    Full Text Available Foram utilizadas 22 vacas da raça Gir (Bos indicus em anestro pós-parto, amamentando e mantidas sob regime de pastejo. O padrão de crescimento folicular foi estudado em 15 animais, enquanto os outros sete foram utilizados somente no acompanhamento da resposta aos tratamentos hormonais. Ultra-sonografia em tempo real foi realizada diariamente, do quarto ao qüinquagésimo dia de lactação, por meio de aparelho equipado com probe de 5MHz. Nenhum animal apresentou estro, ovulação ou luteinização folicular durante o período de avaliação. Verificaram-se quatro a oito ondas foliculares surgindo em intervalos de seis a sete dias, cujo diâmetro máximo dos folículos dominantes e subordinados foi de 8,9±0,6 e 6,3±0,7mm, respectivamente. Aos 56 dias pós-parto, as 22 vacas foram divididas em dois grupos: 11 tratadas com 4,2 mig de acetato de buserelina e 11 com 3.000UI de hCG. A ovulação, regressão e luteinização folicular foram verificadas em animais dos dois tratamentos e uma nova onda folicular surgiu dentro de dois a três dias após a terapia hormonal. Corpos lúteos de menor tamanho e concentrações de progesterona abaixo de 1ng/mL indicaram baixa atividade luteal.This experiment was carried out with 22 anestrus Gir cows (Bos indicus, with the postpartum follicular growth studied in 15 of these suckling and kept on pasture, while the seven others were used only for hormonal treatments. Daily real time ultrasonography was done from 4th to the 50th day, using B-mode ultrasound scanner equipped with a linear array 5.0MHz probe. No animal showed estrus, ovulation or follicular luteinization during de experimental period. Four to eight follicular waves emerged each six or seven days and maximum diameter of dominant and subordinate follicles were 8.9±0.6mm and 6.3±0.7mm, respectively. On day 56 of postpartum all cows were separated in two groups: 11 cows were treated either with 4.2 mug of buserelin acetate and 11 with 3,000UI of h

  13. Study of the temperament of bos indicus calves on weaning

    Directory of Open Access Journals (Sweden)

    Gustavo da Silva Freitas

    2012-12-01

    Full Text Available Ones of the largest commercial cattle herd in the world, Brazil has its cattle characterized by the use of an extensive system and the predominance of zebu breeds, especially the Nelore and its crosses. In this system the temperament of cattle becomes a problem because of the low human-animal interaction, and bad-tempered animals can cause accidents, increase maintenance costs of facilities and provide poorer quality of the carcass, meat and leather. The aim of this study was to evaluate the temperament of 24 calves Nellore and Guzerath purebreds , with a mean of 235.81 ± 39.95 days of age after submitted into two treatments during the breeding season of the cows. The treatments were: T1 - calves submitted to the management of permanent feeding (PF and T2 - calves submitted to the management of controlled feeding (CF. Ninety days after the beginning of the breeding season, the CF was interrupted and the calves stayed with their mothers until weaning. The temperament of calves was evaluated in the weaning management through the following methods: escape velocity in meters/second (EV, reactivity test in the contention trunk (RT, crush score (CS and escape distance (ED. The EV was obtained with the use of the equipment "flight speed" placed in the exit of the trunk contention. The animals with higher velocity were considered the worst temperament. The CS, on a scale of 1 to 5, evaluated the general condition of the animals including movement, stress, behavioral signs of stress such as muscle tone, sclerotic membrane and muscle shake. The highest scores were given to animals with worst temperament. The ED was held inside the barn (97m², where the observer moved toward the animal (one step per second and registered the distance in meters of how the animal allowed the approach before starting the escape. The animals that maintained for a period more than 60 seconds inside the barn had the highest ED (8.5 m. With the adoption of the CF and a good management, the animals tend to get used to it and, consequently, to humans, resulting in less react. To verify possible statistical differences in the reactivity of the animals, was used the Mann-Whitney test. Through the displacement (z = 0.26, P = 0.84, stress (z = 1.32, P= 0.24, CS (z = -0.49, P= 0.67, ED (z = -1.68, P= 0.10 and EV (z = 0.23, P= 0.84, no significant difference was observed between treatments. The ED variable showed a higher standard deviation, possibly because of the number of evaluated animals. Under the daily management of controlled feeding, it was expected a lower ED of the animals submitted to the T2 treatment, but it can conclude that the animals of CF and PF have an equidistant reactivity at weaning, probably this is due the fact of the reduction of human-animal interaction after the end of the breeding season and also because of the increased expression of natural behaviors that zebu cattle have, such as high reactivity and fear of man.

  14. BIOACTIVE PEPTIDES OF THE COW MILK WHEY PROTEINS (Bos taurus

    Directory of Open Access Journals (Sweden)

    A. V. Iukalo

    2013-10-01

    Full Text Available Data on the biological functions of milk whey proteins, which are implemented at the level of their proteolytic degradation products — bioactive peptides have been reviewed. The main functions of these proteins is to provide the amino acid nutrition of mammals in the early stages of development, as well as the transport of fatty acids, retinol, involved in the synthesis of lactose, ions of calcium and iron, immune protection, antimicrobial action, etc. However, in recent years, it has been found that milk proteins like casein are precursors of biologically active peptides. Аngiotensin — converting enzyme, opioid peptides which are opiate receptor agonists, anti–microbial peptides, peptides with immunomodulatory and hypocholesterolemic action, and peptides affecting motility have been found among the products of proteolytic degradation of ?-lactoglobulin, ?-laktoalbumin, lactoferrin and milk whey albumin. Also data on the possible participation of peptides from milk whey proteins in the implementation of the biological functions of both the assimilation of calcium, antioxidant effect, the regulation of appetite, anticarcinogenic are provided. The authors assume that the phenomenon of bioactive peptides formation could be considered as an additional function of natural food proteins, which gives advantages to the mammals and has a positive effect on their development in the postnatal period. Ways of bioactive peptides formation, their resistance to action of proteolytic enzymes, the ability to cross into the bloodstream and have biological effects have been also discussed. Up to date, only a few products with bioactive peptides from milk whey proteins are obtained. Further studies of their structure, mechanism of action, ways of formation and methods of isolation are required for their wider use. Formation of functional products based on bioactive peptides from milk whey proteins will allow efficient use of milk whey, which is often a byproduct of the dairy industry.

  15. BLUE OCEAN STRATEGY (BOS SEBAGAI PARADIGMA BARU MANAJEMEN PENDIDIKAN ISLAM

    Directory of Open Access Journals (Sweden)

    Ikhwan Fuad

    2016-08-01

    Full Text Available The focus of this article is to describe the Blue Ocean Strategy as a new paradigm of Islamic education management. the author seeks to elaborate on how the adoption of the Blue Ocean strategy of the business world to the world of education and answered the principles of what is accepted and rejected away from the theory. Adoption of blue ocean strategy is done by applying the universal principles are : among others reconstruct market boundaries, focus on the big picture rather than numbers, reach beyond existing demand, perform a series of strategies with appropriate, efforts to overcome organizational constraints and integrate execution into strategy. The principles of Blue Ocean Strategy Indicators that can be absorbed is an indicator that focuses gave excellent service and were not absorbed is a strong indicator of economic motivation. Generally, Blue Ocean Strategy quite well applied as a management paradigm of Islamic education.

  16. Background Oriented Schlieren (BOS) of a Supersonic Aircraft in Flight

    Science.gov (United States)

    Heineck, James T.; Banks, Daniel W.; Schairer, Edward T.; Haering, Edward A.; Bean, Paul S.

    2016-01-01

    This article describes the development and use of Background Oriented Schlieren on a full-scale supersonic jet in flight. A series of flight tests was performed in October, 2014 and February 2015 using the flora of the desert floor in the Supersonic Flight Corridor on the Edwards Air Force Base as a background. Flight planning was designed based on the camera resolution, the mean size and color of the predominant plants, and the navigation and coordination of two aircraft. Software used to process the image data was improved with additional utilities. The planning proved to be effective and the vast majority of the passes of the target aircraft were successfully recorded. Results were obtained that are the most detailed schlieren imagery of an aircraft in flight to date.

  17. Consolidation of Base Operations Support (BOS) in Panama

    Science.gov (United States)

    1982-12-01

    Canal area. Its activities have been consolidated on an intraservice basis under single managership at tLe 193d Infantry Brigade. The consolidation...Force single managership . They did, however, re C-6 disagree that two positions could be saved, arguing that seasonal fluctuations in workload require

  18. Characterization of yolk sac proteins of Bos indicus cattle embryos.

    Science.gov (United States)

    Matsumoto, F S; Oliveira, V C; Mançanares, C A F; Ambrosio, C E; Miglino, M A

    2012-11-14

    The yolk sac is an embryonic membrane that is essential for the embryo's initial survival in many mammals. It also plays an important role in the production of proteins necessary for development. We studied proteins of the yolk sac in bovine embryos at up to 40 days of gestation. We examined the yolk sac of 17 bovine embryos at different gestational periods, measuring α-fetoprotein, α-1-antitrypsin, and transferrin. This experiment was carried out by Western blot technique, associated with electrophoresis on a 6% sodium dodecyl sulfate polyacrylamide gel. Mouse monoclonal antibody anti-human-α-fetoprotein, mouse antibody anti-human-transferrin and rabbit polyclonal anti-human-α-1-antitrypsin were used as primary antibodies, and conjugated peroxidase as a secondary antibody. We detected the three proteins in some of the yolk sac samples; however, the bands in some specimens (samples) were weak, maybe a result of poor antigen-antibody reaction, since the antibodies used in this study were not specific to bovine proteins. The fact that weak bands appeared might be due to a weak cross-reaction.

  19. Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

    African Journals Online (AJOL)

    , bile and dung in their folk medicine in Nigeria and South Africa. ... from domestic animals such as honey, milk, fat, bone marrow, blood, flesh, faeces, urine, ..... body functions by lowering cholesterol level, improving memory, enhancing the ...

  20. Culture-independent analysis of microflora in Gayals ( Bos frontalis ...

    African Journals Online (AJOL)

    Comparative DNA sequence analysis of 16S/18S rRNA genes (rDNA) were undertaken to further our understanding of the make-up of micro-organisms communities in the feces of Gayals. Total DNA were extracted from the feces of 5 Gayals. Two rDNA libraries (16S/18S rDNA) were constructed. In the 16S rDNA library, ...

  1. De prijsvorming van hout uit het Nederlandse bos

    NARCIS (Netherlands)

    Slangen, L.H.G.

    1987-01-01

    The aim of this study is to elucidate the price formation of home- grown Dutch timber. First, Dutch forestry is typified. Then, the functions and structure of the roundwood trade are discussed. An econometric model is specified in order to analyse the factors that determine the 'passing

  2. ANALISA AKUNTABILITAS DAN TRANSPARANSI TENTANG IMPLEMENTASI KEBIJAKAN PENGELOLAAN BOS

    Directory of Open Access Journals (Sweden)

    Nurul Hariswati

    2015-01-01

    Full Text Available This research was conducted with the aim to analyse the implementation of the accountability and transparency financial management which the source stemming from government. The approach used is a case study of indepth interview from financial manager, head master, and stakeholders. The results of this research show that first appeared as constraints and not regulated and obligations of private schools in terms of taxation. Second, the scale of priority importance of accountability between the financial manager and head master has different values so as conflicts of interest. Third, the implementation of transparency development from the publication such as via the website, call center, facebook. The fourth, the Government has n ot set a standard policy to use of the grant allocations.

  3. Ethnoveterinary survey of tradomedical importance of Bos taurus L ...

    African Journals Online (AJOL)

    Purpose: To evaluate the ethnoveterinary uses of cow by-products from Nigeria and South Africa. Methods: A field survey was conducted from January to September, 2015 by conducting interviews with 110 respondents who provided information in respect of the use of cow urine, bile and dung in their folk medicine in ...

  4. Serological evidence for brucellosis in Bos indicus in Nigeria

    NARCIS (Netherlands)

    Bertu, Wilson J.; Gusi, Amahyel M.; Hassan, Moses; Mwankon, Esther; Ocholi, Reuben A.; Ior, Daniel D.; Husseini, Bakari A.; Ibrahim, Gideon; Abdoel, Theresia H.; Smits, Henk L.

    2012-01-01

    Purpose Nigeria is the largest cattle-rearing nation in Africa with most animals kept under traditional husbandry practices. While bovine brucellosis does not receive much attention, a relatively high seroprevalence is found in samples submitted for laboratory testing. The aim of the study was to

  5. Hvor bosætter folk sig i Kumasi, Ghana?

    DEFF Research Database (Denmark)

    Eskemose Andersen, Jørgen; Andreasen, Jørgen

    2002-01-01

    overklassen. Det forunderlige og besynderlige er fraværet af store slumråder som ellers ses overalt i den 3 Verdens storbyer. Der er en del slum i den indre del af byen og der bor mange fattige folk i de såkaldte gårdhuse som er så karakterisek for regionen, men det store spørgsmål er hvor den stadige vækst...

  6. Molecular characterization of Cryptosporidium spp. in calves (Bos taurus and Bos indicus in the Formiga city, Minas Gerais - Brazil

    Directory of Open Access Journals (Sweden)

    Roberto César Araujo Lima

    2014-02-01

    Full Text Available Cryptosporidiosis is a waterborne disease, has as aggravating the difficulty of preventing environmental contamination and lack of effective therapeutic measures. With marked importance to the cattle, causes inflammation and intestinal villous atrophy resulting in loss of absorptive surface. This study aimed to perform molecular characterization of Cryptosporidium spp. in calves in the city of Formiga, Minas Gerais. A total of 300 faeces samples from Holstein calves, Nelore and indefinite breed, both healthy, were evaluated by negative contrast staining technique of malachite green and through the reaction of nested PCR for amplification of DNA fragments of the 18S subunit of the RNA gene ribosomal. Occurrence of 5.33 % ( 16/300 for malachite green and 4.66 % ( 14/300 by PCR was observed, whereas no correlation was found between positive and variables studied. Through molecular characterization were identified Cryptosporidium andersoni and Cryptosporidium ryanae species. In conclusion, we observed a low incidence of infection and elimination of Cryptosporidium spp. oocysts, the absence of clinical signs in animals, strong agreement between the results obtained by the two techniques. Beyond, with the molecular characterization ( nested PCR , species of C. andersoni and C. ryanae were diagnosed in age groups not present in the literature. These two species of Cryptosporidium are described above for the first time parasitizing cattle in the state of Minas Gerais.

  7. Different true-protein sources do not modify the metabolism of crossbred Bos taurus × Bos indicus growing heifers

    Directory of Open Access Journals (Sweden)

    Diego Azevedo Mota

    2015-02-01

    Full Text Available The present study was conducted to investigate the effect of alternative true-protein sources to soybean meal, with different ruminal degradability, using a sugarcane-based diet, on nutrient digestion, ruminal fermentation, efficiency of microbial protein synthesis and passage rate in prepubertal dairy heifers. Eight crossbred rumen- and duodenum-cannulated Holstein × Gyr dairy heifers (202.0±11.5 kg BW were evaluated in a 4 × 4 Latin square experimental design with four treatments and four periods in two simultaneous replicates. Dietary treatments were: soybean meal; cottonseed meal; peanut meal; and sunflower meal. When associated with diets containing sugarcane, the different protein sources did not affect intake or digestibility of dry mater, crude protein, organic matter and neutral detergent fiber. The average ruminal pH, NH3-N and concentration of total volatile fatty acids were not different among the diets supplied. The concentration of butyric acid was different among the protein sources, wherein the animals fed the diet with sunflower meal presented lower values than those fed the other sources. Diets did not affect nitrogen balance, microbial nitrogen, microbial synthesisefficiency, estimated dry matter flow, or passage rate. Alternative protein sources can be used to reduce the costs without changing the animal metabolism.

  8. PÉRDIDA DE PESO EN BOVINOS Bos indicus Y Bos taurus DURANTE EL PROCESO DE SUBASTA

    Directory of Open Access Journals (Sweden)

    Pablo Rodr\\u00EDguez-Rodr\\u00EDguez

    2012-01-01

    Full Text Available El objetivo del presente trabajo fue determinar la pérdida de peso de bovinos en subasta. Se evaluó además el porcentaje de merma correspondiente al peso del animal según su sexo, el patrón racial, la categoría comercial, el peso vivo de entrada a las instalaciones de la subasta y el tiempo de espera de cada animal desde el ingreso hasta el momento de su remate. Se analizaron un total de 629 animales en la subasta Asociación Cámara de Ganaderos Unidos del Sur, ubicada en Pérez Zeledón, San José, Costa Rica, entre agosto y noviembre del 2011. El sexo del animal y el patrón racial no tuvieron efecto significativo sobre los kilogramos de peso perdidos. Mientras que, según la categoría comercial, el periodo de espera y el peso de ingreso (p<0,05, se pueden perder entre 4,31 y 9,91; entre 6,16 y 7,31; y entre 3,52 y 9,54 kilos por animal, respectivamente. Para el porcentaje de merma, las variables patrón racial, categoría comercial y el periodo de espera presentaron efectos significativos, no así el sexo y el peso de ingreso. El porcentaje de merma fluctuó entre 1,57 a 2,54%.

  9. Comparison of methanogen diversity of yak (Bos grunniens and cattle (Bos taurus from the Qinghai-Tibetan plateau, China

    Directory of Open Access Journals (Sweden)

    Huang Xiao

    2012-10-01

    Full Text Available Abstract Background Methane emissions by methanogen from livestock ruminants have significantly contributed to the agricultural greenhouse gas effect. It is worthwhile to compare methanogen from “energy-saving” animal (yak and normal animal (cattle in order to investigate the link between methanogen structure and low methane production. Results Diversity of methanogens from the yak and cattle rumen was investigated by analysis of 16S rRNA gene sequences from rumen digesta samples from four yaks (209 clones and four cattle (205 clones from the Qinghai-Tibetan Plateau area (QTP. Overall, a total of 414 clones (i.e. sequences were examined and assigned to 95 operational taxonomic units (OTUs using MOTHUR, based upon a 98% species-level identity criterion. Forty-six OTUs were unique to the yak clone library and 34 OTUs were unique to the cattle clone library, while 15 OTUs were found in both libraries. Of the 95 OTUs, 93 putative new species were identified. Sequences belonging to the Thermoplasmatales-affiliated Linage C (TALC were found to dominate in both libraries, accounting for 80.9% and 62.9% of the sequences from the yak and cattle clone libraries, respectively. Sequences belonging to the Methanobacteriales represented the second largest clade in both libraries. However, Methanobrevibacter wolinii (QTPC 110 was only found in the cattle library. The number of clones from the order Methanomicrobiales was greater in cattle than in the yak clone library. Although the Shannon index value indicated similar diversity between the two libraries, the Libshuff analysis indicated that the methanogen community structure of the yak was significantly different than those from cattle. Conclusion This study revealed for the first time the molecular diversity of methanogen community in yaks and cattle in Qinghai-Tibetan Plateau area in China. From the analysis, we conclude that yaks have a unique rumen microbial ecosystem that is significantly different from that of cattle, this may also help to explain why yak produce less methane than cattle.

  10. Imputation of microsatellite alleles from dense SNP genotypes for parentage verification across multiple Bos taurus and Bos indicus breeds

    Science.gov (United States)

    Microsatellite markers (MS) have traditionally been used for parental verification and are still the international standard in spite of their higher cost, error rate, and turnaround time compared with Single Nucleotide Polymorphisms (SNP) -based assays. Despite domestic and international demands fr...

  11. Evaluación de los polimorfismos de nucleotido simple asociados a cambios en el color de la carne en ganados bos indicus y cruces con bos taurus

    OpenAIRE

    Castro Molina, Susan Lorena

    2013-01-01

    La palatabilidad de la carne comprende muchos factores como el aspecto, el color, el sabor, la jugosidad y la dureza, los cuales se asocian a la calidad sensorial. Actualmente existe una tendencia hacia el bajo consumo de carne, dado por los elevados precios y en muchas ocasiones por la inadecuada calidad. El color de la carne constituye el primer atributo sensorial que recibe el consumidor en el momento de tomar la decisión para la compra, un óptimo color le otorga a la carne propiedades de ...

  12. Evaluation of genetic and non-genetic factors on foot and mouth disease (FMD) virus vaccine-elicited immune response in Hardhenu (Bos taurus x Bos indicus) cattle.

    Science.gov (United States)

    Manjeet; Pander, B L; Sharma, R; Dhaka, S S; Magotra, Ankit; Dev, Kapil

    2017-12-01

    Foot and mouth disease (FMD) is the most contagious disease of mammals and a major threat to animal husbandry sector. In India, vaccination with the inactivated trivalent (O, A and Asia1) vaccine is one proven way for protecting the livestock from FMD. However, many outbreaks have been reported in different parts of the country. Therefore, present study was aimed at elucidating the effects of genetic and non-genetic factors on FMD viral vaccine-elicited immune response in Hardhenu cattle. The effect of season of vaccination was not consistent. The effect of status of animal was significant for all the pre and post AB titres except for pre AB titre of serotype O and post AB titre of Asia1.The estimates of heritability for response to vaccination were low to high ranging from 0.11 to 0.45. The highest heritability estimate was obtained for serotype O and the lowest for Asia1. The heritability estimates for pre and post AB titres ranged from 0.15 to 0.33. All the pre and post AB titres and responses to vaccination had genetic correlations ranged from high negative to high positive among them. Results of this study highlight the variation in vaccine response which needs to be further exploited on large-scale animal data for better immunization and protection against highly contagious viral vesicular disease of cloven-hoofed animals.

  13. Effect of monensin inclusion on intake, digestion, and ruminal fermentation parameters by Bos taurus indicus and Bos taurus taurus steers consuming bermudagrass hay.

    Science.gov (United States)

    Bell, N L; Anderson, R C; Callaway, T R; Franco, M O; Sawyer, J E; Wickersham, T A

    2017-06-01

    Effects of monensin inclusion and cattle subspecies on utilization of bermudagrass hay (13.7% CP, 77.3% NDF, and 38.8% ADF) were evaluated using ruminally cannulated steers (5 [BI] and 5 [BT]; 398 kg BW). Subspecies were concurrently subjected to a 2-period, 2-treatment crossover design. Treatments were 0 (CON) or 200 mg·steer·d monensin (MON) in 0.91 kg dried distillers' grains with solubles. Periods were 70 d in length: 20 d of adaptation, 22 d of sample collection, and 28 d for withdrawal of treatment. Steers were group housed during adaptation and moved to individual covered pens for sampling. Hay, ort, and fecal grab samples were collected d 21 through 25 for determination of intake and digestion. Ruminal fluid was collected with a suction strainer 0, 2, 4, 8, and 12 h after feeding on d 42 for pH, VFA, and ruminal NH-N (RAN) analysis. Additionally, at h 2, ruminal fluid and contents were collected for determination of rate of NH production and CH production rate. No subspecies × monensin interactions were observed ( ≥ 0.12). Monensin had no effect ( ≥ 0.16) on intake or digestibility parameters. No subspecies effect ( ≥ 0.11) was observed for forage OM intake, total OM intake, or OM digestion. Total digestible OM intake tended to be greater ( = 0.06) for BT steers than for BI steers (14.0 vs. 12.2 g/kg BW). There was an effect of hour after feeding ( ≤ 0.01) on pH, total VFA, acetate:propionate ratio, and molar percent acetate and propionate. Total VFA concentration was greater ( = 0.01) in CON steers than in MON steers (66.5 vs. 62.0 m). Monensin decreased molar percent acetate ( = 0.02) from 72.5 to 71.2% and increased molar percent propionate ( < 0.01) from 16.9 to 18.7%, resulting in a reduced ( < 0.01) acetate:propionate ratio (from 4.34 to 3.85). Although not significantly ( = 0.19), monensin numerically reduced the CH production rate by 15.8%. Greater ( = 0.07) CH production rate tended to be observed in BI steers than in BT steers (21.4 vs. 16.6 μmol CH·mL·h, respectively). Monensin had no effect ( ≥ 0.32) on pH, RAN, or rate of NH production. A subspecies × hour after feeding interaction was observed for RAN, with BT having greater RAN at h 0 and 4, whereas BI had greater RAN at h 2, 8, and 12. Overall, monensin decreased the acetate:propionate ratio and total VFA concentration but had no effect on forage utilization. steers consumed less digestible OM and had a greater CH production rate compared with BT steers, suggesting BT were better able to utilize the available forage resource than BI.

  14. Effect of monensin withdrawal on intake, digestion, and ruminal fermentation parameters by Bos taurus indicus and Bos taurus taurus steers consuming bermudagrass hay.

    Science.gov (United States)

    Bell, N L; Callaway, T R; Anderson, R C; Franco, M O; Sawyer, J E; Wickersham, T A

    2017-06-01

    Effects of monensin withdrawal and cattle subspecies on the utilization of bermudagrass hay (14.3% CP, 72.3% NDF, and 36.9% ADF) were evaluated using ruminally cannulated steers (5 [BI] and 5 [BT]). Subspecies were concurrently subjected to a 2-period, 2-treatment crossover design. Treatments consisted of either 0 mg·steer·d-1 monensin with no previous monensin feeding (CON) or withdrawal from 200 mg·steer·d-1 monensin (MON) fed individually in 0.91 kg dried distillers' grains with solubles for 42 d. Withdrawal was evaluated for a 28-d period. Ruminal fluid was collected 2 h after feeding on d 0, 1, 4, 7, 14, and 21 after withdrawal for determination of pH, VFA, ruminal NH-N (RAN), rate of NH production, and CH production rate. Hay, ort, and fecal grab samples were collected d 23 through 28 after withdrawal for determination of intake and digestion. No subspecies × monensin, subspecies × day, or subspecies × monensin × day interactions were observed ( ≥ 0.11). An effect of day after monensin withdrawal was observed ( < 0.01) for total VFA concentration, with an increase following withdrawal followed by a decrease and then stabilization. Monensin × day after monensin withdrawal interactions ( ≤ 0.01) were observed for the acetate:propionate (A:P) ratio and molar percent of acetate and propionate. There was a decrease in molar percent of propionate between d 1 and 4 from 19.1 to 18.0; however, it remained greater ( ≤ 0.10) for MON than CON through d 7. Withdrawal increased molar percent of acetate from 68.3 to 69.8 between d 0 and 4 for MON steers. The A:P ratio was less ( ≤ 0.01) on d 0 for MON than for CON (3.4 vs. 4.0), but by d 4, it increased to 3.8 and was not different ( = 0.14) from CON. By d 14, no differences ( ≥ 0.88) remained for acetate, propionate, or the A:P ratio. After monensin withdrawal, monensin reduced ( < 0.01) RAN by 12.3% (2.09 vs. 1.83 m for CON and MON, respectively). Monensin withdrawal and cattle subspecies had no effect ( ≥ 0.23) on rate of NH production or CH production rate. Monensin withdrawal had no effect ( ≥ 0.45) on intake or digestibility parameters. Greater forage OM intake ( = 0.09; 21.2 vs. 19.2 g/kg BW) and OM digestibility ( < 0.01; 72.4 vs. 63.0%) resulted in greater ( < 0.01) total digestible OM intake (16.8 vs. 13.2 g/kg BW) in BT steers than in BI steers. These results suggest that BT steers are better able to utilize bermudagrass hay than BI steers. Upon monensin withdrawal, steers previously fed monensin continue to have a reduced A:P ratio for at least 7 d.

  15. Linkage disequilibrium levels in Bos indicus and Bos taurus cattle using medium and high density SNP chip data and different minor allele frequency distributions

    Science.gov (United States)

    Linkage disequilibrium (LD), the observed correlation between alleles at different loci in the genome, is a determinant parameter in many applications of molecular genetics. With the wider use of genomic technologies in animal breeding and animal genetics, it is worthwhile revising and improving the...

  16. Antibody titers to vaccination are not predictive of level of protection against a BVDV type 1b challenge in Bos indicus - Bos taurus steers

    Science.gov (United States)

    Subclinical illness associated with infection is thought to reduce performance and increase production costs in feedlot cattle, but underlying components remain largely unidentified. Vaccination is frequently used in feedlot settings but producers lack metrics that evaluate the effectiveness of vacc...

  17. Detection of Theileria annulata carriers in Holstein-Friesian (Bos taurus taurus) and Sistani (Bos taurus indicus) cattle breeds by polymerase chain reaction in Sistan region, Iran.

    Science.gov (United States)

    Majidiani, Hamidreza; Nabavi, Reza; Ganjali, Maryam; Saadati, Dariush

    2016-12-01

    Theileria annulata is common in tropical and subtropical regions especially in Iran and causes great economic losses in cattle industry. In Iran the epidemiological aspects of bovine theileriosis in different breeds of cattle is poorly understood. The aim of present study is comparison of the number of T. annulata carriers in the two major cattle breeds (Holstein-Friesian and Sistani) in Sistan of Iran by giemsa and polymerase chain reaction (PCR) methods. During winter 2013, 160 native cattle, from the two major breeds in Sistan, with the mean age of more than one year and without typical clinical symptoms of theileriosis were selected. At first, a thin layer smear was held from their ear sublime vein blood for Giemsa staining method. In order to do PCR assay, jugular vein blood sample of each cow was taken. The PCR employs primers specific for the 721-bp gene fragment encoding the 30-kDa major merozoite surface antigen of T. annulata. By PCR method, 38 (47.5 %) Holstein blood samples and 22 (27.5 %) Sistani blood samples had DNA of T. annulata and considered positive (The correlation was significant at values of P < 0.05). By checking 160 blood smears with light microscope and lens × 100, only 10 samples (6.25 %) were positive for T. annulata. Statistical comparison between PCR and smear method showed that the PCR method is more sensitive and accurate in comparison to Giemsa staining method to diagnose the asymptomatic carriers of T. annulata.

  18. Recycling of Badger/Fox Burrows in Late Pleistocene Loess by Hyenas at the Den Site Bad Wildungen-Biedensteg (NW, Germany: Woolly Rhinoceros Killers and Scavengers in a Mammoth Steppe Environment of Europe

    Directory of Open Access Journals (Sweden)

    Cajus Diedrich

    2013-01-01

    Full Text Available The Late Pleistocene (MIS 5c-d Ice Age spotted hyena open air den and bone accumulation site Bad Wildungen-Biedensteg (Hesse, NW, Germany represents the first open air loess fox/badger den site in Europe, which must have been recycled by Crocuta crocuta spelaea (Goldfuss, 1823 as a birthing den. Badger and fox remains, plus remains of their prey (mainly hare, have been found within the loess. Hyena remains from that site include parts of cub skeletons which represent 10% of the megafauna bones. Also a commuting den area existed, which was well marked by hyena faecal pellets. Most of the hyena prey bones expose crack, bite, and nibbling marks, especially the most common bones, the woolly rhinoceros Coelodonta antiquitatis (NISP  =  32%. The large amount of woolly rhinoceros bones indicate hunting/scavenging specializing on this large prey by hyenas. Other important mammoth steppe hyena prey remains are from Mammuthus primigenius, Equus caballus przewalskii, Bison/Bos, Megaloceros giganteus, Cervus elaphus, and Rangifer tarandus. The few damaged bone remains of a scavenged cave bear Ursus spelaeus subsp. are unique for an open air situation. Abundant micromammal, frog, and some fish remains were concentrated in “pellets” that contain mainly mammoth steppe micromammals and also frog and fish remains that seem to originate from the nearby river/lake.

  19. Macromamíferos del yacimiento de Labeko Koba (Arrasate, País Vasco

    Directory of Open Access Journals (Sweden)

    Jesús Altuna

    2000-01-01

    Full Text Available El yacimiento de Labeko Koba (Arrasate, País Vasco es un yacimiento mixto, constituido en parte por una guarida de hienas durante fases del Würm II-III y el Würm III y que encierra también niveles que se desarrollan durante las primeras fases del Paleolítico Superior. Son abundantes los huesos de Ungulados que llevan marcas de mordeduras de este carnívoro, así como los coprolitos del mismo. Las marcas de origen antrópico se limitan casi exclusivamente a los niveles superiores. El oso de las cavernas es también abundante en uno de los niveles y los ungulados más frecuentes son el caballo, los bovinos y el ciervo, seguidos del rinoceronte lanudo y el sarrio. Están también presentes el reno y el mamut y en menor cantidad el jabalí, corzo y megácero. Se hace un estudio más detallado de la hiena por un lado y del caballo, los bovinos y el rinoceronte lanudo por otro. Entre los bovinos están representados tanto Bos primigenius como Bison priscus. Los restos de caballo se comparan con la forma Equus caballus germanicus y E.c. gallicus de la literatura paleontológica.

  20. Combining organic and inorganic nitrogen fertilisation reduces N2O emissions from cereal crops

    DEFF Research Database (Denmark)

    Nyamadzawo, George; Shi, Yeufeng; Chirinda, Ngonidzashe

    2014-01-01

    ha-1 cattle manure-N. In China, treatments were; (i) Control, (ii) 300 kg N ha-1 Urea, (iii) 92 kg N ha-1 Urea plus 65 kg ha-1 chicken (Gallus domesticus) manure-N, (iv) 100 kg N ha-1 Urea and (v) 100 kg N ha-1 control release Urea. Our results showed that under both temperate and tropical conditions...... emissions were measured from maize and winter wheat plots. In Zimbabwe the treatments were; (i) Control, (ii) 60 kg N ha-1 ammonium nitrate (NH4NO3), (iii) 120 kg N ha-1 NH4NO3, (iv) 60 kg ha-1 cattle (Bos primigenius) manure-N, plus 60 kg N ha-1 NH4NO3, (v) 60 kg N ha-1 cattle manure-N, and (vi) 120 kg N......, integrated nutrient management resulted in lower N2O emissions compared to inorganic fertilizers which had higher total and yield-scale N2O emissions. We conclude that by combining organic and inorganic N sources, smallholder farmers in both China and Zimbabwe, and other countries with similar climatic...

  1. The Punta Lucero Quarry site (Zierbena, Bizkaia): a window into the Middle Pleistocene in the Northern Iberian Peninsula

    Science.gov (United States)

    Gómez-Olivencia, Asier; Sala, Nohemi; Arceredillo, Diego; García, Nuria; Martínez-Pillado, Virginia; Rios-Garaizar, Joseba; Garate, Diego; Solar, Gonzalo; Libano, Iñaki

    2015-08-01

    The period between the end of the Early Pleistocene and the mid-Middle Pleistocene (roughly between 1.0 and 0.4 Ma BP) is of great interest in Western Europe. It witnessed several climatic oscillations and changes in the fauna, the demise of a hominin species and the appearance of another, along with important cultural and technological changes. Thus, the few available sites with these chronologies is vital to the understanding of the tempo and mode of these changes. Middle Pleistocene sites in the Northern Iberian Peninsula are very rare. Here we present the study of the site found at the Punta Lucero Quarry (Biscay province, Northern Iberian Peninsula), which includes for the first time the complete collection from the site. The fossil association from this site includes several ungulates, such as a Megacerine deer, Cervus elaphus, large bovids (likely both Bos primigenius and Bison sp. are present), Stephanorhinus sp., and carnivores, such as Homotherium latidens, Panthera gombaszoegensis, Canis mosbachensis and Vulpes sp. This association is typical of a middle Middle Pleistocene chronology and would be the oldest macro-mammal site in the Eastern Cantabrian region. This site would likely correspond to a chronology after Mode 1 technological complex and before the arrival of Mode 2 technology in this region. Thus, it offers a glimpse into the paleoecological conditions slightly prior to or contemporaneous with the first Acheulian makers in the northern fringe of the Iberian Peninsula.

  2. Identification of putative pheromones in bovine (Bos taurus) faeces in relation to estrus detection.

    Science.gov (United States)

    Sankar, R; Archunan, G

    2008-01-15

    Ten different volatile compounds were detected in bovine faeces using three chromatograms. The chemical profiles of estrus faeces were distinguished significantly from other phases by the presence of three specific substances, viz. acetic acid and propionic acid and 1-iodo undecane. The estrus specific synthetic compounds were rubbed onto the genital region of nonestrus animals (dummy cows), and the bulls were allowed to sniff the genital region and observed sexual behaviours. The statistical significance was higher (Piodo undecane. The bioassay revealed that the fatty acids viz., acetic acid; propionic acid and 1-iodo undecane produced in faeces during estrus appear to be estrus specific. The results suggest that these compounds may be used as estrus indicator in cow, probably involved in bovine biocommunication.

  3. Role of manganese and veratryl alcohol in the ligninolytic system of Bjerkandera sp. strain BOS55

    NARCIS (Netherlands)

    Mester, T.

    1998-01-01

    Introduction
    Lignin is a three dimensional hydrophobic plant polymer derived from the random coupling of phenylpropanoid precursors. The chemical and physical characteristics of lignin require a nonspecific, extracellular oxidative process for

  4. Absorption and excretion of 14C-perfluorooctanoic acid (PFOA)in angus cattle (Bos taurus)

    Science.gov (United States)

    Perfluorinated chemicals (PFCs), such as perfluorooctanoic acid (PFOA), are environmentally persistent industrial chemicals often found in biosolids. Application of these biosolids to pastures raises concern about accumulation of PFOA in the edible tissues of food animals. Because data on the absorp...

  5. Bovine Genome Database: supporting community annotation and analysis of the Bos taurus genome

    Directory of Open Access Journals (Sweden)

    Childs Kevin L

    2010-11-01

    Full Text Available Abstract Background A goal of the Bovine Genome Database (BGD; http://BovineGenome.org has been to support the Bovine Genome Sequencing and Analysis Consortium (BGSAC in the annotation and analysis of the bovine genome. We were faced with several challenges, including the need to maintain consistent quality despite diversity in annotation expertise in the research community, the need to maintain consistent data formats, and the need to minimize the potential duplication of annotation effort. With new sequencing technologies allowing many more eukaryotic genomes to be sequenced, the demand for collaborative annotation is likely to increase. Here we present our approach, challenges and solutions facilitating a large distributed annotation project. Results and Discussion BGD has provided annotation tools that supported 147 members of the BGSAC in contributing 3,871 gene models over a fifteen-week period, and these annotations have been integrated into the bovine Official Gene Set. Our approach has been to provide an annotation system, which includes a BLAST site, multiple genome browsers, an annotation portal, and the Apollo Annotation Editor configured to connect directly to our Chado database. In addition to implementing and integrating components of the annotation system, we have performed computational analyses to create gene evidence tracks and a consensus gene set, which can be viewed on individual gene pages at BGD. Conclusions We have provided annotation tools that alleviate challenges associated with distributed annotation. Our system provides a consistent set of data to all annotators and eliminates the need for annotators to format data. Involving the bovine research community in genome annotation has allowed us to leverage expertise in various areas of bovine biology to provide biological insight into the genome sequence.

  6. Particle-in-a-bos model of one-dimensional excitons in conjugated polymers

    DEFF Research Database (Denmark)

    Pedersen, T.G.; Johansen, P.M.; Pedersen, H.C.

    2000-01-01

    A simple two-particle model of excitons in conjugated polymers is proposed as an alternative to usual highly computationally demanding quantum chemical methods. In the two-particle model, the exciton is described as an electron-hole pair interacting via Coulomb forces and confined to the polymer...... of these cases an approximate solution for the general case is obtained. As an application of the model the influence of a static electric field on the electron-hole overlap integral and exciton energy is considered....

  7. Algunos Factores Relacionados con la Dinámica Folicular en Bos indicus

    National Research Council Canada - National Science Library

    Guillermo Henao Restrepo

    2010-01-01

      El desarrollo folicular bovino durante un ciclo estral normal, se caracteriza por un crecimiento en forma de ondas con presencia de dos a cinco cohortes foliculares por ciclo, de las cuales solo...

  8. Evidence of a major gene influencing hair length and heat tolerance in Bos taurus cattle.

    Science.gov (United States)

    Olson, T A; Lucena, C; Chase, C C; Hammond, A C

    2003-01-01

    Evidence was found that supports the existence of a major gene (designated as the slick hair gene), dominant in mode of inheritance, that is responsible for producing a very short, sleek hair coat. Cattle with slick hair were observed to maintain lower rectal temperatures (RT). The gene is found in Senepol cattle and criollo (Spanish origin) breeds in Central and South America. This gene is also found in a Venezuelan composite breed, the Carora, formed from the Brown Swiss and a Venezuelan criollo breed. Two sets of backcross matings of normal-haired sire breeds to Senepol crossbred dams assumed to be heterozygous for the slick hair gene resulted in ratios of slick to normal-haired progeny that did not significantly differ from 1:1. Data from Carora x Holstein crossbred cows in Venezuela also support the concept of a major gene that is responsible for the slick hair coat of the Carora breed. Cows that were 75% Holstein: 25% Carora in breed composition segregated with a ratio that did not differ from 1:1, as would be expected from a backcross matinginvolving a dominant gene. The effect of the slick hair gene on RT depended on the degree of heat stress and appeared to be affected by age and/or lactation status. The decreased RT observed for slick-haired crossbred calves compared to normal-haired contemporaries ranged from 0.18 to 0.4 degrees C. An even larger decrease in RT (0.61 degrees C; P < 0.01) was observed in lactating Carora x Holstein F1 crossbred cows, even though it did not appear that these cows were under severe heat stress. The improved thermotolerance of crossbred calves due to their slick hair coats did not result in increased weaning weights, possibly because both the slick and normal-haired calves were being nursed by slick-haired dams. There were indications that the slick-haired calves grew faster immediately following weaning and that their growth during the cooler months of the year was not compromised significantly by their reduced quantity of hair. In the Carora x Holstein crossbred cows there was a positive effect of slick hair on milk yield under dry, tropical conditions.

  9. Tuberculosis de la fauna silvestre en ganaderías de bovino de lidia (Bos Taurus)

    OpenAIRE

    Miralles, Alberto; Mas, A.; Rosa, A.; Seva, J.I.

    2011-01-01

    La tuberculosis es una enfermedad infecciosa causada por microorganismos del Complejo Mycobacterium tuberculosis (CMTB), principalmente compuesto por Mycobacterium bovis y Mycobacterium caprae. En el presente estudio se determinará la presencia de tuberculosis en dos especies de fauna silvestre: el jabalí y el ciervo, los cuales viven en contacto con ganado bovino de lidia. Para ello se estudiaron un total de 32 jabalíes y 8 ciervos, abatidos en dos monterías celebradas en fincas ...

  10. Spatial movement of free-roaming cattle (Bos Taurus) when in proximity to wolves (Canis lupus)

    Science.gov (United States)

    In 1995 and 1996, 31 wolves were reintroduced into Yellowstone National Park and 35 in central Idaho. These populations have grown to more than 1,500 with more than 835 in Idaho. As wolf populations have grown, so has predation on livestock, complicating cow and ranch management. Our study was de...

  11. Genome Sequence of Bovine Polyomavirus 1 Detected in a Salers Cow (Bos taurus) from Catalonia, Spain.

    Science.gov (United States)

    Ben Salem, Nicole; Pérez de Val, Bernat; Martin, Maite; Moens, Ugo; Ehlers, Bernhard

    2016-01-28

    We identified a variant of the first bovine polyomavirus (BPyV1; family Polyomaviridae) in a lymph node of a Salers cow. As the 2 previously published genome sequences of this virus originated from fetal bovine serum and ground beef, respectively, this is the first BPyV1 genome that could be traced back to an individual. Copyright © 2016 Ben Salem et al.

  12. fabrikanten sturen patiënten met een vodje papier het bos in

    NARCIS (Netherlands)

    ir.ing Ruud Thelosen

    2016-01-01

    Het artikel bespreekt de bijsluiter van medicijnen die in meerdere opzichten onduidelijk en weinig verhelderend is. De auteur levert de suggestie om de beproefde bedrijfskundige methode van FMEA te gaan gebruiken.

  13. Global mapping of miRNA-target interactions in cattle (Bos taurus)

    DEFF Research Database (Denmark)

    Scheel, Troels K H; Moore, Michael J; Luna, Joseph M

    2017-01-01

    With roles in development, cell proliferation and disease, micro-RNA (miRNA) biology is of great importance and a potential therapeutic target. Here we used cross-linking immunoprecipitation (CLIP) and ligation of miRNA-target chimeras on the Argonaute (AGO) protein to globally map miRNA interact...... a significant resource for understanding of bovine and species-conserved miRNA regulation, and demonstrate the power of experimental methods for establishing comprehensive interaction maps....

  14. Base Operations Support (BOS) Competitive Sourcing and Privatization: How Are We Doing?

    Science.gov (United States)

    2001-04-01

    48 NASA KENNEDY SPACE CENTER AND PATRICK AIR FORCE BASE JOINT PERFORMANCE MANAGEMENT OFFICE ORGANIZATION ................48...Undated. 47 Appendix F NASA KENNEDY SPACE CENTER AND PATRICK AIR FORCE BASE JOINT PERFORMANCE MANAGEMENT OFFICE ORGANIZATION KENNEDY SPACE CENTER

  15. Para explicar 'el bosón de Higgs con manzanas'

    Directory of Open Access Journals (Sweden)

    María de los Angeles Miranda Bustamante

    Full Text Available Este trabajo aborda el desafío que enfrenta hoy el Periodismo de Ciencia y Tecnología en medios impresos para atraer la atención del público, que está a menudo saturado de información. Para ello proponemos el uso del edutainment, una mezcla de educación y entretención, para hacer más claras y cercanas las noticias en esta área, buscando que la ciencia realmente se transforme en un bien social. Luego de estudiar este recurso en investigaciones anteriores aplicadas a publicaciones de diarios chilenos, proponemos aquí una estrategia metodológica para analizar el uso del edutainment en las noticias de Ciencia y Tecnología, describiendo categorías acerca del contenido visual y textual de las páginas, que abordan el diseño, las estrategias textuales y la interactividad.

  16. Chemische samenstelling van naalden, bodem, bodemvocht en grondwater van twaalf monitoring-locaties onder bos

    NARCIS (Netherlands)

    Leeters, E.E.J.M.; Klap, J.M.; Boumans, L.J.M.; Olsthoorn, A.F.M.

    1994-01-01

    In deze studie wordt aan de hand van twaalf boslocaties op zandgronden, die gedurende de periode 1992-1997 zijn bemonsterd, gekeken of er trends in de tijd zijn aan te tonen. De verwachting is dat het verwachte effect van beleidsmaatregelen is aan te tonen in de chemische samenstelling van naalden,

  17. Karakteristik Habitat Banteng (Bos Javanicus D'Alton, 1823) Di Resort Rowobendo Taman Nasional Alas Purwo

    OpenAIRE

    Purnomo, Danang Wahyu; Pudyatmoko, Satyawan

    2011-01-01

    Fragmentasi habitat dan perburuan liar telah menyebabkan penurunan populasi alami Banteng. Sementara itu, sistem pengelolaan habitat di Taman Nasional Alas Purwo tidak sesuai dengan karakter tiap-tiap tipe habitat yang ada. Penelitian ini bertujuan mengidentifikasi karakter habitat yang dapat memberikan informasi tentang pemilihan habitat oleh Banteng dan faktor-faktor yang memengaruhinya. Karakter habitat diestimasi menggunakan dua ...

  18. Nucleotide diversity of the melanocortin 1 receptor gene (MC1R) in the gayal (Bos frontalis).

    Science.gov (United States)

    Xi, Dongmei; Liu, Qing; Huo, Yinqiang; Sun, Yongke; Leng, Jing; Gou, Xiao; Mao, Huaming; Deng, Weidong

    2012-07-01

    The melanocortin 1 receptor gene (MC1R) plays a crucial role in determining coat colour of mammals. To investigate the relationship of polymorphism of the MC1R with coat colour in gayal, the coding sequence (CDS), and the 5'- and 3'-untranslated regions (UTR) of the MC1R were sequenced from 63 samples from the gayal and compared with the sequences of the MC1R from other ruminant species. A sequence of 1,136 bp including the whole CDS (954 bp) and parts of the 5'- and 3'-UTR (164 and 18 bp, respectively) of the gayal MC1R was obtained. A total of nine single nucleotide polymorphisms (SNPs) including four SNPs (c.-129T>C, c.-127A>C, c.-106C>T, c.-1G>A) in the 5'-UTR and five SNPs (c.201C>T, c.583C>T, c.663T>C, c.871A>G and c.876T>C) in the CDS were detected, revealing high genetic diversity. Three novel coding SNPs including c.201C>T, c.583C>T and c.876T>C, which have not been reported previously in bovid species, were retrieved. Within five coding SNPs, c.201C>T, c.663T>C and c.876T>C were silent mutations, while c.583C>T and c.871A>G were mis-sense mutations, resulting in changes in the amino acids located in the fifth (p.L195F) and seventh (p.T291A) transmembrane regions, respectively. The alignment of amino acid sequences was found to be very similar to those for other bovid species. It was demonstrated, using the functional effect prediction, that the p.T291A amino acid replacement could have an effect on MC1R protein function but not for the p.L195F substitution. Using phylogenetic analyses it was revealed that the gayal has a close genetic relationship with the yak. However, three classical bovine MC1R loci the E (D), E (+) and e were not retrieved in the gayal, indicating other genes or factors could affect coat colour in this species.

  19. Efficiency of utilization of dietary energy for milk production in lactating crossbred cattle (Bos Indicus

    Directory of Open Access Journals (Sweden)

    Debashis Saha

    2012-09-01

    Full Text Available The present study was conducted on efficiency of utilization of dietary energy for milk production in lactating crossbred cattle. 18 lactating crossbred cattle of early to mid-lactation, approximate body weight (375.39±23.43 kg, milk yield, parity and stage of lactation were divided into three groups of six animals each and were fed 0, 50 and 100% diammonium phosphate (DAP in the mineral mixture of concentrates for 120 days. The chaffed mixed roughage (berseem + wheat straw and concentrate mixture was fed to supply about nearly 18:82 concentrate to roughage ratio on dry matter basis. Tap water was available to the animals twice daily. A metabolism trial of seven days was conducted at the end of experiment to study digestibility of organic nutrients and balances of energy. DAP did not affect the nutrient intake, body weight changes, digestibility of Dry matter (DM, Crude protein (CP, Ether extract (EE, Crude fiber (CF, Nitrogen free extract (NFE and daily milk yield. It was concluded that the at 46.07 Mcal Gross energy intake level the losses in feces, urine, methane and heat production was 45.82%, 5.40%, 4.31% and 33.01%, respectively, and net energy retention for milk production was 11.43%. The gross efficiency of conversion of metabolic energy ME for milk production was 35.69% and the net efficiency of conversion of ME for milk production was 39.56%.

  20. The Genetic Variation of Bali Cattle (Bos javanicus Based on Sex Related Y Chromosome Gene

    Directory of Open Access Journals (Sweden)

    A Winaya

    2011-09-01

    Full Text Available Bali cattle is very popular Indonesian local beef related to their status in community living process of farmers in Indonesia, especially as providers of meat and exotic animal. Bali cattle were able to adapt the limited environment and becoming local livestock that existed until recently.  In our early study by microsatellites showed that Bali cattle have specific allele. In this study we analyzed the variance of partly sex related Y (SRY gene sequence in Bali cattle bull as a source of cement for Artificial Insemination (AI.  Blood from 17 two location of AI center, Singosari, Malang and Baturiti, Bali was collected and then extracted to get the DNA genome.  PCR reaction was done to amplify partially of SRY gene segment and followed by sequencing PCR products to get the DNA sequence of SRY gene. The SRY gene sequence was used to determine the genetic variation and phylogenetic relationship.  We found that Bali cattle bull from Singosari has relatively closed genetic relationship with Baturiti. It is also supported that in early data some Bali bulls of Singosari were came from Baturiti. It has been known that Baturiti is the one source of Bali cattle bull with promising genetic potential. While, in general that Bali bull where came from two areas were not different on reproductive performances. It is important to understand about the genetic variation of Bali cattle in molecular level related to conservation effort and maintaining the genetic characters of the local cattle. So, it will not become extinct or even decreased the genetic quality of Indonesian indigenous cattle.   Key Words : Bali cattle, SRY gene, artificial insemination, phylogenetic, allele   Animal Production 13(3:150-155 (2011

  1. Acute arbeidsintoxicaties door gebruik van bestrijdingsmiddelen in de bos-, land- en tuinbouw

    NARCIS (Netherlands)

    van de Laar RTH; de Vries I; Meulenbelt J

    1992-01-01

    In 1991 a prospective study on occupational pesticide poisoning in agricultural workers was conducted to determine the extent and severity of pesticide poisoning in the Netherlands and the circumstances leading to these poisonings. All cases of potential occupational pesticide poisoning in which

  2. Kwaliteit van het bovenste freatische grondwater in de zandgebieden van Nederland, onder bos en heidevelden

    NARCIS (Netherlands)

    Boumans LJM; Beltman WHJ

    1991-01-01

    An increase in nitrate concentration is found under higher vegetation, southern forest borders, less vital forest stands, deeper groundwater levels (local factors) and more regional N, NOx and SOx deposition. Highest concentrations are found under Douglas fir, Scots pine, Black pine and Norway

  3. Tick loads in Bos taurus cattle grazing in two contrasting production systems

    Directory of Open Access Journals (Sweden)

    Raquel Salazar B

    2016-05-01

    Full Text Available Objectives. To relate the effect of biotic and abiotic factors on Rhipicephalus (Boophilus microplus tick loads on cows grazing either in intensive silvopastoral systems (ISS (Lucerna or in grass pastures associated with sugarcane plantations (La Isabela. Materials and methods. Tick counts were performed on 27 Lucerne breed animals that were in different physiological states, six of which were grazing on forage grass paddocks associated with commercial sugarcane plantations and the remaining animals grazed in an ISS based on Leucaena leucocephala and Cynodon plectostachyus. The tick counts were made every 15 days. The data of temperature, humidity, and radiation were taken from a weather station that was inside the ISS. Results. There was a weak relationship between saturation deficit and tick load (R2=0.34 and another between UV radiation and tick load (R2=0.205 for animals grazing in ISS. There were differences in tick counts when comparing animals of similar productivity from both systems evaluated: in La Isabela (sugarcane grass paddocks average counts were 311 ticks perceptible to the touch (TPT and in Lucerna (ISS farm average counts were 206 TPT (p= 0.02. Additionally, there were greater tick counts in high productivity cows compared to low productivity cows. Conclusions. The abiotic and biotic factors of the ecosystem and animal productivity can affect the TPT counts. In ISS systems, tick counts can be lower than those observed in monoculture grazing systems.

  4. Occurrence and functional significance of the transcriptome in bovine (Bos taurus) spermatozoa

    National Research Council Canada - National Science Library

    Sellappan Selvaraju; Sivashanmugam Parthipan; Lakshminarayana Somashekar; Atul P Kolte; B Krishnan Binsila; Arunachalam Arangasamy; Janivara Parameshwaraiah Ravindra

    2017-01-01

    ...). Both intact and fragmented transcripts were found. These spermatozoal transcripts were associated with various stages of spermatogenesis, spermatozoal function, fertilization, and embryo development...

  5. Clotting of cow (Bos taurus) and goat milk (Capra hircus) using calve ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-10-06

    Oct 6, 2008 ... phosphate buffer with a flow rate of 9.5 mL/h. Collection of fractions was made using Microcol TDC 80 (Gilson). Fractions of 5 mL were collected. The optical density was obtained by passing different fractions through a spectrophotometer at 280 nm using a 1.0 cm length curvet. Measuring of milk clotting ...

  6. Assessment of inbreeding depression in Nellore cows (Bos indicus) through high-density SNP genotypes

    Science.gov (United States)

    Inbreeding has been incriminated as a cause of decrease in reproductive performance in cattle. This negative correlation is known as ‘inbreeding depression’, and evidence supporting this hypothesis was generated from association studies between reproductive traits and estimates of inbreeding coeffic...

  7. Ovarian follicular dynamics and hormones throughout the estrous cycle in Thai native (Bos indicus) heifers.

    Science.gov (United States)

    Chasombat, Jakkhaphan; Nagai, Takashi; Parnpai, Rangsun; Vongpralub, Thevin

    2014-01-01

    Relatively few studies have been reported regarding the reproductive physiology of female Thai native cattle. Therefore, the objective of the present study was to evaluate the follicular dynamics and concentrations of follicle stimulating hormone (FSH), estradiol (E2) and progesterone (P4) during the estrous cycle in Thai native heifers (TNH) and to compare obtained results with those of European and Indian cattle breeds previously reported. For the detection of estrus, ovaries of all 20 heifers were examined twice daily (12 h intervals) by ultrasonography for three consecutive estrous cycles. From data of 60 estrous cycles (n = 60 estrous cycles from 20 heifers), it was found that 14 (70%) and 6 heifers (30%) had two (42 estrous cycles collected from 14 heifers) and three follicular waves (18 estrous cycles collected from 6 heifers), respectively. The days when estrus was detected, interovulatory intervals, life-spans of corpus lutea (CL), and days for growing and regression of CLs were shorter in the two follicular waves than those in the three follicular waves (P growth rates of the dominant follicle (DF) in an ovulatory wave were observed than those of the preceding waves without ovulation (P growth in each follicular wave. In addition, the FSH and E2 peak concentrations during the ovulatory wave were higher than those of the anovulation waves (P cattle breeds, the diameter of the largest preovulatory follicle (OF), subordinate follicles (SF) and CLs were smaller than those in European and Indian cattle breeds. In conclusion, when compared with European and some breeds of Indian cattle, the length of interovulatory intervals was shorter, and the sizes of dominant SF and CLs were smaller in Thai native heifers. © 2013 Japanese Society of Animal Science.

  8. Touched by genius: on animal and madmen | ten Bos | South African ...

    African Journals Online (AJOL)

    It is argued that the idea that they cannot is widespread, not only in philosophy but also in biology or poetry. Animals are generally considered to be too honest for that. A second question is whether there are people who are too honest for feigning or acting. Foucault's famous discussion about madmen sheds some light on ...

  9. Macro and micro elements profile of yak (Bos grunniens milk from Qilian of Qinghai plateau

    Directory of Open Access Journals (Sweden)

    Adriana Ianieri

    2012-04-01

    Full Text Available Twelve elements were analyzed by the ICP-AES method for macro (calcium, phosphorus, sulphur, magnesium, potassium, sodium and micro (cobalt, chromium, copper, iron, zinc, manganese elements. The macro and micro elements of yak (Qilian milk were analyzed among different farms and a significant difference was found in phosphorus and sulphur concentrations (P<0.05. Potassium and sulphur concentrations in yak milk were higher while calcium concentrations were similar to cow milk but lower than milk of other species. Sodium, magnesium and phosphorus concentrations found in this study were in the mid-range of those in milk of different animal species. The higher concentrations of potassium and lower concentrations of sodium found in yak milk should be of benefit to patients with hyperpiesia. The composition of yak milk was particularly rich in cobalt, manganese and chromium, while it was deficient in zinc.

  10. Onderzoek Sclerotinia in 2012 : Sclerotiën, sporen, BOS en spuittechniek

    NARCIS (Netherlands)

    Wanders, J.; Russchen, H.J.; Lamers, J.G.; Lange, de J.; Akker, van den H.; Roessel, van G.J.

    2014-01-01

    De problemen met Sclerotinia (rattenkeutelziekte), veroorzaakt door de schimmel Sclerotinia sclerotiorum, nemen de laatste jaren steeds meer toe. In diverse vollegrondsgroenten is Sclerotinia een van de belangrijkste ziekten. Om te komen tot een integrale aanpak van de problematiek is er door de

  11. Development of a physiologically based pharmacokinetic model for flunixin in cattle (Bos taurus).

    Science.gov (United States)

    Leavens, Teresa L; Tell, Lisa A; Kissell, Lindsey W; Smith, Geoffrey W; Smith, David J; Wagner, Sarah A; Shelver, Weilin L; Wu, Huali; Baynes, Ronald E; Riviere, Jim E

    2014-01-01

    Frequent violation of flunixin residues in tissues from cattle has been attributed to non-compliance with the USFDA-approved route of administration and withdrawal time. However, the effect of administration route and physiological differences among animals on tissue depletion has not been determined. The objective of this work was to develop a physiologically based pharmacokinetic (PBPK) model to predict plasma, liver and milk concentrations of flunixin in cattle following intravenous (i.v.), intramuscular (i.m.) or subcutaneous (s.c.) administration for use as a tool to determine factors that may affect the withdrawal time. The PBPK model included blood flow-limited distribution in all tissues and elimination in the liver, kidney and milk. Regeneration of parent flunixin due to enterohepatic recirculation and hydrolysis of conjugated metabolites was incorporated in the liver compartment. Values for physiological parameters were obtained from the literature, and partition coefficients for all tissues but liver and kidney were derived empirically. Liver and kidney partition coefficients and elimination parameters were estimated for 14 pharmacokinetic studies (including five crossover studies) from the literature or government sources in which flunixin was administered i.v., i.m. or s.c. Model simulations compared well with data for the matrices following all routes of administration. Influential model parameters included those that may be age or disease-dependent, such as clearance and rate of milk production. Based on the model, route of administration would not affect the estimated days to reach the tolerance concentration (0.125 mg kg(-1)) in the liver of treated cattle. The majority of USDA-reported violative residues in liver were below the upper uncertainty predictions based on estimated parameters, which suggests the need to consider variability due to disease and age in establishing withdrawal intervals for drugs used in food animals. The model predicted that extravascular routes of administration prolonged flunixin concentrations in milk, which could result in violative milk residues in treated cattle.

  12. A fine structure genetic analysis evaluating ecoregional adaptability of a Bos taurus breed (Hereford.

    Directory of Open Access Journals (Sweden)

    H D Blackburn

    Full Text Available Ecoregional differences contribute to genetic environmental interactions and impact animal performance. These differences may become more important under climate change scenarios. Utilizing genetic diversity within a species to address such problems has not been fully explored. In this study Hereford cattle were genotyped with 50K Bead Chip or 770K Bovine Bead Chip to test the existence of genetic structure in five U.S. ecoregions characterized by precipitation, temperature and humidity and designated: cool arid (CA, cool humid (CH, transition zone (TZ, warm arid (WA, and warm humid (WH. SNP data were analyzed in three sequential analyses. Broad genetic structure was evaluated with STRUCTURE, and ADMIXTURE software using 14,312 SNPs after passing quality control variables. The second analysis was performed using principal coordinate analysis with 66 Tag SNPs associated in the literature with various aspects of environmental stressors (e.g., heat tolerance or production (e.g., milk production. In the third analysis TreeSelect was used with the 66 SNPs to evaluate if ecoregional allelic frequencies deviated from a central frequency and by so doing are indicative of directional selection. The three analyses suggested subpopulation structures associated with ecoregions from where animals were derived. ADMIXTURE and PCA results illustrated the importance of temperature and humidity and confirm subpopulation assignments. Comparisons of allele frequencies with TreeSelect showed ecoregion differences, in particular the divergence between arid and humid regions. Patterns of genetic variability obtained by medium and high density SNP chips can be used to acclimatize a temperately derived breed to various ecoregions. As climate change becomes an important factor in cattle production, this study should be used as a proof of concept to review future breeding and conservation schemes aimed at adaptation to climatic events.

  13. relationship of thyroid and adrenal function to growth rate in bos ...

    African Journals Online (AJOL)

    Immediately following the collection of blood in heparinized bottles in ice, the plasma was recovered and stored at -200C. Analyses of plasma thyroxine and cortisol were done by competitive protein binding methods. Initial. Weight. Final. Daily Gain. Feed/. Weight. Daily Gain. Age (days) Weight/Age Thyroxine ng. Cortisol.

  14. El reto es encontrar el bosón de Higgs

    CERN Multimedia

    Couceiro, Belén

    2005-01-01

    The CERN has half a century of researches about how was the universe in the first moments of its creation. He is now plunged in the construction of the LHC, the most powerful particle accelerator in the world

  15. Proteome analysis of functionally differentiated bovine (Bos indicus) mammary epithelial cells isolated from milk

    KAUST Repository

    Janjanam, Jagadeesh

    2013-10-01

    Mammary gland is made up of a branching network of ducts that end in alveoli. Terminally differentiated mammary epithelial cells (MECs) constitute the innermost layer of aveoli. They are milk-secreting cuboidal cells that secrete milk proteins during lactation. Little is known about the expression profile of proteins in the metabolically active MECs during lactation or their functional role in the lactation process. In the present investigation, we have reported the proteome map of MECs in lactating cows using 2DE MALDI-TOF/TOF MS and 1D-Gel-LC-MS/MS. MECs were isolated from milk using immunomagnetic beads and confirmed by RT-PCR and Western blotting. The 1D-Gel-LC-MS/MS and 2DE-MS/MS based approaches led to identification of 431 and 134 proteins, respectively, with a total of 497 unique proteins. Proteins identified in this study were clustered into functional groups using bioinformatics tools. Pathway analysis of the identified proteins revealed 28 pathways (p < 0.05) providing evidence for involvement of various proteins in lactation function. This study further provides experimental evidence for the presence of many proteins that have been predicted in annotated bovine genome. The data generated further provide a set of bovine MEC-specific proteins that will help the researchers to understand the molecular events taking place during lactation. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Nellore cattle (Bos indicus) and ticks within the Brazilian Pantanal: ecological relationships.

    Science.gov (United States)

    Ramos, Vanessa N; Piovezan, Ubiratan; Franco, Ana Helena A; Rodrigues, Vinicius S; Nava, Santiago; Szabó, Matias P J

    2016-02-01

    Pantanal is a huge floodplain mostly in Brazil, and its main economic activity is extensive cattle raising, in farms characterized by an extremely wildlife-rich environment. We herein describe tick infestations of cattle and of the natural environment in Pantanal of Nhecolândia in Brazil, at areas with and without cattle during both dry and wet seasons. Environmental sampling resulted in three tick species: Amblyomma sculptum (423 nymphs and 518 adults), Amblyomma parvum (7 nymphs and 129 adults), Amblyomma ovale (3 adults) as well as three clusters and two individuals of Amblyomma sp. larvae. A significantly higher number of adult A. sculptum ticks was found in areas with cattle in the wet season. From 106 examinations of bovines 1710 ticks from three species were collected: Rhipicephalus microplus (55.7% of the total), A. sculptum (38%) and A. parvum (4.1%), as well as 32 Amblyomma sp. larvae. A significant similarity was found between Amblyomma tick fauna from environment and on cattle during both seasons. All A. sculptum females on bovines were flat whereas many of A. parvum females and A. sculptum nymphs were engorging. Although R. microplus was the most abundant tick species on cattle, overall highest tick prevalence on bovines in the dry season was of A. sculptum nymphs. Lack of R. microplus in environmental sampling, relationship between cattle and increase in adult A. sculptum numbers in the environment as well as suitability of bovine for the various tick species are discussed.

  17. Translating culture: Matthee’s Kringe in ’n bos as a case in point

    Directory of Open Access Journals (Sweden)

    W. Cloete

    2007-07-01

    Full Text Available The translation of “cultural identity” in a novel such as “Kringe in ’n bos” contributes towards the definition of a uniquely South African representation of time and space in the global context. When translation is studied as a product of its socio-historical context, the translator is faced with problems of translating ideology and cultural identity in literature. Realia constitute a particular challenge to the translator because, according to the definition, precise equivalents of these words do not exist in other languages, which could cause shifts in the target language text. This article considers the concept of translatability and concludes that, despite the problems encountered, an adequate and satisfactory German translation from the Afrikaans original should be possible. The question of translatability assumes an interesting dimension as the Afrikaans novel was translated into English by the author herself. The privileged position of author-translator granted Matthee a near-perfect understanding of the different layers of meaning and intention of the source text and eliminated the gap between the author and translator. However, one gains the impression that the German translator (Stege resorted to transference as a strategy to avoid translation and it emerges that most instances of definite mistranslations are, indeed, attributable to Stege’s unfamiliarity with the South African context.

  18. The complete mitochondrial genome of Bos taurus coreanae (Korean native cattle).

    Science.gov (United States)

    Wang, Xi; Zhang, Yuan Qing; He, Dong Chang; Yang, Xiao Ming; Li, Bo; Wang, Dong Cai; Guang, Jin; Xu, Fang; Li, Jun Ya; Gao, Xue; Gao, Hui Jiang; Zhang, Lu Pei; Zhang, Xi Zhong

    2016-01-01

    Korean native cattle is one of the famous native breeds in Korean. In the present work, we report the complete mitochondrial genome sequence of Korean native cattle for the first time. The total length of the mitogenome was 16,339 bp with the base composition of 33.4% for A, 27.2% for T, 26.0% for C, and 13.4% for G, and an A-T (60.6%)-rich feature was detected. It harbored 13 protein-coding genes, 2 ribosomal RNA genes, 22 transfer RNA genes and 1 non-coding control region (D-loop region). The arrangement of all genes was identical to the typical mitochondrial genomes of cattle. The complete mitochondrial genome sequence of Korean native cattle would serve as an important data set of the germplasm resources for further study.

  19. Helitrons and Retrotransposons Are Co-localized in Bos taurus Genomes.

    Science.gov (United States)

    Babii, A; Kovalchuk, S; Glazko, T; Kosovsky, G; Glazko, V

    2017-06-01

    DNA transposons helitrons are mobile genetic elements responsible for major movements of the genetic material within and across different genomes. This ability makes helitrons suitable candidate elements for the development of new approaches of multilocus genotyping of live-stock animals, along with the well-known microsatellite loci. We aimed to estimate the informativeness of helitron and microsatellite markers in assessing the consolidation and the "gene pool" standards of two commercial dairy cattle breeds (Ayrshire breed and holsteinized Black-and-White cattle) and one local breed of Kalmyk cattle, and to reveal any inter-breed difference in the organization of genomic regions flanked by helitrons in the studied cattle breeds. We used the combination of two highly-polymorphic genomic elements - helitrons and trinu-cleotide microsatellites (AGC)6G and (GAG)6C, respectively - for genome scanning of the sampled groups of cattle. Also, we pyrosequenced the genomic regions flanked by the inverted repeats of 3'-end of Heligloria family of helitron fragments. Generally, the both combinations of markers generated polymorphic spectra, based on which certain interbreed differentiation could be observed. The analysis of the identified interspersed repeats suggests that in factory and local cattle the genomic regions flanked by helitron fragments are shaped differently and contain different superfamilies of transposable elements, especially retrotransposons. Despite the well-known fact of retrotransposon-dependent microsatellite expansion, our data suggest that, in the cattle genome, the DNA transposons and microsatellites can also be found in close neighbourhood, and that helitrons and retrotransposons may form domains of increased variability - targets for factors of artificial selection.

  20. Effect of Ractopamine Hydrochloride and Zilpaterol Hydrochloride on tenderness of longissimus steaks of Bos Taurus steers

    Science.gov (United States)

    Objectives: Three experiments were conducted to determine 1) the interaction of ractopamine hydrochloride (RH) inclusion rate (0 or 300 mg·hd-1·d-1 for last 30 to 34 d before harvest) and dietary protein level (13.5 or 17.5% CP) on LM slice shear force (SSF) at 14 d postmortem (Exp. 1); 2) the inter...

  1. A fine structure genetic analysis evaluating ecoregional adaptability of a Bos taurus breed (Hereford)

    Science.gov (United States)

    Ecoregional differences contribute to genetic environmental interactions and impact animal performance. These differences may become more important under climate change scenarios. Utilizing genetic diversity within a species to address such problems has not been fully explored. In this study Herefor...

  2. CRYPTOSPORIDIUM ANDERSONI N. SP. (APICOMPLEXA: CRYPTOSPORIDIIDAE) FROM CATTLE, BOS TAURUS. (R825148)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  3. Microsatellite Imputation for parental verification from SNP across multiple Bos taurus and indicus breeds

    Science.gov (United States)

    Microsatellite markers (MS) have traditionally been used for parental verification and are still the international standard in spite of their higher cost, error rate, and turnaround time compared with Single Nucleotide Polymorphisms (SNP)-based assays. Despite domestic and international demands fro...

  4. Physical composition, primary cuts and meat cuts of carcasses from Zebu and Bos taurus X Bos indicus crossbred cattle Composição física, cortes primários e cortes cárneos da carcaça de bovinos Zebu e de mestiços Bos taurus X Bos indicus

    Directory of Open Access Journals (Sweden)

    Daniel Perotto

    2009-09-01

    Full Text Available Data on hot carcass weight, hot carcass yield, hindquarter weights and physical components, forequarter and spare ribs, and the weights of the main commercial cuts from the hindquarters of twenty young intact bulls were assessed. The animals, belonging to four genetic groups (Nellore, ½ Guzerath + ½ Nellore (½ G + ½ N, ½ Red Angus + ½ Nellore (½ R + ½ N and ½ Marchigiana + ½ Nellore (½ M + ½ N, were raised on pastures, finished in dry lot and slaughtered at live weights ranging from 445 to 517 kg, and at ages ranging from 679 to 863 days. During the dry lot period, which lasted 114 days, animals were fed sorghum silage offered ad libitum, and a concentrate (13.5 MJ of ME, 18% CP in the DM at 1% live weight per day. Genetic group influenced hot carcass weight, forequarter weight, meat weight in the spare ribs, as well as meat and bone weights in the forequarter. Animals in the ½ M + ½ N group were superior both to those in the Nellore and in the ½ G + ½ N groups for hot carcass weight, forequarter weight and meat weight in the spare ribs. The ½ M + ½ N group also differed from the ½ R + ½ N and from the ½ G + ½ N groups in terms of forequarter weight and meat weight in the forequarter, respectively. Conversely, forequarter bone weight of ½ M + ½ N animals was higher than in animals from the Nellore and the ½ R + ½ N groups, respectively. There was no effect of genetic group on hindquarter cuts, except for higher shank and knuckle weights in the ½ M + ½ N group compared to the ½ G + ½ N and Nellore groups, respectively.Foram avaliados o peso e o rendimento de carcaça quente, os pesos dos cortes primários, os pesos dos componentes físicos dos cortes primários e os pesos dos principais cortes comerciais do traseiro especial de 20 bovinos machos não-castrados dos grupos genéticos Nelore, ½ Guzerá + ½ Nelore (½ G + ½ N, ½ Red Angus + ½ Nelore (½ R + ½ N e ½ Marchigiana + ½ Nelore (½ M + ½ N terminados em confinamento. O experimento durou em média 114 dias, período no qual os animais foram alimentados com silagem de sorgo à vontade e concentrado composto de 73,5% de grão de milho, 25% de caroço de algodão e 1,5% de ureia, perfazendo 13,5 MJ de EM e 18% de PB por kg de MS, fornecido à base de 1% do peso vivo do animal por dia. O grupo genético influenciou os pesos de carcaça quente, do dianteiro, da carne do costilhar e os pesos da carne e dos ossos do dianteiro. Animais do grupo ½ M + ½ N superaram os Nelore e os ½ G + ½ N em peso de carcaça quente e em peso do corte dianteiro e da porção de carne do costilhar. O grupo ½ M + ½ N distinguiu-se também do ½ R + ½ N quanto ao peso de dianteiro e do ½ G + ½ N quanto ao peso da carne do dianteiro. Por outro lado, a quantidade de ossos do dianteiro dos animais ½ M + ½ N foi superior à dos animais dos grupos Nelore e ½ R + ½ N. Não houve efeito de grupo genético sobre os cortes resultantes do desdobramento do traseiro especial, exceto pelo fato de os animais ½ M + ½ N apresentarem maior peso de músculo em comparação aos ½ G + ½ N e maior peso de patinho em comparação aos Nelore.

  5. Distribution and excretion of perfluorooctane sulfonate (PFOS) in beef cattle (Bos taurus)

    Science.gov (United States)

    Perfluorooctane sulfonate (PFOS), a perfluoroalkyl surfactant used in many industrial products, is present in industrial wastes and in wastewater treatment plant biosolids. Biosolids are commonly applied to pastures and crops used for animal feed; consequently, PFOS may accumulate in the edible tis...

  6. New Q lineage found in bovine (Bos taurus) of Iberian Peninsula.

    Science.gov (United States)

    Lopez-Oceja, Andres; Muro-Verde, Amara; Gamarra, David; Cardoso, Sergio; de Pancorbo, Marian M

    2016-09-01

    The northern Iberian Peninsula is home to a variety of autochthonous cattle breeds, such as the Terreña and Pirenaica. With the objective of characterizing the matrilineal lineages of these breeds, a study of mitochondrial DNA was performed. The D-loop of 155 individuals was analyzed and most of the individuals were carriers of the T3 haplogroup, while haplogroups T and T1 were much less frequent. A Pirenaica individual belonging to the Q haplogroup was found. To verify the presence of the Q haplogroup individual, the entire mitochondrial DNA was sequenced and compared with two descendants. The individuals were assigned to the Q1 sub-haplogroup. These findings extend the geographic distribution of the Q haplogroup to the south west of the European continent. This new Q1 lineage has seven polymorphisms in the coding region, so this lineage is probably as old as the Q lineages described to date.

  7. Cardioprotective and antioxidant effects of oleogum resin "Olibanum" from Bos Boswellia carteri Birdw. (Bursearceae).

    Science.gov (United States)

    Zaki, Ahmed A; Hashish, Nadia E; Amer, Mohamed A; Lahloub, Mohamed-Farid

    2014-05-01

    One of the leading causes of death worldwide is cardiovascular disease, hence searching for a cure is an important endeavor. The totally safe, edible, and inexpensive Boswellia plant exudate, known as olibanum or frankincense, is considered to possess diverse medicinal values in traditional medicine and from recent biological studies. Investigating the cardioprotective and antioxidant activities of olibanum from a Boswellia species, family Bursearaceae, namely Boswellia carteri Birdw. was the aim of this study. Cardioprotective activity was evaluated using a model of myocardial infarction induced by isoprenaline (ISO), while antioxidant activity was tested adopting nitric oxide scavenging (NOS) and azino-bis-3-ethyl benzthiazoline-6-sulfonic acid (ABTS) assays. The results revealed a mild cardioprotective effect and weak antioxidant activity. Copyright © 2014 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  8. Detection of two non-synonymous SNPs in SLC45A2 on BTA20 as candidate causal mutations for oculocutaneous albinism in Braunvieh cattle.

    Science.gov (United States)

    Rothammer, Sophie; Kunz, Elisabeth; Seichter, Doris; Krebs, Stefan; Wassertheurer, Martina; Fries, Ruedi; Brem, Gottfried; Medugorac, Ivica

    2017-10-05

    Cases of albinism have been reported in several species including cattle. So far, research has identified many genes that are involved in this eye-catching phenotype. Thus, when two paternal Braunvieh half-sibs with oculocutaneous albinism were detected on a private farm, we were interested in knowing whether their phenotype was caused by an already known gene/mutation. Analysis of genotyping data (50K) of the two albino individuals, their mothers and five other relatives identified a 47.61-Mb candidate haplotype on Bos taurus chromosome BTA20. Subsequent comparisons of the sequence of this haplotype with sequence data from four Braunvieh sires and the Aurochs genome identified two possible candidate causal mutations at positions 39,829,806 bp (G/A; R45Q) and 39,864,148 bp (C/T; T444I) that were absent in 1682 animals from various bovine breeds included in the 1000 bull genomes project. Both polymorphisms represent coding variants in the SLC45A2 gene, for which the human equivalent harbors numerous variants associated with oculocutaneous albinism type 4. We demonstrate an association of R45Q and T444I with the albino phenotype by targeted genotyping. Although the candidate gene SLC45A2 is known to be involved in albinism in different species, to date in cattle only mutations in the TYR and MITF genes were reported to be associated with albinism or albinism-like phenotypes. Thus, our study extends the list of genes that are associated with bovine albinism. However, further research and more samples from related animals are needed to elucidate if only one of these two single nucleotide polymorphisms or the combination of both is the actual causal variant.

  9. Producción in vivo de embriones bovinos F1 (Bos taurus x Bos indicus) durante la época de lluvias y nortes en un agroecosistema tropical.

    OpenAIRE

    Gordillo Paez, Leonardo

    2012-01-01

    El objetivo fue determinar el efecto de la temperatura ambiental y la humedad relativa sobre la producción in vivo de embriones bovinos F1, durante la época de lluvias y nortes, en un agroecosistema tropical cálido subhúmedo en Veracruz, México. A 22 vacas Cebú se les indujo ovulación múltiple, y siete días después de la inseminación artificial se recolectaron los embriones. Durante el estudio se monitoreó la humedad relativa y temperatura ambiental, y se asociaron con la producción de embrio...

  10. Estudo histopatológico comparativo em fígados de bovinos (Bos taurus L. e Bos indicus L.), bubalinos (Bubalus bubalis L.) e ovinos (Ovis aries L.) infectados por Fasciola hepatica (Linnaeus, 1758)

    OpenAIRE

    Bostelmann, Silvia Cristina Werle

    2013-01-01

    Este trabalho foi realizado com o objetivo de melhor identificar e estudar comparativamente as lesões histológicas do fígado decorrente da fasciolose hepática em três espécies de animais domésticos. Foram examinados fígados infectados por Fasciola hepatica de bovinos e bubalinos provenientes de matadouros e frigoríficos oficialmente inspecionados no Estado do Paraná e fígados de ovinos de propriedades particulares, onde o abate era realizado no local. O material foi processado pela técnica de...

  11. Coenzyme Q10 supplementation during in vitro maturation of bovine oocytes (Bos taurus) helps to preserve oocyte integrity after vitrification.

    Science.gov (United States)

    Ruiz-Conca, M; Vendrell, M; Sabés-Alsina, M; Mogas, T; Lopez-Bejar, M

    2017-10-01

    Oocyte vitrification causes less cell stress than slow cooling, but cytoskeletal and spindle alterations may occur affecting the oocyte competence. In vitro maturation (IVM) supplementation with different antioxidant molecules has been performed to attenuate this harmful stress. Coenzyme Q10 (CoQ10 ) supplementation has previously shown to have positive effects in bovine and mouse in vitro embryo development. The aim of this study was to evaluate the effects of CoQ10 during bovine oocyte IVM and vitrification. Cumulus-oocyte complexes (COCs) (n = 311) were cultured under standard maturation conditions with 0 μM (control), 25 μM and 50 μM CoQ10 supplementation. After 22 hr, a cohort of 170 oocytes both from the control and from CoQ10 -supplemented groups were vitrified, warmed and returned to incubation until 24 hr of maturation, while the rest of the oocytes (n = 141) remained fresh. Then, oocyte survival was assessed morphologically by stereomicroscopy. Oocytes from all groups were then fixed and stained for assessing cortical granules (CG) migration and nuclear stage. High rates of oocyte MII progression and appropriate CG migration as a continuous layer beneath the plasma membrane were obtained both in control and in CoQ10 groups. Results showed that although vitrification has great impact in survival of IVM bovine oocytes, 50 μM CoQ10 supplementation significantly improved oocyte survival (p = .045) and reduced the premature CG exocytosis, helping to preserve the CG migration pattern (31.3% control vs. 54.5% in 50 μM CoQ10 ; p = .039), attenuating the negative effects of vitrification. © 2017 Blackwell Verlag GmbH.

  12. Abundancia relativa de Amblyomma spp. (Acari: Ixodidae en bovinos (Bos taurus y B. indicus de Costa Rica

    Directory of Open Access Journals (Sweden)

    V. Alvarez

    2003-06-01

    Full Text Available El estudio describe la abundancia de garrapatas del género Amblyomma encontradas sobre bovino a través de muestreos mensuales llevados a cabo en diez fincas pertenecientes a ocho zonas ecológicas (ZE de Costa Rica. Durante la visita se recolectaban garrapatas >4 mm del lado derecho de los bovinos. El estudio recopiló información meteorológica para algunas de las fincas ubicadas en el ensayo, mostrando que la variable que más fluctúa es la de precipitación. La principal especie de Amblyomma encontrada fue A. cajennense. La presencia de ninfas del género Amblyomma se localizan solo en los meses de enero a mayo, coincidente con la época de menor humedad en la zona de estacionalidad de lluvias, por lo que es esperable solo una generación por año. En el trabajo de laboratorio se mantienen ninfas de Amblyomma a las cuales se les mide el tiempo de muda y de sobrevivencia bajo condiciones controladas, sin encontrar mayores diferencias entre sexo. Los períodos de sobrevivencia muestran la imposibilidad de efectuar un manejo de potreros con el fin de controlar a las especies de este género. La presencia de adultos del género Amblyomma es a lo largo del año sin presentar una preferencia particular por alguna época. El estudio dividió las zonas de estudio en régimen lluvioso estacional y régimen sin patrón de estacionalidad. La mayor presencia de adultos de Amblyomma se da precisamente en el de estacionalidad, o de influencia Pacífico. Se reporta la presencia de A. maculatum solo en la ZE correspondiente al Bosque húmedo Tropical transición a premontano. Igualmente, se informa de la presencia de Ixodes boliviensis en la ZE denominada Bosque muy húmedo Montano bajo.The research describe the big amount of ticks of the Amblyomma genus, found on bovines through monthly samplings carried out in ten farms in eight ecological zones (EZ of Costa Rica. Ticks larger than 4 mm were picked up from the right side of the animals during the visit. The study compiled meteorological information for some farms located in the experiment, showing that the most fluctuant variable is rainfall. The most important Amblyomma species found was A. cajennense. Amblyomma nymphs were found only from January to May, which coincides with the lower humidity season in the rain seasonality area; as for it is expected only one generation per year. In the lab work Amblyomma nymphs are kept to measure the moulting season and the surviving time under controlled conditions, but no major differences were found between both sexes. The surviving periods show that it is not possible to do a grazing land handling, in order to control this genus species. Adults of the genus Amblyomma are present through all the year, not showing any specific preference for a season. The research divided the investigation areas in rain seasonality and not-seasonality systems. The highest amount of Amblyomma is found given in the rain seasonality system or of Pacific influence. A. maculatum is present only in the EZ of Tropical Humid Forest transition to pre-montainous. Likewise, Ixodes boliviensis is found in the EZ of low mountainous Very Humid Forest.

  13. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus)

    Science.gov (United States)

    Ha, Minh; Sabherwal, Manya; Duncan, Elizabeth; Stevens, Stewart; Stockwell, Peter; McConnell, Michelle; Bekhit, Alaa El-Din; Carne, Alan

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes) was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes). This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth. PMID:26447763

  14. Selection of suitable reference genes for quantitative gene expression studies in milk somatic cells of lactating cows (Bos indicus).

    Science.gov (United States)

    Varshney, N; Mohanty, A K; Kumar, S; Kaushik, J K; Dang, A K; Mukesh, M; Mishra, B P; Kataria, R; Kimothi, S P; Mukhopadhyay, T K; Malakar, D; Prakash, B S; Grover, S; Batish, V K

    2012-06-01

    We assessed the suitability of 9 internal control genes (ICG) in milk somatic cells of lactating cows to find suitable reference genes for use in quantitative PCR (qPCR). Eighteen multiparous lactating Sahiwal cows were used, 6 in each of 3 lactation stages: early (25 ± 5 d in milk), mid (160 ± 15 d in milk), and late (275 ± 25 d in milk) lactation. Nine candidate reference genes [glyceraldehyde 3-phosphate dehydrogenase (GAPDH), protein phosphatase 1 regulatory subunit 11 (PPP1R11), β-actin (ACTB), β-2 microglobulin (B2M), 40S ribosomal protein S15a (RPS15A), ubiquitously expressed transcript (UXT), mitochondrial GTPase 1 (MTG1), 18S rRNA (RN18S1), and ubiquitin (UBC)] were evaluated. Three genes, β-casein (CSN2), lactoferrin (LTF), and cathelicidin (CAMP) were chosen as target genes. Very high amplification was observed in 7 ICG and very low level amplification was observed in 2 ICG (UXT and MTG1). Thus, UXT and MTG1 were excluded from further analysis. The qPCR data were analyzed by 2 software packages, geNorm and NormFinder, to determine suitable reference genes, based on their stability and expression. Overall, PPP1R11, ACTB, UBC, and GAPDH were stably expressed among all candidate reference genes. Therefore, these genes could be used as ICG for normalization of qPCR data in milk somatic cells through lactation. Copyright © 2012 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  15. Localisation of aphidicolin-induced break points in Holstein-Friesian cattle (Bos taurus using RBG-banding

    Directory of Open Access Journals (Sweden)

    Mernies Beatriz

    2002-11-01

    Full Text Available Abstract Fragile sites (FS seem to play a role in genome instability and may be involved in karyotype evolution and chromosome aberrations. The majority of common fragile sites are induced by aphidicolin. Aphidicolin was used at two different concentrations (0.15 and 0.30 μM to study the occurrence of FS in the cattle karyotype. In this paper, a map of aphidicolin induced break points and fragile sites in cattle chromosomes was constructed. The statistical analysis indicated that any band with three or more breaks was significantly damaged (P r = 0.54. On the contrary, 21 FS were identified on negative R bands while 9 FS were located on positive R bands.

  16. Association of CAPN1 and CAST gene polymorphisms with meat tenderness in Bos taurus beef cattle from Argentina

    Directory of Open Access Journals (Sweden)

    Pablo Corva

    2007-01-01

    Full Text Available The activity of the calpains/calpastatin proteolytic system is closely related to the postmortem tenderization of meat. We investigated the association between beef tenderness and single nucleotide polymorphism (SNP markers on the CAPN1 gene (SNP316, alleles C/G; SNP530 alleles A/G and the CAST gene 3' untranslated region (SNP2870, alleles A/G. We sampled nine slaughter groups comprising 313 steers which had been reared in beef production systems in Argentina between 2002 and 2004 from crosses between Angus, Hereford and Limousin cattle. Minor allele frequencies for the markers were 0.27 to 0.46 (C, 0.02 to 0.18 (A, and 0.24 to 0.53 (A, respectively. The presence of CAPN1 markers had significant effects on meat shear force but no detectable effects were demonstrated for the CAST marker. The shear force of meat from steers with the SNP316 CC genotype was 11% lower than for the SNP316 CG genotype and 17% lower than for the SNP316 GG genotype. There were very few steers with the SNP530 AA genotype and, contrary to previous studies, meat from steers with the SNP530 GG genotype showed an 11.5% higher shear force than that from steers with the SNP530 GA genotype. Final body weight, carcass weight and rib eye area were not affected by any of the markers. These results support the concept that CAPN1 variants are associated with tenderness across a wide range of beef production systems.

  17. Comet assay to determine genetic damage by the use of ivermectin in zebu cows (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Donicer Montes-Vergara

    2017-05-01

    Full Text Available Objective. The objective of the work was evaluate the damage genetic caused by the use of ivermectin (IVM in cows zebu to concentrations of 1% and 3.15% through the test comet. Material and methods. 15 cows, were taken with age between 3 and 4 years old, average weight of 350 kg, body condition between 3 and 3.5. Three experimental groups with five animals per group, which were exposed to the concentration of IVM to 1% to 3.15% more group control (without application of IVM were used. Animal blood sample was performed by venipuncture jugular or medial flow with vacutainer® needle, extracting 8 ml of blood. The blood samples it was collected at 9, 18 and 27 days post-treatment. Results. The display of the comets is made by using fluorescence microscope, the cells were evaluated by means of visual log and the Comet image software. Evidenced the presence of nuclei with DNA migration in all analyzed plates. The values of classification of comets indicate cells with high levels of damage (grade 3: cells with high damage. The rate of DNA damage of the treatment to 1% to 3.15% was significant, to relate to the control group. Conclusions. The results obtained in this study demonstrate the likely genotoxic potential of the use of IVM in cattle.

  18. Accumulation and detoxification of metals and arsenic in tissues of cattle (Bos taurus), and the risks for human consumption

    Energy Technology Data Exchange (ETDEWEB)

    Roggeman, Saskia, E-mail: saskiaroggeman@gmail.com [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); de Boeck, Gudrun [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium); De Cock, Hilde [General Medical Laboratory (Medvet/AML), Department of Pathology, Emiel Vloorsstraat 9, 2020 Antwerpen (Belgium); Blust, Ronny; Bervoets, Lieven [Laboratory for Systemic Physiological and Ecotoxicological Research (SPHERE), Department of Biology, University of Antwerp, Groenenborgerlaan 171/U7, 2020 Antwerp (Belgium)

    2014-01-01

    The aim of this study was to investigate metal accumulation and detoxification processes in cattle from polluted and unpolluted areas. Therefore dairy cows from farms and free ranging Galloway cows from nature reserves were used as study animals. The concentrations of Ag, Cd, Pb, Al, Cr, Mn, Fe, Co, Ni, Cu, Zn and As were determined in muscle, kidney, liver and lungs of cattle from polluted and reference areas in Belgium. In kidney and liver also the metallothionein concentrations were measured. For Ag, Mn, Co, Cu, Zn and As the concentrations in the different tissues were significantly higher in the sampled Galloways than in the sampled dairy cows. On the other hand Cd and Pb were significantly higher in tissues of both cattle breeds from polluted sites. Cadmium seemed to be the most important metal for metallothionein induction in kidneys whereas Zn seemed to be the most important metal for the induction of metallothionein in the liver. This study also suggested that only for Mn and Cd a significant part of the uptake occurs via the lungs. Although in muscle none of the Cd and Pb levels exceeded the European limits for human consumption, 40% of the livers and 85% of the kidneys of all examined cows were above the European limit for cadmium. Based on the existing minimum risk levels (MRLs) for chronic oral exposure, the present results suggested that a person of 70 kg should not eat more than 150 g cow meat per day because of the Cr levels in the muscles. - Highlights: •Cadmium induced metallothionein in kidney while Zn induced metallothionein in liver. •For Mn and Cd a significant part of the uptake happens via the lungs. •40% of the livers and 85% of the kidneys exceeded the European limit for cadmium. •A person of 70 kg should not eat more than 150 g bovine meat per day.

  19. In-Depth Characterization of Sheep (Ovis aries Milk Whey Proteome and Comparison with Cow (Bos taurus.

    Directory of Open Access Journals (Sweden)

    Minh Ha

    Full Text Available An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes. This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  20. Candidate gene expression in Bos indicus ovarian tissues: pre-pubertal and post-pubertal heifers in diestrus

    Directory of Open Access Journals (Sweden)

    Mayara Morena Del Cambre Amaral Weller

    2016-10-01

    Full Text Available Growth factors such as bone morphogenetic proteins 6, 7, 15 and two isoforms of transforming growth factor-beta (BMP6, BMP7, BMP15, TGFB1 and TGFB2 and insulin-like growth factor system act as local regulators of ovarian follicular development. To elucidate if these factors as well as others candidate genes such as estrogen receptor 1 (ESR1, growth differentiation factor 9 (GDF9, follicle stimulating hormone receptor (FSHR, luteinizing hormone receptor (LHR, bone morphogenetic protein receptor, type 2 (BMPR2, type 1 insulin-like growth factor receptor (IGFR1, and key steroidogenic enzymes cytochrome P450 aromatase and 3-β-hydroxysteroid dehydrogenase (CYP19A1 and HSD3B1 could modulate or influence diestrus on the onset of puberty in Brahman heifers, their ovarian mRNA expression was measured before and after puberty (luteal phase. Six post-pubertal (POST heifers were euthanized on the luteal phase of their second cycle, confirmed by corpus luteum observation, and six pre-pubertal (PRE heifers were euthanized in the same day. Quantitative real-time PCR analysis showed that the expression of FSHR, BMP7, CYP19A1, IGF1 and IGFR1 mRNA was greater in PRE heifers, when contrasted to POST heifers. The expression of LHR and HSD3B1 was lower in PRE heifers. Differential expression of ovarian genes could be associated with changes in follicular dynamics and different cell populations that have emerged as consequence of puberty and the luteal phase. The emerging hypothesis is that BMP7 and IGF1 are co-expressed and may modulate the expression of FSHR, LHR and IGFR1 and CYP19A1. BMP7 could influence the down-regulation of LHR and up-regulation of FSHR and CYP19A1, which mediates the follicular dynamics in heifer ovaries. Up-regulation of IGF1 expression pre-puberty, compared to post-puberty diestrus, correlates with increased levels FSHR and CYP19A1. Thus, BMP7 and IGF1 may play synergic roles and were predicted to interact, from the expression data (P = 0.07, r = 0.84. The role of these co-expressed genes in puberty and heifers luteal phase merits further research.

  1. Molecular phylogeny of the tribe Bovini (Bovidae, Bovinae) and the taxonomic status of the Kouprey, Bos sauveli Urbain 1937.

    Science.gov (United States)

    Hassanin, Alexandre; Ropiquet, Anne

    2004-12-01

    The kouprey is a very rare bovid species of the Indochinese peninsula, and no living specimen has been described for a long time, suggesting that it is possibly extinct. Its systematic position within the tribe Bovini remains confused since the analyses of morphological characters have led to several conflicting hypotheses. Some authors have also suggested that it could be a hybrid species produced by the crossing of the banteng with gaur, zebu, or water buffalo. Here we performed a molecular phylogeny of the tribe Bovini to determine the taxonomic status of the kouprey. DNA was extracted from the holotype specimen preserved in the MNHN collections. Phylogenetic analyses were carried out on a matrix including all the taxonomic diversity described in the tribe Bovini, and 2065 nucleotide characters, representing three different markers, i.e., the promotor of the lactoferrin and two mitochondrial genes (cytochrome b and subunit II of the cytochrome c oxidase). The results show that the kouprey belongs to the subtribe Bovina, and that three different clades can be evidenced into this group: the first includes the domestic ox, zebu, and European bison; the second incorporates the yak and American bison; and the third contains the kouprey, banteng and gaur. All hypotheses involving hybridization for the origin of the kouprey can be rejected, confirming that it is a real wild species. Molecular datings and biogeographic inferences suggest that the kouprey diverged from banteng and gaur during the Plio-Pleistocene of Asia. In addition, several molecular signatures were detected in the cytochrome b gene, permitting a molecular identification of the kouprey. We propose a conservation project based on a molecular taxonomy approach for tracking the kouprey in Indochina in order to determine whether some populations still survive in the wild.

  2. MANAJEMEN KONFLIK KONSERVASI BANTENG (Bos javanicus D' ALTON 1823 DI KAWASAN TAMAN NASIONAL MERU BETIRI DAN TAMAN NASIONAL ALAS PURWO

    Directory of Open Access Journals (Sweden)

    R Garsetiasih

    2016-06-01

    Full Text Available Penelitian manajemen konflik banteng dengan masyarakat sekitar Taman Nasional Meru Betiri (TNMB dan Taman Nasional Alas Purwo (TNAP telah dilakukan pada bulan  Desember 2009 sampai Desember 2011. Tujuan penelitian untuk memformulasikan manajemen konservasi banteng secara kolaboratif. Untuk mengetahui pengaruh dan kepentingan para pihak dilakukan analisis stakeholder melalui wawancara dengan para pihak terkait konflik yaitu Perum Perhutani, Perkebunan Bandealit, Balai Taman Nasional Meru Betiri (BTMB, Balai Taman Nasional Alas Purwo (BTNAP dan masyarakat.Teknik AHP dipakai untuk menilai persepsi pakar, analisis SWOT digunakan dalam penentuan strategi untuk implementasi program kegiatan dan analisis tingkat comanagement. Stakeholders yang mempunyai pengaruh dan kepentingan terhadap pengelolaan TN dan banteng adalah BTNMB, LSM KAIL, masyarakat dan Perkebunan Bandealit, sedangkan di TNAP yaitu BTNAP, LSM binaan KAIL, masyarakat dan Perum Perhutani. Stakeholder tidak terkait  konflik, tetapi dapat berkontribusi dalam pengelolaan kolaboratif konservasi banteng yaitu Balai Besar Inseminasi Buatan (BBIB, Dinas Peternakan, Dinas Pertanian, Dinas Kehutanan dan Dinas Pariwisata. Hasil analisis menunjukkan prioritas program yang dapat dikolaborasikan dalam konservasi bantengadalah peningkatan kualitas habitat (instruktif, pengembangan penangkaran (kooperatif, pengembangan ekowisata (advokatif, pengembangan tanaman obat dan buah (kooperatif.

  3. Manajemen Konflik Konservasi Banteng (Bos Javanicus D' Alton 1823) di Kawasan Taman Nasional Meru Betiri dan Taman Nasional Alas Purwo

    OpenAIRE

    R Garsetiasih; Alikodra, Hadi S.

    2015-01-01

    Penelitian manajemen konflik Banteng dengan masyarakat sekitar Taman Nasional Meru Betiri (TNMB) dan Taman Nasional Alas Purwo (TNAP) telah dilakukan pada bulan Desember 2009 sampai Desember 2011. Tujuan penelitian untuk memformulasikan manajemen konservasi Banteng secara kolaboratif. Untuk mengetahui pengaruh dan kepentingan para pihak dilakukan analisis stakeholder melalui wawancara dengan para pihak terkait konflik yaitu Perum Perhutani, Perkebunan Bandealit, Balai Taman Nasional Meru Bet...

  4. PRODUCTIVITY AND TICK LOAD IN Bos Indicus X B. taurus CATTLE IN A TROPICAL DRY FOREST SILVOPASTORAL SYSTEM

    Directory of Open Access Journals (Sweden)

    Raquel Sofía Salazar Benjumea

    2015-04-01

    Full Text Available Rhipicephalus (Boophilus microplus ticks cause significant economic losses to the Colombian cattle sector: reduction in meat and milk production, blood losses and transmission of blood parasites. The degree of infestation depends on the breed, physiological state and nutrition of the animal and on microclimatic characteristics, which affect the tick life cycle. Diverse studies suggest that given the characteristics of intensive silvopastoral systems (ISS, tick loads within these systems are lower. In this study, the tick loads of grazing animals were monitored for five animal groups: three at an ISS and two at traditional farms located on the Valley of Ibague (Tolima. within the ISS, there were greater tick loads in high production cows (P = 0.026 and a positive relationship (P < 0.05 between milk production and tick load in August sampling. Greater tick counts were also observed in the in San Javier (traditional farm group compared to all other animal groups. We conclude that the dynamics of ticks is a complex phenomenon affected by many factors, whose association determines the observed tick population at any given time.

  5. In-Depth Characterization of Sheep (Ovis aries) Milk Whey Proteome and Comparison with Cow (Bos taurus).

    Science.gov (United States)

    Ha, Minh; Sabherwal, Manya; Duncan, Elizabeth; Stevens, Stewart; Stockwell, Peter; McConnell, Michelle; Bekhit, Alaa El-Din; Carne, Alan

    2015-01-01

    An in-depth proteomic study of sheep milk whey is reported and compared to the data available in the literature for the cow whey proteome. A combinatorial peptide ligand library kit (ProteoMiner) was used to normalize protein abundance in the sheep whey proteome followed by an in-gel digest of a 1D-PAGE display and an in-solution digestion followed by OFFGEL isoelectric focusing fractionation. The peptide fractions obtained were then analyzed by LC-MS/MS. This enabled identification of 669 proteins in sheep whey that, to our knowledge, is the largest inventory of sheep whey proteins identified to date. A comprehensive list of cow whey proteins currently available in the literature (783 proteins from unique genes) was assembled and compared to the sheep whey proteome data obtained in this study (606 proteins from unique genes). This comparison revealed that while the 233 proteins shared by the two species were significantly enriched for immune and inflammatory responses in gene ontology analysis, proteins only found in sheep whey in this study were identified that take part in both cellular development and immune responses, whereas proteins only found in cow whey in this study were identified to be associated with metabolism and cellular growth.

  6. Follicles and gonadotropins during waves 2 and 3 in three-wave interovulatory intervals in Bos taurus heifers.

    Science.gov (United States)

    Ginther, O J; Siddiqui, M A R; Araujo, E R; Dangudubiyyam, S V

    2017-12-01

    Observations were made on follicle dynamics and gonadotropin concentrations in anovulatory wave 2 and ovulatory wave 3 in three-wave interovulatory intervals (n = 15). Hypotheses were not used owing to inadequate availability of rationale. The future dominant follicles for waves 2 and 3 were designated DF2 and DF3 and the largest future subordinate follicles as SF2 and SF3, respectively. The day of expected diameter deviation (day 0) was defined as the day that DF2 or DF3 was closest to 8.5 mm. The first day that DF2 became smaller (P waves 2 and 3 were similar at peak concentration, but the postsurge nadir of surge 2 occurred 1 day earlier than for surge 3. An LH increase was not temporally associated with deviation in wave 2, but an increase (P wave 3 began on day -1. Diameter of SF2 (6.5 ± 0.2 mm) on day 0 was less (P wave 2 did not differ among days. Diameter of subordinate follicles that attained ≥6 mm in wave 3 was greater (interaction, P wave 2 (1 of 15 waves) than for wave 3 (8 of 15 waves). Novel observations involving DF2 and DF3 were (1) before deviation, diameter of DF2 vs DF3 and an incline in FSH surge 2 vs surge 3 were similar and (2) after deviation, smaller diameter of DF2 vs DF3 by day 2 was associated with an earlier cessation (nadir) in FSH surge 2 vs surge 3 and an absence of an LH increase during deviation. Novel observations involving subordinate follicles ≥6 mm were (1) before deviation, diameters were similar between waves 2 and 3 in association with the similar incline in FSH surges 2 vs 3 and (2) after deviation, a greater diameter increase of subordinates occurred in RO than in LO for wave 3, but an increase did not occur for either ovary in wave 2. The characteristics of diameter deviation were profoundly different between waves 2 and 3 owing to a smaller SF2 than SF3 at deviation but similar diameter of DF2 and DF3. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Ruđer Bošković and the Structure of the Experience of Scientific Discovery

    Directory of Open Access Journals (Sweden)

    Francis Brassard

    2016-05-01

    Full Text Available Ruđer Josip Bošković (1711-1787 was a Jesuit priest and a scientist from the former Republic of Dubrovnik in today’s Croatia. He published many works in such fields as mathematics, physics, astronomy and geodesy. According to Werner Heisenberg, Bošković’s “main work, Theoria Philosophiae Naturalis, contains numerous ideas which have reached full expression only in modern physics of the past fifty years.” The question that this paper seeks to elucidate is what enabled Bošković to anticipate the discoveries of modern physics.Because Bošković could not avail himself of the resources and instruments by which modern theories are validated, it is assumed that there exists a mechanism of subjective validation that allowed him to accept the truthfulness of his ideas. It will be argued that this mechanism of internal validation is very similar to the process of spiritual transformation. More specifically, using Polanyi’s notion of twofold awareness (subsidiary and focal, it will be shown that this mechanism is best explained by the fact that when an idea has been fully internalized by a person so that it has become an instrument by which that person makes sense of the world and interacts with it, it acquires by this process an enormous credibility.

  8. Pengaruh Pakan Tambahan Berupa Ampas Tahu Dan Limbah Bioetanol Berbahan Singkong (Manihot utilissima Terhadap Penampilan Sapi Bali (Bos sondaicus

    Directory of Open Access Journals (Sweden)

    dwi dedeh kurnia sari

    2016-06-01

    Full Text Available This study was aimed to observe the performance of Bali cattle given additional feed of tofu waste, solid and liquid waste of bio-ethanol made from cassava. Six male Bali cattle with body weight of 190- 230 kg were used. The design of this study was a 3x3 Latinsquare with cross over pattern. The 3 treatments were included feeding DM 3% of the body weight, consist of treatment A : forage and additional feed from tofu wastes 2 kg, 200 g of solid waste and liquid wastes given 100 ml per day, treatment B : forage given daily and additional feed was given once every two days, and treatment C : only forage. The measured variables were (1 feed consumption, (2 daily weight gain (ADG, (3 feed conversion. The results are that the effect of provision of additional feed highly a real and tangible feed intake (P<0.05, ADG (P<0.01, and feed conversion (P<0.01. Average of feed consumption (kg DM-1day-1 for A, B, C were 6.97; 6.92; 6.12, respectively. Average of ADG (kg head-1day-1 for A, B, C were 0.64, 0.50, and 0.10, respectively. Average of feed conversion for treatment A, B, and C were 10.94, 14.00, and 64.00, respectively. We conclueded that additional feed can increase feed consumption, body weight and give high feed conversion. It can be suggested there should be more research on additional levels of solid waste and waste liquid bio-ethanol.

  9. Impact of exercise on productivity, behavior, and immune functioning of weaned Bos indicus-cross calves housed in drylots.

    Science.gov (United States)

    Daigle, C L; Jackson, B; Gill, R; Wickersham, T A; Sawyer, J E

    2017-12-01

    The effects of 2 exercise regimes on cattle productivity, immune function, and behavior were evaluated against a control ( = 4 pens/treatment) using weaned -cross calves ( = 203) housed in drylots (16-18 calves/single sex pens). Three treatments were applied 3 times per week for 4 wk: 1) programmatic exercise (PRO), in which cattle and a stockperson walked in the alleyway behind their home pen for 20 min; 2) free exercise (FREE), in which cattle were moved into the drovers alley for 60 min, not exercised by a stockperson, and were allowed free access to their home pen and alleyway; and 3) control (CON), in which calves were removed from their home pen only for routine husbandry. Behavior observations were conducted on d -2 and -1 relative to treatment implementation (d 0) and on d 5, 6, 12, 13, 19, 20, 26, and 27. Instantaneous scan sampling was used to create behavioral profiles for cattle (posture: stand, lie, and walk; and behavior: feed, drink, and ruminate). Focal observations recorded the incidence of social behaviors (allogrooming, social play, and agonistic interactions) and animal-environment interactions (AEI; fencepost licking, rock eating, tongue rolling, and cross-suckling). Body weights, exit velocities, and antibody titers to a bovine viral diarrhea virus type 1b vaccine were measured on d -10, 10, and 28. A linear mixed model (PROC MIXED) was used to evaluate the impact of exercise treatment, sex, time, and their interactions on cattle behavior, health, and productivity. Statistical differences were not observed ( = 0.11) for overall ADG among cattle receiving FREE (1.00 kg ± 0.04) PRO (0.85 kg ± 0.04), or CON (0.86 kg ± 0.05) exercise treatments. Allogrooming ( = 0.05), lying ( < 0. 01), AEI ( < 0.01), rumination ( < 0.01), and agonistic interactions ( < 0.01) increased over time. Comfort-related behaviors (e.g., lying, rumination) increased over the evaluation period, suggesting that calves became acclimated to the environment. Exercise did not alter behaviors or vaccine response and did not reduce the performance of production-critical (e.g., feeding, resting, ruminating) behaviors.

  10. Predicting wolf (Canis lupus)-cattle (Bos Taurus) encounters and consequential effects on cattle resource selection patterns

    Science.gov (United States)

    The gray wolf population in Idaho has grown dramatically from the original 35 reintroduced individuals in 1995-1996 to 94 documented packs and a minimum population of 835 individuals in 2009. Wolf depredation on livestock has also increased dramatically with this population growth. Substantial spa...

  11. Developmental block and programmed cell death in Bos indicus embryos: effects of protein supplementation source and developmental kinetics.

    Directory of Open Access Journals (Sweden)

    Sheila Merlo Garcia

    Full Text Available The aims of this study were to determine if the protein source of the medium influences zebu embryo development and if developmental kinetics, developmental block and programmed cell death are related. The culture medium was supplemented with either fetal calf serum or bovine serum albumin. The embryos were classified as Fast (n = 1,235 or Slow (n = 485 based on the time required to reach the fourth cell cycle (48 h and 90 h post insemination - hpi -, respectively. The Slow group was further separated into two groups: those presenting exactly 4 cells at 48 hpi (Slow/4 cells and those that reached the fourth cell cycle at 90 hpi (Slow. Blastocyst quality, DNA fragmentation, mitochondrial membrane potential and signs of apoptosis or necrosis were evaluated. The Slow group had higher incidence of developmental block than the Fast group. The embryos supplemented with fetal calf serum had lower quality. DNA fragmentation and mitochondrial membrane potential were absent in embryos at 48 hpi but present at 90 hpi. Early signs of apoptosis were more frequent in the Slow and Slow/4 cell groups than in the Fast group. We concluded that fetal calf serum reduces blastocyst development and quality, but the mechanism appears to be independent of DNA fragmentation. The apoptotic cells detected at 48 hpi reveal a possible mechanism of programmed cell death activation prior to genome activation. The apoptotic cells observed in the slow-developing embryos suggested a relationship between programmed cell death and embryonic developmental kinetics in zebu in vitro-produced embryos.

  12. Comparison of a flow assay for brucellosis antibodies with the reference cELISA test in West African Bos indicus.

    Directory of Open Access Journals (Sweden)

    Barend M deC Bronsvoort

    Full Text Available Brucellosis is considered by the Food and Agricultural Organisation and the World Health Organisation as one of the most widespread zoonoses in the world. It is a major veterinary public health challenge as animals are almost exclusively the source of infection for people. It is often undiagnosed in both human patients and the animal sources and it is widely acknowledged that the epidemiology of brucellosis in humans and animals is poorly understood, particularly in sub-Saharan Africa. It is therefore important to develop better diagnostic tools in order to improve our understanding of the epidemiology and also for use in the field for disease control and eradication. As with any new diagnostic test, it is essential that it is validated in as many populations as possible in order to characterise its performance and improve the interpretation of its results. This paper describes a comparison between a new lateral flow assasy (LFA for bovine brucellosis and the widely used cELISA in a no gold standard analysis to estimate test performance in this West African cattle population. A Bayesian formulation of the Hui-Walter latent class model incorporated previous studies' data on sensitivity and specificity of the cELISA. The results indicate that the new LFA is very sensitive (approximately 87% and highly specific (approximately 97%. The analysis also suggests that the current cut-off of the cELSIA may not be optimal for this cattle population but alternative cut-offs did not significantly change the estimates of the LFA. This study demonstrates the potential usefulness of this simple to use test in field based surveillance and control which could be easily adopted for use in developing countries with only basic laboratory facilities.

  13. Comparison of a Flow Assay for Brucellosis Antibodies with the Reference cELISA Test in West African Bos indicus

    Science.gov (United States)

    Bronsvoort, Barend M. deC.; Koterwas, Bronwyn; Land, Fiona; Handel, Ian G.; Tucker, James; Morgan, Kenton L.; Tanya, Vincent N.; Abdoel, Theresia H.; Smits, Henk L.

    2009-01-01

    Brucellosis is considered by the Food and Agricultural Organisation and the World Health Organisation as one of the most widespread zoonoses in the world. It is a major veterinary public health challenge as animals are almost exclusively the source of infection for people. It is often undiagnosed in both human patients and the animal sources and it is widely acknowledged that the epidemiology of brucellosis in humans and animals is poorly understood, particularly in sub-Saharan Africa. It is therefore important to develop better diagnostic tools in order to improve our understanding of the epidemiology and also for use in the field for disease control and eradication. As with any new diagnostic test, it is essential that it is validated in as many populations as possible in order to characterise its performance and improve the interpretation of its results. This paper describes a comparison between a new lateral flow assasy (LFA) for bovine brucellosis and the widely used cELISA in a no gold standard analysis to estimate test performance in this West African cattle population. A Bayesian formulation of the Hui-Walter latent class model incorporated previous studies' data on sensitivity and specificity of the cELISA. The results indicate that the new LFA is very sensitive (∼87%) and highly specific (∼97%). The analysis also suggests that the current cut-off of the cELSIA may not be optimal for this cattle population but alternative cut-offs did not significantly change the estimates of the LFA. This study demonstrates the potential usefulness of this simple to use test in field based surveillance and control which could be easily adopted for use in developing countries with only basic laboratory facilities. PMID:19381332

  14. TERMOGRAFIA DIGITAL POR INFRAVERMELHO DO ESCROTO E QUALIDADE DO SÊMEN EM TOUROS NELORE (BOS TAURUS INDICUS

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2014-12-01

    Full Text Available Aimed to study the relationship between scrotal temperature on semen quality by use of infrared thermography in Nelore bulls bred extensively. There were scrotal thermography and semen collection. Climatic data were collected by means of globe thermometer. The thermograms of the scrotum were obtained by digital infrared thermography. We carried out ejaculates through electroejaculation for analysis of quantitative and qualitative characteristics. For the data, we used analysis of variance and subsequently applied the Tukey test at 5%. (p <0.05 between animals for sperm vigor, sperm motility between animals and between crops, sperm concentration, total sperm and total viable sperm between groups, between harvests for the scrotum temperatures and climate data. It was concluded that the surface temperatures of the scrotum and climatic factors influence the quality of semen. Thermography is recommended as a complementary test in the evaluation of reproductive bulls.

  15. MANAJEMEN KONFLIK KONSERVASI BANTENG (Bos javanicus D' ALTON 1823) DI KAWASAN TAMAN NASIONAL MERU BETIRI DAN TAMAN NASIONAL ALAS PURWO

    OpenAIRE

    Garsetiasih, R; Hadi S Alikodra

    2016-01-01

    Penelitian manajemen konflik banteng dengan masyarakat sekitar Taman Nasional Meru Betiri (TNMB) dan Taman Nasional Alas Purwo (TNAP) telah dilakukan pada bulan  Desember 2009 sampai Desember 2011. Tujuan penelitian untuk memformulasikan manajemen konservasi banteng secara kolaboratif. Untuk mengetahui pengaruh dan kepentingan para pihak dilakukan analisis stakeholder melalui wawancara dengan para pihak terkait konflik yaitu Perum Perhutani, Perkebunan Bandealit, Balai Taman Nasional Meru Bet...

  16. Perfluorooctane sulfonate plasma half-life determination and long term tissue distribution in beef cattle (Bos taurus)

    Science.gov (United States)

    Perfluorooctane sulfonate (PFOS) is used in consumer products as a surfactant and is found in industrial and consumer waste which ends up in wastewater treatment plants (WWTPs). PFOS does not breakdown during WWTP processes and accumulates in the biosolids. Common practices include application of bi...

  17. Soluble forms of CD46 are detected in Bos taurus plasma and neutralize BVDV, the bovine pestivirus.

    Science.gov (United States)

    Alzamel, Nidal; Bayrou, Calixte; Decreux, Annabelle; Desmecht, Daniel

    2016-12-01

    The pestivirus bovine viral diarrhea virus (BVDV) is known to bind to the CD46 molecule, which subsequently promotes entry of the virus. Mapping of the BVD-virion-binding site has shown that two peptides, 66EQIV69 and 82GQVLAL87, located on antiparallel beta sheets in the most distal complement control protein module (CCP1), provide the attachment platform. In the present study, we reveal new CD46-encoding transcripts that are predicted to encode CCP1-containing soluble forms. Further, we show that the serum of most adult cattle contains soluble CD46 (sCD46) and that a recombinant soluble isoform neutralizes BVDV infectivity in an in vitro assay. We have then established an ELISA for determination of plasma sCD46 in a large cohort of animals. Overall, serum sCD46 amounts to 8±18ng/mL (mean±SD, n=440), with a IC [95-105] ranging from 6,4 to 9,8ng/mL and extreme values ​​between 0 and 178ng/mL. We found that sCD46 is not detectable in fetal and neonatal sera and that its plasma concentration increases progressively up to adulthood. We also detected high- and low-sCD46 performers and show that this phenotype does not depend of environment. As modern rearing techniques make it possible to disseminate genetically-determined phenotypes very quickly in a population, a large-scale study examining whether high-sCD46 animals provide epidemiological protection against BVDV infection and transmission should be undertaken. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. The compartments of the parenchyma of the lymph nodes in newborn bull calves of domestic cattle (Bos taurus

    Directory of Open Access Journals (Sweden)

    P. N. Gavrilin

    2017-04-01

    Full Text Available The article analyzes the features of the structure of the lymphoid lobules of the parenchyma of the superficial somatic (Limphonodi subiliaci, L. cervicales superficiales, profund somatic (L. axillares proprii L. poplitei, somatovisceral (L. iliaci mediales, L. retropharyngei mediales and visceral (L. mediastinales caudales, L. ileocolici lymph nodes of newborn bull calves of domestic cattle. To visualize clearly the boundaries of the structural components of lymphoid lobules we used the author’s modification of the impregnation of total median frozen histological sections with silver nitrate. We have established a high level of tissue differentiation of the lymph nodes, a significant development of the lymphoid parenchyma, the division of the parenchyma into lymphoid lobules, the presence in the lobules of all the main structural components that are represented by two morphotypes. The first morphotype is ribbon-like perisinusoidal cords (interfollicular zone, paracortical and medullary cords. The second morphotype is rounded lymphoid formations (central zones of deep cortex units, lymphatic nodules. Lymphoid lobules are located along the marginal sinus in one row, they are better developed and differentiated in the visceral lymph nodes. In all the lymph nodes, the lymphoid lobules have a similar histoarchitectonic, and each structural component of the lymphoid lobules has a specific architectonic of the reticular meshwork and the density of the location of the fibroblastic reticulocytes. We determined that the structures of the first morphotype which provide the migration of lymphocytes, the detection of antigens and the accumulation of plasmocytes are more developed. We have established that the relative volume of structures of the first morphotype is 4.5–8.0 times larger than the volume of the structures of the second morphotype, which provide clonal proliferation of T and B lymphocytes, especially in deep somatic lymph nodes. Among the zones of the second morphotype, predominate T-dependent zones, the relative volume of which considerably exceeds the volume of B-dependent zones (lymphoid nodules: in the superficial somatic lymph nodes by 14–30 times, profound somatic by 12–14 times, somatovisceral by 6–7 times and visceral by 4.5–5.5 times. We determined that lymphatic nodules can form in different parts of compartments: in the interfollicular zone and paracortical cords of all lymph nodes and in the medullary cords of the visceral lymph nodes. The study shows that the parenchyma of the lymph nodes of newborn bull calves has a high degree of maturity, contains a full set of structural markers of immunocompetence, among which predominate the components that support lymphocyte migration, antigen detection and accumulation of plasma cells.

  19. Radiocarbon chronologies and extinction dynamics of the Late Quaternary mammalian megafauna of the Taimyr Peninsula, Russian Federation

    NARCIS (Netherlands)

    MacPhee, RDE; Tikhonov, AN; Mol, D; Maliave, CD; Van der Plicht, H; Greenwood, AD; Flemming, C; Agenbroad, L; MacPhee, Ross D.E.; Tikhonov, Alexei N.; Marliave, Christian de; Greenwood, Alex D.

    This paper presents 75 new radiocarbon dates based on late Quaternary mammal remains recovered from eastern Taimyr Peninsula and adjacent parts of the northern Siberian lowlands, Russian Federation, including specimens of woolly mammoth (Mammuthus primigenius), steppe bison (Bison priscus), muskox

  20. El medio ambiente durante el Pleistoceno Superior en la región Cantábrica con referencia especial a sus faunas de mamíferos.

    Directory of Open Access Journals (Sweden)

    Jesús Altuna

    1992-01-01

    Isturitz, no han sido hallados fósiles hasta el presente en el Cantábrico. Aumentan el corzo y el jabalí a partir de Alleröd. Por fín el paso al Holoceno lo marca la desaparición total del reno, la disminución de caballo, cabra y sarrio, el aumento de corzo y jabalí y la presencia única de Bos primigenius entre los Bovinos.

  1. A study of [i]Neospora caninum[/i] and [i]Toxoplasma[/i] [i]gondii[/i] antibody seroprevalence in healthy cattle in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Eva Bártová

    2015-02-01

    Full Text Available [b]Introduction and objective[/b]. The aim of study was to test the sera of healthy dairy cows by ELISAs, the methods also used in other groups of animals in the Czech Republic, and thus to obtain actual data about [i]N. caninum[/i] and [i]T. gondii[/i] seroprevalence in cattle. [b]Material and methods[/b]. In the Czech Republic, sera from 546 clinically healthy dairy cows ([i]Bos primigenius f. taurus[/i] aged > 2 years from 49 farms in 7 districts were collected. Sera were tested for [i]Neospora caninum[/i] antibodies by a commercial competitive-inhibition enzyme-linked immunosorbent assay; samples with more than 30% inhibition were considered as positive. The same samples were also analysed for Toxoplasma-specific IgG antibodies by an enzyme-linked immunosorbent assay; samples with more than 50% S/P were considered as positive. [b]Results[/b]. Antibodies against [i]N. caninum[/i] were found only in 3 cows (0.5% with inhibitions of 47, 78 and 85. Antibodies against [i]T. gondii [/i]were found in 53 cows (9.7% with S/P ranging from 51% to over 211%; positive animals were found in 4 of 7 districts, with prevalences ranging from 8% – 14%. Indication of mixed infections (concurrent presence of both [i]N. caninum[/i] and [i]T. gondii [/i]antibodies was not proved. [b]Conclusion[/b]. The results of the study indicate that dairy cows in the Czech Republic have a relatively low seroprevalence for both [i]N. caninum[/i] and [i]T. gondii[/i]. Therefore, natural infection with [i]N. caninum[/i] and [i]T. gondii[/i] seems not to be very common in Czech cattle. These results show actual data about [i]N. caninum[/i] and [i]T. gondii [/i]infection in healthy dairy cattle from the Czech Republic.

  2. High resolution mesurements of 18O/16O ratios of present and fossil herbivores dental enamel using the ims 1270 ion microprobe

    Science.gov (United States)

    Pisapia, C.; Bentaleb, I.; Rollion-Bard, C.; Tafforeau, P.; Fontugne, M.; France-Lanord, C.

    2003-04-01

    The isotopic composition of dental enamel is used for palaeoenvironmental issues. Enamel has a striated structure. Growth striations represent daily formation of enamel and precipitate as apatite cristals in equilibrium with the body water of the animal which mainly reflects the water ingested. The isotopic composition of meteoric water is well-correlated with environmental temperature. Enamel is the most mineralised biomaterial in comparison with dentine or bone and the isotopic signal is more easily preserved during fossilization. The knowledge of δ18O of enamel authorizes reconstruction of palaeotemperatures. The aim of this project is to develop the methodology for the analysis of the isotopic composition in oxygen (δ18O) of great herbivores enamel using the ims 1270 ion microprobe. This probe enables analyses at great resolution (spots diameter : 1-10μm) more than those obtained classically (eg. 50μm maximum with micromill sampling) for such studies. As a consequence, each analysis represents a smaller period of time and authorizes a precise description of past climates. Data obtained represent the bulk isotopic oxygen composition of bioapatite (PO_43-, CO_32- and OH groups). Instrumental deviation is corrected using mesurements of sedimentary hydroxyapatite and carbonate standards of known isotopic composition and calculating the relative proportion of these groups in the enamel analyzed: δinst = %carbonates^*δinst for carbonates + %hydroxyapatite ^*δinst for hydroxyapatite. Analyses were made on molars of present (Camelus dromedarius - Capra hircus: Pakistan, Ovis aries - Bos taurus: France) and fossil (Mammuthus primigenius: Siberia, Gaindatherium: Thailand) herbivores. First results on present or sub-present teeth showed coherent data (δ18O from 3.80 ppm for the Siberian mammoth to 27.77 ppm for the pakistanian goat) and seasonal variations of the signals are visible. Comparisons between bulk composition measured with ion microprobe and carbonates

  3. Mycobacterium bovis infections in slaughter pigs in Mubende district, Uganda: a public health concern

    Directory of Open Access Journals (Sweden)

    Muwonge Adrian

    2012-09-01

    Full Text Available Abstract Background Bovine tuberculosis (TB caused by Mycobacterium bovis is primarily a disease of ruminants, particularly cattle (Bos primigenius and buffalo (Syncerus caffer, and is endemic in most developing countries. To date, studies done in Uganda have documented the prevalence of M. bovis in cattle, humans and wild life, in addition to non-tuberculous mycobacteria in pigs. Pigs are increasingly becoming an important component of the livestock sector and share the human ecosystem in rural Uganda. It is therefore of public health interest that they are not a source of human infections. As a follow up to previously published findings on mycobacteria in pigs, this study was aimed at investigating the occurrence and molecular characteristics of M. bovis detected in slaughter pigs in Mubende district, Uganda. One hundred fifty mesenteric lymph nodes with lesions suggestive of mycobacterial infections were collected from approximately one thousand slaughtered pigs in Mubende district over a period of five months. The isolation and identification of M. bovis was done using conventional mycobacteriological methods. Mycobacteria belonging to the Mycobacterium tuberculosis complex (MTC were identified to species level using deletion analysis. Molecular typing was done using Spoligotyping and MIRU-VNTR analysis. Molecular data were analysed and interpreted using MIRU-VNTR plus, SpolDB4.0 and the Mycobacterium bovis spoligo database. Results Of the examined animals, one boar and two sows from Madudu Sub County were infected with M. bovis which presented as lesions of a deep yellow colour and a grit-like texture in the mesenteric lymph nodes. This represents 2% (3/150 of the lymph nodes where lesions suggestive of mycobacterial infections were detected. Molecular analysis revealed that the isolates from the infected pigs showed identical MIRU-VNTR profile and spoligotype (SB1469. Conclusions This is the first study documenting the occurrence of M

  4. Gene : CBRC-ACAR-01-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CTED: hypothetical protein [Bos taurus] 1e-18 43% MRALMHIIIIIIVRASMRALMHIIIIIIIIIIIIIIIIIIIVRASMIALMHIIIIIIIIIIIIIIIVRASMR...ALMHIIIIIIIIIIIIVGASMIALMHIIIIIIIIVRASMRALMHIIIIIIIIIIIIIIVRASMRALMHIIIIIIIIIIIIIIIIIAGASMRALI

  5. Taxonomy Icon Data: cattle [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available rus_L.png Bos_taurus_NL.png Bos_taurus_S.png Bos_taurus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cg...i?i=Bos+taurus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Bos+taurus&t=NL http://biosciencedbc.jp/taxonomy..._icon/icon.cgi?i=Bos+taurus&t=S http://biosciencedbc.jp/taxonomy_icon/ico...n.cgi?i=Bos+taurus&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=28 ...

  6. Molecular Characterization of Bovine SMO Gene and Effects of Its Genetic Variations on Body Size Traits in Qinchuan Cattle (Bos taurus).

    Science.gov (United States)

    Zhang, Ya-Ran; Gui, Lin-Sheng; Li, Yao-Kun; Jiang, Bi-Jie; Wang, Hong-Cheng; Zhang, Ying-Ying; Zan, Lin-Sen

    2015-07-27

    Smoothened (Smo)-mediated Hedgehog (Hh) signaling pathway governs the patterning, morphogenesis and growth of many different regions within animal body plans. This study evaluated the effects of genetic variations of the bovine SMO gene on economically important body size traits in Chinese Qinchuan cattle. Altogether, eight single nucleotide polymorphisms (SNPs: 1-8) were identified and genotyped via direct sequencing covering most of the coding region and 3'UTR of the bovine SMO gene. Both the p.698Ser.>Ser. synonymous mutation resulted from SNP1 and the p.700Ser.>Pro. non-synonymous mutation caused by SNP2 mapped to the intracellular C-terminal tail of bovine Smo protein; the other six SNPs were non-coding variants located in the 3'UTR. The linkage disequilibrium was analyzed, and five haplotypes were discovered in 520 Qinchuan cattle. Association analyses showed that SNP2, SNP3/5, SNP4 and SNP6/7 were significantly associated with some body size traits (p 0.05). Meanwhile, cattle with wild-type combined haplotype Hap1/Hap1 had significantly (p < 0.05) greater body length than those with Hap2/Hap2. Our results indicate that variations in the SMO gene could affect body size traits of Qinchuan cattle, and the wild-type haplotype Hap1 together with the wild-type alleles of these detected SNPs in the SMO gene could be used to breed cattle with superior body size traits. Therefore, our results could be helpful for marker-assisted selection in beef cattle breeding programs.

  7. Metal exposure and accumulation patterns in free-range cows (Bos taurus) in a contaminated natural area: Influence of spatial and social behavior

    NARCIS (Netherlands)

    Roggeman, S.; Brink, van den N.W.; Praet, van N.; Blust, R.; Bervoets, L.

    2013-01-01

    Possible effects of spatial metal distribution, seasonal-, ecological- and ethological parameters, on the metal exposure of cows were investigated. Therefore the habitat use, vegetation selection and foraging behavior of two free ranging Galloway herds in a metal polluted nature reserve were

  8. Resposta superovulatória após ablação folicular usando um dispositivo simplificado em bovinos (Bos taurus taurus)

    OpenAIRE

    Wagner Marques de Lima

    2007-01-01

    A influência do momento da ablação do folículo dominante antes do início do tratamento superovulatório, e seu efeito sobre a dinâmica folicular ovariana e a taxa de produção de embriões, ainda permanece indeterminada em bovinos. O presente estudo foi desenvolvido com objetivo de avaliar a resposta superovulatória de fêmeas da raça Limousin, determinando os efeitos da influência do dia de início da superovulação (SOV) de animais no diestro; da presença ou ausência de folículos palpáveis nos ov...

  9. Genome-wide DNA methylation profiles and their replationship with mRNA and the microRNA transcriptome in bovine muscle tissue (Bos Taurine)

    Science.gov (United States)

    DNA methylation is a key epigenetic modification in mammals, having essential and important roles in muscle development. We sample longissimus thoracis tissues from a well-known elite native breed of Chinese Qinchuan cattle living within comparable environments at fetal and adult stages, using methy...

  10. Pengaruh Pengadukan Dan Variasi Feeding Terhadap Pembentukan Biogas Dari Sampah Dapur Rumah Makan Pada Reaktor Batch Dengan Aktivator Feses Sapi (Bos Taurus)

    OpenAIRE

    Tri Utomo, Doron; Hadiwidodo, Mochtar; Sudarno, Sudarno

    2014-01-01

    Food waste is organic waste that is quite lot and have not good treatment now. Food waste in anaerobic treatment have potential to produce biogas with addition cow feces as an activator. Stirring is one effort to increase the production of biogas. Research has been conducted in a batch system but the results have not been produced an optimal biogas. This research use two big reactors (19 liter) and 16 small reactors (600 ml dan 500 ml). There are four parameters that were observed the biogas...

  11. Quality attributes and composition of meat from red deer (Cervus elaphus), fallow deer (Dama dama) and Aberdeen Angus and Holstein cattle (Bos taurus).

    Science.gov (United States)

    Bureš, Daniel; Bartoň, Luděk; Kotrba, Radim; Hakl, Josef

    2015-08-30

    The consumption of venison from deer species has increased in recent years owing to presumably positive health effects. Therefore a comparison was made of the physical characteristics, chemical composition and sensory attributes of meat obtained from red deer, fallow deer and Aberdeen Angus and Holstein cattle raised under conditions typical for commercial farming practice and slaughtered at similar ages. Venison had one-quarter the crude fat content, lower total collagen and a higher proportion of heat-soluble collagen. It was darker and less yellow than beef. Deer species provided meat with higher polyunsaturated/saturated fatty acid ratio and lower atherogenic index. In addition, the venison of red deer contained five times as much n-3 polyunsaturated fatty acids as the beef. Steaks prepared from venison were scored higher than beef for flavour and aroma intensity; they were also tenderer and more easily chewable. Compared with beef, venison from two widely farmed deer species was superior in nutrient composition, thus offering potential benefits for human consumption, and it received higher scores for most of the sensory attributes examined. © 2014 Society of Chemical Industry.

  12. Studies on the food and feeding habits of Gaur Bos taurus H. Smith (Mammalia: Artiodactyla: Bovidae in two protected areas of Goa

    Directory of Open Access Journals (Sweden)

    S.D. Gad

    2009-02-01

    Full Text Available Feeding habits and diet composition of gaur were studied at Bhagvan Mahaveer Wildlife Sanctuary and Mollem National Park, Goa. Altogether, 32 species of plants belonging to 17 families constitute the gaur diet. The fruits, leaves, young shoots, bark and flowers are consumed, with a preference for leaves (87%. In summer gaur also consumed the bark of cashew (Anacardium occidentale and teak (Tectona grandis trees. Strong association was observed between food preference and season (chi-square=12.94; p=0.001. Peak feeding activity was observed early in the morning (0630 to 0830 hr and in the evening (1730 to 1845 hr. During hot hours of the day (1330 to 1530 hr, animals were found resting in the shade of large trees.

  13. Effects of Bos taurus autosome 9-located quantitative trait loci haplotypes on enzymatic mastitis indicators of milk from dairy cows experimentally inoculated with Escherichia coli

    DEFF Research Database (Denmark)

    Sørensen, Lars Peter; Engberg, Ricarda Greuel; Løvendahl, Peter

    2015-01-01

    Holstein cows divided into 4 groups representing repeated experiments and, within group, divided according to quantitative trait locus haplotype. All cows were inoculated with viable E. coli, and milk samples were collected 27 times from −6 to 396 h post-E. coli inoculation (PI). Activity of the 4 enzymes...... decreased significantly at 12 h PI and bacteria counts increased 100-fold and peaked at 18 h PI, which was validated by PCR. Also, SCC started to increase at 12 h PI and increased on average 70 times; however, no significant differences in SCC level were detected between HH and HL cows at any sampling point....... The enzymes LDH, NAGase, and alkaline phosphatase showed similar responses, with a significantly increased activity and higher peak values for the HH than the HL cows. Significant differences between HH and HL cows were detected at different time points for these 3 enzymes, but not after adjusting P-values...

  14. Effects of post-weaning growth rate and puberty induction protocol on reproductive performance of Bos indicus-influenced beef heifers.

    Science.gov (United States)

    Moriel, P; Lancaster, P; Lamb, G C; Vendramini, J M B; Arthington, J D

    2017-08-01

    A 3-yr study evaluated the effectiveness of puberty induction using exogenous reproductive hormones in beef heifers undergoing different post-weaning growth rates. On d 0 of each year, grazing Angus × Brahman heifers (60 heifers/yr) were stratified by initial BW and age (BW = 253 ± 30 kg; age = 310 ± 18 d), and randomly assigned, in a 3 × 2 factorial design, to achieve a low (LOW; 0.45 kg/d), medium (MED; 0.73 kg/d), or high (HIGH; 1.00 kg/d) growth rate from d 0 to 168 (5 heifers/pasture; 4 pastures/growth rate/yr). Dietary supplements were offered 3 times weekly (Mondays, Wednesdays, and Fridays) at 0800 h to provide 1.8, 2.9, and 4.4 kg of supplement DM per heifer daily from d 0 to 168. On d 0 of each year, 2 pastures/growth rate treatment were randomly assigned to receive (SYNC) or not (NOSYNC) a puberty induction protocol, which consisted of intravaginal controlled internal drug release (CIDR) insertion on d 65, CIDR removal on d 72, followed by 100-µg i.m. injection of GnRH on d 74, and 25-mg i.m. injection of PGF on d 84. Immediately after the puberty induction protocol, all heifers were grouped by growth rate treatment (1 group/growth rate/yr) into a single pasture and exposed to yearling Angus × Brahman bulls from d 84 to 168 (1 bull/group/yr). Interactions among growth rate and puberty induction protocol were not detected for any variable ( ≥ 0.26). Overall heifer ADG achieved only 51 to 56% of targeted ADG, and percentage of mature BW on d 84 did not differ between MED and HIGH heifers ( = 0.30), but both were heavier than LOW heifers ( puberty induction protocol increased puberty attainment on d 84 ( puberty induction protocol ( ≥ 0.25). However, heifers calved 11 d earlier when enrolled in the puberty induction protocol ( = 0.02). In summary, puberty induction and HIGH and MED growth rates resulted in earlier attainment of puberty and pregnancy in -influenced beef heifers. However, neither growth rate or puberty induction impacted overall heifer pregnancy and calving rates on their first breeding season.

  15. Genetic parameters of infectious bovine keratoconjunctivitis and its relationship with weight and parasite infestations in Australian tropical Bos taurus cattle

    DEFF Research Database (Denmark)

    Ali, A.; O'Neill, C.J.; Thomson, P.C.

    2012-01-01

    recorded for tick counts, helminth eggs counts as an indicator of intestinal parasites and live weights at several ages including 18 months. Results: Negative genetic correlations were estimated between IBK incidence and weight traits for animals in pre-weaning and post-weaning datasets. Genetic...... correlations among weight measurements were positive, with moderate to high values. Genetic correlations of IBK incidence with tick counts were positive for the pre-weaning and negative for the post-weaning datasets but negative with helminth eggs counts for the pre-weaning dataset and slightly positive...... and helminth eggs counts suggest that they are controlled by common genes (with pleiotropic effects). Genetic correlations between IBK incidence and tick and helminth egg counts were moderate and opposite between pre-weaning and post-weaning datasets, suggesting that the environmental and (or) maternal effects...

  16. An original SERPINA3 gene cluster: Elucidation of genomic organization and gene expression in the Bos taurus 21q24 region

    Directory of Open Access Journals (Sweden)

    Ouali Ahmed

    2008-04-01

    Full Text Available Abstract Background The superfamily of serine proteinase inhibitors (serpins is involved in numerous fundamental biological processes as inflammation, blood coagulation and apoptosis. Our interest is focused on the SERPINA3 sub-family. The major human plasma protease inhibitor, α1-antichymotrypsin, encoded by the SERPINA3 gene, is homologous to genes organized in clusters in several mammalian species. However, although there is a similar genic organization with a high degree of sequence conservation, the reactive-centre-loop domains, which are responsible for the protease specificity, show significant divergences. Results We provide additional information by analyzing the situation of SERPINA3 in the bovine genome. A cluster of eight genes and one pseudogene sharing a high degree of identity and the same structural organization was characterized. Bovine SERPINA3 genes were localized by radiation hybrid mapping on 21q24 and only spanned over 235 Kilobases. For all these genes, we propose a new nomenclature from SERPINA3-1 to SERPINA3-8. They share approximately 70% of identity with the human SERPINA3 homologue. In the cluster, we described an original sub-group of six members with an unexpected high degree of conservation for the reactive-centre-loop domain, suggesting a similar peptidase inhibitory pattern. Preliminary expression analyses of these bovSERPINA3s showed different tissue-specific patterns and diverse states of glycosylation and phosphorylation. Finally, in the context of phylogenetic analyses, we improved our knowledge on mammalian SERPINAs evolution. Conclusion Our experimental results update data of the bovine genome sequencing, substantially increase the bovSERPINA3 sub-family and enrich the phylogenetic tree of serpins. We provide new opportunities for future investigations to approach the biological functions of this unusual subset of serine proteinase inhibitors.

  17. The first identification of a blood-sucking abomasal nematode Ashworthius sidemi in cattle (Bos taurus) using simple polymerase chain reaction (PCR).

    Science.gov (United States)

    Moskwa, Bożena; Bień, Justyna; Cybulska, Aleksandra; Kornacka, Aleksandra; Krzysiak, Michał; Cencek, Tomasz; Cabaj, Władysław

    2015-06-30

    A simple polymerase chain reaction (PCR) test was used to identify Ashworthius sidemi, a blood-sucking gastrointestinal nematode that commonly infects bison, red and roe deer, and moose in Poland. The present study uses this technique to confirm the possibility of transmission of A. sidemi infection from wildlife to domestic animals, such as cattle and sheep, grazing on the same natural pastures. A 406 bp fragment of genomic A. sidemi DNA was actually detected in DNA isolated from larval cultures derived from feces from cattle. A. sidemi DNA has been detected in cattle which represent a new host for this parasite. This is the first evidence of A. sidemi in cattle. The results reveal that a PCR test based on DNA from L3 larvae can be used for in vivo detection of A. sidemi invasions in breeding animals. In conclusion, the transfer of A. sidemi infection from wildlife to the farm animals sharing the same pastures appears possible. Copyright © 2015. Published by Elsevier B.V.

  18. PENDUGAAN MODEL PERTUMBUHAN DAN BENTUK SEBARAN SPASIAL POPULASI BANTENG (BOS SONDAICUS D'ALTON DI TAMAN NASIONAL ALAS PURWO JAWA TIMUR

    Directory of Open Access Journals (Sweden)

    Yanto Santosa

    2009-12-01

    Full Text Available Population of bulls in the world is decreasing to 80%. On Java and Bali, the habitat of the species has declined by about 20% and 30% respectively (IUCN 2003. In Java, especially in Alas Purwo National Park, the decreasing population of bulls is caused by hunting and degradation of habitat. The estimation of growth bulls population in APNP is increase. The size of population in the beginning is 588 individuals the rate of growth is 0.093 and carrying capacity of habitat is 4772 individuals. The population will reach the carrying capacity by the year of 2126. The pattern of spatial distribution of bulls in APNP based on analysis of chi-square test is grouped (2hit>220.025. The pattern of distribution in low-land forest and platation forest is randomized (20.9752hit20.025, meanwhile it is grouped in coastal forest ecosystem. The pattern of distribution in each type of ecoystem is influenced by the factor of resources (feedings, water, and salty water and predation factor

  19. Diferenças sazonais no padrão endócrino e ovariano do ciclo estral de novilhas Bos taurus indicus (Nelore

    Directory of Open Access Journals (Sweden)

    Anivaldo Olivio Corte Junior

    2012-02-01

    Full Text Available Ciclos estrais em oito novilhas Nelore foram acompanhados durante diferentes estações (outono n=11; inverno n=8; primavera n=9; verão n=9 com contagem e diâmetro de folículos ≥ 3 mm diariamente, com colheitas de sangue a cada 12 h para LH e P4, e a cada 3 h para o pico de LH. Cinco novilhas ovariectomizadas receberam 17β estradiol (2μg/kg em cada estação, com colheitas de sangue a cada 3 h para quantificar LH. A diferença percentual (Δ% do peso entre os meses não variou entre as estações. Durante o ciclo estral, a concentração de P4 (média e máxima foi maior (p<0,01, e o número de folículos menor (p<0,01, no outono e verão, se comparados ao inverno e primavera. No inverno houve mais ciclos com três ondas e no verão somente ciclos com duas ondas foliculares (p<0,01. Como as características da secreção de LH não foram diferentes apesar da variação na concentração de P4, e como houve correlação negativa entre os valores máximos de P4 e a variação percentual (Δ% diária no fotoperíodo (p<0,01; r= -0,45, supõe-se que haja variação sazonal na sensibilidade das células luteínicas ao LH. Nas novilhas ovariectomizadas, a concentração basal (sem estradiol circanual de LH foi menor no verão (p=0,02, assim como a sua secreção em resposta ao estradiol (p<0,01, o que permite supor que também haja uma variação sazonal na sensibilidade hipotalâmica ao estradiol. De acordo com o presente experimento, há indícios de sazonalidade reprodutiva em novilhas Nelore.

  20. Frecuencia relativa de Boophilus microplus (Acari: Ixodidae en bovinos (Bos taurus y B. indicus en ocho zonas ecológicas de Costa Rica

    Directory of Open Access Journals (Sweden)

    V. Alvarez

    2003-06-01

    Full Text Available El estudio sobre la abundancia relativa de Boophilus microplus se realizó en diez fincas, distribuidas en ocho zonas ecológicas (ZE y dos regímenes pluviales de Costa Rica. Se efectuaron visitas mensuales para recolectar garrapatas mayores de 4.5 mm del lado derecho de los animales. El número total de garrapatas se multiplicaba por dos y se dividía entre el total de animales muestreados durante la visita para determinar el promedio de garrapatas por finca. Se trató de adecuar la visita a la finca al baño de los animales para permitir la recuperación de la población de garrapatas. Se detectó B. microplus en todas las fincas muestreadas, a lo largo del año. Se hicieron análisis estadísticos de comparación de medias y no se encontraron diferencias entre ZE, fincas o épocas del año. Por el contrario, si hubo diferencias estadísticamente significativas entre los regímenes pluviales. El régimen pluvial 1, con estacionalidad de lluvias presentó mayores infestaciones de garrapatas (p = 0.03. Se nota una situación de isotermia y de poca variabilidad en cuanto a la humedad relativa en algunas de las zonas en estudio. La intensidad de los baños fue bastante inferior a otros estudios realizados en el pasado. Pese a que no se encontraron diferencias entre sistemas de producción, se hace énfasis en que las intensidades de baño fueron mayores en una finca de ganado europeo, en comparación con otra de la misma ZE, pero de ganado cruzado. Se recomienda el sistema de eliminación manual de garrapatas en las fincas de doble propósito y lechería especializada con cargas no mayores de 30-35 animales, como un sistema alternativo viable para reducir, de manera considerable, la aplicación de ixodicidas y con ello se logran una serie de ventajas importantes.The research on the relative abundancy of Boophilus microplus took place in ten farms, distributed in eight ecological zones (EZ and two rainfall systems of Costa Rica. Monthly visits were made to pick up ticks larger than 4mm from the right side of the animals. The total number of ticks was increased by two and divided between the total of sampled bovines per farm. Farm visits were adjusted to animals bath to allow the recovery of the tick population. B. microplus was detected in all sampled farms throughout the year. Media comparison statistic analyses were made and no differences were found among EZ, farms and seasons. On the contrary, there were important statistical differences between rainfall systems. The rainfall system 1, that included rain seasonality, showed larger tick infestations (p = 0.03. An isothermal and low variability regarding relative humidity situations were present in some of the areas included in this research. Bath intensity was lower to other past studies. Eventhough no differences were found between production systems, it is important to emphasize that bath intensity was higher in european cattle farms, in comparison to others of the same EZ, but of crossbred. A tick manual removable system was recommended in dual-purpose and specialized dairy farms with no more than 30-35 animals, as an alternative feasible system that significantly reduced acaricide use.

  1. Preovulatory follicle diameter, growth rate and time of ovulation during induced oestrus using a CIDR® in trypanotolerant female Bos taurus N'Dama cattle.

    Science.gov (United States)

    Okouyi, M'foumou W'otari Marcel; Drion, Pierre-Vincent; Hanzen, Christian

    2015-12-01

    The aim of this study was to assess the dose (300 to 600 IU) effects of equine chorionic gonadotropin (eCG) on the preovulatory follicle diameter, growth rate and time of ovulation characterized by echography. The eCG was injected at the end (D0) of the 7-day treatment with a controlled internal device release (CIDR®) and a PGF2α being injected 2 days before the removal of the CIDR® (d-2). The 120 N'Dama female were distributed into five experimental groups. The control group (n = 26) was treated with physiological saline at the removal of the CIDR®, while the animals in the four treated groups received, respectively, 300 IU (n = 25), 400 IU (n = 24), 500 IU (n = 22) and 600 IU (n = 23) of eCG. The diameter of the preovulatory follicle was significantly higher (P < 0.05) in the animals treated with 300 IU (10.1 ± 1.4 mm) than in untreated animals (9.3 ± 1.2 mm). Follicle growth rate was significantly (P < 0.05) higher in treated animals (1.0 ± 0.4 mm/day) than in the control group (0.9 ± 0.4 mm/day). The average interval between the time of eCG injection and ovulation was similar in the non-treated (83.7 ± 14.4 h) and treated animals (79.7 ± 11.9). Treated animals showed a significant increase in the percentage of ovulation (94.7 % compared to 73.1 %) (P < 0.01). Use of eCG contributed towards synchronising the time of ovulation between 72 to 96 h, which would facilitate the use of systematic insemination.

  2. Ontwikkelingen in vraag en aanbod van rondhout in Nederland en aangrenzend gebied en mogelijke knelpunten en kansen voor de bos- en houtsector in de periode 2005 - 2025

    NARCIS (Netherlands)

    Oosterbaan, A.; Berg, van den C.A.; Schelhaas, M.J.

    2007-01-01

    In opdracht van het Ministerie voor LNV is een verkennende studie uitgevoerd naar de vraag en het aanbod van rondhout in de komende 20 jaar in ons land en het aangrenzende gebied van België, Nordrhein Westfalen en Niedersachsen. Als eerste stap is gekeken naar ontwikkelingen in vraag en aanbod

  3. Serotyping of foot and mouth disease virus and Pasteurella multocida from Indian gaurs (Bos gaurus), concurrently infected with foot and mouth disease and haemorrhagic septicaemia.

    Science.gov (United States)

    Chandranaik, Basavegowdanadoddi Marinaik; Hegde, Raveendra; Shivashankar, Beechagondahalli Papanna; Giridhar, Papanna; Muniyellappa, Handenahally Kaverappa; Kalge, Rajeshwar; Sumathi, Benamanahalli Raju; Nithinprabhu, Kumble; Chandrashekara, Narasimhaiah; Manjunatha, Venkataramanappa; Jaisingh, Nirupama; Mayanna, Asha; Chandrakala, Gowda Kallenahalli; Kanaka, Sermaraja; Venkatesha, Mudalagiri Dasappagupta

    2015-06-01

    We report the serotyping of foot-and-mouth disease virus (FMDV) and Pasteurella multocida from Indian gaurs which were concurrently infected with foot-and-mouth disease (FMD) and haemorrhagic septicaemia. Bannerghatta biological park (BBP), a national park located in the outskirts of Bengaluru city, Karnataka, India, is bordered by several villages. These villages witnessed massive outbreaks of FMD which spread rapidly to the herbivores at BBP. Post-mortem was conducted on carcasses of two Indian gaurs that died with symptoms of FMD. The salient gross findings included extensive vesicular lesions on the tongue, gums, cheeks, upper palate and hooves. Haemorrhagic tracheitis and ecchymotic haemorrhages on the heart were characteristic. The vesicular lesions of oral cavity were positive for 'O' type of FMD virus by sandwich enzyme-linked immuno sorbent assay (ELISA). The heart blood and spleen samples yielded growth of pure cultures of P. multocida. The isolates were typed as P. multocida type B using KTSP61 and KTT72 primers yielding specific amplicons of 620 bp. The phylogenetic analysis of the isolates was carried by sequencing of 1.4-Kbp nucleotides on the 16S ribosomal RNA (rRNA) gene of the isolates.

  4. Sequence diversity between class I MHC loci of African native and introduced Bos taurus cattle in Theileria parva endemic regions

    DEFF Research Database (Denmark)

    Obara, Isaiah; Nielsen, Morten; Jeschek, Marie

    2016-01-01

    There is strong evidence that the immunity induced by live vaccination for control of the protozoan parasite Theileria parva is mediated by class I MHC-restricted CD8+ T cells directed against the schizont stage of the parasite that infects bovine lymphocytes. The functional competency of class I...

  5. The Behavioural Responses of Beef Cattle (Bos taurus to Declining Pasture Availability and the Use of GNSS Technology to Determine Grazing Preference

    Directory of Open Access Journals (Sweden)

    Jaime Manning

    2017-05-01

    Full Text Available Combining technologies for monitoring spatial behaviour of livestock with technologies that monitor pasture availability, offers the opportunity to improve the management and welfare of extensively produced beef cattle. The aims of the study were to investigate changes to beef cattle behaviour as pasture availability changed, and to determine whether Global Navigation Satellite System (GNSS technology could determine livestock grazing preference and hence improve pasture management and paddock utilisation. Data derived from GNSS collars included distance travelled and location in the paddock. The latter enabled investigation of individual animal interactions with the underlying Normalised Difference Vegetation Index (NDVI and pasture biomass of the paddock. As expected, there was a significant temporal decrease in NDVI during the study and an increase in distance travelled by cattle (P < 0.001; r2 = 0.88. The proportion of time budget occupied in grazing behaviour also increased (P < 0.001; r2 = 0.71. Cattle showed a partial preference for areas of higher pasture biomass/NDVI, although there was a large amount of variation over the course of the study. In conclusion, cattle behaviour changed in response to declining NDVI, highlighting how technologies that monitor these two variables may be used in the future as management tools to assist producers better manage cattle, to manipulate grazing intensity and paddock utilisation.

  6. Associations between novel single nucleotide polymorphisms in the Bos taurus growth hormone gene and performance traits in Holstein-Friesian dairy cattle.

    Science.gov (United States)

    Mullen, M P; Berry, D P; Howard, D J; Diskin, M G; Lynch, C O; Berkowicz, E W; Magee, D A; MacHugh, D E; Waters, S M

    2010-12-01

    Growth hormone, produced in the anterior pituitary gland, stimulates the release of insulin-like growth factor-I from the liver and is of critical importance in the control of nutrient utilization and partitioning for lactogenesis, fertility, growth, and development in cattle. The aim of this study was to discover novel polymorphisms in the bovine growth hormone gene (GH1) and to quantify their association with performance using estimates of genetic merit on 848 Holstein-Friesian AI (artificial insemination) dairy sires. Associations with previously reported polymorphisms in the bovine GH1 gene were also undertaken. A total of 38 novel single nucleotide polymorphisms (SNP) were identified across a panel of 22 beef and dairy cattle by sequence analysis of the 5' promoter, intronic, exonic, and 3' regulatory regions, encompassing approximately 7 kb of the GH1 gene. Following multiple regression analysis on all SNP, associations were identified between 11 SNP (2 novel and 9 previously identified) and milk fat and protein yield, milk composition, somatic cell score, survival, body condition score, and body size. The G allele of a previously identified SNP in exon 5 at position 2141 of the GH1 sequence, resulting in a nonsynonymous substitution, was associated with decreased milk protein yield. The C allele of a novel SNP, GH32, was associated with inferior carcass conformation. In addition, the T allele of a previously characterized SNP, GH35, was associated with decreased survival. Both GH24 (novel) and GH35 were independently associated with somatic cell count, and 3 SNP, GH21, 2291, and GH35, were independently associated with body depth. Furthermore, 2 SNP, GH24 and GH63, were independently associated with carcass fat. Results of this study further demonstrate the multifaceted influences of GH1 on milk production, fertility, and growth-related traits in cattle. Copyright © 2010 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  7. Effects of GHRP-2 and Cysteamine Administration on Growth Performance, Somatotropic Axis Hormone and Muscle Protein Deposition in Yaks (Bos grunniens) with Growth Retardation.

    Science.gov (United States)

    Hu, Rui; Wang, Zhisheng; Peng, Quanhui; Zou, Huawei; Wang, Hongze; Yu, Xiaoqiang; Jing, Xiaoping; Wang, Yixin; Cao, Binghai; Bao, Shanke; Zhang, Wenhua; Zhao, Suonan; Ji, Hanzhong; Kong, Xiangying; Niu, Quanxi

    2016-01-01

    The objective of this study was to investigate the effects of growth hormone-releasing peptide-2 (GHRP-2) and cysteamine (CS) administration on growth performance in yaks with growth retardation and try to elucidate its regulatory mechanisms. Trial 1, thirty-six 1-year-old Qinghai high plateau yaks (body weight 38-83.2 kg) were randomly chosen for body weight and jugular blood samples collection. The relationship between body weight and serum GHRH (P growth retardation (average body weight 54.8 ± 8.24 kg) were randomly selected and assigned to negative control group (NG), GHRP-2 injection group (GG) and cysteamine feeding group (CG), with 5 yaks per group. Another five 1-year-old Qinghai high plateau yaks with normal growth performance (average body weight 75.3 ± 2.43 kg) were selected as positive control group (PG). The average daily gain (ADG) of the GG and CG were significantly higher than those in the PG and NG (P muscle (Pmuscle (P muscle (Pmuscle atrophy F-box (Atrogin-1) and muscle ring finger 1 (MuRF1) mRNA (P Growth retardation in yaks was primarily due to somatotropic axis hormones secretion deficiency. Both GHRP-2 and CS administration can accelerate growth performance and GH, IGF-1 secretion in yaks with growth retardation. GHRP-2 enhanced muscle protein deposition mainly by up-regulated the protein synthesis pathways, whereas CS worked mainly by down-regulated the ubiquitin-proteasome pathway.

  8. Development of early tissue cysts and associated pathology of Besnoitia besnoiti in a naturally infected bull (Bos taurus) from South Africa.

    Science.gov (United States)

    Dubey, J P; van Wilpe, E; Blignaut, D J C; Schares, G; Williams, J H

    2013-06-01

    Besnoitia besnoiti is an apicomplexan that causes serious economic loss in cattle in many countries and the disease is now spreading in Europe. At least 2 phases of bovine besnoitiosis are recognized clinically. An acute febrile phase characterized by anasarca and necrosis of skin is associated with multiplication of tachyzoites in vascular endothelium; this phase is short-lived and rarely diagnosed. Chronic besnoitiosis characterized by dermal lesions is associated with the presence of macroscopic tissue cysts and is easily diagnosed. Here we report the development of early B. besnoiti tissue cysts in a naturally infected Hugenoot bull from South Africa. Tissue cysts were 10-70 μm in diameter, contained 1-12 bradyzoites, and were most numerous in the dermis, testicles, and pampiniform venous plexus. Amylopectin granules in bradyzoites stained red with periodic acid Schiff (PAS) reaction. Bradyzoites varied in size and in the intensity of PAS reaction (some were PAS-negative), some were plump, and others were slender. With immunohistochemical staining with Besnoitia oryctofelisi and bradyzoite-specific antibodies (BAG-1 made against Toxoplasma gondii bradyzoites), the staining was confined to parasites, and all intracystic organisms were BAG-1 positive. With Gomori's silver stain only bradyzoites were stained very faintly whereas the rest of the tissue cyst was unstained. Ultrastructurally many tissue cysts contained dead bradyzoites and some appeared empty. Unlike bradyzoites from mature cysts, bradyzoites in the present case contained few or no micronemes. These findings are of diagnostic significance. Ultrastructually host cyst cells had features of myofibroblasts, and immunohistochemistry using antibodies against MAC387, lysozyme, vimentin, Von Willebrand factor, and smooth muscle actin confirmed this. Polymerase chain reaction on DNA extracted from lymph node of the bull confirmed B. besnoiti diagnosis. Associated clinical findings, lesions, and histopathology are briefly presented. The bull died of nephrotic syndrome; anasarca in acute besnoitiosis due to protein-losing glomerulopathy is a finding not previously reported in cattle.

  9. Digital infrared thermography of the scrotum, semen quality, serum testosterone levels in Nellore bulls (Bos taurus indicus and their correlation with climatic factors

    Directory of Open Access Journals (Sweden)

    Felipe Rydygier de Ruediger

    2016-02-01

    Full Text Available The objective was to study the relationship of climatic conditions with the temperature of the scrotum surface and sperm quality through digital infrared thermography in Nellore bulls, raised extensively. In six bulls held with scrotal thermography Flir E40® cameras, blood samples for serum testosterone and semen collection were taken by electroejaculation every 10 days, with six replications. Climatic factors: ambient temperature, relative humidity, dry globe temperature and temperature of the wet globe were recorded using a globe thermometer (InstruTemp®, ITWTG-2000. Thermal images of the scrotum were analyzed with the Flir Tools® software for the temperatures of scrotal surface, the right and left sides of the scrotum lap thirds: dorsal, middle and ventral testicles; and tails of the epididymis. The semen data and thermograms were submitted to ANOVA and Tukey’s test at 5%. Pearson correlation was used for the surface temperatures of the scrotum, rectal temperature, quantitative and qualitative characteristics of semen and climatic factors. There was a positive correlation (P<0.05 for sperm motility x scrotal temperatures; sperm concentration x scrotal temperatures; climatic factors x rectal temperature. There was a negative correlation (P<0.05 between ambient temperature x sperm concentration. It was concluded that the temperature of the scrotum surface and climatic factors, temperature and humidity, influence the quality of semen. Thermography is recommended as a supplementary examination for reproductive evaluation of bulls.

  10. Serological survey of bovine brucellosis in Fulani nomadic cattle breeds (Bos indicus) of North-central Nigeria: Potential risk factors and zoonotic implications.

    Science.gov (United States)

    Alhaji, N B; Wungak, Y S; Bertu, W J

    2016-01-01

    A cross sectional study was conducted to investigate seroprevalence and associated risk factors of bovine brucellosis in Fulani nomadic herds in the 3 agro-ecological zones of Niger State, North-central Nigeria between January and August 2013. A total of 672 cattle in 113 herds were screened for Brucella antibodies using Rose Bengal Plate Test (RBPT) and confirmed by Lateral flow Assay (LFA). Data on herd characteristics and zoonotic factors were collected using structured questionnaire administered on Fulani herd owners. Factors associated with Brucella infection were tested using Chi-square test and multivariable logistic model. The overall cattle-level seroprevalence was 1.9% (95% CI: 1.1-3.2) with highest in agro-zone C (3.2%). Herd-level seroprevalence was 9.7% (95% CI: 5.23-16.29) and highest in agro-zone C (13.5%). Sex and agro-ecological zones were significantly (Pbrucellosis occurrence. Inhalation of droplets from milk of infected cows, and drinking raw milk were less likely [OR 0.27; 95% CI: 0.09-0.82 and OR 0.27; 95% CI: 0.08-0.99, respectively] not to predisposed to brucellosis in humans. Eating infected raw meat, and contact with infected placenta were more likely [OR 7.49; 95% CI: 2.06-28.32 and OR 5.74; 95% CI: 1.78-18.47, respectively] to be risks for the disease in humans. These results highlighted the important risk factors for bovine brucellosis in Fulani herds. Thus, brucellosis control programs which take these factors into consideration will be beneficial. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Novel insights into the role of cell-free seminal mRNAs on semen quality and cryotolerance of spermatozoa in bulls (Bos taurus).

    Science.gov (United States)

    Shilpa, Munivenkatappa; Selvaraju, Sellappan; GirishKumar, Venkataswamy; Parthipan, Sivashanmugam; Binsila, Krishnan B; Arangasamy, Arunachalam; Ravindra, Janivara Parameshwaraiah

    2017-11-01

    The aim of the present study was to ascertain the effectiveness of seminal plasma mRNAs as markers to assess the reproductive performance of bulls. Semen samples (33 ejaculates) from 11 bulls were evaluated for sperm kinematic and functional parameters. Total RNA was isolated from cell-free seminal (cfs) using TRIzol LS reagent and the concentration of cfs-RNA was 24.4±2.3µgmL-1 seminal plasma. The cfs-RNA was fragmented to a size of 25-500bp. Of the cfs-mRNAs screened using real time PCR, expression of protamine 1 (PRM1) was positively (P2.5μm and straightness >85%) in raw semen was positively (P<0.05) associated with bone morphogenetic protein 2 (BMP2), ubiquitin conjugating enzyme E2D3 (UBE2D3), tumour-associated necrotic factor-associated death domain (TRADD) and caspase-3 (CASP3) expression. Nerve growth factor (NGF) expression was positively (P<0.05) associated with the maintenance of post-thaw functional membrane integrity in spermatozoa and could be used to assess the cryotolerance of bull semen. In conclusion, the expression of cfs mRNAs can be used to assess the reproductive performance of males and to predict the sensitivity of spermatozoa to cryoinjury.

  12. Heat-tolerant versus heat-sensitive Bos taurus cattle: Influence of air temperature and breed on the metabolic response to a provocative immune challenge

    Science.gov (United States)

    The response of the immune and stress systems have been assessed in response to a lipopolysaccharide (LPS) challenge, yet the role of metabolism in mediating energy requirements during the acute phase response (APR) has not been sufficiently studied. This study tested heat-tolerant and heat-sensitiv...

  13. MALDI-MS lipid profiles of oocytes recovered by ovum pickup from Bos indicus and 1/2 indicus × taurus with high vs low oocyte yields.

    Science.gov (United States)

    Silva-Santos, K C; Ferreira, C R; Santos, G M G; Eberlin, M N; Siloto, L S; Rosa, C O; Marcantonio, T N; Seneda, M M

    2014-10-01

    The aim of the present study was to compare the lipid profile in oocytes of indicus and 1/2 indicus × taurus cows with high and low antral follicle count (AFC)/oocyte yields. After an OPU procedure (D0), antral follicles ≥3 mm were counted by ultrasonography (D4, 19, 34, 49, 64), and cows were assigned to groups with either high AFC (≥30 follicles; indicus, NH group; 1/2 indicus × taurus, AH group) or low AFC (≤15 antral follicles; indicus, NL group; 1/2 indicus × taurus, AL group). The lipid profiles of the oocytes were determined by MALDI-MS. For GI, GII and GIII oocytes, the indicus samples tend to cluster separately from the 1/2 indicus × taurus samples. The lipid species [PC (P-38:5) + H](+) and/or [PC (P-36:2) + Na](+) , [PC (38:2) + H](+) , [PC (38:5) + Na](+) and [TAG (60:8) + NH(4) ](+) were more abundant in indicus (NH and NL groups) than 1/2 indicus × taurus. The higher lipid content in the indicus oocytes likely reflects differences in the rate of lipid metabolism and may contribute to oocyte competence and embryo development. © 2014 Blackwell Verlag GmbH.

  14. Development of early tissue cysts and associated pathology of Besnoitia Besnoiti in a naturally infected bull (Bos Taurus) from South Africa

    Science.gov (United States)

    Besnoiti besnoiti is an apicomplexan that causes serious economic loss in cattle in many countries and the disease is now spreading in Europe. Two phases of bovine besnoitiosis are recognized clinically. An acute febrile phase characterized by anasarca and necrosis of skin is associated with multipl...

  15. The prey pathway: a regional history of cattle (Bos taurus and pig (Sus scrofa domestication in the northern Jordan Valley, Israel.

    Directory of Open Access Journals (Sweden)

    Nimrod Marom

    Full Text Available The faunal assemblage from the 9(th-8(th millennium BP site at Sha'ar Hagolan, Israel, is used to study human interaction with wild suids and cattle in a time period just before the appearance of domesticated animals of these species in the Jordan Valley. Our results, based on demographic and osteometric data, indicate that full domestication of both cattle and suids occurred at the site during the 8(th millennium. Importantly, domestication was preceded in both taxa by demographic and metric population parameters indicating severe overhunting. The possible role of overhunting in shaping the characteristics of domesticated animals and the social infrastructure to ownership of herds is then explored.

  16. Antral follicle populations and embryo production--in vitro and in vivo--of Bos indicus-taurus donors from weaning to yearling ages.

    Science.gov (United States)

    Silva-Santos, K C; Santos, G M G; Koetz Júnior, C; Morotti, F; Siloto, L S; Marcantonio, T N; Urbano, M R; Oliveira, R L; Lima, D C M; Seneda, M M

    2014-04-01

    Interest in indicus-taurus cattle has been increasing, as these animals are likely to present the best characteristics of Zebu and European bovine breeds. The aim of this study was to compare the embryo production of indicus-taurus donors with high vs low antral follicle counts obtained by ovum pickup/in vitro production (OPU/IVP) and superovulation (SOV)/embryo collection. Braford females at weaning age (3/8 Nelore × 5/8 Hereford, n = 137, 9 ± 1 month old) were subjected to six serial ovarian ultrasonographs and were assigned to two groups according to the number of antral follicles ≥ 3 mm as follows: G-High antral follicular count (AFC, n = 20, mean ≥ 40 follicles) and G-Low AFC (n = 20, mean ≤ 10 follicles). When the females (n = 40) reached 24 months of age, they were subjected to both OPU/IVP and SOV/embryo collection. The average number of follicles remained highly stable throughout all of the ultrasound evaluations (range 0.90-0.92). The mean number of COCs recovered (36.90 ± 13.68 vs 5.80 ± 3.40) was higher (p taurus females. © 2014 Blackwell Verlag GmbH.

  17. Molecular differentiation of Sarcocystis buffalonis and Sarcocystis levinei in water buffaloes (Bubalus bubalis) from Sarcocystis hirsuta and Sarcocystis cruzi in cattle (Bos taurus).

    Science.gov (United States)

    Gjerde, Bjørn; Hilali, Mosaad; Abbas, Ibrahim E

    2016-06-01

    The purpose of the present study was to obtain sarcocysts of Sarcocystis buffalonis and Sarcocystis levinei from water buffaloes and characterize the isolates by molecular methods in order to determine whether the two species were genetically different from Sarcocystis hirsuta and Sarcocystis cruzi, respectively, from cattle, which had been characterized before. About 35 macroscopically visible (3-4 × 1-2 mm) and 20 barely visible (1-3 × 0.2 mm) sarcocysts were excised from the esophagus of 18 naturally infected and freshly slaughtered adult water buffaloes at three slaughterhouses in Egypt. Genomic DNA was extracted from the sarcocysts, and all isolates were first characterized at the mitochondrial cytochrome c oxidase subunit I gene (cox1) gene through PCR amplification and direct sequencing. Selected isolates were subsequently further characterized at the 18S and 28S ribosomal (r) RNA genes and the internal transcribed spacer 1 (ITS1) region of the nuclear rDNA unit by direct sequencing or cloning. Only six of the isolated macroscopic sarcocysts belonged to S. buffalonis, whereas the others belonged to Sarcocystis fusiformis. Twelve of the smaller cysts belonged to S. levinei and seven to Sarcocystis sinensis. The characterization of the sarcocysts of S. sinensis and some of the sarcocysts of S. fusiformis have been reported before. Fifteen additional sarcocyst isolates of S. fusiformis were characterized at cox1 in the present study and found to be identical or closely similar to previous isolates. At cox1, the sequence identity between the six isolates of S. buffalonis was 99.8-100 % (two haplotypes), whereas the identity between the 12 isolates of S. levinei was 99.0-100 % (10 haplotypes). The identity between cox1 sequences of S. buffalonis and S. hirsuta (n = 56) was 92.9-93.6 % (on average 93.4 %), and the identity between cox1 sequences of S. levinei and S. cruzi (n = 22) was 92.9-94.0 % (on average 93.5 %). The phylogenetic analyses placed with high support the cox1 sequences of S. buffalonis and S. hirsuta into two monophyletic sister groups, and the same was true for the cox1 sequences of S. levinei and S. cruzi. Hence, the study established that S. buffalonis and S. levinei are distinct species different from S. hirsuta and S. cruzi, respectively. Nucleotide sequences of S. buffalonis could be distinguished from those of S. hirsuta also at the 28S rRNA gene (clearly different) and the ITS1 region (small and uncertain difference) but not at the 18S rRNA gene. Sequences of S. levinei could be distinguished from those of S. cruzi both at the 18S and 28S rRNA genes (ITS1 region not examined). However, the cox1 gene was superior to the 18S and 28S rRNA genes as regards the ability to unambiguously delimit the species within each species pair, since at the latter markers, the number of consistent nucleotide differences between the species was low and there was a slight overlap between the intraspecific and interspecific sequence divergence. Comparison of the newly generated 18S rRNA gene sequences of S. levinei from water buffaloes with similar sequences deposited in GenBank suggested that S. levinei and S. cruzi are not strictly intermediate host specific but might occasionally infect cattle and water buffaloes, respectively.

  18. Molecular characterization of Trypanosoma spp. infecting cattle (Bos taurus), white-tailed deer (Odocoileus virginianus), and elk (Cervus elaphus canadensis) in the United States

    Science.gov (United States)

    The benign trypanosomes of cattle and wild ungulates in the United States are designated Trypanosoma theileri and Trypanosoma cervi, respectively. Historically these parasites have been identified based on morphology, host, and vector, if known. No molecular characterization has been reported for T....

  19. Protocolos de inseminación artificial a tiempo fijo en vacas (Bos indicus en el trópico bajo

    Directory of Open Access Journals (Sweden)

    Andrés M. Sanabria-V.

    2011-02-01

    Full Text Available En una hacienda de clima tropical bajo, se evalula  respuesta  a  tres  programas de  Inseminación Artificial a Tiempo Fijo (IATF en 30 vacas vacías cebú  comercial, cíclicas,  con buena  condición corporal,  seleccionadas por  palpación  rectal  ydistribuidas al azar en  tres grupos de 10 vacas cada uno. A  éstos  se  les  asignó  un  protocolo  de sincronización de celos y ovulación diferente. En el grupo 1 se utilizó un dispositivo  intravaginal impregnado con progesterona;  las vacas del grupo 2 recibieron un  implante auricular  impregnado de Norgestomet  y  en  el  grupo  3  se  realizó  el protocolo de Ovsynch. Se diagnosticó la preñez mediante ultrasonografía, 30 días después de la inseminación en  los  tratamientos y  los datos  fueron analizados mediante  estadística descriptiva  con variables  de  tipo  cuantitativo.  Los  resultados obtenidos para el grupo 1, fueron 4 de 10 vacas preñadas, en el grupo 2, 6 de 10 vacas preñadas y en  el  grupo  3, 3  de 10  vacas. Se  encontraron diferencias  significativas  entre  las  vacas  que recibieron  el  implante  auricular,  así  como  a aquellas  vacas que  se  les hizo  el protocolo de Ovsynch,  pero  no  se  encontraron  diferencias significativas  entre  el  dispositivo  intravaginal impregnado con progesterona,  respecto de  los dos restantes. El valor más económico por preñez se obtuvo  con  la  utilización  del  protocolo  de Ovsynch; sin embargo, en  términos de eficiencia,fue mejor usar el implante auricular impregnado de  Norgestomet;  esto  por  razones  de mejoramiento  genético.  De  esta  forma  se concluyó que el protocolo del implante auricular con Norgestomet  tuvo una superior  tasa de preñez,sin que  esto  sea  una  constante,  debido  a  que  existen diferentes  factores que hacen variar  los resultados de la IATF.

  20. Fast, accurate and automatic ancient nucleosome and methylation maps with epiPALEOMIX

    DEFF Research Database (Denmark)

    Hanghøj, Kristian; Seguin, Andaine; Schubert, Mikkel

    2016-01-01

    , equids and aurochs, we investigate the temporal, geographical and preservation range of ancient epigenetic signatures. We first assess the quality of inferred ancient epigenetic signatures within well-characterized genomic regions. We find that tissue-specific methylation signatures can be obtained...

  1. The first appearance of cattle in Denmark occurred 6000 years ago: an effect of cultural or climate and environmental changes

    DEFF Research Database (Denmark)

    Noe-Nygaard, Nanna; Hede, Mikkel Ulfeldt

    2006-01-01

    Stable carbon and nitrogen isotope ratios from bones of contemporaneous Late Atlantic aurochs and early cattle in eastern Denmark are significantly different and provide information on the origin and feeding strategies of the earliest domestic cattle. The data show that the early cattle were feed...

  2. Avaliação da taxa de concepção de novilhas e vacas (Bos taurus x Bos indicus) com o uso de sêmen sexado na inseminação artificial ou embriões produzidos in vivo e in vitro

    OpenAIRE

    Peres, Anelise Ribeiro [UNESP

    2014-01-01

    The reproduction biotechnologies are used as an alternative to improve reproductive efficiency and accelerate the production of animals of high performance zootechnical. This study aimed to evaluate the conception rate of heifers and cows crossbred inseminated with sexed semen and conventional (Experiment 1) and conception rate of heifers and cows crossbred receiving the transfer of embryos produced in vivo (TE) and in vitro (PIVE) with sexed semen (Experiment 2). In experiment 1, sexed and c...

  3. Molecular approach of the fragile chromosomal region Xq31-34 in cattle (Bos taurus by microdissection and DOP-PCR Aproximação molecular da região cromossômica frágil Xq31-34 em bovinos (Bos taurus utilizando microdissecação cromossômica e DOP-PCR

    Directory of Open Access Journals (Sweden)

    S. Llambí

    2008-08-01

    Full Text Available Fragile sites (FS are chromosomal regions where the normal compactation of chromatine is not observed. FRAXA (Fra Xq27.3, X sexual chromosome is one of the most studied FS in humans. FRAXA is an expansion of the trinucleotide CGG located in the gene FMR-1. In cattle, sites of chromosomal fragility were reported in BTAX, associated with different pathologies and fertility impairment. Chromosomal microdissection has became a valuable tool for isolating chromatine fragments. In this work, it was combined the chromosomal microdissection technique with DOP-PCR in order to carry out a molecular analysis of the fragile chromosomal region BTAXq31-34. In that region, polymorphic DNA-RAPD sequences (GC rich are present and sequences of the gene FMR-1 are missing. The results showed the usefulness of the microdissection-DOP-PCR technique for molecular characterization of fragile chromosomal sites in cattle.Os sítios frágeis (FS são regiões de cromossomo onde a compactação normal da cromatina não é realizada. O FRAXA (Fra Xq27.3, cromossomo sexual X é um dos FS mais estudados em seres humanos. O FRAXA apresenta expansão do trinucleotídeo CGG localizado no gene FMR-1. Em bovinos, existem estudos informando sobre fragilidade cromossômica em BTAX associada com diversas patologias e alterações na fertilidade. A microdissecação cromossômica é uma valiosa técnica para isolar fragmentos de cromatina. Neste trabalho, combinou-se a técnica de microdissecação de cromossomo com DOP-PCR para executar a análise molecular da região do sitio frágil cromossômico BTAXq31-34. Naquela região estão presentes seqüências do polimorfo DNA-RAPD (rico em GC, em que as seqüências do gene FMR-1 estão ausentes. Os resultados mostram a utilidade da técnica de microdissecação-DOP-PCR para a caracterização molecular de sítios frágeis cromossômicos em bovinos.

  4. Hemograma de bovinos (Bos indicus sadios da raça nelore no primeiro mês de vida, criados no estado de São Paulo Hemogram of healthy nelore breed (Bos indicus calf at the first month of life, raised in São Paulo state, Brazil

    Directory of Open Access Journals (Sweden)

    Alexander Welker Biondo

    1998-06-01

    Full Text Available Avaliou-se as mudanças nos constituintes do hemograma de bovinos da raça Nelore, 71 machos e 56 fêmeas, no primeiro mês de vida, criados no Estado de São Paulo. Foram utilizadas 127 amostras de sangue de bezerros criados a pasto, divididos em cinco grupos: de 0-3, 3-7, 7-14 , 14-21 e 21-30 dias de idade. Os valores médios encontrados foram: número de hemácias 8,31 ± l,84 x 10(6/ mi l; Volume globular 39 ± 6%; taxa de hemoglobina 12,89 ± 2,04g/dl; Volume Corpuscular Médio 48,19 ± 5,68fl; Concentração de Hemoglobina Corpuscular Média 32,81 ± 1,84; reticulócitos 0,27 ± 0,54% e eritroblastos 214 ± 594/mil; número de leucócitos/mil 10593 ± 3008, neutrófilos bastonetes 97 ± 165; neutrófilos segmentados 4837 ± 2201; linfócitos 5222 ± 1909; eosinófilos 86 ± 139; monócitos 346 ± 221; basófilos 4 ± 24. Os fatores sexuais não apresentaram influência significativa sobre o hemograma, com exceção dos reticulócitos e eritroblastos. Os fatores etários apresentaram influência significativa (p≤0,03 sobre as curvas de regressão do hemograma, com o volume globular, hemácias e hemoglobina diminuindo e o CHCM e reticulócitos aumentando até os 3 a 7 dias, havendo uma inversão desta variação dos sete até os 30 dias. A curva de regressão do percentual de linfócitos aumentou e de neutrófilos diminuiu gradativamente após o nascimento. O encontro destas curvas ocorreu entre o sétimo e o décimo quarto dia de vida.Changes on the hemogram parameters were evaluated for healthy Nelore purebreed bovines at the first month age, with 71 male and 56 female, and raised in São Paulo State, Brazil. For this purpose, 127 samples of blood were collected, and divided in five groups ; 0-3 , 3-7 . 7-14 , 14-21 and 21-30 days of age. The mean values were: erithrocyte counts 8.31± 1.84 x 10(6/ mu l; Package Cell Volume 39 ± 6%: hemoglobin 12.89 ± 2.04g/dl; Mean Corpuscular Volume 48.19 ± 5.68fl; Mean Corpuscular Hemoglobin Concentration 32.81 ± 1.84 ; Reticulocytes 0.27 ± 0.54%; erythroblast 214 ± 594/mul; leukocytes (mu l: 10593 ± 3008; band neutrophils 97 ± 165; segmented neutrophils 4837 ± 2201; lymphocytes 5222 ± 1909; eosinophils 86 ± 139: monocytes 346 ± 221; basophils 3 ± 24. Sex had no influencing the hemogram values except to reticulocytes and erythroblast that were higher in females. Age significantly influenced the leucogram and eritrogram values (p≤0.0 3. The Package Cell Volume, erythrocytes, and hemoglobin decreasing and the Mean Corpuscular Hemoglobin Concentration and reticulocytes increasing until the thirth to seventh days. There was an subsequent inversion of this variation in this period until the thirtieth day. The lymphocyte percentage regression curve increasing and neutrophils decreasing after birth. The intersection between the two leukocytes curves occurred between the seventh and the fourteenth day of life.

  5. EFEITO DE UM PROBIÓTICO NO PERÍMETRO ESCROTAL E ESPERMIOGRAMA EM TOUROS JOVENS TABAPUÃ (Bos taurus indicus (Nota Científica EFFECT OF ONE PROBIOTIC ON SCROTAL PERIMETER AND SPERMIOGRAM IN YOUNG TABAPUA BULLS (Bos taurus indicus

    Directory of Open Access Journals (Sweden)

    Valéria da Silva Gandolfo

    2009-04-01

    Full Text Available

    Neste experimento avaliou-se o efeito do probiótico Proenzime® no perímetro escrotal e espermiograma em touros jovens Tabapuã. Duas colheitas de sêmen de 21 touros Tabapuã, com trinta meses de idade, foram realizadas nos dias zero (D0 e 120 (D120 por eletroejaculação, totalizando 42 amostras. Dividiram-se os touros em grupo-controle (GC com dez animais e grupo tratado (GT com onze animais. Os touros do GT receberam 4g de probiótico/animal/dia, durante 120 dias. Houve diferença (p<0,01 entre as colheitas (D0 e D120 nos grupos GC e GT para o perímetro escrotal (GC – D0: 30,50 cm e D120: 33,55 cm; GT – D0: 29,90 cm e D120: 34,30 cm. Houve diferença (p<0,05 entre colheitas (D0 e D120 nos grupos GC e GT, respectivamente, para: defeitos menores (GC – D0: 13,84 % e D120: 21,79%; GT – D0: 14,99% e D120: 20,84% e defeitos totais (GC – D0: 22,29% e D120: 29,24%; GT – D0: 25,14% e D120: 32,81%. Os resultados demonstram que, entre grupos, não houve alteração significativa das características seminais e perímetro escrotal.
       
    PALAVRAS-CHAVES: Aditivo, nutrição, sêmen, touro.

    PALAVRAS-CHAVE: Touro, sêmen, nutrição, aditivo.    The objective of this experiment was to evaluate the effect of the probiotic Proenzime® on scrotal perimeter and spermiogram in young Tabapua bulls. Two samples of semen from 21 Tabapua bulls, aging 30 months, were collected in day zero (D0 and 120 (D120 by electroejaculation, totalizing 42 samples. The bulls were divided in control group (CG with 10 animals and trated group (TG with 11 animals. The bulls of TG received 4g of probiotic/animal/day, during 120 days. There was difference (p<0.01 between collects (D0 and D120 in the groups CG and TG for scrotal perimeter (CG – D0: 30.50 cm and D120: 33.55 cm; TG – D0: 29.90 cm and D120: 34.30 cm. There was difference (p<0.05 between collects (D0 and D120 in the groups CG and TG, respectively. Minor defects (CG – D0: 13.84% and D120: 21.79%; TG – D0: 14.99% and D120: 20.84% and total defects (CG – D0: 22.29% and D120: 29.24%; TG – D0: 25.14% and D120: 32.81%. The results exposed allow concluding that significant alterations were not observed between groups for the seminal characteristics and scrotal perimeter.   

    KEY WORDS: Aditive, bull, nutrition, semen.

  6. Optical-flow-based background-oriented schlieren technique for measuring a laser-induced underwater shock wave

    CERN Document Server

    Hayasaka, Keisuke; Liu, Tianshu; Kameda, Masaharu

    2016-01-01

    The background-oriented schlieren (BOS) technique with the physics-based optical flow method (OF-BOS) is developed for measuring the pressure field of a laser-induced underwater shock wave. Compared to BOS with the conventional cross-correlation method in PIV (called PIV-BOS), by using the OF-BOS, the displacement field generated by the small density gradient in water can be obtained at the spatial resolution of one vector per pixel. The corresponding density and pressure fields can be further extracted. It is particularly demonstrated that the sufficiently high spatial resolution of the extracted displacement vector field is required in the tomographic reconstruction to correctly infer the pressure field of the spherical underwater shock wave. The capability of the OF-BOS is critically evaluated based on synchronized hydrophone measurements. Special emphasis is placed on direct comparison between the OF-BOS with the PIV-BOS.

  7. Test report on the Abacus 30 kW bimode{reg_sign} inverter and maximum power tracker (MPT)

    Energy Technology Data Exchange (ETDEWEB)

    Bonn, R.; Ginn, J.; Zirzow, J. [and others

    1995-06-01

    Sandia National Laboratories conducts the photovoltaic balance of systems (BOS) program, which is sponsored by the US Department of Energy`s Office of Energy Management. Under this program, SNL lets commercialization contracts and conducts a laboratory program designed to advance BOS technology, improve BOS component reliability, and reduce the BOS life-cycle-cost. This report details the testing of the first large US manufactured hybrid inverter and its associated maximum power tracker.

  8. UCP Mainport : kontseptuaalne uurimus Utrechti raudteejaama maa-ala arendamiseks = UCP Mainport : concept study redevelopment station area Utrecht

    Index Scriptorium Estoniae

    2000-01-01

    Mainporti projekti arhitekt Ben van Berkel, projekteerijad: Van Berkel & Bos, Holland Railconsult. Projekti II etapis uuriti Hoog Catherijne ostukeskuse laiendamist. Projekteerijad: Van Berkel & Bos, Neutelings & Riedijk, Alsop & Störmer.Van Berkel & Bos (arhitektibüroo, Holland). Holland Railconsult (projekteerimisbüroo, Utrecht). Alsop & Störmer (arhitektibüroo, London). Neutelings & Riedijk (arhitektibüroo, Rotterdam)

  9. Two-Dimensional Protein Pattern Recognition in Chemical Toxicity

    Science.gov (United States)

    1994-04-20

    VIRUS (SUBTYPE AYW). 5 HBB_BOVIN HEMOGLOBIN BETA CHAIN. - BOS TAURUS (BOVINE). 6 HBBABOSJA HEMOGLOBIN BETA-A CHAIN. - BOS JAVANICUS (WILD BANTENG ). 7...HEMOGLOBIN BETA-A CHAIN. - BOS JAVANICUS (WILD BANTENG ). MW START END SEQ 4244 NO MATCH 2980 NO MATCH 2376 NO MATCH 2090 40 58 FFESFGDLSTADAVMNNPK 1840 NO

  10. NCBI nr-aa BLAST: CBRC-FCAT-01-0063 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-0063 ref|NP_001015581.1| chemokine binding protein 2 [Bos taurus] gb|AAX46341.1| chemokine bi...nding protein 2 [Bos taurus] gb|AAX46675.1| chemokine binding protein 2 [Bos taurus] NP_001015581.1 2e-49 86% ...

  11. The Practicality of Behavioral Observation Scales, Behavioral Expectation Scales, and Trait Scales.

    Science.gov (United States)

    Wiersma, Uco; Latham, Gary P.

    1986-01-01

    The practicality of three appraisal instruments was measured in terms of user preference, namely, behavioral observation scales (BOS), behavioral expectation scales (BES), and trait scales. In all instances, BOS were preferred to BES, and in all but two instances, BOS were viewed as superior to trait scales. (Author/ABB)

  12. The prevalence and impact of post traumatic stress disorder and burnout syndrome in nurses.

    Science.gov (United States)

    Mealer, Meredith; Burnham, Ellen L; Goode, Colleen J; Rothbaum, Barbara; Moss, Marc

    2009-01-01

    To determine whether post traumatic stress disorder (PTSD) and burnout syndrome (BOS) are common in nurses, and whether the co-existence of PTSD and BOS is associated with altered perceptions of work and nonwork-related activities. University hospital nurses were administered four validated psychological questionnaires. The response rate was 41% (332/810). Twenty two percent (73/332) had symptoms of PTSD, 18% (61/332) met diagnostic criteria for PTSD, and 86% (277/323) met criteria for BOS. Ninety eight percent (59/60) of those fulfilling diagnostic criteria for PTSD were positive for BOS. When grouped into three categories: positive for PTSD and BOS (n=59), positive for BOS and negative for PTSD (n=217), and negative for both BOS and PTSD (n=46), there were significant differences in the years of employment as a nurse (Pnursing care (P=.006), confidence in physicians (P=.01), and perception that their work impacted patient outcomes (P=.01). Nurses with BOS and PTSD were significantly more likely to have difficulty in their life outside of the work environment when compared to those with BOS alone. We identified that PTSD and BOS are common in nurses and those with PTSD will almost uniformly have symptoms of BOS. Co-existence of PTSD and BOS has a dramatic effect on work and nonwork related activities and perceptions.

  13. Kiezen van Nederlandsche Elephantidae, aanwezig in het Rijksmuseum van Geologie en Mineralogie

    NARCIS (Netherlands)

    Zonneveld, J.I.S.

    1942-01-01

    In this paper we described the molar teeth of E. primigenius found in our country and stored in the Rijksmuseum van Geologie en Mineralogie at Leyden. Special attention is paid to the individual age of the animals at the moment when the grinders were rendered inoparative. As a rule this must have

  14. Results of the CERPOLEX/Mammuthus Expeditions on the Taimyr Peninsula, Arctic Siberia, Russian Federation

    NARCIS (Netherlands)

    Mol, D.; Tikhonov, A.; van der Plicht, J.; Kahlke, R.D.; Debruyne, R.; van Geel, B.; van Reenen, G.B.A.; Pals, J.P.; de Marliave, C.; Reumer, J.W.F.

    2006-01-01

    Abstract During a series of expeditions organized by CERPOLEX/Mammuthus to the Taimyr region in northern Siberia several mammoth (Mammuthus primigenius) carcasses were discovered and subsequently excavated and studied. The oldest specimen is the Arilakh Mammoth (ca. 55,800 BP). Much younger are the

  15. Results of the CERPOLEX/Mammuthus expeditions on the Taimyr peninsula, Arctic Siberia, Russian federation

    NARCIS (Netherlands)

    Mol, D; Tikhonov, A; van der Plicht, J; Kahlke, RD; Debruyne, R; van Geel, B; van Reenen, G; Pals, JP; de Marliave, C; Reumer, JWF; Kahlke, Ralf-Dietrich; Pals, Jan Peter; Reumer, Jelle W.F.

    During a series of expeditions organized by CERPOLEX/Mammuthus to the Taimyr region in northern Siberia several mammoth (Mammuthus primigenius) carcasses were discovered and subsequently excavated and studied. The oldest specimen is the Arilakh Mammoth (ca. 55,800 BP). Much younger are the Jarkov

  16. Diet and chronology of the neolithic cultures in the low povolzhye

    DEFF Research Database (Denmark)

    Vybornov, A. A.; Kulkova, Marianna A.; Kosintsev, Pavel

    . The identification of animal bones allowed the detailed reconstruction of the meat component of the diet. Fish bones indicate the consumption of freshwater. Onager, saiga antelope, red deer, aurochs, wild-boar, corsac fox, wolf, birds and fish were found in Kairshak type sites of the Seroglazovskaya culture (Baybek......, Kairshak-III sites) in the North Caspian Sea region. The dog is the only example of domestic animals. Fifty radiocarbon dates were obtained for this culture. Most of the dates lay in the interval from 6500 to 5900 calBC. Dates on shells are 500 years older. Remains of onager, saiga antelope, red deer...... Povolzhye, in the sites of the Orlovskaya culture (Algay, Varfolomeyevka), bones of tarpan, onager, aurochs, saiga antelope,wolf, corsac fox, red deer, bird and fish were identified. Fifty radiocarbon dates were obtained for this cultural type. Most dates lay in the period from 6200 to 5400 BC. Dates...

  17. Resolving a zoological mystery: the kouprey is a real species

    OpenAIRE

    Hassanin, Alexandre; Ropiquet, Anne

    2007-01-01

    The kouprey is a rare and enigmatic forest ox discovered by scientists in Cambodia only in 1937. Numerous morphological hypotheses have been proposed for the origin of the kouprey: that it is a species closely related to banteng and gaur, two other wild oxen of southeast Asia; a morphologically divergent species placed in a separate genus, named Novibos; a wild species linked to aurochs and domestic cattle; a vicariant population of banteng; a feral cattle; or a hybrid of banteng with either ...

  18. Paradigms and proboscideans in the southern Great Lakes region, USA

    Science.gov (United States)

    Saunders, J.J.; Grimm, E.C.; Widga, C.C.; Campbell, G.D.; Curry, B. Brandon; Grimley, D.A.; Hanson, P.R.; McCullum, J.P.; Oliver, J.S.; Treworgy, J.D.

    2010-01-01

    Thirteen new chronometric dates for Illinois proboscideans are considered in relation to well-dated pollen records from northeastern and central Illinois. These dates span an interval from 21,228 to 12,944 cal BP. When compared to pollen spectra, it is evident that Mammut americanum inhabited spruce (Picea) and black ash (Fraxinus nigra) forest during the B??lling-Aller??d (14,700-12,900 cal BP) and early Younger Dryas (12,900-11,650 cal BP) chronozones. Both Mammuthus jeffersonii and Mammuthus primigenius inhabited spruce dominated open-woodland during the Oldest Dryas chronozone, while M.??primigenius persisted in a forest of predominantly black ash during the Aller??d chronozone. A newly discovered specimen from Lincoln, IL, clarifies the taxonomic distinction between M. primigenius and M.??jeffersonii. Hitherto, a paradigm of proboscidean succession during the full- to late-glacial periods was based on the vegetation succession of steppe tundra-like vegetation to spruce forest to spruce-deciduous forest. The presumed proboscidean succession was that of cold, dry steppe-adapted M. primigenius succeeded by more mesic-tolerant M. jeffersonii that in turn was succeeded by the wet forest-adapted M.??americanum. Reported data do not support this view and indicate a need for re-evaluation of assumptions of proboscidean ecology and history, e.g., the environmental tolerances and habits of M.??primigenius in regions south of 55??N, and its dynamic relationship with other proboscidean taxa. ?? 2009 Elsevier Ltd and INQUA.

  19. Bovine gene polymorphisms related to fat deposition and meat tenderness

    Directory of Open Access Journals (Sweden)

    Marina R.S. Fortes

    2009-01-01

    Full Text Available Leptin, thyroglobulin and diacylglycerol O-acyltransferase play important roles in fat metabolism. Fat deposition has an influence on meat quality and consumers' choice. The aim of this study was to determine allele and genotype frequencies of polymorphisms of the bovine genes, which encode leptin (LEP, thyroglobulin (TG and diacylglycerol O-acyltransferase (DGAT1. A further objective was to establish the effects of these polymorphisms on meat characteristics. We genotyped 147 animals belonging to the Nelore (Bos indicus, Canchim (5/8 Bos taurus + 3/8 Bos indicus, Rubia Gallega X Nelore (1/2 Bos taurus + 1/2 Bos indicus, Brangus Three-way cross (9/16 Bos taurus + 7/16 Bos indicus and Braunvieh Three-way cross (3/4 Bos taurus + 1/4 Bos indicus breeds. Backfat thickness, total lipids, marbling score, ribeye area and shear force were fitted, using the General Linear Model (GLM procedure of the SAS software. The least square means of genotypes and genetic groups were compared using Tukey's test. Allele frequencies vary among the genetic groups, depending on Bos indicus versus Bos taurus influence. The LEP polymorphism segregates in pure Bos indicus Nelore animals, which is a new finding. The T allele of TG is fixed in Nelore, and DGAT1 segregates in all groups, but the frequency of allele A is lower in Nelore animals. The results showed no association between the genotypes and traits studied, but a genetic group effect on these traits was found. So, the genetic background remains relevant for fat deposition and meat tenderness, but the gene markers developed for Bos taurus may be insufficient for Bos indicus.

  20. Effects of equine chorionic gonadotrophin on follicular, luteal and conceptus development of non-lactating Bos indicus beef cows subjected to a progesterone plus estradiol-based timed artificial insemination protocol

    Directory of Open Access Journals (Sweden)

    Paulo Pitaluga Costa e Silva Filho

    2013-08-01

    Full Text Available The aim of this study was to evaluate the effects of equine chorionic gonadotropin (eCG on ovarian follicular responses, corpus luteum (CL development and conceptus length on day 16 after timed artificial insemination (TAI. A total of 124 cows at day 0 (D0 received 2 mg of estradiol benzoate (EB and the insertion of a progesterone (P4 intravaginal device. Eight days later, the device was removed, and cows received 0.15 mg of prostaglandin and 0.5 mg of estradiol cypionate (EC, and were randomly assigned to 1 of 2 treatments: eCG (n=60, in which cows received 300 U of eCG; and control (n=64. Cows were TAI 48 h after P4 device removal. The diameter of the largest follicle (LF present on D8 and D10 and of CL on D15 and D26 were measured. Conceptus recovered rate, conceptus length, CL diameter and weight were determined at slaughter on D26. Plasma P4 concentration was determined on D15 and D26. Follicular growth from D8 to D10 (P=0.03, the diameter of CL at D15 (P=0.03 and D26 (P=0.003 and the CL weight at day 26 (P=0.04 were greater in the eCG group than the control. However, there was no effect of eCG treatment on oestrus occurrence, conceptus recovery rate and length, or P4 concentrations on either D15 or D26. In conclusion, although eCG increases follicular responses and the diameter of the CL, this gonadotropin treatment does not influence the length of the conceptus or the P4 concentration on the subsequent oestrus cycle.

  1. Análisis de PCR-RFLP del gen de leptina y su asociación con características de la leche en ganado nativo (Bos indicus de Irán

    Directory of Open Access Journals (Sweden)

    Mojtaba Rezaei

    2015-01-01

    Full Text Available Se utilizó una muestra ganadera experimental para la caracterización de los genes y las frecuencias genotípicas y evaluar la asociación entre los polimorfismos de longitud del fragmento de restricción BsaAI en el gen de leptina y las características lácteas. Se recolectaron muestras de sangre de 390 vacas proporcionadas por el censo ganadero de la provincia de Guilán en Irán. La extracción de ADN genómico se basó en el método modificado de precipitación salina. El fragmento de 522 bp que comprende la región parcial del exón 3 e intrón 2 del locus del gen de leptina se amplificó mediante PCR-RFLP e iniciadores específicos. La digestión del fragmento amplificado con la enzima de restricción BsaAI reveló dos alelos de A y B con frecuencias de 0.447 y 0.553, y tres genotipos de AA, AB, BB con frecuencias de 0.185, 0.526 y 0.289 en la población estudiada, respectivamente. El resultado del contenido de polimorfismo fue 0.372 y para heterocigosis 0.526. Los resultados demostraron que la población estudiada estaba en equilibrio Hardy-Weinberg. El análisis estadístico indicó que el polimorfismo LEP- BsaAI tiene un efecto significativo en la producción de leche, porcentaje de grasa y proteína de la leche ( P <0.01. Animales portadores del genotipo heterocigoto (AB produjeron 1.17 y 0.7 kg/d más leche que los animales homocigotos AA y BB, respectivamente. Los animales con el genotipo AA tuvieron mayor grasa (0.28 % y porcentaje de proteína (0.17 % que el genotipo AB. Tales resultados pueden utilizarse como criterios para facilitar la selección genética en los programas de cría animal.

  2. Color-Doppler signals of blood flow in the corpus luteum and vascular perfusion index for ovarian and uterine arteries during expansion of the allantochorion in Bos taurus heifers.

    Science.gov (United States)

    Pinaffi, F L V; Araujo, E R; Silva, L A; Ginther, O J

    2017-10-15

    Hemodynamics of the CL and each main uterine artery during expansion of the allantochorion from the ipsilateral side (CL side) to the contralateral side were studied in heifers (n = 8 nonbred, 9 pregnant). Progesterone concentration, vascular perfusion index for each uterine artery (by spectral ultrasonography), extent of blood flow in the CL (percentage of CL tissue with color-Doppler signals of blood flow), and intrauterine location of the expanding allantochorion (by gray-scale ultrasonic imaging) were determined daily from Days 14-60 (Day 0 = ovulation). In the pregnant group, but not in the nonbred group, the percentage of CL tissue with blood-flow signals increased (P flow signals. Functional increases in the CL during early pregnancy were attributed to the greater uterine arterial blood flow on the ipsilateral or CL side and the reported prominent anastomosis from a branch of the uterine artery to the ovarian artery that supplies the CL ovary. After an initial significant decrease in vascular perfusion index in each uterine artery in the pregnant group, the index began to increase on Day 17 in the ipsilateral artery and on Day 18 in the contralateral artery. The perfusion continued in the ipsilateral artery but discontinued in the contralateral artery on Day 21. Perfusion and diameter of the uterine artery were greater for the ipsilateral side until the vesicle entered the contralateral horn on Day 33 and increased for the contralateral horn between vesicle entry and filling of the horn on Day 44. During Days 35-60, the perfusion index (P flow in the ipsilateral uterine artery and (2) blood flow in each of the ipsilateral and contralateral uterine arteries increases as the allantochorion expands in each uterine horn. Copyright © 2017. Published by Elsevier Inc.

  3. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-06-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitroen los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  4. Estudio molecular de la glicoproteína oviductal OVGP1 y su efecto en la fecundación y el desarrollo embrionario in vitro en la especie porcina (Sus scrofa) y bovina (Bos taurus)

    OpenAIRE

    Algarra Oñate, Blanca

    2016-01-01

    Se ha considerado el oviducto como un mero conducto para gametos y embriones durante muchos años, pero numerosos estudios realizados en las últimas décadas han demostrado que está involucrado en importantes procesos que son necesarios para la correcta fisiología de gametos y embriones. Además, el oviducto es el lugar donde tiene lugar la fecundación y el desarrollo embrionario temprano. Gametos y embriones están en contacto con el fluido oviductal (FO) durante su paso a través del oviducto. ...

  5. Un modelo didáctico para comprender el bosón de Higgs como parte del modelo estándar de partículas elementales

    Directory of Open Access Journals (Sweden)

    Jonás Valencia Carrillo

    2016-01-01

    Full Text Available Se explica de forma didáctica, accesible para profesores que imparten los cursos de física moderna básica, el mecanismo del rompimiento espontáneo de la sime - tría con la presencia de un campo de Higgs. Para conseguir este objetivo, se desarrolla un modelo matemático basado en el comportamiento de resortes que obedecen a las leyes del oscilador armónico simple y con la presencia de cargas que oscilan junto con éstos. Como resultado, se obtiene que la luz emitida por las cargas oscilantes, los fotones, duplican su masa cuando los resortes se deforman más allá de su límite elástico debido a la presencia de una fuerza externa que rompe la simetría inicial del sistema.

  6. Fatores etários no leucograma de fêmeas zebuínas sadias da raça Nelore (Bos indicus Influence of age on the leukogram values for healthy Nelore (Zebu cattle

    Directory of Open Access Journals (Sweden)

    Joselito Nunes Costa

    2000-06-01

    Full Text Available Para avaliar-se a influência dos fatores etários sobre o leucograma de fêmeas zebuínas da raça Nelore, examinaram-se amostras de sangue de 158 animais, distribuídos por sete grupos etários ( até 3 meses; 3 a 6 meses; 6 a 12 meses; 12 a 24 meses; 24 a 48 meses; 48 a 72 meses e maior que 72 meses. Os resultados expressos em valores médios (± desvios padrões máximo (máx. e mínimo (mín. em milhares de células por mm³ para os diferentes componentes do leucograma foram os seguintes: leucócitos total máx. - 16992 ± 4104 ( 6 a 12 meses e min. -10353 ± 2397 (48 a 72 meses ; neutrófilos total máx. - 3931 ± 1578 (até 3 meses e min. - 2416 ± 1118 ( 6 a 12 meses ; eosinófilos máx. - 999 ± 499 (24 a 48 meses e min. - 265 ± 276 ( 3 a 6 meses ; basófilos máx. - 67 ± 88 (> 72 meses e min. - 39 ± 78 (6 a 12 meses; linfócitos típicos máx. - 12758 ± 3608 (6 a 12 meses e min. - 5906 ± 1883 (48 a 72 meses; linfócitos atípicos máx. - 1310 ± 603 (3 a 6 meses e min. - 760 ± 419 ( 48 a 72 meses ; linfócitos total máx. - 14079 ± 4027 (6 a 12 meses e min. - 6666 ± 2059 ( 48 a 72 meses ; monócitos máx. -27 ± 62 ( até 3 meses e min.- 0 ( 6 a 12 meses. A existência de diferenças (p > 0,05 entre grupos demonstrando diminuição dos neutrófilos e aumento dos linfócitos no primeiro ano de vida; a diminuição dos valores do total de leucócitos a partir de um ano de idade, como reflexo de comportamento similar dos números de linfócitos (típicos e atípicos e o aumento dos eosinófilos entre 24 e 48 meses de vida, caracterizaram a influência dos fatores etários sobre a variação dos valores dos componentes do leucograma de fêmeas zebuínas da raça Nelore criadas em São Paulo - Brasil.In order to evaluate the influence of the age on the white blood cell counts of Nelore (Zebu cattle, 158 blood samples from seven groups of different ages (group I-up to three months; group II-three to six months; group III-six to 12 months; group IV-12 to 24 months; group V-24 to 48 months; group VI-48 to 72 months and group VII-older than 72 months were studied. The highest and lowest mean values observed were total white blood cell/mm³-16992±4104 (group III and 10353±2397 (group VI; neutrophils/mm³-3931±1578 (group I and 2416 ±1118 (group III; eosinophils/ mm³-999±499 (group V and 265±276 (group II; basophils/mm³-67±88 (group VII and 39±78 (group III; typical lymphocytes/ mm³-12758±3608 (group III and 5906±1883 (group VI; atypical lymphocytes/ mm³-1310±603 (group II and 760±419 (group VI ; lymphocytes total/ mm³-14079±4027 (group III and 6666±2059 (group VI; monocytes/mm³-27±62 (group I and 0 (group III. The differences (p>0.05 observed among the groups in relation to total white blood cell, lymphocytes, neutrophils and eosinophils can be related to the influence of the age on leukogram of Nelore (Zebu cattle raised in São Paulo- Brazil.

  7. Determinación de las condiciones de crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del tracto intestinal de terneros (Bos taurus

    Directory of Open Access Journals (Sweden)

    José Ávila

    2010-07-01

    Full Text Available El objetivo de este estudio fue conocer el efecto de la temperatura, pH y la concentración de inóculo sobre el crecimiento in vitro de una cepa probiótica (Lactobacillus delbruekii subsp. bulgaricus aislada del intestino delgado de terneros. Para ello se utilizó en el primer caso, el método de superficie de respuesta para determinar las condiciones de pH y temperatura óptimas de la cepa, y en el segundo, un diseño experimental completamente aleatorizado considerando el factor concentración de inóculo inicial a seis niveles, donde el crecimiento (en medio De Man, Rogosa y Sharpe expresado en unidades de Absorbancia, constituyó la variable respuesta; presentándose una máxima respuesta (0,806 uA para 5 % de concentración inicial de inóculo. Los valores de pH y temperatura utilizados permitieron el establecimiento de una zona óptima de crecimiento in vitro en los siguientes intervalos, pH entre 5,1 y 5,6; y temperatura entre 38,0 y 41,5 °C, donde el máximo crecimiento se obtuvo a pH 5,31 y a 39,38 °C. Por otro lado se encontraron incrementos significativos del crecimiento in vitro (p < 0,05 a medida que se utiliza menor concentración de inóculo inicial. Con la información obtenida se espera incrementar los rendimientos de la cepa y así promover la producción de productos probióticos para el consumo animal en Venezuela.

  8. Distribution patterns of the glucose transporters GLUT4 and GLUT1 in skeletal muscles of rats (Rattus norvegicus), pigs (Sus scrofa), cows (Bos taurus), adult goats, goat kids (Capra hircus), and camels (Camelus dromedarius).

    Science.gov (United States)

    Duehlmeier, R; Sammet, K; Widdel, A; von Engelhardt, W; Wernery, U; Kinne, J; Sallmann, H-P

    2007-02-01

    Earlier studies demonstrated that forestomach herbivores are less insulin sensitive than monogastric omnivores. The present study was carried out to determine if different distribution patterns of the glucose transporters GLUT1 and GLUT4 may contribute to these different insulin sensitivities. Western blotting was used to measure GLUT1 and GLUT4 protein contents in oxidative (masseter, diaphragm) and glycolytic (longissimus lumborum, semitendinosus) skeletal muscle membranes of monogastric omnivores (rats and pigs), and of forestomach herbivores (cows, adult goats, goat kids, and camels). Muscles were characterized biochemically. Comparing red and white muscles, the isocitrate dehydrogenase (ICDH) activity was 1.5-15-times higher in oxidative muscles of all species, whereas lactate dehydrogenase (LDH) activity was 1.4-4.4-times higher in glycolytic muscles except in adult goats. GLUT4 levels were 1.5-6.3-times higher in oxidative muscles. GLUT1 levels were 2.2-8.3-times higher in glycolytic muscles in forestomach herbivores but not in monogastric animals. We conclude that GLUT1 may be the predominant glucose transporter in glycolytic muscles of ruminating animals. The GLUT1 distribution patterns were identical in adult and pre-ruminant goats, indicating that GLUT1 expression among these muscles is determined genetically. The high blood glucose levels of camels cited in literature may be due to an "NIDDM-like" impaired GLUT4 activity in skeletal muscle.

  9. C- and G-banding patterns and chromosomal morphology of some breeds of Australian cattle.

    Science.gov (United States)

    Potter, W L; Upton, P C; Cooper, J; Blackshaw, A W

    1979-12-01

    A cytogenetical study using metaphase chromosomes from cultured lymphocytes, was made of 2 Banteng (Bibos banteng) steers and 218 bulls representing 13 purebreeds (Bos taurus type, Bos indicus type and Sanga) and 7 cross-breeds. Studies were made of photographic karyotypes of Giemsa stained and C-banded chromosomes of bulls of each breed and of B-banded chromosomes from 3 breeds of Bos indicus and one cross-breed Australian Friesian Sahiwal) cattle. The relative lengths of chromosomes of Bos taurus and Bos indicus bulls were compared and significant difference in relative lengths of the X chromosomes were noted between these two species. There was a differences in morphology of the Y chromosomes; Sanga, Banteng and Bos taurus type breeds had a small submetacentric Y chromosome, except for the Jersey which had a metacentric Y chromosome. All Bos indicus type bulls had an acrocentric Y chromosome but the Droughtmaster breed had two forms of the Y chromosome (submetacentric and acrocentric). The C-banding patterns of the autosomes and X chromosomes were similar for all breeds while those of the Y chromosomes of Bos indicus type cattle allowed their accurate identification. G-banding patterns of Bos indicus resembled those of Bos taurus and enabled pairing of homologous chromosomes. Centromeres of the autosomes were unstained but those of the sex chromosomes were darkly stained.

  10. An Official Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Healthcare Professionals: A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of healthcare professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other healthcare professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care healthcare professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care healthcare professionals and diminish the harmful consequences of BOS, both for critical care healthcare professionals and for patients.

  11. An Official Critical Care Societies Collaborative Statement-Burnout Syndrome in Critical Care Health-care Professionals: A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.

  12. A Critical Care Societies Collaborative Statement: Burnout Syndrome in Critical Care Health-care Professionals. A Call for Action.

    Science.gov (United States)

    Moss, Marc; Good, Vicki S; Gozal, David; Kleinpell, Ruth; Sessler, Curtis N

    2016-07-01

    Burnout syndrome (BOS) occurs in all types of health-care professionals and is especially common in individuals who care for critically ill patients. The development of BOS is related to an imbalance of personal characteristics of the employee and work-related issues or other organizational factors. BOS is associated with many deleterious consequences, including increased rates of job turnover, reduced patient satisfaction, and decreased quality of care. BOS also directly affects the mental health and physical well-being of the many critical care physicians, nurses, and other health-care professionals who practice worldwide. Until recently, BOS and other psychological disorders in critical care health-care professionals remained relatively unrecognized. To raise awareness of BOS, the Critical Care Societies Collaborative (CCSC) developed this call to action. The present article reviews the diagnostic criteria, prevalence, causative factors, and consequences of BOS. It also discusses potential interventions that may be used to prevent and treat BOS. Finally, we urge multiple stakeholders to help mitigate the development of BOS in critical care health-care professionals and diminish the harmful consequences of BOS, both for critical care health-care professionals and for patients.

  13. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  14. Dicty_cDB: Contig-U06163-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH240-431B11 (Children's Hospita... 38 0.29 4 ( AC216756 ) Bos taurus BAC CH240-444K24 (Children's Hospital...29 4 ( AC226030 ) Bos taurus BAC CH240-415P8 (Children's Hospital ... 38 0.29 4 ( EW679945 ) CE2001C11...31 2 ( AC216978 ) Bos taurus BAC CH240-311O3 (Children's Hospital ... 38 0.31 4 ( EW679057 ) CE2001C11...2 ( AC225935 ) Bos taurus Y BAC CH240-411D10 (Children's Hospita... 38 0.32 4 ( AC220873 ) Bos taurus...36 2 ( AC226428 ) Bos taurus BAC CH240-462K8 (Children's Hospital ... 38 0.36 4 >( BJ431286 ) Dictyostelium

  15. Y chromosome morphology of cattle.

    Science.gov (United States)

    Potter, W L; Upton, P C

    1979-11-01

    Metaphase chromosomes from cultured lymphocytes were prepared from 246 bulls including Bos indicus, Bos taurus. Bos (Bibos) banteng, Sanga and interspecific and intra-specific breed crosses. Morphology and karyotype position of the Y chromosome for each bull were noted. Karyotype position of the Y chromosome varied between bulls from 25th to 29th pair and the Y chromosomes of Bos indicus and breeds derived from Bos indicus bulls were acrocentric while those of Bos taurus, Sanga and breeds derived from these bulls were metacentric/submetacentric. Two forms of Y chromosome were noted in the Droughtmaster breed. C-banding patterns of the acrocentric Y chromosome were characteristic and enabled easy identification.

  16. Exposing Compassion Fatigue and Burnout Syndrome in a Trauma Team: A Qualitative Study.

    Science.gov (United States)

    Berg, Gina M; Harshbarger, Jenni L; Ahlers-Schmidt, Carolyn R; Lippoldt, Diana

    2016-01-01

    Compassion fatigue (CF) and burnout syndrome (BOS) are identified in trauma, emergency, and critical care nursing practices. The purpose of this qualitative study was to measure CF and BOS in a trauma team and allow them to share perceptions of related stress triggers and coping strategies. Surveys to measure CF and BOS and a focus group allowed a trauma team (12 practitioners) to share perceptions of related stress triggers and coping strategies. More than half scored at risk for CF and BOS. Stress triggers were described as situation (abuse, age of patient) versus injury-related. Personal coping mechanisms were most often reported. Both CF and BOS can be assessed with a simple survey tool. Strategies for developing a program culturally sensitive to CF and BOS are provided.

  17. Re-Placing Coyote

    OpenAIRE

    Shelley M. Alexander; Victoria M. Lukasik

    2016-01-01

    Our human relationship with coyote is old, sometimes magical but lately polarized and complex. Archeological evidence shows coyote (Canis latrans) displayed ubiquitous distribution across the continent for over 1 million years (Wang, Tedford and Antón, 2010). Through this, coyote has witnessed the rise and fall of iconic species, such as the woolly mammoth (Mammuthus primigenius), dire wolf (C. dirus), among others that migrated to this continent during the Pleistocene ice age (Wang, Tedford ...

  18. Gene : CBRC-TTRU-01-1304 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

  19. The number of FoxP3+ cells in transbronchial lung allograft biopsies does not predict bronchiolitis obliterans syndrome within the first five years after transplantation

    DEFF Research Database (Denmark)

    Krustrup, Dorrit; Iversen, Martin; Martinussen, Torben

    2015-01-01

    Background: An important limitation to the success of lung transplantation is the development of bronchiolitis obliterans syndrome (BOS). It has been hypothesized that regulatory T lymphocytes (Tregs) are related to the risk of BOS. We aim to evaluate whether the number of forkhead box P3 (FoxP3...... grade 1 and grade 2/3, respectively, to no rejection. According to a Cox regression analysis, the number of FoxP3+ cells/mm2 was not predictive of time to BOS. Discussion and Conclusions: Our data indicate that the number of FoxP3+ cells in the lung allograft did not correlate with BOS-free survival...

  20. Acute cellular rejection is a risk factor for bronchiolitis obliterans syndrome independent of post-transplant baseline FEV1

    DEFF Research Database (Denmark)

    Burton, C.M.; Iversen, M.; Carlsen, J.

    2009-01-01

    maximum FEV(1) occurred at a median 183 days post-transplant. Freedom from BOS was 81%, 53%, 38% and 15%, and cumulative incidence of BOS was 18%, 43%, 57% and 77% at 1, 3, 5 and 10 years post-transplantation, respectively. Acute cellular rejection was independently associated with an increased cause......-specific hazard of BOS (hazard ratio 1.4, confidence interval 1.1 to 1.8, p = 0.009). The absolute value of baseline FEV(1) was a significant confounder in all survival and competing risk analyses of BOS (p rejection remains...