WorldWideScience

Sample records for augusta maine usa

  1. 2007 U.S. Geological Survey Topographic Lidar: Augusta-Manchester, Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Lidar Contract No. 07CRCN0014 Lidar was collected at a 1.0 points per square meter (1.0m GSD) for the towns of Augusta and Manchester in Maine while no snow was on...

  2. Health assessment for O'Connor Company site, Augusta, Kennebec County, Maine, Region 1. CERCLIS No. MED980731475. Preliminary report

    Energy Technology Data Exchange (ETDEWEB)

    1989-04-10

    The F. O'Connor Site (FOC) is listed by the U.S. Environmental Protection Agency (EPA) on the National Priorities List. The 28-acre site is located in Augusta (Kennebec County), Maine. FOC recycled capacitors, transformers, and scrap metal for about 20 years. Waste oil from these operations was disposed of on-site or burned. Preliminary on-site soil sampling results have identified PCB's (ND to 200,000 ppm), various PAH's (ND to 23 ppm), and various metals such as lead (62 to 3,210 ppm), nickel (18 to 29 ppm), chromium (28 to 34 ppm), arsenic (8 to 13 ppm), and mercury (ND to 3 ppm). On-site groundwater sampling results detected 1,4-dichlorobenzene (ND to 28 ppb) and PCB's (ND to 72 ppb). Potential environmental pathways include those related to contaminated groundwater, surface water, soils and sediment, and volatilization of contaminants in ambient air. In addition, bioaccumulation of contaminants in fish, water fowl, livestock, and commercial agricultural products may be another environmental pathway. Based on available information, this site is considered to be of potential public health concern because of the risk to human health caused by the likelihood of human exposure to hazardous substances. Area residents may be exposed through direct contact with and ingestion of contaminated off-site soil and sediment. An additional exposure pathway may exist through the ingestion of fish, waterfowl, and other aquatic organisms that bioaccumulate site-related contaminants.

  3. Gridded bathymetry of Kohala, Hawaii, Main Hawaiian Islands, USA.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — 5-m grid of bathymetric data of Kohala coast of Hawaii, Main Hawaiian Islands, USA. The ASCII grids include multibeam bathymetry from the Reson 8101 multibeam sonar...

  4. Maine State Library. Transcription of an Automation Workshop and a Public Hearing regarding Library Automation (Augusta, Maine, September 17-18, 1984).

    Science.gov (United States)

    Epstein, Susan Baerg

    This document contains the full transcript of a 2-day workshop on library automation. The first day of the workshop was devoted to a review of the state-of-the-art of library automation and the second day included presentation of testimony by Maine librarians. The transcript of the first day includes discussions of the historical development of…

  5. 33 CFR 100.724 - Annual Augusta Invitational Rowing Regatta; Savannah River, Augusta, GA.

    Science.gov (United States)

    2010-07-01

    ... Rowing Regatta; Savannah River, Augusta, GA. 100.724 Section 100.724 Navigation and Navigable Waters... WATERS § 100.724 Annual Augusta Invitational Rowing Regatta; Savannah River, Augusta, GA. (a) Definitions... all non-participants. (2) After the termination of the Invitational Rowing Regatta each day,...

  6. Arsenic evolution in fractured bedrock wells in central Maine, USA

    Science.gov (United States)

    Yang, Q.; Zheng, Y.; Culbertson, C.; Schalk, C.; Nielsen, M. G.; Marvinney, R.

    2010-12-01

    Elevated arsenic concentration in fractured bedrock wells has emerged as an important and challenging health problem, especially in rural areas without public water supply and mandatory monitoring of private wells. This has posed risks of skin, bladder, prostate diseases and cancers to private well users. In central Maine, including the study site, 31% of bedrock wells in meta-sedimentary formations have been reported of elevated arsenic concentrations of > 10 µg/L. Geophysical logging and fracture specific water sampling in high arsenic wells have been conducted to understand how water flowing through the aquifers enters the boreholes and how arsenic evolves in the fracture bedrock wells. Two domestic wells in Manchester, Maine, located 50 meter apart with 38 µg/L and 73 µg/L of arsenic in unfiltered water, were investigated to characterize fractures by geophysical logging and to determine flow rates by pumping test. Water samples, representing the bore hole and the fractures, were collected and analyzed for arsenic under ambient and pumping conditions. Transmissivity of the fractures was estimated at 0.23-10.6 m2/day. Water with high dissolved arsenic was supplied primarily by high yielding fractures near the bottom of the borehole. Dissolved arsenic concentrations in borehole water increased as fracture water with high arsenic was replacing borehole water with initially low dissolved arsenic in response to pumping. The precipitation of iron particulates enriched in arsenic was common during and after pumping. Laboratory experiment on well water samples over a period of 16 days suggested that in the borehole arsenic was mainly settled with iron enriched particles, likely amorphous ferric oxyhydroxides, with possibly minor adsorption on the iron minerals. Another bedrock well in Litchfield, Maine, with 478 µg/L of arsenic in the unfiltered well water, is being investigated to quantify and reconstruct of the groundwater flow under ambient and pumping conditions

  7. Le matronae diventano Augustae: un nuovo profilo femminile

    OpenAIRE

    Cenerini, Francesca

    2016-01-01

    This paper analizes the new role of women in the new domus Augusta and at the beginning of the Roman imperial society, expecially Livia, Augustus’ wife, called Iulia Augusta after the dead of her husband.

  8. Ascariasis in humans and pigs on small-scale farms, Maine, USA, 2010-2013.

    Science.gov (United States)

    Miller, Leigh Ann; Colby, Kate; Manning, Susan E; Hoenig, Donald; McEvoy, Elizabeth; Montgomery, Susan; Mathison, Blaine; de Almeida, Marcos; Bishop, Henry; Dasilva, Alexandre; Sears, Stephen

    2015-02-01

    Ascaris is a genus of parasitic nematodes that can cause infections in humans and pigs. During 2010-2013, we identified 14 cases of ascariasis in persons who had contact with pigs in Maine, USA. Ascaris spp. are important zoonotic pathogens, and prevention measures are needed, including health education, farming practice improvements, and personal and food hygiene. PMID:25626125

  9. Ascariasis in Humans and Pigs on Small-Scale Farms, Maine, USA, 2010–2013

    OpenAIRE

    Miller, Leigh Ann; Colby, Kate; Manning, Susan E.; Hoenig, Donald; McEvoy, Elizabeth; Montgomery, Susan; Mathison, Blaine; de Almeida, Marcos; Bishop, Henry; Dasilva, Alexandre; Sears, Stephen

    2015-01-01

    Ascaris is a genus of parasitic nematodes that can cause infections in humans and pigs. During 2010–2013, we identified 14 cases of ascariasis in persons who had contact with pigs in Maine, USA. Ascaris spp. are important zoonotic pathogens, and prevention measures are needed, including health education, farming practice improvements, and personal and food hygiene.

  10. The orientation of Julia Augusta Taurinorum (Torino)

    CERN Document Server

    Sparavigna, Amelia Carolina

    2012-01-01

    It seems that the ancient Roman towns were oriented with the sunrise. Here I propose a discussion on the orientation of Torino, the Julia Augusta Taurinorum, which has the ancient Roman structure perfectly preserved. According to the sunrise amplitude, the Turin's birthday could be the winter solstice.

  11. The orientation of Julia Augusta Taurinorum (Torino)

    OpenAIRE

    Sparavigna, Amelia Carolina

    2012-01-01

    It seems that the ancient Roman towns were oriented with the sunrise. Here I propose a discussion on the orientation of Torino, the Julia Augusta Taurinorum, which has the ancient Roman structure perfectly preserved. According to this ancient ritual, we can use the sunrise amplitude to determine the Turin's birthday. The use of the hour angle is also proposed, in this case the day of the foundation of Turin could be the winter solstice.

  12. USA

    DEFF Research Database (Denmark)

    Nedergaard, Peter

    http://www.systime.dk/ungdomsuddannelser/almen-studieforberedelse/usa-en-grundbog-i-politik-og-okonomi.html......http://www.systime.dk/ungdomsuddannelser/almen-studieforberedelse/usa-en-grundbog-i-politik-og-okonomi.html...

  13. Sand and gravel mining: effects on ground water resources in Hancock county, Maine, USA

    Science.gov (United States)

    Peckenham, John M.; Thornton, Teresa; Whalen, Bill

    2009-01-01

    Based on this preliminary study, existing sand and gravel mining regulations (in Maine, USA) can be inferred to provide some protection to water resources. Sand and gravel deposits are important natural resources that have dual uses: mining for construction material and pumping for drinking water. How the mining of sand and gravel affects aquifers and change aquifer vulnerability to contamination is not well documented. Mining regulations vary greatly by state and local jurisdiction. This study test metrics to measure the effectiveness of mining regulations. The sand and gravel aquifer system studied is covered with former and active gravel pits to nearly 25% of its areal extent. Data from homeowner interviews and field measurements found scant evidence of changes in water quantity. Water quality analyses collected from springs, streams, ponds and wells indicate that the aquifer was vulnerable to contamination by chloride and nitrate. However, water quality changes can not be related directly to mining activities.

  14. Applicability of International Harvesting Equipment Productivity Studies in Maine, USA: A Literature Review

    Directory of Open Access Journals (Sweden)

    Patrick Hiesl

    2013-11-01

    Full Text Available Harvesting equipment productivity studies have been conducted in many countries around the world spanning over 25 years. These studies have shown that many factors influence individual machine productivity. These factors include stand and site conditions, equipment configuration, management objectives, and operator experience. Productivity can increase or decrease with slight changes in any of these factors. This literature review also highlights the variety of experimental designs and data collection methods encountered in a cross section of those studies. It further shows the variation in species composition, stand density, tree diameter, and harvest prescription. Although studies that include the influence of operator performance on harvest equipment productivity are limited, they were included in this review where appropriate and available. It is clear that productivity equations should be developed using population-level data with several operators. Some studies were conducted in stands similar to Maine, but they used harvesting equipment that is not commonly used in logging operations in this state. Therefore the applicability of existing studies to the logging industry in Maine, USA, is very limited. Our conclusion is that in order to accurately predict harvesting productivity it is necessary to develop regional harvesting productivity equations using harvesting equipment commonly used in Maine. Forest operations researchers in other regions will be able to use this summary to explore the difficulty of applying productivity information to regional logging operations.

  15. 76 FR 18497 - Television Broadcasting Services; Augusta, GA

    Science.gov (United States)

    2011-04-04

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Augusta, GA AGENCY: Federal Communications... 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video Division,...

  16. Wound healing activity of Abroma augusta in Wistar rats

    Institute of Scientific and Technical Information of China (English)

    Shanbhag T; Dattachaudhuri A; Shenoy S; Bairy KL

    2009-01-01

    Objective:The study was undertaken to evaluate the wound healing profile of alcoholic extract of Abroma au-gusta and its effect on dexamethasone suppressed wound healing in Wistar rats.Methods:An alcoholic extract of Abroma augusta was prepared.Three models were used -incision,excision and dead space wound models. Four groups of animals were used for each model.They were administered 2% gum acacia (orally),alcoholic extract of Abroma augusta (orally),dexamethasone (intramuscularly)and combination of Abroma augusta (o-rally)with dexamethasone (intramuscularly)respectively.The parameters studied included breaking strength of incision wound,period of epithelization and wound contraction rate in the excision wound,breaking strength,dry weight and hydroxyproline content of granulation tissue in dead space wound.Results:The breaking strength of incision wound of Abroma augusta treated group was significantly increased (P <0.001) while that of dexamethasone treated animals was significantly decreased (P <0.001)as compared to control. Coadministration of dexamethasone and Abroma augusta significantly reversed the dexamethasone suppressed wound healing in incision wound model (P <0.001).Animals treated with both dexamethasone and Abroma augusta also showed significant (P <0.004)increase in the breaking strength of granulation tissue in the dead space wound and a significant (P <0.011)reduction in the period of epithelization in the excision wound as compared to rats treated with dexamethasone alone.The rate of wound contraction was not significantly altered in any of the groups.Conclusion:The alcoholic extract of Abroma augusta was found to reverse dexametha-sone suppressed wound healing.

  17. Agent-Based Modeling of Harvest Decisions by Small Scale Forest Landowners in Maine, USA

    Directory of Open Access Journals (Sweden)

    Jessica E. Leahy

    2013-01-01

    Full Text Available Small-scale forests are an excellent example of coupled social-ecological systems, which involve human and biophysical subsystems with complex two-way feedback interactions. The multifaceted nature of landowner decisions drives a significant need to better understand decision-making processes, reactions to policy, and combined impacts on ecosystems in a comprehensive manner. Small-scale forests require an integrated approach to modeling the social and biophysical components comprehensively. Agent-based modeling involves modeling individualistic behavior and interpreting patterns that emerge. The interaction between agents and their environments makes this a valuable tool to assess repeated decisions of individual landowners responding to changing environmental conditions. Agent-based models can be used to determine potential ecological, economic, and social outcomes of landowner decisions and reactions to changing conditions. A forest landowner agent-based model experiment was developed to model timber harvesting in Maine, USA. We present baseline simulation results and compare the effect of a social change (an increased tax rate and a biophysical change (a pest outbreak resulting in increased tree mortality on the system. These three scenarios were analyzed using ANOVA and MANOVA tests on harvested hectares and landowner goal scores to assess landowner behavior and priorities by action. We conclude by reviewing implications for future modeling efforts.

  18. Determination of bioanalytical parameters for the standardization of Abroma augusta

    Institute of Scientific and Technical Information of China (English)

    Dinesh K Patel; S P Dhanabal

    2013-01-01

    Objective:To set the analytical parameters for simultaneous determination of different phytochemicals present in theAbroma augusta(A. augusta).Methods:Different phytochemical test including total phenol and total flavonoid content were carried out in the present investigation.Further, a rapid and simple high-performance thin-layer chromatographic(HPTLC) method was developed for the qualitative and quantitative analysis.Moreover antimicrobial study was also performed in the present investigation to know the presence of biological contamination. Results:Preliminary phytochemical analysis revealed the presence of glycoside, alkaloid, carbohydrate and steroid in theA. augusta.Total phenol and total flavonoid content were found to be0.29% and0.50% w/w respectively.All tested microorganism in theA. augusta extract were found to be under the limit.Chloroform: methanol: acetic acid:H2O(170:25:25:4) was used as a solvent system for the qualitative and quantitative analysis throughHPTLCMethod.HPTLC analysis revealed1.87% w/w of linoleic acid in theA. augusta extract.Conclusions:Results showed that the selected parameters in the present investigation would set the new standards for the qualitative and quantitative analysis ofA. augusta.

  19. THE MAIN COMPONENTS OF THE CIVIC EDUCATION IN MODERN SCHOOL (USING THE EXAMPLE OF THE USA

    Directory of Open Access Journals (Sweden)

    Inna Stanislavovna Bessarabova

    2015-11-01

    Full Text Available The urgency of the topic is stipulated by the importance of the problem of civic education under modern conditions of forming of the constitutional state and civic society, which has the rights and freedoms of citizens as the highest value.The purpose of the research is to reveal and characterize the peculiarities of the process of civic education of schoolchildren in modern secondary school (using the example of the USA.The results of the research showed that civic education involves three basic components: civic knowledge, civic skills and civic position. Civic knowledge includes clear understanding of the government structure and the processes of law adoption. At this stage the main focus in the process of civic education is directed to the students’ knowledge and skills to analyze historical and political events in the country, to understand the directions of the state policy in the country. The main function of the civic knowledge is its stimulation of the civic activity.The essential part of civic education is the formation of the civic skills, which are dependent on many factors including home environment, active and responsible participation in political life of the society, general education. These skills are classified as interaction, control and influence.The next basic component of civic education – civic position – is connected with personal and social characteristics of a citizen, which are important for active participation under the conditions of constitutional democracy. Civic position is closely connected with conscious readiness of a person to take part in social activity, availability of the theoretical civic know-ledge and practical civic skills. Itshould be mentioned that civic knowledge, civic skills and civic position are interconnected.Practical implications of the results. The results of the research are applicable in the process of working out of the new technologies, methods and approaches in education to

  20. Social-Ecological Scale Mismatches and the Collapse of the Sea Urchin Fishery in Maine, USA

    Directory of Open Access Journals (Sweden)

    Robert L. Vadas

    2012-06-01

    Full Text Available Scale mismatches result in incomplete or ambiguous feedback that impairs the ability to learn and adapt and, ultimately, to sustain natural resources. Our aim is to examine the sea urchin fishery in Maine, USA to better understand the multiscale, social, and biophysical conditions that are important for the design of institutions that might be able to sustain the resource. During the late 1980s and 1990s, the Maine sea urchin fishery was a classic gold rush fishery. In the beginning, the fishery was characterized by an abundant resource with little to no harvesting activity, followed by a period of rapid increase in landings and effort that led to a subsequent and persistent decline in the sea urchin population and a significant reduction in effort. We conducted semistructured interviews with scientists and experienced fishermen to understand the multiscale, social, and biophysical conditions that influence fishermen's harvesting strategies, and the implications of this for the design of institutions for successful resource management. The current co-management system includes an advisory body made up of industry members and scientists it also includes limited entry, and additional input control mechanisms. Many of these measures are implemented at a very broad scale; however, we find that the ecological conditions relevant to the sustainable processes occur at the scale of individual fishing sites or ledges, which is a much finer scale than current management. Therefore, the co-management system maintains an open access system and leaves few incentives for the development of sustainable harvesting strategies among fishermen. The clear suggestion is that the appropriate management system would be one that directly addresses the fine scale ecological and social dynamics within this fishery and gives fishermen property rights over individual ledges (for example, leases. After having briefly reviewed experiences in Canada and Chile, we found that

  1. La figura de Diocleciano en la Historia Augusta

    OpenAIRE

    Moreno Ferrero, Isabel

    1984-01-01

    Uno de los principales problemas que la Historia Augusta tiene hoy, todavía, planteados, a pesar de los esfuerzos realizados por resolverlo, es el del verdadero momento de composición de las vidas. Desde este punto de vista el nombre de Diocleciano, junto al de Constantino, ha ocupado un lugar preferente en la discusión de los investigadores e, incluso dentro del intento de definición que la Historia Augusta parece hacer de un ideal de optimus princeps, se ha sugerido que es él, junto a la Te...

  2. In vitro prevention of chick pancreatic lipase activity by Abroma augusta extract

    Institute of Scientific and Technical Information of China (English)

    Nidhi Gupta; Aditya Ganeshpurkar; Nishikant Jatav; Divya Bansal; Nazneen Dubey

    2012-01-01

    Objective: To investigate chick pancreatic lipase inhibitory activities of the Abroma augusta (A. augusta). Methods: A. augusta was first extracted with methanol and subjected to phytochemical screenings. Quantitative estimation of flavonoids, phenolics and alkaloids was done. Pancreatic lipase from chick pancreas was isolated and used as substrate for anti-lipase studies. Results:A. augusta extract effectively inhibited concentration dependent lipase activity, whereby extract at concentration 100 μg/mL inhibited 88.6% enzyme activity. Conclusions: From these results, it could be concluded that A. augusta can be used as a potential source anti-lipase agents.

  3. Chemical constituents of Gustavia Augusta L. (Lecythidaceae); Constituintes quimicos de Gustavia Augusta L. (Lecythidaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Afonso Duarte Leao de; Rocha, Arnaldo F. Imbiriba da; Pinheiro, Maria Lucia Belem; Andrade, Carlos Humberto de S.; Galotta, Ana Lucia de A. Queiroz; Santos, Maria do Perpetuo Socorro S. dos [Amazonas Univ., Manaus, AM (Brazil). Dept. de Quimica]. E-mail: afonsodlsouza@yahoo.com.br

    2001-08-01

    The Gustavia augusta is used in the folk medicine against leishmaniasis and showed anti-inflammatory action. The phyto chemical studies of the plant stem bark have led to the isolation of (22E)-stigmasta-7,22-dien-3{beta}-ol, 24{alpha}(S)-ethyl-5{alpha}-colesta-7, trans-22-dien-3-one, D-friedoolean-14-en-3{beta}-ol, D-friedoolean-14-en-3-one and D-friedoolean-14-en-3{alpha}-ol along with stigmasterol, {alpha}-amyrin, {beta}-amyrin, lupeol, 3{alpha}-hydroxy-lupeol and betulinic acid. The structures of these compounds were identified by IR, GC/M S, {sup 1} H and {sup 1} {sup 3} C NMR spectral analysis and comparison with literature data. (author)

  4. Particle size distribution of main-channel-bed sediments along the upper Mississippi River, USA

    Science.gov (United States)

    Remo, Jonathan; Heine, Ruben A.; Ickes, Brian

    2016-01-01

    In this study, we compared pre-lock-and-dam (ca. 1925) with a modern longitudinal survey of main-channel-bed sediments along a 740-km segment of the upper Mississippi River (UMR) between Davenport, IA, and Cairo, IL. This comparison was undertaken to gain a better understanding of how bed sediments are distributed longitudinally and to assess change since the completion of the UMR lock and dam navigation system and Missouri River dams (i.e., mid-twentieth century). The comparison of the historic and modern longitudinal bed sediment surveys showed similar bed sediment sizes and distributions along the study segment with the majority (> 90%) of bed sediment samples having a median diameter (D50) of fine to coarse sand. The fine tail (≤ D10) of the sediment size distributions was very fine to medium sand, and the coarse tail (≥ D90) of sediment-size distribution was coarse sand to gravel. Coarsest sediments in both surveys were found within or immediately downstream of bedrock-floored reaches. Statistical analysis revealed that the particle-size distributions between the survey samples were statistically identical, suggesting no overall difference in main-channel-bed sediment-size distribution between 1925 and present. This was a surprising result given the magnitude of river engineering undertaken along the study segment over the past ~ 90 years. The absence of substantial differences in main-channel-bed-sediment size suggests that flow competencies within the highly engineered navigation channel today are similar to conditions within the less-engineered historic channel.

  5. Particle size distribution of main-channel-bed sediments along the upper Mississippi River, USA

    Science.gov (United States)

    Remo, Jonathan W. F.; Heine, Reuben A.; Ickes, Brian S.

    2016-07-01

    In this study, we compared pre-lock-and-dam (ca. 1925) with a modern longitudinal survey of main-channel-bed sediments along a 740-km segment of the upper Mississippi River (UMR) between Davenport, IA, and Cairo, IL. This comparison was undertaken to gain a better understanding of how bed sediments are distributed longitudinally and to assess change since the completion of the UMR lock and dam navigation system and Missouri River dams (i.e., mid-twentieth century). The comparison of the historic and modern longitudinal bed sediment surveys showed similar bed sediment sizes and distributions along the study segment with the majority (> 90%) of bed sediment samples having a median diameter (D50) of fine to coarse sand. The fine tail (≤ D10) of the sediment size distributions was very fine to medium sand, and the coarse tail (≥ D90) of sediment-size distribution was coarse sand to gravel. Coarsest sediments in both surveys were found within or immediately downstream of bedrock-floored reaches. Statistical analysis revealed that the particle-size distributions between the survey samples were statistically identical, suggesting no overall difference in main-channel-bed sediment-size distribution between 1925 and present. This was a surprising result given the magnitude of river engineering undertaken along the study segment over the past ~ 90 years. The absence of substantial differences in main-channel-bed-sediment size suggests that flow competencies within the highly engineered navigation channel today are similar to conditions within the less-engineered historic channel.

  6. The geomorphic function and characteristics of large woody debris in low gradient rivers, coastal Maine, USA

    Science.gov (United States)

    Magilligan, F. J.; Nislow, K. H.; Fisher, G. B.; Wright, J.; Mackey, G.; Laser, M.

    2008-05-01

    The role, function, and importance of large woody debris (LWD) in rivers depend strongly on environmental context and land use history. The coastal watersheds of central and northern Maine, northeastern U.S., are characterized by low gradients, moderate topography, and minimal influence of mass wasting processes, along with a history of intensive commercial timber harvest. In spite of the ecological importance of these rivers, which contain the last wild populations of Atlantic salmon ( Salmo salar) in the U.S., we know little about LWD distribution, dynamics, and function in these systems. We conducted a cross-basin analysis in seven coastal Maine watersheds, documenting the size, frequency, volume, position, and orientation of LWD, as well as the association between LWD, pool formation, and sediment storage. In conjunction with these LWD surveys, we conducted extensive riparian vegetation surveys. We observed very low LWD frequencies and volumes across the 60 km of rivers surveyed. Frequency of LWD ≥ 20 cm diameter ranged from 15-50 pieces km - 1 and wood volumes were commonly DBH. These results strongly reflect the legacy of intensive timber harvest and land clearing and suggest that the frequency and distribution of LWD may be considerably less than presettlement and/or future desired conditions.

  7. Soil chemical and physical properties at the Bear Brook Watershed in Maine, USA.

    Science.gov (United States)

    SanClements, Michael D; Fernandez, Ivan J; Norton, Stephen A

    2010-12-01

    Acidic deposition leads to the acidification of waters and accelerated leaching and depletion of soil base cations. The Bear Brook Watershed in Maine has used whole-watershed chemical manipulations to study the effects of elevated N and S on forest ecosystem function on a decadal time scale. The objectives of this study were to define the chemical and physical characteristics of soils in both the reference and treated watersheds after 17 years of treatment and assess evidence of change in soil chemistry by comparing soil studies in 1998 and 2006. Results from 1998 confirmed depletion of soil base cation pools and decreased pH due to elevated N and S within the treated watershed. However, between 1998 and 2006, during a period of declining SO4(2-) deposition and continued whole-watershed experimental acidification on the treated watershed, there was little evidence of continued soil exchangeable base cation concentration depletion or recovery. The addition of a pulse of litterfall and accelerating mineralization from a severe ice storm in 1998 may have had significant effects on forest floor nutrient pools and cycling between 1998 and 2006. Our findings suggest that mineralization of additional litter inputs from the ice storm may have obscured temporal trends in soil chemistry. The physical data presented also demonstrate the importance of coarse fragments in the architecture of these soils. This study underscores the importance of long-term, quantitative soil monitoring in determining the trajectories of change in forest soils and ecosystem processes over time. PMID:20559716

  8. Provenance of geogenic arsenic in the Goose River basin, Maine, USA

    Science.gov (United States)

    Sidle, W.; Wotten, B.; Murphy, E.

    2001-11-01

    Occurrences of arsenic (As) are sporadic in drinking water from many wells in mid-coastal Maine. This is particularly the case where water supplies are pumped from fractured igneous and metamorphic bedrock. Although health risk-based As contamination levels are lowered, it is likely that the provenance of trace As concentrations will need to be scrutinized. Approximately 33% of wells sampled in the Goose River ground-watershed had at least one occurrence of 10 µg l-1 As. Geologic mapping in combination with the rock petrology and mineral chemistry were important in deciphering probable local source areas for arsenic. Median whole rock As is greater than 39 mg kg-1 in the Bucksport Formation and anatectic granitoids of the Waldoboro Pluton Complex. 34S isotopic composition of arsenian pyrites indicate that local areas of anomalous arsenic-bearing, transported soils are not the source of trace As in groundwater, but, instead, the As is derived from oxidation processes in the fractured bedrock along the western margin of the ground-watershed. In groundwater, the As3+/As5+ ratios ranged from 0.01 to 4.45 and were inconsistent spatially and temporally. Although it is probable that the stability field in most groundwater supplies is HAsO4 2-, arsenic speciation is not necessarily an aid to predicting transport. Instead an isotopic evaluation of associated groundwater SO4 2- clearly indicates a consistent correlation of elevated As with enriched δ34SSO4. The δ34SSO4 ranges of +4.05 to +4.61‰ may be characteristic of local oxidation in the fractured groundwater flow systems. Potential areas of geogenic As transport may be predictable.

  9. 76 FR 2112 - Peach Orchard Road Groundwater Plume Site, Augusta, Richmond County, GA; Notice of Settlement

    Science.gov (United States)

    2011-01-12

    ... AGENCY Peach Orchard Road Groundwater Plume Site, Augusta, Richmond County, GA; Notice of Settlement... costs concerning the Peach Orchard Road Groundwater Plume Site located in Augusta, Richmond County... Site name Peach Orchard Road Groundwater Plume Superfund Site by one of the following methods:...

  10. 75 FR 61417 - South River Watershed Dam No. 10A, Augusta County, VA

    Science.gov (United States)

    2010-10-05

    ... Natural Resources Conservation Service South River Watershed Dam No. 10A, Augusta County, VA AGENCY... not being prepared for the rehabilitation of South River Watershed Dam No. 10A, Augusta County... Register. [This activity is listed in the Catalog of Federal Domestic Assistance under 10.904,...

  11. Tracing mercury pathways in Augusta Bay (southern Italy) by total concentration and isotope determination.

    Science.gov (United States)

    Bonsignore, M; Tamburrino, S; Oliveri, E; Marchetti, A; Durante, C; Berni, A; Quinci, E; Sprovieri, M

    2015-10-01

    The mercury (Hg) pollution of sediments is the main carrier of Hg for the biota and, subsequently, for the local fish consumers in Augusta Bay area (SE Sicily, Italy), a coastal marine system affected by relevant sewage from an important chlor-alkali factory. This relationship was revealed by the determination of Mass Dependent (MDF) and Mass Independent Fractionation (MIF) of Hg isotopes in sediment, fish and human hair samples. Sediments showed MDF but no MIF, while fish showed MIF, possibly due to photochemical reduction in the water column and depending on the feeding habitat of the species. Benthic and demersal fish exhibited MDF similar to that of sediments in which anthropogenic Hg was deposited, while pelagic organisms evidenced higher MDF and MIF due to photoreduction. Human hair showed high values of δ(202)Hg (offset of +2.2‰ with respect to the consumed fish) and Δ(199)Hg, both associated to fish consumption. PMID:26074159

  12. Response of white sucker (Catostomus commersoni) to pulp and paper mill effluent in the Androscoggin River, Maine, USA.

    Science.gov (United States)

    Mower, Barry F; Munkittrick, Kelly R; McMaster, Mark E; Van Beneden, Rebecca J

    2011-01-01

    Adverse effects of pulp and paper mill effluent on fish populations have been well documented in many countries over the last two decades. Some of the initial studies were at mills with conventional chlorine bleaching and no secondary effluent treatment. Following installation of secondary treatment, changes in bleaching technology to elemental chlorine-free bleaching, and other process changes, adverse effects on fish were reduced or eliminated at some mills. Because no two mills are exactly alike, it is difficult to predict adverse impacts of any given mill on fish populations. In 1994, a study of female white sucker (Catostomus commersoni) in the Androscoggin River, Maine, USA, showed induction of mixed function oxidase, reductions in gonad size and plasma estradiol, and an increase in plasma testosterone in fish downstream of discharges from three large bleached kraft pulp and paper mills, and host community municipal sewage treatment plants (STP). After all three mills switched to elemental chlorine-free bleaching in the late 1990s, studies from 2001 to 2003 found that the pattern of reproductive impacts on white sucker populations measured in 1994 was not repeated. In addition, population estimates of white sucker from 2002 to 2003 using mark-recapture techniques found that densities and biomass were well within the range of those of a reference population, and of those reported in the literature for unimpacted populations. Detailed studies immediately above and below each mill/sewage treatment plant showed no evidence of reproductive effects. However, a clear pattern of eutrophication was noted, which increased cumulatively downstream below each mill/STP. PMID:20872897

  13. Antimicrobial and cytotoxic activities of Abroma augusta Lnn. leaves extract

    Institute of Scientific and Technical Information of China (English)

    FK Saikot; Alam Khan; MF Hasan

    2012-01-01

    Objective: To evaluate the antimicrobial and cytotoxic activity of acetone extract of leaves ofAbroma augusta. Methods: Disc diffusion method was used to demonstrate antibacterial and antifungal activities. Cytotoxicity was determined against brine shrimp nauplii. In addition, minimum inhibitory concentration (MIC) was determined using serial dilution technique to determine antibacterial potency. Results: The extract showed significant antibacterial activities against three gram-positive (Bacillus subtilis, Bacillus megaterium and Staphylococcus aureus) and four gram-negative (Escherichia coli, Shigella dysenteriae, Shigella sonnei and Salmonella typhi) bacteria. The antifungal activity was found strong against five fungi (Aspergillus flavus, Aspergillus niger, Candida albicans, Rhizopus oryzae and Aspergillus fumigatus). In cytotoxicity determination, LC50 of the extract against brine shrimp nauplii was 7.06μg/ml. Conclusions: The Abroma leaves extract may be consider as a potent antimicrobial and cytotoxic agent for further advance research.

  14. Constituintes químicos de Gustavia augusta L. (Lecythidaceae

    Directory of Open Access Journals (Sweden)

    Souza Afonso Duarte Leão de

    2001-01-01

    Full Text Available Gustavia augusta is used in the folk medicine against leishmaniosis and showed anti-inflammatory action. The phytochemical studies of the plant stem bark have led to the isolation of (22E-stigmasta-7,22-dien-3beta-ol, 24alpha(S-ethyl-5alpha-colesta-7,trans-22-dien-3-one, D-friedoolean-14-en-3beta-ol, D-friedoolean-14-en-3-one and D-friedoolean-14-en-3alpha-ol along with stigmasterol, alpha-amyrin, beta-amyrin, lupeol, 3alpha-hidroxi-lupeol and betulinic acid. The structures of these compounds were identified by IR, GC/MS, ¹H and 13C NMR spectral analysis and comparison with literature data.

  15. Edificios con forjados postesados mediante tendones no adherentes. Edificio Mapfre-Vía Augusta, en Barcelona-España

    Directory of Open Access Journals (Sweden)

    Llombart Jaques, José Antonio

    1994-08-01

    Full Text Available The technique of unbonded tendons applied to post-tensioned flat-slabs of buildings of certain importance has not been very frequent in Spain to date; in fact, it was used on very few occasions. This article gives the basic characteristics of the post-tensioned floors comparing them with the conventional solutions of reinforced concrete floors. The second part of the article brings a description of the main aspects of the design and construction of the Mapfre-Vía Augusta building in Barcelona. This recently raised building has the floor construction with slabs post-tensioned by unbonded tendons.

    La técnica del postesado no adherente, aplicada a losas de forjado de edificios de cierta entidad, ha sido hasta el momento poco común en España, habiéndose utilizado solamente en contadas ocasiones. Se indican, en primer lugar, las características fundamentales de los forjados postesados y se establecen comparaciones con soluciones convencionales de forjados de hormigón armado. En la segunda parte del artículo se describen los principales aspectos de proyecto y construcción de la estructura del Edificio Mapfre-Vía Augusta, en Barcelona, de reciente construcción, cuyos forjados están constituidos por losas postesadas mediante tendones no adherentes.

  16. Three-dimensional numerical simulations on wind- and tide-induced currents: The case of Augusta Harbour (Italy)

    Science.gov (United States)

    De Marchis, Mauro; Freni, Gabriele; Napoli, Enrico

    2014-11-01

    The hydrodynamic circulation in the coastal area of the Augusta Bay (Italy), located in the eastern part of Sicily, is analysed. Due to the heavy contamination generated by the several chemical and petrochemical industries active in the zone, the harbour was declared a Contaminated Site of National Interest. To mitigate the risks connected with the industrial activities located near the harbour, it is important to analyse the hydrodynamic circulation in the coastal area. To perform such analysis, a parallel 3D numerical model is used to solve the Reynolds-averaged momentum and mass balance, employing the k-ε turbulence model for the Reynolds stresses. The numerical model is parallelized using the programing technology - Message Passing Interface (MPI) and applying the domain decomposition procedure. The Augusta Bay circulation is mainly due to the relative contribution of the wind force acting over the free surface and the tidal motion through the mouths. Due to the geometric complexity of the domain and the presence of several piers along the coast, a curvilinear boundary-fitted computational grid was used, where cells corresponding to land areas or to wharfs were excluded from the computation. Comparisons between numerical results and field measurements were performed. Three different simulations were performed to selectively isolate the effect of each force, wind and tide, acting in the considered domain. The current in the basin was successfully estimated on the basis of the numerical results, demonstrating the specific role of wind and tidal oscillation in the hydrodynamic circulation inside the harbour.

  17. Broadening Educational Horizons: The National Science Foundation GK-12 Teaching Fellowship Program at the University of Maine, Orono, ME, USA.

    Science.gov (United States)

    Wilson, K. R.; Kelley, J. T.

    2005-12-01

    The future of meaningful scientific research in the United States depends heavily upon the quality of the science and mathematics education received by students in our grade K-12 education system. The National Science Foundation's GK-12 Teaching Fellowship Program provides opportunities for scientific enrichment for students and their teachers at the K-12 level. Currently in its fifth year at the University of Maine, Orono, the program is one of over 100 such programs in the country. Last year, the program was honored by the New England Board of Higher Education with a Regional Award for Excellence in Project Achievement. The program has three broad goals: to enrich the scientific education of students by providing equipment, role models, and expertise that they may not otherwise be exposed; to provide professional development for teachers through curriculum enrichment and participation at scientific conferences; and to improve the teaching and communication skills of fellows. Fellows represent a broad spectrum of research interests at the University of Maine, including Biology, Chemistry, Engineering, Forestry, Geological Sciences, and Marine Science. This past year, 13 graduate students and 1 undergraduate student worked with 52 teachers and 2300 students in 26 schools across the state of Maine. The benefits of this program are tangible and substantial. New awareness of the innovative ways that K-12 and University education systems can work together to promote hands-on science and the scientific method, is one of the major contributions of the NSF GK-12 Teaching Fellowship Program.

  18. The Penobscot River, Maine, USA: a Basin-Scale Approach to Balancing Power Generation and Ecosystem Restoration

    Directory of Open Access Journals (Sweden)

    Laura Rose Day

    2011-09-01

    Full Text Available Although hydropower is a source of low-carbon energy, without careful consideration and management, dams have the potential to degrade river ecosystems and the goods and services they provide to society. Today, a broad range of hydropower interests and stakeholders are seeking approaches to hydropower development and operation that are more environmentally and socially sustainable. The Penobscot River Restoration Project ('the Project' illustrates that basin-scale approaches can provide a broader set of solutions for balancing energy and riverine environmental resources than can be achieved at the scale of individual projects. The Penobscot basin is the largest in Maine and historically supported culturally and economically significant populations of migratory fish. These migratory fish populations declined dramatically following the construction of a series of hydropower dams on the main stem river and major tributaries in the early 20th century. The Project, negotiated between a power company (PPL Corporation and a coalition including the Penobscot Indian Nation, resource agencies, and nongovernmental conservation organizations, features the removal of two main stem dams on the lower Penobscot and improved fish passage at the dams that remain. Because of various capacity and/or operational changes, power production will be increased at the remaining dams and total hydropower energy production from the basin will be maintained or increase slightly. The Project is expected to expand considerably the proportion of the basin accessible to migratory fish and contribute to significant increases in fish populations. The Project illustrates that a basin-scale approach can potentially yield more comprehensive solutions for sustainable hydropower than can be achieved at the project scale, and we recommend that such large-scale planning processes can improve the sustainability of both regulatory licensing of existing dams as well as the planning of

  19. Vidrios romanos de Bracara Augusta (Portugal): análisis arqueométrico

    OpenAIRE

    García Giménez, Rosario; Petit-Domínguez, María Dolores; Soto García, Isabel Sonsoles de; Rucandio, M. I.

    2014-01-01

    En este trabajo se han estudiado vidrios romanos de Bracara Augusta, actualmente Braga (Portugal), a través de su composición química, analizando los constituyentes mayoritarios, minoritarios y traza mediante espectrometría de plasma-masas (ICPMS). Lo

  20. 76 FR 65380 - Safety Zone; 2011 Head of the South Regatta, Savannah River, Augusta, GA

    Science.gov (United States)

    2011-10-21

    ... Head of the South Regatta, which will consist of a series of rowing races. The 2011 Head of the South... hazards associated with the event. ] Discussion of Rule On November 11 and 12, 2011, Augusta Rowing Club is hosting the 2011 Head of the South Regatta, a series of rowing races on the Savannah River...

  1. Limestone fluidized bed treatment of acid-impacted water at the Craig Brook National Fish Hatchery, Maine, USA

    Science.gov (United States)

    Sibrell, P.L.; Watten, B.J.; Haines, T.A.; Spaulding, B.W.

    2006-01-01

    Decades of atmospheric acid deposition have resulted in widespread lake and river acidification in the northeastern U.S. Biological effects of acidification include increased mortality of sensitive aquatic species such as the endangered Atlantic salmon (Salmo salar). The purpose of this paper is to describe the development of a limestone-based fluidized bed system for the treatment of acid-impacted waters. The treatment system was tested at the Craig Brook National Fish Hatchery in East Orland, Maine over a period of 3 years. The product water from the treatment system was diluted with hatchery water to prepare water supplies with three different levels of alkalinity for testing of fish health and survival. Based on positive results from a prototype system used in the first year of the study, a larger demonstration system was used in the second and third years with the objective of decreasing operating costs. Carbon dioxide was used to accelerate limestone dissolution, and was the major factor in system performance, as evidenced by the model result: Alk = 72.84 ?? P(CO2)1/2; R2 = 0.975. No significant acidic incursions were noted for the control water over the course of the study. Had these incursions occurred, survivability in the untreated water would likely have been much more severely impacted. Treated water consistently provided elevated alkalinity and pH above that of the hatchery source water. ?? 2005 Elsevier B.V. All rights reserved.

  2. Mass balances of mercury and nitrogen in burned and unburned forested watersheds at Acadia National Park, Maine, USA

    Science.gov (United States)

    Nelson, S.J.; Johnson, K.B.; Kahl, J.S.; Haines, T.A.; Fernandez, I.J.

    2007-01-01

    Precipitation and streamwater samples were collected from 16 November 1999 to 17 November 2000 in two watersheds at Acadia National Park, Maine, and analyzed for mercury (Hg) and dissolved inorganic nitrogen (DIN, nitrate plus ammonium). Cadillac Brook watershed burned in a 1947 fire that destroyed vegetation and soil organic matter. We hypothesized that Hg deposition would be higher at Hadlock Brook (the reference watershed, 10.2 ??g/m2/year) than Cadillac (9.4 ??g/m2/year) because of the greater scavenging efficiency of the softwood vegetation in Hadlock. We also hypothesized the Hg and DIN export from Cadillac Brook would be lower than Hadlock Brook because of elemental volatilization during the fire, along with subsequently lower rates of atmospheric deposition in a watershed with abundant bare soil and bedrock, and regenerating vegetation. Consistent with these hypotheses, Hg export was lower from Cadillac Brook watershed (0.4 ??g/m2/year) than from Hadlock Brook watershed (1.3 ??g/m2/year). DIN export from Cadillac Brook (11.5 eq/ ha/year) was lower than Hadlock Brook (92.5 eq/ha/year). These data show that ??50 years following a wildfire there was lower atmospheric deposition due to changes in forest species composition, lower soil pools, and greater ecosystem retention for both Hg and DIN. ?? Springer Science + Business Media B.V. 2006.

  3. Flow and sorption controls of groundwater arsenic in individual boreholes from bedrock aquifers in central Maine, USA

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Qiang [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9 W, Palisades, NY 10964 (United States); School of Earth and Environmental Sciences, Queens College and Graduate Center, City University of New York, 65-30 Kissena Blvd., Flushing, NY 11367 (United States); Culbertson, Charles W.; Nielsen, Martha G.; Schalk, Charles W. [U.S. Geological Survey, Maine Water Science Center, 196 Whitten Road, Augusta, ME 04330 (United States); Johnson, Carole D. [U.S. Geological Survey, Branch of Geophysics, 11 Sherman Place, Unit 5015, University of Connecticut, Storrs, CT 06269 (United States); Marvinney, Robert G. [Maine Geological Survey, 93 State House Station, Augusta, ME 04333 (United States); Stute, Martin [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9 W, Palisades, NY 10964 (United States); Zheng, Yan, E-mail: yan.zheng@qc.cuny.edu [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9 W, Palisades, NY 10964 (United States); School of Earth and Environmental Sciences, Queens College and Graduate Center, City University of New York, 65-30 Kissena Blvd., Flushing, NY 11367 (United States)

    2015-02-01

    To understand the hydrogeochemical processes regulating well water arsenic (As) evolution in fractured bedrock aquifers, three domestic wells with [As] up to 478 μg/L are investigated in central Maine. Geophysical logging reveals that fractures near the borehole bottom contribute 70–100% of flow. Borehole and fracture water samples from various depths show significant proportions of As (up to 69%) and Fe (93–99%) in particulates (> 0.45 μm). These particulates and those settled after a 16-day batch experiment contain 560–13,000 mg/kg of As and 14–35% weight/weight of Fe. As/Fe ratios (2.5–20 mmol/mol) and As partitioning ratios (adsorbed/dissolved [As], 20,000–100,000 L/kg) suggest that As is sorbed onto amorphous hydrous ferric oxides. Newly drilled cores also show enrichment of As (up to 1300 mg/kg) sorbed onto secondary iron minerals on the fracture surfaces. Pumping at high flow rates induces large decreases in particulate As and Fe, a moderate increase in dissolved [As] and As(III)/As ratio, while little change in major ion chemistry. The δD and δ{sup 18}O are similar for the borehole and fracture waters, suggesting a same source of recharge from atmospheric precipitation. Results support a conceptual model invoking flow and sorption controls on groundwater [As] in fractured bedrock aquifers whereby oxygen infiltration promotes the oxidation of As-bearing sulfides at shallower depths in the oxic portion of the flow path releasing As and Fe; followed by Fe oxidation to form Fe oxyhydroxide particulates, which are transported in fractures and sorb As along the flow path until intercepted by boreholes. In the anoxic portions of the flow path, reductive dissolution of As-sorbed iron particulates could re-mobilize As. For exposure assessment, we recommend sampling of groundwater without filtration to obtain total As concentration in groundwater. - Highlights: • Most Fe and some As exist as particulates in the tested borehole and fracture water.

  4. Paleotsunamis Evidence In The Augusta Bay (Eastern Sicily, Italy)

    Science.gov (United States)

    Smedile, A.; de Martini, P.; Barbano, M. S.; Pantosti, D.; Gerardi, F.; Del Carlo, P.; Bellucci, L. G.; Gasperini, L.; Sagnotti, L.; Polonia, A.; Pirrotta, C.

    2008-12-01

    The Augusta Bay, in Eastern Sicily (Italy), was repeatedly hit by tsunami waves related to large historical earthquakes (e.g. 1908, 1693, 1169). The area is characterized by coastal lowlands or lagoons, and by a relatively wide continental shelf with a thick late-Holocene record that has been investigated through the acquisition of a tight grid of CHIRP-sonar profiles. Well targeted sediment samples have been collected both offshore and inland. The integrated interpretation of the geophysical and geological data has been carried out in order to recognize, date and correlate key-layers in the sediment column that may be directly or indirectly related to tsunami events. A total of 26 cores were collected inland at a maximum distance of 530 m from the present coastline. The clay and silt dominated stratigraphy is intercalated by at least 5 high-energy or anomalous depositional layers, repeatedly found in several cores. These layers are made of coarse to fine sand with sharp basal contacts and present a bioclastic component made of microfauna (foraminifera) and shell fragments both suggestive of a marine provenance. Chronological constraints on the age of these deposits is based on AMS radiocarbon datings and on the attribution of a tephra layer to the 122 BC Etna eruption (thanks to petro- chemical and morphoscopic analyses). Integrating these data, the inland sequence spans the last 4100 yrs and the two uppermost high-energy events could be related to the AD 1169 and 1693 historical tsunamis. The offshore record was studied from a 6.7 m-long piston-core collected at 70 m water depth. The homogeneous sequence of dark gray mud is interrupted at -3 m by the same Etna tephra deposit found inland. Through the analysis of tephrostratigraphy, radiocarbon datings, high resolution paleomagnetic analysis and radioactive tracers, the entire core sequence has been dated back to the last 4500 yrs. Moreover, the quantitative micropaleontological analysis on the benthic

  5. Abroma augusta L. (Malvaceae) leaf extract attenuates diabetes induced nephropathy and cardiomyopathy via inhibition of oxidative stress and inflammatory response

    OpenAIRE

    Khanra, Ritu; Dewanjee, Saikat; K Dua, Tarun; Sahu, Ranabir; Gangopadhyay, Moumita; De Feo, Vincenzo; Zia-Ul-Haq, Muhammad

    2015-01-01

    Background Abroma augusta L. (Malvaceae) leaf is traditionally used to treat diabetes in India and Southern Asia. Therefore, current study was performed to evaluate the protective effect of defatted methanol extract of A. augusta leaves (AA) against type 2 diabetes mellitus (T2DM) and its associated nephropathy and cardiomyopathy in experimental rats. Methods Antidiabetic activity of AA extracts (100 and 200 mg/kg, p.o.) was measured in streptozotocin-nicotinamide induced type 2 diabetic (T2D...

  6. DOE hearing on the draft area recommendation report for the Crystalline Repository Project, Augusta Armory, Augusta, Maine: Volume 2, April 7, 1986: Transcript of proceedings

    International Nuclear Information System (INIS)

    This document contains a transcript of the comments of 9 witnesses. These meetings were held to hear the public's comments regarding the selection of a site for a second high-level radioactive waste repository

  7. DOE hearing on the draft area recommendation report for the Crystalline Repository Project, Augusta Armory, Augusta, Maine, April 7, 1986: Volume 5: Transcript of proceedings

    International Nuclear Information System (INIS)

    This document contains a transcript of the comments of 11 witnesses. These meetings were held to hear the public's comments regarding the selection of a site for a second high-level radioactive waste repository

  8. DOE hearing on the draft area recommendation report for the Crystalline Repository Project, Augusta Armory, Augusta, Maine: Volume 1, April 7, 1986: Transcript of proceedings

    International Nuclear Information System (INIS)

    This document contains a transcript of the comments of 10 witnesses. These meetings were held to hear the public's comments regarding the selection of a site for a second high-level radioactive waste repository

  9. DOE hearing on the draft area recommendation report for the Crystalline Repository Project, Augusta Armory, Augusta, Maine, April 7, 1986: Volume 4: Transcript of proceedings

    International Nuclear Information System (INIS)

    This document contains a transcript of the comments of 6 witnesses. These meetings were held to hear the public's comments regarding the selection of a site for a second high-level radioactive waste repository

  10. More than a century of bathymetric observations and present-day shallow sediment characterization in Belfast Bay, Maine, USA: Implications for pockmark field longevity

    Science.gov (United States)

    Brothers, L.L.; Kelley, J.T.; Belknap, D.F.; Barnhardt, W.A.; Andrews, B.D.; Maynard, M.L.

    2011-01-01

    Mechanisms and timescales responsible for pockmark formation and maintenance remain uncertain, especially in areas lacking extensive thermogenic fluid deposits (e.g., previously glaciated estuaries). This study characterizes seafloor activity in the Belfast Bay, Maine nearshore pockmark field using (1) three swath bathymetry datasets collected between 1999 and 2008, complemented by analyses of shallow box-core samples for radionuclide activity and undrained shear strength, and (2) historical bathymetric data (report and smooth sheets from 1872, 1947, 1948). In addition, because repeat swath bathymetry surveys are an emerging data source, we present a selected literature review of recent studies using such datasets for seafloor change analysis. This study is the first to apply the method to a pockmark field, and characterizes macro-scale (>5 m) evolution of tens of square kilometers of highly irregular seafloor. Presence/absence analysis yielded no change in pockmark frequency or distribution over a 9-year period (1999-2008). In that time pockmarks did not detectably enlarge, truncate, elongate, or combine. Historical data indicate that pockmark chains already existed in the 19th century. Despite the lack of macroscopic changes in the field, near-bed undrained shear-strength values of less than 7 kPa and scattered downcore 137Cs signatures indicate a highly disturbed setting. Integrating these findings with independent geophysical and geochemical observations made in the pockmark field, it can be concluded that (1) large-scale sediment resuspension and dispersion related to pockmark formation and failure do not occur frequently within this field, and (2) pockmarks can persevere in a dynamic estuarine setting that exhibits minimal modern fluid venting. Although pockmarks are conventionally thought to be long-lived features maintained by a combination of fluid venting and minimal sediment accumulation, this suggests that other mechanisms may be equally active in

  11. An integrated approach to the assessment of pollutant delivery chronologies to impacted areas: Hg in the Augusta Bay (Italy).

    Science.gov (United States)

    Bellucci, Luca Giorgio; Giuliani, Silvia; Romano, Stefania; Albertazzi, Sonia; Mugnai, Cristian; Frignani, Mauro

    2012-02-21

    Assessing pollution levels and trends in heavily impacted environments is important but hardly achievable due to the difficulty of recovering suitable undisturbed sediment records. An integrated approach is here presented to solve this kind of problem. It was adopted in the Augusta Bay (Italy) for the study of Hg historical inputs and present trends. Archive information on dredging and mud disposal, together with bathymetry and high-resolution seismic profiles, were used to identify suitable sampling sites. Undisturbed sediment cores were collected in the port and bay. Sediments were analyzed for depth distributions of radiotracers ((210)Pb and (137)Cs), Hg, and main sediment parameters (magnetic susceptibility, grain size, dry bulk density, mineralogy, and organic carbon and nitrogen contents). Hexachlorobenzene (HCB) was also analyzed as an additional time tracer, since its production history in the area was well-known. Results show that peak Hg contamination (up to 575 mg·kg(-1)) was reached in the 1970s. Technological improvements and waste treatment in the following years determined a consistent decrease, but high concentrations still affect surficial sediments (0.25-92 mg·kg(-1)). Hg-HCB correlation suggests that this situation is likely the effect of resuspension and redistribution of deep sediments by dredging and naval traffic. PMID:22233219

  12. Worst-case scenario approach to the tsunami hazard assessment for the coastal areas between Augusta and Siracusa, eastern Sicily, Italy

    Science.gov (United States)

    Armigliato, Alberto; Pagnoni, Gianluca; Zaniboni, Filippo; Tinti, Stefano

    2015-04-01

    The province of Siracusa encompasses a very long portion of the eastern Sicily coastline, ranging from the southern part of the Catania Gulf to the north down to the southern-eastern end of the island, known as Capo Passero. Within this domain, the area comprised between the towns of Augusta and Siracusa has been selected as one of the sites for the testing of innovative methods for tsunami hazard, vulnerability and risk assessment and reduction developed in the frame of the EU Project called ASTARTE - Assessment, STrategy And Risk Reduction for Tsunamis in Europe (Grant 603839, 7th FP, ENV.2013.6.4-3). The selection was driven by two main reasons. First, the area was hit by at least seven tsunamis in the approximate time interval from 1600 BC to present, as can be deduced from historical catalogues and paleo-tsunami deposits analysis: the most famous are probably the 21 July 365, 4 February 1169, 11 January 1693 and 28 December 1908 tsunamis. Secondly, as a whole, the test site has a strong relevance from the industrial, commercial, military, historical and cultural points of view: here it is sufficient to mention the huge petrochemical pole in the Augusta bay and the listing of Siracusa as UNESCO World Heritage Site since 2005. This contribution deals with the tsunami hazard assessment for the Augusta-Siracusa area, approached through the worst-case credible scenario technique. We selected five main source areas: the choice is driven mainly by the already mentioned fact that historical catalogues and paleo-tsunami studies tell us that the area under investigation can be impacted by tsunamis generated both in the near-field and in the far-field. The five areas include the Hyblaean-Malta escarpment and the Messina Straits in the near-field, the western and eastern lobes of the Ionian subduction zone in the intermediate field, and the western Hellenic Trench in the far-field. In each source area, a selection of possible faults was made, whose characteristics and

  13. Sediment transport modelling based on grain size trend analysis in Augusta Harbour (Sicily)

    Science.gov (United States)

    Barbera, Giuseppe; Feo, Roberto; Freni, Gabriele

    2015-12-01

    To support marine civil engineer in pollutant studies, sediment management or dredging operations, is useful to know how the sediments move in accumulation basin. This paper investigates the dynamic of the sediment path using a two-dimensional numeric model: the Grain Size Trend Analysis (GSTA). The GSTA was applied using GiSedTrend plugin, under GIS software. The case study is the Augusta Harbour, which is one of the most polluted Italian harbours. It is the marine part of the Site of National Interest (SNI) of Priolo Gargallo (Siracusa, Italy) and it can be hydrodynamically considered as a lagoon. Two scenarios were obtained by using different geostatistical criteria.

  14. Under Augustus sign: the role of Astronomy in the foundation of Augusta Praetoria Salassorum

    OpenAIRE

    Bertarione, Stella Vittoria; Magli, Giulio

    2013-01-01

    Augusta Praetoria Salassorum, modern Aosta, was founded around 25 BC to celebrate the victory of Augustus army on the Salassi. Aosta is a city of the founder under many respects; for instance, one of the two twin temples of the forum was devoted to Augustus, and a huge triumphal arc to the ruler still welcomes the town visitors. Recently, a sculpted block has been uncovered, still in its original position, on a corner of one of the town towers. The block carries reliefs, such as a plough and ...

  15. In Memoriam doctora Augusta Noemí Ochoa López (1937-2015

    Directory of Open Access Journals (Sweden)

    Gabriela Rouillon

    2015-10-01

    Full Text Available La Doctora Augusta Noemí Ochoa López, nació un martes 4 de mayo de 1937 en Cañete, Lima. Empezó los estudios de la carrera de biología en la Universidad Nacional Mayor de San Marcos, en 1953, también llevo cursos de la carrera de Educación. Obtuvo su grado de Bachiller en Biología en el año 1966 con la Tesis “Observaciones sobre el Desove de la Anchoveta, Engraulis ringens J., en la zona del Callao”.

  16. Portuguese nursing: history of the life and activism of Maria Augusta Sousa

    Directory of Open Access Journals (Sweden)

    Deybson Borba de Almeida

    2016-06-01

    Full Text Available Abstract OBJECTIVE To analyze the history of the life and activism of Portuguese nurse Maria Augusta Sousa. METHOD Sousa's life story was obtained by means of semi-structured interview swith Sousa as the oral source of data. NVivo qualitative research software was used for data analysis. Content analysis focused on thematic analysis based on the theoretical and philosophical ideas of Michel Foucault, in particular, power and techniques of the self. RESULTS Alienation and political participation were revealed as pertinent issues. In techniques of production of activist subjects, the following were highlighted: the importance of the review of formal education; actions of involvement with the world, society and the profession; and finally, techniques of the self, techniques of constitution of activist subjects, professional identity and way of being. CONCLUSION The constitution of the nurse Maria Augusta Sousa as an activist came about through questioning of how to be, education in the context of her family, and political engagement in Catholic Youth. This impacted her trajectory of contributions to Portuguese nursing, as expressed in the following achievements: the integration of nursing training into higher education; the creation of the Regulation of Nurses Professional Practice; and implementation of the Order of Nurses.

  17. An assessment of streamflow, water quality, and the effects of constructing an impoundment on Bridge Creek at Augusta, Wisconsin

    Science.gov (United States)

    House, Leo B.

    1981-01-01

    This study documents Streamflow, temperature, and water-quality conditions of Bridge Creek at Augusta, Wisconsin, and evaluates the potential effects of a proposed small impoundment on the creek. The effects are of concern to the Wisconsin Department of Natural Resources because the stream is a Class II trout stream.

  18. Under Augustus sign: the role of Astronomy in the foundation of Augusta Praetoria Salassorum

    CERN Document Server

    Bertarione, Stella Vittoria

    2013-01-01

    Augusta Praetoria Salassorum, modern Aosta, was founded around 25 BC to celebrate the victory of Augustus army on the Salassi. Aosta is a city of the founder under many respects; for instance, one of the two twin temples of the forum was devoted to Augustus, and a huge triumphal arc to the ruler still welcomes the town visitors. Recently, a sculpted block has been uncovered, still in its original position, on a corner of one of the town towers. The block carries reliefs, such as a plough and a spade, which are clearly related to the town foundation ritual. As a consequence, we carried out an archaeoastronomical analysis of the original urban plan taking into account the complex natural horizon of the Alps in which Aosta valley is nested. The results show that the town was very likely oriented in such a way as to pinpoint Augustus associations with the cosmic signs of renewal: the winter solstice and the Capricorn.

  19. Noé en Mérida (Augusta Emérita

    Directory of Open Access Journals (Sweden)

    Arce, Javier

    2000-12-01

    Full Text Available For a long time, a relief, preserved in the Museo Nacional de Arte Romano in Mérida (Badajoz, Spain has been considered to be a representation of the oriental god Mithras Saxigenus and, therefore, as another witness of the oriental cults in the ancient capital of Lusitânia. Although some authors interpreted it differently, as a funeral banquet with a portrait of the dead person, nobody has yet proposed the Christian interpretation presented here: the image of Noah emerging from the Ark, shown on the front of a sarcophagus lid, and the representation of a celestial banquet celebrating the salvation of the dead. The piece is dated to the last quarter of the 3rd century AD and thus is the first archaeological evidence of Christianity in the colonia Augusta EmeritaSe estudia un relieve conservado en el Museo Nacional de Arte Romano de Mérida (Badajoz, España que durante mucho tiempo ha sido considerado como una representación de Mitra saxígeno y, por tanto, un documento más entre los testimonios de cultos orientales en la capital de la Lusitania. A pesar de que algunos autores dieron una interpretación diferente, esto es, que se trataba de un banquete funerario con la representación del difunto, ninguno ha propuesto la identificación con una escena cristiana que aquí se propone, representada en el frente de una tapa de sarcófago, con la imagen de Noé saliendo del arca y, a continuación, una representación del banquete celestial en el que participan los justos. La pieza se fecha en el último cuarto del siglo III d.C. y se convierte así en el primer testimonio arqueológico de la presencia de cristianos en la colonia Augusta Emerita.

  20. Planning, Implementing, and Evaluating a Program to Address the Oral Health Needs of Aboriginal Children in Port Augusta, Australia

    OpenAIRE

    Misan, G.; Jamieson, L. M.; L. Richards; H. Mills; A. Russell; Shearer, M.; Parker, E J

    2012-01-01

    Aboriginal Australian children experience profound oral health disparities relative to their non-Aboriginal counterparts. In response to community concerns regarding Aboriginal child oral health in the regional town of Port Augusta, South Australia, a child dental health service was established within a Community Controlled Aboriginal Health Service. A partnership approach was employed with the key aims of (1) quantifying rates of dental service utilisation, (2) identifying factors influencin...

  1. Past climate, future perspective: an exploratory analysis using climate proxies and drought risk assessment to inform water resources management and policy in Maine, USA.

    Science.gov (United States)

    Gupta, Avirup Sen; Jain, Shaleen; Kim, Jong-Suk

    2011-03-01

    In recent decades, significant progress has been made toward reconstructing the past climate record based on environmental proxies, such as tree rings and ice core records. However, limited examples of research that utilizes such data for water resources decision-making and policy exist. Here, we use the reconstructed record of Palmer Drought Severity Index (PDSI), dating back to 1138AD to understand the nature of drought occurrence (severity and duration) in the state of Maine. This work is motivated by the need to augment the scientific basis to support the water resources management and the emerging water allocation framework in Maine (Maine Department of Environmental Protection, Chapter 587). Through a joint analysis of the reconstructed PDSI and historical streamflow record for twelve streams in the state of Maine, we find that: (a) the uncertainties around the current definition of natural drought in the Chapter 587 (based on the 20th century instrumental record) can be better understood within the context of the nature and severity of past droughts in this region, and (b) a drought index provides limited information regarding at-site hydrologic variations. To fill this knowledge gap, a drought index-based risk assessment methodology for streams across the state is developed. Based on these results, the opportunities for learning and challenges facing water policies in a changing hydroclimate are discussed. PMID:21075507

  2. Using model analyses and surface-atmosphere exchange measurements from the Howland AmeriFlux Site in Maine, USA, to improve understanding of forest ecosystem C cycling

    Energy Technology Data Exchange (ETDEWEB)

    Hollinger, David Y.; Davidson, Eric A.; Richardson, Andrew D.; Dail, D. B.; Scott, N.

    2013-03-25

    Summary of research carried out under Interagency Agreement DE-AI02-07ER64355 with the USDA Forest Service at the Howland Forest AmeriFlux site in central Maine. Includes a list of publications resulting in part or whole from this support.

  3. Tsunami vulnerability and damage for buildings analyzed by means of two methods (PTVA-3 and SCHEMA) in the area of Augusta and Siracusa, eastern Sicily, Italy

    Science.gov (United States)

    Pagnoni, Gianluca; Tinti, Stefano

    2015-04-01

    aim of this work is to compare the vulnerability and damage analyses carried out by means of the PTVA-3 and the SCHEMA methods on the same data set, that is the urban and port areas of Siracusa and Augusta in order to highlight similarities and discrepancies. In this preliminary analysis the coastal inundation was not derived from tsunami simulations, but was assumed to be constant along the coast (bathtub hypothesis) and was taken to be 5 m and 10 m respectively for Siracusa and Augusta. The main outcome of the compared analysis is that the two methods do not provide completely overlapping vulnerability and damage maps, though they use equivalent 5-degree scales. In general the PTVA-3 method tends to overestimate the damage, although there are several counterexamples where PTVA-3 foresees less damage than SCHEMA. The differences we found in the assessment opens the question of how to treat uncertainties in the vulnerability and damage analyses, which is a problem often overlooked, but of crucial importance for the application and for civil authorities.

  4. Health-hazard evaluation report HETA 83-335-1618, Kendall Company, Augusta, Georgia. [Ethylene oxide

    Energy Technology Data Exchange (ETDEWEB)

    Seligman, P.; Gorman, R.

    1985-08-01

    Environmental and breathing-zone samples were analyzed for ethylene oxide at the Kendall Company, Augusta, Georgia in August, 1983 and July and August, 1984. The evaluation was requested confidentially to investigate employee complaints of eye irritation and neurologic symptoms and concern over an excessive number of miscarriages. Physicians at the Medical College of Georgia had reported cases of peripheral neuropathy and cataracts related to ethylene-oxide exposure. Twenty-one employees were interviewed. Company medical records were reviewed. Ethylene-oxide concentrations ranged from nondetectable to 0.83 part per million (ppm). The OSHA standard for ethylene oxide is 1.00 ppm. Grab samples taken during sterilizer down/loading contained 0.3 to 25.0ppm ethylene oxide. Medical records confirmed three cases of neuropathy and four of cataracts. Headache, eye irritation, and fatigue were the most prominent symptoms reported. Many of these symptoms were resolved when ethylene oxide was removed from the alcohol wipes. Five of six miscarriages were not occupationally related. The authors conclude that cases of peripheral neuropathy and cataracts among ethylene-oxide sterilizer operators can be related to past exposures, which were higher. Recommendations include using engineering controls to reduce ethylene-oxide exposure further and complying with OSHA recommendations in monitoring employees exposed to action-level concentrations of 0.5ppm ethylene oxide.

  5. Anthropogenic and natural lead isotopes in Fe-hydroxides and Fe-sulphates in a watershed associated with arsenic-enriched groundwater, Maine, USA

    Science.gov (United States)

    Ayuso, Robert A.; Foley, Nora K.

    2008-01-01

    A survey of the natural and anthropogenic sources of lead contributing to secondary minerals in sulphidic schists associated with arsenic-enriched groundwater in Coastal Maine shows that the most likely source is natural Pb, particularly from coexisting sulphide minerals. The secondary minerals also reflect notable contributions from anthropogenic Pb. The Pb isotopes establish pathways by which Pb, and by inference As, could have been transported from As-bearing minerals (arsenian pyrite, arsenopyrite, lollingite, orpiment, arsenic oxide and others), via sulphide oxidation or carbonation reactions into multiple generations of secondary minerals (goethite, hematite, jarosite, natrojarosite and others). Lead isotopic compositions of the sulphides and secondary minerals determined by thermal ionization mass spectrometry (n=53) range widely. Lead and As contents of the sulphides and secondary minerals overlap, and are generally positively correlated. Pyrite, the dominant sulphide in sulphidic schists associated with As-enriched groundwater in Coastal Maine, has values of 206Pb/204Pb from 18.186 to 18.391, 207Pb/204Pb from 15.617 to 15.657, 208Pb/204Pb from 38.052 to 38.210, 206Pb/207Pb from c. 1.1625 to 1.1760 and 208Pb/207Pb from c. 2.4276 to 2.4394. Mixtures of Fe-hydroxide and oxide minerals (predominantly goethite and hematite) and secondary Fe-sulphate minerals (jarosite, natrojarosite, rozenite and melanterite) in the sulphidic schists have overlapping but generally higher values of 206Pb/204Pb from 18.495 to 19.747 (one sample at 21.495), 207Pb/204Pb from 15.595 to 15.722 (one sample at 15.839), 208Pb/204Pb from 38.186 to 39.162,206Pb/207Pb from c.1.1860 to 1.2575 (one sample at 1.3855) and 208Pb/207Pb from c. 2.4441 to 2.4865 than the sulphides. Sulphides from Zn-Pb metal mines are somewhat less radiogenic than sulphides from the schists. Other sulphides (mostly pyrite) associated with pegmatites and granitic rocks are heterogeneous and more

  6. Construction of the Vinalhaven Intrusive Complex, Maine, USA: the Plutonic Record of Evolving Magma Chambers Affected by Multiple Episodes of Replenishment, Rejuvenation, Crystal Accumulation and Eruption

    Science.gov (United States)

    Wiebe, R. A.; Hawkins, D. P.

    2004-12-01

    Increasingly, the plutonic roots of volcanic systems can be shown to contain temporal records of events inferred from the study of volcanic rocks. The Vinalhaven intrusive complex preserves evidence for multiple episodes of silicic and mafic replenishments, rejuvenation of granite, and probable eruptive events over a nominal time-span of 1.7 Ma (Hawkins and Wiebe, this volume). The complex is about 12 km in diameter and consists mainly of cg granite, a thick section of arcuate, inward-dipping gabbro-diorite sheets in the southeastern half of the complex, and a circular core of fg granite. Field relations demonstrate that the base of the intrusion is along the southeastern margin of the complex, and the top is along the northwestern margin where it intrudes coeval volcanic rocks. Aphyric basaltic and granitic dikes fed this essentially bimodal intrusion. When basaltic dikes intersected a silicic chamber, basalt spread across a floor of silicic crystal mush to form gabbro-diorite sheets in granite. Several extensive layers of angular blocks of country rock occur within the mafic rocks. Granitic dikes and the fg granitic core of the complex have sharp to gradational contacts with cg granite, and, locally, both granites are intimately mixed and commingled. These relations indicate that new silicic injections mixed into partly crystallized resident magma. Several irregular bodies of porphyry (0.2 to 0.5 km in average dimension) intrude cg granite with sharp, gradational, or commingled contacts. The porphyry has 5 to 40% corroded phenocrysts, identical in composition to crystals in the granite, and a variably quenched matrix. Some of these bodies formed when late injections of basalt remelted largely solid portions of cg granite. New silicic input may have contributed to other porphyry bodies. The matrix probably quenched because of a sudden decrease in pressure, possibly due to eruption of magma from the chamber. The cg granite and inter-layered mafic rocks preserve a

  7. Characterization of concrete from Roman theatre and amphitheater in Emerita Augusta (Mérida, Spain)

    Science.gov (United States)

    Mota-Lopez, Maria Isabel; Fort, Rafael; Alvarez de Buergo, Monica; Pizzo, Antonio; Maderuelo-Sanz, Ruben; Meneses-Rodríguez, Juan Miguel

    2016-04-01

    The restoration of historical buildings is very important for the history and culture of the cities and their population. It requires an advanced knowledge of the building materials used for the construction of these structures. Previously to any intervention in historical buildings, it is necessary a historic-scientific study of the original material. Historic mortars or concretes can reveal us different composition and the dependence on the geographical location and the time period of its construction. Historical concretes are complex systems that contain aerial or hydraulic binders or a blend of them, with aggregates, not always crystalline, and others elements that interact with the binder. The use of different techniques for microstructural characterization of materials, like optical microscopy, X-ray diffractometry or petrophysical analysis, allows the determination of the composition and some properties of these concretes. However, each technique has its own limits and, in many cases, several characterization techniques must be used to obtain coherent and reliable results. The present study focuses on the compositional characterization of Roman concrete from Roman buildings for public spectacles of Emerita Augusta, Mérida, Spain. An advanced knowledge of the Roman concrete composition is required to get a reliable restoration and preservation of these ancient monuments. Various samples of concrete were extracted from different zones from this archaeological site. The concrete was studied through mineralogical analysis (petrographic microscope and XRD) and petrophysical properties determination (bulk and real density, open porosity, mercury porosimetry intrusion, compressive strength and Ultrasound propagation velocity). The results obtained allow us to know the original composition of the concrete and the provenance of the aggregates used in it. Acknowledgements: Community of Madrid for financing Geomateriales2 program (P2013/MIT2914), to the funding

  8. Programas de investigación en el Museo Nacional de Arte Romano: proyectos Foros de Augusta Emerita y Lusitania Romana

    Directory of Open Access Journals (Sweden)

    Nogales Basarrate, Trinidad

    2006-02-01

    Full Text Available This paper, taking as its starting point deficient position Museums find themselves in the course of their research activity, analyses two projects developed by the National Museum of Roman Art (MNAR. Both of these reflect two of the priority research avenues. First, the Foros de Augusta Emerita project is based on one of the Museum´s most important archaeological excavation and the corresponding exhibition discourse, and the results have aroused the interest of the international research community due to the evident link with Rome. Secondly, the Roman Lusitania programme aims to enlarge the scope from Augusta Emerita out in the colony´s sphere of influence.Este artículo, partiendo de la situación deficiente en que los Museos ejercitan su labor investigadora, analiza dos proyectos desarrollados desde el Museo Nacional de Arte Romano (MNAR. Ambos son reflejo de dos de sus líneas prioritarias de investigación. Por un lado, el proyecto Foros de Augusta Emerita se sustenta en uno de los trabajos de intervención arqueológica y discurso expositivo más importantes del MNAR, cuyos resultados han movido el interés de la comunidad científica internacional por sus evidentes conexiones con Roma. Por otra parte, el programa Lusitania Romana pretende ampliar las líneas científicas desde Augusta Emerita en relación con su territorio de influencia.

  9. Retinal chromophore structure and Schiff base interactions in red-shifted channelrhodopsin-1 from Chlamydomonas augustae.

    Science.gov (United States)

    Ogren, John I; Mamaev, Sergey; Russano, Daniel; Li, Hai; Spudich, John L; Rothschild, Kenneth J

    2014-06-24

    Channelrhodopsins (ChRs), which form a distinct branch of the microbial rhodopsin family, control phototaxis in green algae. Because ChRs can be expressed and function in neuronal membranes as light-gated cation channels, they have rapidly become an important optogenetic tool in neurobiology. While channelrhodopsin-2 from the unicellular alga Chlamydomonas reinhardtii (CrChR2) is the most commonly used and extensively studied optogenetic ChR, little is known about the properties of the diverse group of other ChRs. In this study, near-infrared confocal resonance Raman spectroscopy along with hydrogen-deuterium exchange and site-directed mutagenesis were used to study the structure of red-shifted ChR1 from Chlamydomonas augustae (CaChR1). These measurements reveal that (i) CaChR1 has an all-trans-retinal structure similar to those of the light-driven proton pump bacteriorhodopsin (BR) and sensory rhodopsin II but different from that of the mixed retinal composition of CrChR2, (ii) lowering the pH from 7 to 2 or substituting neutral residues for Glu169 or Asp299 does not significantly shift the ethylenic stretch frequency more than 1-2 cm(-1) in contrast to BR in which a downshift of 7-9 cm(-1) occurs reflecting neutralization of the Asp85 counterion, and (iii) the CaChR1 protonated Schiff base (SB) has stronger hydrogen bonding than BR. A model is proposed to explain these results whereby at pH 7 the predominant counterion to the SB is Asp299 (the homologue to Asp212 in BR) while Glu169 (the homologue to Asp85 in BR) exists in a neutral state. We observe an unusual constancy of the resonance Raman spectra over the broad range from pH 9 to 2 and discuss its implications. These results are in accord with recent visible absorption and current measurements of CaChR1 [Sineshchekov, O. A., et al. (2013) Intramolecular proton transfer in channelrhodopsins. Biophys. J. 104, 807-817; Li, H., et al. (2014) Role of a helix B lysine residue in the photoactive site in

  10. Modeling, Analysis, and Preservation Techniques for Historic Reinforced Concrete Structures in Seismic Prone Regions Case Study: Augusta Airship Hangar, Sicily

    International Nuclear Information System (INIS)

    Throughout the world there are hundreds of historic monuments and structures considered to be invaluable and irreplaceable. They are symbols of cultural identity and a means of educating people about history. Preservation of historic monuments and structures is therefore an important part of safeguarding these cultural heritage sites so that they retain their value for future generations.This report discusses a procedure for the investigation of seismic hazards in existing buildings and possible steps that can be taken to avoid damage caused by these hazards. The Augusta Airship Hangar located in Sicily, will be used as a case study however the topics addressed in this paper can be applied to other structures of historic value around the world.First state-of-the-art scanning procedures were used to create scale digital models that were imported into a structural analysis program. Within this program dynamic analyses were performed on the model based on actual ground motions taken close to the site. This data was used to determine the period and mode shapes of the structure. Then a nonlinear analysis, including a static pushover analysis, was implemented on a two-dimensional model of the structural frame. From this analysis the failure mechanisms of the structure were revealed with relation to an allowable roof displacement. The structural integrity of the structure was evaluated based on pre-defined performance goals. Finally multiple suggestions were made how the Augusta Airship Hangar might be repaired and strengthened so that this structure will not be destroyed should an earthquake occur.The results of our study show that historic structures, despite their age, can still be strong and ductile. Also there are a multitude of effective preservation and retrofit techniques that can be used to strengthen these historic structures, should an earthquake occur. Through this study, the Augusta Airship Hangar has proven to be not only a historic symbol for Sicily but

  11. Planning, Implementing, and Evaluating a Program to Address the Oral Health Needs of Aboriginal Children in Port Augusta, Australia

    Directory of Open Access Journals (Sweden)

    E. J. Parker

    2012-01-01

    Full Text Available Aboriginal Australian children experience profound oral health disparities relative to their non-Aboriginal counterparts. In response to community concerns regarding Aboriginal child oral health in the regional town of Port Augusta, South Australia, a child dental health service was established within a Community Controlled Aboriginal Health Service. A partnership approach was employed with the key aims of (1 quantifying rates of dental service utilisation, (2 identifying factors influencing participation, and (3 planning and establishing a program for delivery of Aboriginal children’s dental services that would increase participation and adapt to community needs. In planning the program, levels of participation were quantified and key issues identified through semistructured interviews. After 3.5 years, the participation rate for dental care among the target population increased from 53 to 70 percent. Key areas were identified to encourage further improvements and ensure sustainability in Aboriginal child oral health in this regional location.

  12. Planning, implementing, and evaluating a program to address the oral health needs of aboriginal children in port augusta, australia.

    Science.gov (United States)

    Parker, E J; Misan, G; Shearer, M; Richards, L; Russell, A; Mills, H; Jamieson, L M

    2012-01-01

    Aboriginal Australian children experience profound oral health disparities relative to their non-Aboriginal counterparts. In response to community concerns regarding Aboriginal child oral health in the regional town of Port Augusta, South Australia, a child dental health service was established within a Community Controlled Aboriginal Health Service. A partnership approach was employed with the key aims of (1) quantifying rates of dental service utilisation, (2) identifying factors influencing participation, and (3) planning and establishing a program for delivery of Aboriginal children's dental services that would increase participation and adapt to community needs. In planning the program, levels of participation were quantified and key issues identified through semistructured interviews. After 3.5 years, the participation rate for dental care among the target population increased from 53 to 70 percent. Key areas were identified to encourage further improvements and ensure sustainability in Aboriginal child oral health in this regional location. PMID:22577401

  13. Un tesoro de tremises visigodos hallado en el llamado «Foro Provincial» de Augusta Emerita

    Directory of Open Access Journals (Sweden)

    Mateos Cruz, Pedro

    2005-12-01

    Full Text Available Since 1999 we are working on a research project about the so called «Provincial Forum of Augusta Emerita». The project deals with the realisation of archaeological interventions in the various lots where remains of public architecture linked with this monumental ensemble have been documented. One of these interventions has been realised in a lot where remains of the so called «Temple of the Holguin-Street» appeared some years ago. During the works on the same site has been brought to light a treasure of twenty gold coins from the time of Leovigild hidden under the walls of a room which in late Antiquity reused the southern side of the Roman temple podium. This article is a study of these pieces set in context with their hiding position and the historical moment in which they have been in use.Desde el año 1999 estamos desarrollando un proyecto de investigación en el llamado «foro Provincial de Augusta Emerita»; el proyecto contempla la realización de intervenciones arqueológicas en los distintos solares donde se han documentado restos de arquitectura pública vinculados a este conjunto monumental. Una de estas intervenciones se ha efectuado en el solar donde hace años aparecieron los restos del denominado «templo de la C/ Holguín», lugar en el que, durante el desarrollo de los trabajos, apareció un tesoro de veinte monedas de oro de época de Leovigildo, oculto bajo los muros de una estancia que reutilizo en época tardoantigua el alzado Sur del podio del templo romano. En este artículo se realiza un estudio de estas piezas contextualizándolas con el lugar de ocultamiento y el momento histórico en que estuvieron en uso.

  14. Tsunami hazard assessment for the area of Siracusa and Augusta (eastern Sicily, Italy) by means of numerical techniques

    Science.gov (United States)

    Tinti, Stefano; Armigliato, Alberto; Pagnoni, Gianluca; Zaniboni, Filippo

    2014-05-01

    The eastern coast of Sicily is one of the littorals most prone to tsunami hazard in the Mediterranean Sea. The potential tsunamigenic sources are many, all connected to the complex geological pattern of the area, and they span different scales. On the local scale one can find the Hyblaean-Malta Escarpment (HME), characterized by mass failures that have been hypothesized as possible causes of local tsunami generation (see e.g. the deep-sea slide off Augusta that was speculatively associated to the 1693 earthquake). On the medium range, the faults along the HME, the Ionian Sea, the Messina Straits, as a part of the wider Calabrian Arc system, provided several relevant earthquakes in the past, some of which producing large tsunamis, such as the 1693 and the 1908 events. In the far field, the western Hellenic Arc, characterized by the largest earthquakes in the whole Mediterranean Sea, has the potential of big trans-Mediterranean tsunamis capable of severe effects also on the coasts of Sicily. In the framework of the EU-FP7 project ASTARTE, the area embracing the cities of Siracusa and Augusta, located in the southern part of the Ionian coast of Sicily, has been chosen as a test site for the evaluation of the tsunami hazard and risk by means of various techniques. In this work we adopt the worst-case credible scenario approach, which means that after taking into account the possible sources in different zones we select the largest events on the basis of historical and geo- and seismo-tectonical considerations and we compute the corresponding tsunami. The numerical calculations are carried out by means of in-house developed models: UBO-BLOCK to simulate the dynamics of the tsunamigenic slides, a code implementing the Okada equations to compute the co-seismic displacements of the sea floor, UBO-TSUFD to calculate the tsunami propagation over a domain covered by one or more regularly spaced grids with different resolution (the finer grids being nested within the coarser

  15. Public health assessment for petitioned addendum, southern wood Piedmont Company, Augusta, Richmond County, Georgia, Region 4. Cerclis No. GAD051034387. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-21

    The Southern Wood Piedmont (SWP) Site is a former wood-treating facility in Augusta, Georgia. A petitioned public health assessment for this site was finalized in March, 1992. This addendum provides an evaluation of additional information that the Agency for Toxic Substances and Disease Registry (ATSDR) has received since the release of its last public health assessment. Based on this information, ATSDR concluded that the site posed a public health hazard prior to 1993. However, data acquired in 1993 confirm that the site no longer poses a public health hazard to the surrounding neighborhoods.

  16. Phenotypes and Virulence among Staphylococcus aureus USA100, USA200, USA300, USA400, and USA600 Clonal Lineages

    OpenAIRE

    King, Jessica M.; Kulhankova, Katarina; Stach, Christopher S.; Vu, Bao G.; Salgado-Pabón, Wilmara

    2016-01-01

    ABSTRACT Staphylococcus aureus diseases affect ~500,000 individuals per year in the United States. Worldwide, the USA100, USA200, USA400, and USA600 lineages cause many of the life-threatening S. aureus infections, such as bacteremia, infective endocarditis, pneumonia, toxic shock syndrome, and surgical site infections. However, the virulence mechanisms associated with these clonal lineages, in particular the USA100 and USA600 isolates, have been severely understudied. We investigated the vir...

  17. Main Facilities

    International Nuclear Information System (INIS)

    This chapter discuss on main nuclear facilities available in the Malaysian Institute for Nuclear Technology Research (MINT). As a national research institute whose core activities are nuclear science and technology, MINT are made up of main commercializable radiation irradiators, pilot plant and fully equipped laboratories. Well elaboration on its characteristics and functions explain for RTP (PUPSPATI TRIGA reactors), Cobalt-60 gamma irradiator, electron beam accelerators, and radioactive waste management center

  18. Augusta Emérita. La investigación arqueológica en una ciudad de época romana

    Directory of Open Access Journals (Sweden)

    Mateos Cruz, Pedro

    2001-12-01

    Full Text Available This article is an ample summary of the recent archaeological results developed in the last years in the roman colony of Augusta Emerita (modern Mérida, Spain. Recent systematic research has change many old views and statements about the urbanistic development of the roman colony as a result of the new scientific proyects undetaken recently, that offer a new undestanding of the evolution of Mérida during the Roman period.En este artículo se plantea la evolución del conocimiento de la ciudad romana de Emerita Augusta a partir de las investigaciones desarrolladas por historiadores y arqueólogos en los últimos años. Con ellas se han puesto en duda argumentos cerrados secularmente, sugiriendo, al menos, una imagen ciudadana distinta a la supuesta hasta ahora, con una fisonomía urbana resultado de variados proyectos, y con procesos y ciclos que, aunque en ocasiones no acertamos a situar o valorar correctamente, ayudan a entender cómo se conformó el devenir y la evolución de Mérida en época antigua.

  19. Assessment of mercury exposure in human populations: A status report from Augusta Bay (southern Italy).

    Science.gov (United States)

    Bonsignore, Maria; Andolfi, Nunzia; Barra, Marco; Madeddu, Anselmo; Tisano, Francesco; Ingallinella, Vincenzo; Castorina, Maria; Sprovieri, Mario

    2016-10-01

    Here we investigate mercury concentrations in the blood (HgB), urine (HgU) and human hair (HgH) of 224 individuals from a coastal area (Eastern Sicily, SE Italy) strongly affected by Hg contamination from one of the largest chlor-alkali plants in Europe. The factors affecting the distribution of Hg and the extent of the exposure of individuals have been explored with a multidisciplinary approach. Multiple regression analyses, together with evidence of high levels of HgB (exceeding the HBMI recommended levels in 50% of cases) and HgH (exceeding the EPA reference dose in 70% of cases), primarily suggest that the consumption of local fish is the main source of Hg for humans. no. significant exposure to inorganic mercury was identified. Toxicokinetic calculations produced a provisional tolerable weekly intake (PTWI) level that, in most cases, exceeds international recommendations, particularly for residents in the studied area. PMID:26806294

  20. Field Demonstration of a High-Efficiency Packaged Rooftop Air Conditioning Unit at Fort Gordon, Augusta, GA

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, Peter R.; Sullivan, Gregory P.; Parker, Graham B.

    2006-03-31

    As part of a larger program targeting the market transformation of packaged rooftop air conditioning, five high-efficiency rooftop air conditioning products were selected in 2002 by the U.S. Department of Energy (DOE) under the Unitary Air Conditioner (UAC) Technology Procurement (http://www.pnl.gov/uac). In February 2003, Fort Gordon in Augusta, Georgia was chosen as the demonstration site. With the goal of validating the field performance and operation of one of the awarded products, a 10-ton high-efficiency packaged rooftop unit (RTU) manufactured by Global Energy Group (GEG) was installed at Fort Gordon in October 2003. Following equipment installation, power metering, air- and refrigerant-side instrumentation was installed on the GEG RTU and a 4-year old typical-efficiency 20-ton RTU manufactured by AAON . The GEG and AAON units were instrumented identically and operated May through July, 2005, to observe performance under a range of conditions. Based on the data collected as part of this demonstration, the GEG equipment performed at least 8% better in stage-1 (single compressor running) cooling and at least 16% better in stage-2 (both compressors running) than the baseline AAON equipment. Performance comparisons are based on what we call application EER normalized to equivalent specific fan power. The full-load, specific-fan-power-normalized application EERs at ARI design conditions were 10.48 Btu/Wh for the GEG and 9.00 Btu/Wh for the baseline machine. With a cost premium of nearly 50%, and slightly higher maintenance costs, the life-cycle cost analysis shows that the GEG technology pays for itself--a positive net-present value (NPV)--only in climates and buildings with long cooling seasons. Manufacture of this equipment on a larger scale can be expected to reduce costs to the point where it is more broadly cost-effective. The assumed 10-ton baseline and new-technology unit costs are $3824.00 and $5525.00 respectively. If the new technology cost is assumed

  1. Main Memory

    NARCIS (Netherlands)

    Boncz, P.A.; Liu, L.; Özsu, M. Tamer

    2008-01-01

    Primary storage, presently known as main memory, is the largest memory directly accessible to the CPU in the prevalent Von Neumann model and stores both data and instructions (program code). The CPU continuously reads instructions stored there and executes them. It is also called Random Access Memor

  2. Chemotaxonomic significance of flavonoids, coumarins and triterpenes of Augusta longifolia (Spreng. Rehder, Rubiaceae-Ixoroideae, with new insights about its systematic position within the family Significância quimiotaxômica de flavonoides, cumarinas e triterpenos de Augusta longifolia (Spreng. Rehder, Rubiaceae-Ixoroideae, com novos entendimentos sobre a posição sistemática dentro da família

    Directory of Open Access Journals (Sweden)

    Rafael Choze

    2010-07-01

    Full Text Available Augusta has traditionally been placed in the tribe Rondeletieae, subfamily Cinchonoideae. However, recent molecular phylogenies positioned it near to Wendlandia (Ixoroideae, but locate A. longifolia near to the clade Ixoroidinae II. The study of A. longifolia afforded two coumarins, five flavonoids, three triterpenoids and one benzoic acid derivative. These metabolites reinforce the separation of Augusta as a monospecific genus, and Lindenia as a genus of three species, closely related to Wendlandia.Augusta tem sido tradicionalmente colocada na tribo Rondeletieae, Cinchonoideae subfamília. No entanto, recentes filogenias moleculares posicionou-a perto de Wendlandia, porém localizando A. longifolia perto do clado Ixoroidinae II. O estudo de A. longifolia resultou em duas cumarinas, cinco flavonoides, três triterpenoides e um derivado do ácido benzóico. Estes metabolitos reforçam a separação da Augusta como um gênero monoespecífico, e Lindenia como um gênero de três espécies, intimamente relacionada com Wendlandia.

  3. MAIN ABSTRACTS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Zhou Enlai and the Sinicization of Marxism Chen Dacai As a key member of the first generation of collective leadership of the CPC, Zhou Enlai contributed greatly to the theoretical cause of the sinicization of Marxism. Such contribution mainly include the fllowing aspects: he spread Marxism in a at a very special historical period as one of the representative of the earliest Chinese Marxists; he presented at an early stage the relationship between Marxism and Chinese revolution,

  4. Estimates of Cl atom concentrations and hydrocarbon kinetic reactivity in surface air at Appledore Island, Maine (USA), during International Consortium for Atmospheric Research on Transport and Transformation/Chemistry of Halogens at the Isles of Shoals

    Science.gov (United States)

    Pszenny, Alexander A. P.; Fischer, Emily V.; Russo, Rachel S.; Sive, Barkley C.; Varner, Ruth K.

    2007-05-01

    Average hydroxyl radical (OH) to chlorine atom (Cl·) ratios ranging from 45 to 119 were determined from variability-lifetime relationships for selected nonmethane hydrocarbons (NMHC) in surface air from six different transport sectors arriving at Appledore Island, Maine, during July 2004. Multiplying these ratios by an assumed average OH concentration of 2.5 × 106 cm-3 yielded estimates of Cl· concentrations of 2.2 to 5.6 × 104 cm-3. Summed reaction rates of methane and more than 30 abundant NMHCs with OH and Cl· suggest that Cl· reactions increased the kinetic reactivity of hydrocarbons by 16% to 30% over that due to OH alone in air associated with the various transport sectors. Isoprene and other abundant biogenic alkenes were the most important hydrocarbon contributors after methane to overall kinetic reactivity.

  5. Textural, mineralogical and stable isotope studies of hydrothermal alteration in the main sulfide zone of the Great Dyke, Zimbabwe and the precious metals zone of the Sonju Lake Intrusion, Minnesota, USA

    Science.gov (United States)

    Li, C.; Ripley, E.M.; Oberthur, T.; Miller, J.D., Jr.; Joslin, G.D.

    2008-01-01

    Stratigraphic offsets in the peak concentrations of platinum-group elements (PGE) and base-metal sulfides in the main sulfide zone of the Great Dyke and the precious metals zone of the Sonju Lake Intrusion have, in part, been attributed to the interaction between magmatic PGE-bearing base-metal sulfide assemblages and hydrothermal fluids. In this paper, we provide mineralogical and textural evidence that indicates alteration of base-metal sulfides and mobilization of metals and S during hydrothermal alteration in both mineralized intrusions. Stable isotopic data suggest that the fluids involved in the alteration were of magmatic origin in the Great Dyke but that a meteoric water component was involved in the alteration of the Sonju Lake Intrusion. The strong spatial association of platinum-group minerals, principally Pt and Pd sulfides, arsenides, and tellurides, with base-metal sulfide assemblages in the main sulfide zone of the Great Dyke is consistent with residual enrichment of Pt and Pd during hydrothermal alteration. However, such an interpretation is more tenuous for the precious metals zone of the Sonju Lake Intrusion where important Pt and Pd arsenides and antimonides occur as inclusions within individual plagioclase crystals and within alteration assemblages that are free of base-metal sulfides. Our observations suggest that Pt and Pd tellurides, antimonides, and arsenides may form during both magmatic crystallization and subsolidus hydrothermal alteration. Experimental studies of magmatic crystallization and hydrothermal transport/deposition in systems involving arsenides, tellurides, antimonides, and base metal sulfides are needed to better understand the relative importance of magmatic and hydrothermal processes in controlling the distribution of PGE in mineralized layered intrusions of this type. ?? Springer-Verlag 2007.

  6. MAIN CONTENTS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The Key to Agricultural Science and Technology Innovation should be placed on the FiveMajor Changes Based on analysis and forecasting on grain consumption influencing factors, production influencing factors and import influencing factors, the supply and demand of main sorts of grain in China is forecas- ted respectively, including paddy, wheat, corn and soybean. In 2020, grain consumption quantity, grain production quantity and grain import quantity of China is 693 million tons, 644 million tons and 49 million tons respectively. For grain security in future, new stratagem on food security should be im- plemented, grain import circumstance and global grain security. Father mechanism should be im- proved, and early warning and regulation on grain production capacity should be paid attention to sys- temically.

  7. A comparison between shell-based δ13C values from an extratropical setting (Gulf of Maine, USA) and atmospheric δ13C values for intervals of the last millennium: insights on regional hydrography and carbon dynamics

    Science.gov (United States)

    Wanamaker, A. D.; Kreutz, K. J.; Introne, D.; Beirne, E. C.

    2010-12-01

    To explore past changes in carbon dynamics in the Gulf of Maine, and to further evaluate the utility of stable carbon isotope ratios (δ13C) derived from the aragonitic shells of the marine bivalve Arctica islandica in global change studies, we compared annual shell δ13C values (N = 4; total of 333 years) with published atmospheric δ13C data (derived from ice cores [AD 1006 to AD 1978; N = 58 measurements] and instrumental series (AD 1981 to AD 2008; total of 28 years]) for intervals of the last millennium. Both datasets were modeled using an exponential function to highlight the low frequency trends in the data and to facilitate a relevant comparison. From AD 1000 to AD 1800, the modeled atmospheric δ13C series increased by 0.20 ‰ (change = 0.00025 ‰ per year), while modeled shell δ13C series decreased by 0.24 ‰ (change = -0.00030 ‰ per year). From AD 1800 to present, both modeled δ13C datasets decreased substantially due to the admixture of isotopically negative carbon derived from increased fossil fuel emissions. The magnitude of the change during this interval in the atmospheric pool was 2.0 ‰ (rate = - 0.0095 ‰ per year), whereas the change in the shell-based values was 1.1 ‰ (rate = - 0.0052 ‰ per year), approximately half of the change noted in the atmosphere. Remarkably, the rate of change in shell δ13C values during the last 200 years was 17 times faster than the previous 800 years. Although the long-term offset (range 8.9 - 8.5 ‰) between atmospheric and shell δ13C data was not constant from AD 1000 to AD 1800, the converging nature of the modeled data suggest that regional hydrographic conditions within the Gulf of Maine during the last millennium have also influenced the δ13C signature in the shells. We will explore some possible hydrographic mechanisms that might explain the divergence between atmospheric and shell-based δ13C values. Despite the noted difference in the atmospheric and shell-based δ13C records, it appears

  8. 美国企业强化内部审计工作的主要措施及启示%Main Measures and Enlightenment of USA Companies Strengthening Internal Audit

    Institute of Scientific and Technical Information of China (English)

    梁水源

    2012-01-01

    美国内部审计专业机构的《2011年度内部审计能力与需要的调查报告》阐述了美国企业内部审计工作的能力与需要的情况。本文介绍了美国企业强化内部审计工作的主要措施:进行一次风险评估,然后有针对性地采取措施;及时发现与确认风险的苗头,努力做到防患于未然;将风险因素以发生的概率大小来进行排列顺序;认真贯彻落实(《萨班斯法案》;提高各项交易业务检查与检测的频率;以增加公司价值为目的,建立增值管理型内部审计;尽可能实施质量保证复审措施。在此基础上,本文结合我国实践,提出了几点建议:建立健全法律制度,加大对违规行为的处罚力度;进一步完善内部审计的信息披露机制;正确处理内部审计与外部审计的关系,等等。%Protiviti's 2011 lnternal Audit Capabilities and Needs Survey states the American enterprise internal audit work's situation of capability and needs. There are 10 main measures of the US companies strengthening internal audit, such as, to conduct a risk assessment, and take targeted measures, to identify emerging risks, provide against possible troubles, to sequence risk factors according to probability of occurrence, to conscientiously fall Sarbanes-Oxley, to increase transaction check frequency and density, to set up adding value manage type internal audit in order to add value; to perform a quality assurance review(QAR). There are 5 inspiration and policy proposals, for instance, to establish and improve legal system, to strengthen punish violate action, to further improve information disclosure mechanism, to correctly handle relationship of internal audit and external audit.

  9. Main findings

    International Nuclear Information System (INIS)

    Licensing regimes vary from country to country. When the license regime involves several regulators and several licenses, this may lead to complex situations. Identifying a leading organisation in charge of overall coordination including preparation of the licensing decision is a useful practice. Also, if a stepwise licensing process is implemented, it is important to fix in legislation decisions and/or time points and to identify the relevant actors. There is considerable experience in civil and mining engineering that can be applied when constructing a deep geological disposal facility. Specific challenges are, however, the minimization of disturbances to the host rock and the understanding of its long-term behavior. Construction activities may affect the geo-hydraulic and geochemical properties of the various system components which are important safety features of the repository system. Clearly defined technical specifications and an effective quality management plan are important in ensuring successful repository implementation which is consistent with safety requirements. Monitoring plan should also be defined in advance. The regulatory organization should prepare itself to the licensing review before construction by allocating sufficient resources. It should increase its competence, e.g., by interacting early with the implementer and through its own R and D. This will allow the regulator to define appropriate technical conditions associated to the construction license and to elaborate a relevant inspection plan of the construction work. After construction, obtaining the operational license is the most important and crucial step. Main challenges include (a) establishing sufficient confidence so that the methods for closing the individual disposal units comply with the safety objectives and (b) addressing the issue of ageing of materials during a 50-100 years operational period. This latter challenge is amplified when reversibility/retrievability is required

  10. Phenotypes and Virulence among Staphylococcus aureus USA100, USA200, USA300, USA400, and USA600 Clonal Lineages.

    Science.gov (United States)

    King, Jessica M; Kulhankova, Katarina; Stach, Christopher S; Vu, Bao G; Salgado-Pabón, Wilmara

    2016-01-01

    Staphylococcus aureus diseases affect ~500,000 individuals per year in the United States. Worldwide, the USA100, USA200, USA400, and USA600 lineages cause many of the life-threatening S. aureus infections, such as bacteremia, infective endocarditis, pneumonia, toxic shock syndrome, and surgical site infections. However, the virulence mechanisms associated with these clonal lineages, in particular the USA100 and USA600 isolates, have been severely understudied. We investigated the virulence of these strains, in addition to strains in the USA200, USA300, and USA400 types, in well-established in vitro assays and in vivo in the rabbit model of infective endocarditis and sepsis. We show in the infective endocarditis and sepsis model that strains in the USA100 and USA600 lineages cause high lethality and are proficient in causing native valve infective endocarditis. Strains with high cytolytic activity or producing toxic shock syndrome toxin 1 (TSST-1) or staphylococcal enterotoxin C (SEC) caused lethal sepsis, even with low cytolytic activity. Strains in the USA100, USA200, USA400, and USA600 lineages consistently contained genes that encode for the enterotoxin gene cluster proteins, SEC, or TSST-1 and were proficient at causing infective endocarditis, while the USA300 strains lacked these toxins and were deficient in promoting vegetation growth. The USA100, USA200, and USA400 strains in our collection formed strong biofilms in vitro, whereas the USA200 and USA600 strains exhibited increased blood survival. Hence, infective endocarditis and lethal sepsis are multifactorial and not intrinsic to any one individual clonal group, further highlighting the importance of expanding our knowledge of S. aureus pathogenesis to clonal lineages causative of invasive disease. IMPORTANCE S. aureus is the leading cause of infective endocarditis in the developed world, affecting ~40,000 individuals each year in the United States, and the second leading cause of bacteremia (D. R

  11. Assessment of sediment contamination in Casco Bay, Maine, USA

    Energy Technology Data Exchange (ETDEWEB)

    Wade, Terry L. [Geochemical and Environmental Research Group, Texas A and M University, 833 Graham Road, College Station, TX 77845 (United States); Sweet, Stephen T. [Geochemical and Environmental Research Group, Texas A and M University, 833 Graham Road, College Station, TX 77845 (United States)], E-mail: sweet@gerg.tamu.edu; Klein, Andrew G. [Geography Department, Texas A and M University, 814B Eller O and M Building, College Station, TX 77843 (United States)

    2008-04-15

    The current status of contaminant concentrations in Casco Bay, decadal trends of these contaminants and changes in their geographical distribution are assessed using sediment samples collected approximately 10 years apart. In general, regulated contaminants appeared to be decreasing in concentration. Total PAH and dioxins/furans concentrations did not significantly change over this period. Total organochlorine pesticides, 4,4-DDE, 4,4-DDD, total DDT, PCB, tributyltin and total butyltin decreased in concentration. Trace element concentrations in sediments decreased at the majority of the sampling sites for chromium, nickel, and selenium while arsenic, cadmium, copper, lead, mercury, silver, and zinc remained relatively constant. None of the contaminants measured has increased by more than a factor of 2. Selected sites located in the Inner Bay, where concentrations are higher and new inputs were more likely, showed increased concentrations of contaminants. Most contaminants were not found at concentrations expected to adversely affect sediment biota based on ERL/ERM guidelines. - Sediment studies indicate decadal decreases for many chemical contaminants in Casco Bay.

  12. Glemmer USA Afghanistan nu?

    DEFF Research Database (Denmark)

    Jakobsen, Peter Viggo

    2015-01-01

    Hvis Obamas efterfølger kan skrue den rigtige strategiske fortælling sammen så vil USA ikke forlade Afghanistan med udgangen af 2016.......Hvis Obamas efterfølger kan skrue den rigtige strategiske fortælling sammen så vil USA ikke forlade Afghanistan med udgangen af 2016....

  13. Det sorte USA

    DEFF Research Database (Denmark)

    Brøndal, Jørn

    Bogen gennemgår det sorte USAs historie fra 1776 til 2016, idet grundtemaet er spændingsforholdet mellem USAs grundlæggelsesidealer og den racemæssige praksis, et spændingsforhold som Gunnar Myrdal kaldte "det amerikanske dilemma." Bogen, der er opbygget som politisk, social og racemæssig historie...

  14. School Psychology Research and Scholarship: USA Status, International Explorations.

    Science.gov (United States)

    Strein, William; Cramer, Katurah; Lawser, Matthew

    2003-01-01

    Addresses questions regarding research in school psychology by coding all of the articles published from 1994-1998 in the main USA school psychology journals and in "School Psychology International." Assessment-related topics and research on clinical/personality issues dominated the USA literature, while clinical/personality and professional…

  15. Health assessment for petitioned public health assessment, Southern Wood Piedmont Company, Augusta, Richmond County, Georgia, Region 4. CERCLIS No. GAD051034387. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1992-03-13

    The Southern Wood Piedmont (SWP) site is located in Augusta, Georgia. Wood-treating operations were conducted at the site from 1923 until 1988. Closure operations at the facility were regulated under the Resource Conservation and Recovery Act (RCRA). When the facility was operating, wastewaters containing hazardous substances were discharged to an on-site, unlined surface impoundment and to off-site drainage ditches. These disposal practices resulted in contamination of groundwater with high concentrations of wood treatment chemicals. Currently, all of the homes in the affected neighborhoods are reportedly connected to the public water system. Sediment samples from drainage ditches along the eastern border of the SWP facility were contaminated with site-related chemicals. The SWP site is categorized as an indeterminate public health hazard. Past exposures to on-site and off-site contamination may have exceeded current dose levels. ATSDR has recommended to the U.S. Environmental Protection Agency (EPA) and the Georgia Environmental Protection Division (EPD) that action be taken.

  16. USA Hire Testing Platform

    Data.gov (United States)

    Office of Personnel Management — The USA Hire Testing Platform delivers tests used in hiring for positions in the Federal Government. To safeguard the integrity of the hiring processes and ensure...

  17. Analysis of complex pumping interactions during an aquifer test conducted at a well field in the coastal plain near Augusta, Georgia, October 2009

    Science.gov (United States)

    Gonthier, Gerald J.

    2009-01-01

    A 24-hour aquifer test was conducted in Well Field 2 near Augusta, Georgia, October 21–22, 2009, to characterize the hydraulic properties of the Midville aquifer system. The selected well was pumped at a rate of 684 gallons per minute. At the initiation of aquifer-test pumping, water levels in each of eight wells monitored for the test were still recovering from the well-field production. Because water levels had not stabilized, data analyses were needed to account for the ongoing recovery. Hydraulic properties of the Midville aquifer system were estimated by an approach based on the Theis model and superposition. The Midville aquifer system was modeled as a Theis aquifer. The principle of superposition was used to sum the effects of multiple pumping and recovery events from a single pumped well and to sum the effects of all pumped wells as the estimated total drawdown at a monitored well. Simulated drawdown at each monitored well was determined by using a spreadsheet (SUMTheis) function of aquifer transmissivity and storativity. Simulated drawdown values were transformed into simulated water levels, accounting for longterm water-level trends. The transmissivity and storativity values that were used to calibrate the simulated water levels to measured water levels (roughly 4,000 square feet per day and 2E-04, respectively) provide estimates of the transmissivity and storativity of the Midville aquifer system in the vicinity of Well Field 2. The approach used in this study can be applied to similar well-field tests in which incomplete drawdown recovery or other known pumping is evident.

  18. Baltimaade kunsti turnee USAs

    Index Scriptorium Estoniae

    1998-01-01

    5. nov.-st USA Lõuna-Carolina osariigis Wellington B. Grey galeriis ja Jenkins Fine Art Center's 13 eesti, läti ja leedu kunstniku näitus, mis hakkab kolme aasta jooksul ringlema Ameerikas. Eksponeeritud fotokunst, video, installatsioon, joonistused. Kuraator Peeter Linnap ja Mari Laanemets peavad ettekande näituse avamisega samal ajal toimuval Fotohariduse Ühingu konverentsil

  19. Guantanamo rikub USA seadusi / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2003-01-01

    Kaks USA tsiviilkohut leiavad oma otsuses, et USA valitsus rikub USA-s ja Guantanamo sõjaväebaasis kinnipeetavate nn. vaenlasvõitlejate õigusi. Inimõigusorganisatsioonid avaldavad heameelt kohtute otsuste üle

  20. USA-USSR protocol

    CERN Multimedia

    1970-01-01

    On 30 November the USA Atomic Energy Commission and the USSR State Committee for the Utilization of Atomic Energy signed, in Washington, a protocol 'on carrying out of joint projects in the field of high energy physics at the accelerators of the National Accelerator Laboratory (Batavia) and the Institute for High Energy Physics (Serpukhov)'. The protocol will be in force for five years and can be extended by mutual agreement.

  1. SECURITIZATION AS A MAIN INSTRUMENT OF STRUCTURED FINANCE FOR BANKS: THEORETICAL BASIS AND LATEST TENDENCIES

    OpenAIRE

    V. Kyrii

    2013-01-01

    In the article theoretical basis of securitization process was considered as main instrument for banks structured finance. Also features for main instruments of securitization were provided. The latest tendencies on securitization market in USA and Europe were analyzed.

  2. Tšarterkool USA-s / Johannes Kiersch

    Index Scriptorium Estoniae

    Kiersch, Johannes

    2001-01-01

    24.-27. mainì 01 toimub Tallinnas EFFE 2001 (European Forum of Freedom in Education) konverents "Haridus tänases kodanikuühiskonnas." Konverentsil esineb ka Witteni Waldorf-pedagoogika Instituudi õppejõud Johannes Kiersch. Lähemalt tema artiklist USA-s populaarsust võitvate tsharterkoolide kohta, mis on riigi- ja erakooli vahevorm

  3. Euroopa teadis USA salavanglaist / Tõnis Erilaid

    Index Scriptorium Estoniae

    Erilaid, Tõnis, 1943-

    2005-01-01

    USA endise välisministri Colin Powelli sõnul pole see tema sõpradele Euroopas uudiseks, et USA on viinud vange riikidesse, kus tema seadused ei kehti. USA praeguse välisministri Condoleezza Rice'i sõnul on USA vange üle kuulanud väljaspool USA-d. USA Today kirjeldab Stare Kiejkuty küla Poolas, kus arvatavasti on olnud salavangla

  4. USA-s valmib Eesti reisisaadete sari / Maris Meiessaar

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2009-01-01

    Eesti juurtega ameerika filmimees James Tusty oma dokfilmi "Laulev revolutsioon" sünnist ja retseptsioonist. Praegu valmistub ta koos Allfilmiga Euroopa telekanalite jaoks tegema filmi sellesuvisest laulupeost ning USA televisiooni jaoks 13-osalist sarja "Estonia"

  5. Pepeljajev eesti näitlejatega USA-s

    Index Scriptorium Estoniae

    2008-01-01

    Sasha Pepeljajevi tantsulavastust "Uksed" etendati USA rahvusvahelisel teatrifestivalil "Arts & Ideas". Vene-Eesti trupi Apparatus lavastus on pühendatud Daniil Harmsi 100. sünniaastapäevale ning põhineb tema töödel

  6. Future USA development

    International Nuclear Information System (INIS)

    The planning for further development in the USA at this time is a mixture of expectation and guessing. Modeling development is certain to continue, but the target reactor is uncertain. The next plant may or may not use the FFTR driver fuel design. The planning, therefore, emphasizes fundamentals and flexibility. There are many options to be modeled. The FFTF driver fuel performance in FFTF must be evaluated; both the reference and improved designs. A decision to use the FFTR driver design in the large plant will demand predictions on the effects of axial blankets, constant power (rather than decreasing) throughout life, and power changes, behavior beyond breach and design basis transients in large plants. A decision favoring a lower doubling time oxide design adds the effects of higher strength/lower swelling alloys, increased pin diameter, reduced cladding thickness/diameter, increased smeared density, gap versus pellet density, and reduced pin pitch/diameter. A helium bonded carbide design adds concern about increased potential for fuel-cladding-assembly mechanical interactions. And blanket pin performance predictions, either in a homogeneous or a heterogeneous core, add an increasing power history and enhanced assembly interactions. It is possible that the decision will be to choose a first core and retain all options for later cores. The modeling objective, for whatever options are chosen, is to predict the effect of normal and off-normal design conditions on performance limits (i.e., fuel temperature, pin deformation, pin lifetime). Several significant uncertainties in the mechanisms associated with the performance limits remain and will be addressed. These include gap closure, gap conductance and fuel properties at higher burnup, fuel-fission product reactions, retained gas, breach mechanisms, assembly interactions and behavior beyond breach, plus establishing appropriate criteria. The LIFE system, with its elements of 1D and 2D fundamental modeling

  7. USA pelgab Hiina tehnoloogialuuret / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2005-01-01

    Hiina Ameerika-vastasest majandusluurest. USA luureameti andmetel on USA-s loodud üle kolme tuhande Hiina firma, kelle ülesandeks on tööstusliku või sõjalise tehnoloogia hankimine. Vt. samas: Hiina firmad ostavad üha suuremaid USA ettevõtteid

  8. Kohtusid Eesti ja USA presidendid

    Index Scriptorium Estoniae

    2007-01-01

    25. juunil 2007 kohtusid Washingtonis Valges Majas USA president George W. Bush ja Eesti president Toomas Hendrik Ilves. Kõne all oli viisavabadus, arengud Afganistanis ja Iraagis, NATO küberkaitsekeskuse loomine Tallinna. T.H. Ilves kohtus ka USA Kongressi Esindajatekoja spiikri Nancy Pelosi, kaitseminister Robert Gates'i ja parlamendiliikmetega. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  9. Turbine main engines

    CERN Document Server

    Main, John B; Herbert, C W; Bennett, A J S

    1965-01-01

    Turbine Main Engines deals with the principle of operation of turbine main engines. Topics covered include practical considerations that affect turbine design and efficiency; steam turbine rotors, blades, nozzles, and diaphragms; lubricating oil systems; and gas turbines for use with nuclear reactors. Gas turbines for naval boost propulsion, merchant ship propulsion, and naval main propulsion are also considered. This book is divided into three parts and begins with an overview of the basic mode of operation of the steam turbine engine and how it converts the pressure energy of the ingoing ste

  10. FrogwatchUSA

    Science.gov (United States)

    Droege, S.

    2002-01-01

    full text: Frogs and toads are perhaps the most approachable and available of all our wildlife. In many, if not most places, they are abundant. In wetter parts of the East, almost anyone outside on a warm rainy night in spring will hear their dream-like calls, bellows, trills and snores. Even in the deserts of the Southwest, a nocturnal trip after a summer monsoon will yield toads moving across the roads toward a cacophonous orgy of mating and calling in the roadside ditches and desert pools. Birds share with frogs and toads this same sense of presence in our daily lives. But the difference is that birds are like the attractive neighbor who just never gives you the time of day, while frogs are more like the troglodyte who appears regularly to chat, philosophize, and have a beer. Uninvited, frogs appear in our water gardens, toads are on our stoops in the morning, we catch them when we are kids, raise their babies in the aquarium, and feel sorry when we find we have run them over with the lawnmower. When concerns about declining populations of amphibians reached the mass media, the Secretaries' office became involved. In addition to using traditional research mechanisms to investigate the problem, the Secretary also wanted to involve the public directly. The combination of high public appeal and the relative ease with which frog calls can be learned made a large-scale monitoring program for frogs and toads possible. What emerged was a program called Frogwatch USA, modeled after a successful Canadian program with a similar name. A web site was created (www.frogwatch.org) that presented potential frogwatchers with directions and a way to register their site online as well as enter their data. Observers chose where to count frogs depending on what they felt was important. For some it was their backyard, others chose vulnerable wetlands in their neighborhoods, or spots on local refuges and parks. Initially funded at $8,000 a year and then after two years increased to

  11. 2004 Maine Lidar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This metadata document describes the collection and processing of Light Detection and Ranging (LIDAR) data over an area along the coast of Maine. Data was collected...

  12. Vliv obchodní politiky USA na jejich postavení v rámci světového obchodu

    OpenAIRE

    Harutjunjan, Hrant

    2013-01-01

    The main aim of the thesis is to determine factors that influence USA trade policy. Secondary objectives are to specify the influence of USA trade policy on their economy and also to determine the trends of major trade policy measures of USA from 1990 until now. Theoretical part is about theory of trade policy in general and application on USA trade policy. Practical part of the diploma thesis includes the facts of US economy, trade policy, multilateral and bilateral agreements and territoria...

  13. Abstracts of Main Essays

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    On Engels'Dialectics of "Theoretical Thinking" Sun Zheng-yu The main significant contribution to Marxist dialectics of Engels is to formulate dialectics on the level of theoretical thinking. This contribution is expressed in three aspects: 1 ) generalizing thoroughly the historical evolution of the way of thinking embodied in science history, philosophy history and human history;

  14. Main facts 1993

    International Nuclear Information System (INIS)

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  15. Main facts 1995

    International Nuclear Information System (INIS)

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations

  16. Maine Bouguer Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Bouguer anomaly grid for the state of Maine. Number of columns is 197 and number of rows is 292. The order of the data is from the lower left to the...

  17. Renovating the Main Building

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    CERN's "Main Building" is exactly that. The Organization's central hub, with hundreds of staff and visitors passing through its doors every day, will soon be getting a well-earned facelift. Refurbishment work will proceed in phases, starting with the Salle des Pas Perdus, the concourse between the Council Chamber and the Main Auditorium. By the end of August, informal seating areas will be installed, electronic display panels will provide practical information and improved sound insulation will enhance conditions in the auditoria and surrounding meeting rooms.   In light green the area that will undergo the facelift. Work will start in July. The ground floor is home to the entrance to Restaurant No. 1, the bank, the post office, the travel agent, the Users Office, the Staff Association, the notice boards etc. Step up to the first floor to access CERN's largest lecture theatre, the Council Chamber and its "Pas Perdus" lobby. Everyone who works at or visits CERN i...

  18. Main roads to melanoma

    Directory of Open Access Journals (Sweden)

    Sini Maria

    2009-10-01

    Full Text Available Abstract The characterization of the molecular mechanisms involved in development and progression of melanoma could be helpful to identify the molecular profiles underlying aggressiveness, clinical behavior, and response to therapy as well as to better classify the subsets of melanoma patients with different prognosis and/or clinical outcome. Actually, some aspects regarding the main molecular changes responsible for the onset as well as the progression of melanoma toward a more aggressive phenotype have been described. Genes and molecules which control either cell proliferation, apoptosis, or cell senescence have been implicated. Here we provided an overview of the main molecular changes underlying the pathogenesis of melanoma. All evidence clearly indicates the existence of a complex molecular machinery that provides checks and balances in normal melanocytes. Progression from normal melanocytes to malignant metastatic cells in melanoma patients is the result of a combination of down- or up-regulation of various effectors acting on different molecular pathways.

  19. Marketing Maine Tablestock Potatoes

    OpenAIRE

    Berney, Gerald; Grajewski, Gregory; Hinman, Don; Prater, Marvin E.; Taylor, April

    2010-01-01

    The Marketing Services Division of USDA’s Agricultural Marketing Service (AMS) was asked by USDA’s Agricultural Research Service (ARS) National Program Leader and ARS’s New England Soil and Water Research Laboratory personnel to help with existing efforts to assist Maine fresh potato farmers in their search for alternative marketing strategies, and reverse the recent decline in the profitability of their operations. ARS researchers previously had conducted an exhaustive study defining possibl...

  20. Megainvesteering USA terasekompaniilt / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2000-01-01

    USA kompanii RUMA toob tänavu Muuga sadamasse ülisuure, ligi 2,2 miljardi kroonise välisinvesteeringu teraseterminali näol. Tabel: Välisinvesteeringute TOP 10. Ilmunud ka: Delovõje Vedomosti 29. märts lk. 4

  1. Dyslexia Laws in the USA

    Science.gov (United States)

    Youman, Martha; Mather, Nancy

    2013-01-01

    Throughout the various states of the USA, the appropriate identification of dyslexia and the timely provision of interventions are characterized by variability and inconsistency. Several states have recognized the existence of this disorder and the well-established need for services. These states have taken proactive steps to implement laws and…

  2. USA panustab keskkonda / Jeffrey Goldstein

    Index Scriptorium Estoniae

    Goldstein, Jeffrey

    2007-01-01

    USA uus energiapoliitika kava näeb ette bensiini tarbimise vähendamist järgneva 10 aasta jooksul 20%, mis omakorda vähendab ameeriklaste autodest eralduva süsihappegaasi heitmete kasvu ning vähendab sõltuvust naftast

  3. Sõda, mille USA on juba kaotanud / Mart Helme

    Index Scriptorium Estoniae

    Helme, Mart, 1949-

    2003-01-01

    USA pole suutnud Iraagi-vastase sõja vajalikkust põhjendada, arvavad paljud USA poliitikavaatlejad. Rängaks diplomaatiliseks eksimuseks peetakse USA kaitseministri Donald Rumsfeldi avaldust, et USA ei vaja kellegi abi sõjas

  4. USA andis Gruusiale vastakaid signaale / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2008-01-01

    USA välisministri Condoleezza Riceþi saabumisest Thbilisisse, et avaldada Gruusiale toetust. USA poolt antud soovitustest Gruusia president Mihhail Saakashvilile mitte jõudu kasutada ega alluda Venemaa provokatsioonidele ning hoiatustest sõjalise konflikti tagajärgede eest. USA analüütikute arvamusi

  5. USA suursaadikuga Tallinna lahel / Katrin Kruss

    Index Scriptorium Estoniae

    Kruss, Katrin

    2007-01-01

    USA suursaadik Stanley Davis Phillips oma haridusteest, perekonnast, armastusest mere vastu, panusest isa Earl Phillipsi mööbliäri laiendamisse, golfiharrastusest, suursaadikute ettevalmistusest USA-s, suursaadiku residentsist Pirital ning uue saatkonnahoone otsingutest Tallinnas. Lisa: Stanley Davis Phillips

  6. USA kaitsetollide vastu / Joseph E. Stiglitz

    Index Scriptorium Estoniae

    Stiglitz, Joseph E.

    2002-01-01

    USA poolt tollide kehtestamine imporditavale terasele on põhjustanud protesti. Riigid, eriti Euroopas, mis on võimelised USA-le vastu hakkama, peavad seda tegema nüüd. Karmide abinõude tarvitusele võtmine on nii nende kui ka USA huvides

  7. The main players

    International Nuclear Information System (INIS)

    About 30 French main players in the field of energy (political parties, administrations, companies, non-governmental organizations and think-tanks) have been reported and dispatched on a chart according to their opinions following 2 axis: pro- versus anti-nuclear energy and pro- versus anti-wind power. The energy sector in France is dominated by 4 companies: EDF, GDF-Suez, Areva and Total, all are strongly pro-nuclear. All the political parties except EELV (Europe-Ecology-Les-Verts) are favourable to nuclear energy. Most non-governmental organizations are favourable to renewable energies, but the FED (Federation Environnement Durable) gathers local associations fighting the installations of wind turbines. (A.C)

  8. Abstracts of Main Essays

    Institute of Scientific and Technical Information of China (English)

    Feng Zi-yi

    2011-01-01

    On Deepening the Research on the Law of the Social Horizontal Development Feng Zi-yi The further development of globalization makes it urgent to deepen the research on the law of social hori- zontal development. Historical development of human society has experienced periods of isolation, multi-cen- ter, and globalization, while the truly horizontal development began from modernity. This kind of development is driven mainly by the logic of capital. The transforming process of capital, from dominating the whole process of economic development toward all aspects of social life, and from dominating nations toward the whole world, is also the logical process of capital pursuing itself and the process of social horizontal and wholly development as well. Horizontal and vertical developments of the society are interacting always. Researching on the law of social horizontal development is important for us to adapt to the historical trend consciously, to grasp the logic of capital rationally and to choose the right road of development.

  9. Main Oxidizer Valve Design

    Science.gov (United States)

    Addona, Brad; Eddleman, David

    2015-01-01

    A developmental Main Oxidizer Valve (MOV) was designed by NASA-MSFC using additive manufacturing processes. The MOV is a pneumatically actuated poppet valve to control the flow of liquid oxygen to an engine's injector. A compression spring is used to return the valve to the closed state when pneumatic pressure is removed from the valve. The valve internal parts are cylindrical in shape, which lends itself to traditional lathe and milling operations. However, the valve body represents a complicated shape and contains the majority of the mass of the valve. Additive manufacturing techniques were used to produce a part that optimized mass and allowed for design features not practical with traditional machining processes.

  10. Uranium and radon in private bedrock well water in Maine: geospatial analysis at two scales.

    Science.gov (United States)

    Yang, Qiang; Smitherman, Paul; Hess, C T; Culbertson, Charles W; Marvinney, Robert G; Smith, Andrew E; Zheng, Yan

    2014-04-15

    In greater Augusta of central Maine, 53 out of 1093 (4.8%) private bedrock well water samples from 1534 km(2) contained [U] >30 μg/L, the U.S. Environmental Protection Agency's (EPA) Maximum Contaminant Level (MCL) for drinking water; and 226 out of 786 (29%) samples from 1135 km(2) showed [Rn] >4,000 pCi/L (148 Bq/L), the U.S. EPA's Alternative MCL. Groundwater pH, calcite dissolution and redox condition are factors controlling the distribution of groundwater U but not Rn due to their divergent chemical and hydrological properties. Groundwater U is associated with incompatible elements (S, As, Mo, F, and Cs) in water samples within granitic intrusions. Elevated [U] and [Rn] are located within 5-10 km distance of granitic intrusions but do not show correlations with metamorphism at intermediate scales (10(0)-10(1) km). This spatial association is confirmed by a high-density sampling (n = 331, 5-40 samples per km(2)) at local scales (≤10(-1) km) and the statewide sampling (n = 5857, 1 sample per 16 km(2)) at regional scales (10(2)-10(3) km). Wells located within 5 km of granitic intrusions are at risk of containing high levels of [U] and [Rn]. Approximately 48 800-63 900 and 324 000 people in Maine are estimated at risk of exposure to U (>30 μg/L) and Rn (>4000 pCi/L) in well water, respectively.

  11. Uranium and radon in private bedrock well water in Maine: geospatial analysis at two scales

    Science.gov (United States)

    Yang, Qiang; Smitherman, Paul; Hess, C.T.; Culbertson, Charles W.; Marvinney, Robert G.; Zheng, Yan

    2014-01-01

    In greater Augusta of central Maine, 53 out of 1093 (4.8%) private bedrock well water samples from 1534 km2 contained [U] >30 μg/L, the U.S. Environmental Protection Agency’s (EPA) Maximum Contaminant Level (MCL) for drinking water; and 226 out of 786 (29%) samples from 1135 km2 showed [Rn] >4,000 pCi/L (148 Bq/L), the U.S. EPA’s Alternative MCL. Groundwater pH, calcite dissolution and redox condition are factors controlling the distribution of groundwater U but not Rn due to their divergent chemical and hydrological properties. Groundwater U is associated with incompatible elements (S, As, Mo, F, and Cs) in water samples within granitic intrusions. Elevated [U] and [Rn] are located within 5–10 km distance of granitic intrusions but do not show correlations with metamorphism at intermediate scales (100−101 km). This spatial association is confirmed by a high-density sampling (n = 331, 5–40 samples per km2) at local scales (≤10–1 km) and the statewide sampling (n = 5857, 1 sample per 16 km2) at regional scales (102–103 km). Wells located within 5 km of granitic intrusions are at risk of containing high levels of [U] and [Rn]. Approximately 48 800–63 900 and 324 000 people in Maine are estimated at risk of exposure to U (>30 μg/L) and Rn (>4000 pCi/L) in well water, respectively.

  12. SECURITIZATION AS A MAIN INSTRUMENT OF STRUCTURED FINANCE FOR BANKS: THEORETICAL BASIS AND LATEST TENDENCIES

    Directory of Open Access Journals (Sweden)

    V. Kyrii

    2013-11-01

    Full Text Available In the article theoretical basis of securitization process was considered as main instrument for banks structured finance. Also features for main instruments of securitization were provided. The latest tendencies on securitization market in USA and Europe were analyzed.

  13. 10 aastat USA-Balti hartat

    Index Scriptorium Estoniae

    2008-01-01

    10 aasta möödumisest 16. jaanuaril 1998 Valges Majas toimunud tseremooniast kui Ameerika Ühendriikide, Leedu, Läti ja Eesti presidendid allkirjastasid USA-Balti partnerlusharta. Eesti, Läti, Leedu presidentide ühisavaldusest - "ajalooline poliitiline teetähis Balti-USA riikide suhtes", tähistamaks USA-Balti partnerlusharta 10. aastapäeva. President George W. Bushi õnnitlusest Eesti, Läti ja Leedu elanikele harta 10. aastapäeva puhul\\

  14. Eesti on USA uus lemmik / Argo Ideon

    Index Scriptorium Estoniae

    Ideon, Argo, 1966-

    2007-01-01

    President Toomas Hendrik Ilvese visiidist Washingtoni, kohtumistest USA presidendi George W. Bushi, asepresident Dick Cheney, asevälisminister John Negroponte, kaitseminister Robert M. Gates'i, USA Kongressi esindajatekoja spiikri Nancy Pelosi ja kongresmenidega. Eestil õnnestus korraldada USA pealinnas kohtumised, mille järjekorras ootab hulk palju suuremaid riike. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  15. USA otsib Iraanist aktiivselt tuumainfot / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Iraan avaldas protesti USA luurelendude üle Iraani kohal. USA endine kaitseminister James Baker peab Iraani ja Põhja-Koreaga nende tuumaprogrammide hävitamiseks sõja alustamist suurimaks veaks. Kuigi Bushi meeskond rõhutab vajadust lahendada küsimus rahumeelselt, toovad Dick Cheney' ja Condoleezza Rice'i avaldused mitme USA kommentaatori arvates meelde Iraagi sõja eelse taktika

  16. Virginia Tech's Ashley White named to USA Today All-USA First Team

    OpenAIRE

    Crumbley, Liz

    2005-01-01

    Virginia Tech senior Ashley White, a University Honors student pursuing degrees in both materials science and engineering and music performance, has been named to USA Today's All-USA College Academic First Team.

  17. BusinessUSA Resource Access API

    Data.gov (United States)

    General Services Administration — BusinessUSA connects businesses to government services and information. The API provides access to resource abstracts including programs, services, data, events,...

  18. USA klaaskatuste murdmise aeg / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2008-01-01

    USA presidendivalimistel kandideeris esmakordselt afroameeriklane, presidendikandidaatide kampaanias osales naiskandidaat Hillary Clinton. Vt. samas: Obama isa kodukülas palvetati ja valmistuti suureks peoks

  19. Forensic entomology and main challenges in Brazil.

    Science.gov (United States)

    Gomes, Leonardo; Von Zuben, Cláudio J

    2006-01-01

    Apart from an early case report from China (13th century), the first observations on insects and other arthropods as forensic indicators were documented in Germany and France during mass exhumations in the 1880s by Reinhard, who is considered a co-founder of the discipline. After the French publication of Mégnin's popular book on the applied aspects of forensic entomology, the concept quickly spread to Canada and United States. At that time, researchers recognized that the lack of systematic observations of insects of forensic importance jeopardized their use as indicators of postmortem interval. General advances in insect taxonomy and ecology helped to fill this gap over the following decades. After World Wars, few forensic entomology cases were reported in the scientific literature. From 1960s to the 1980s, Leclercq and Nuorteva were primarily responsible for maintaining the method in Central Europe, reporting isolated cases. Since then, basic research in the USA, Russia and Canada opened the way to the routine use of Entomology in forensic investigations. Identifications of insects associated with human cadavers are relatively few in the literature of the Neotropical region and have received little attention in Brazil. This article brings an overview of historic developments in this field, the recent studies and the main problems and challenges in South America and mainly in Brazil.

  20. Effect of Main-stem Dams on Zooplankton Communities of the Missouri River (USA)

    Science.gov (United States)

    We examined the distribution and abundance of zooplankton from 146 sites on the Missouri River and found large shifts in the dominance of major taxa between management zones of this regulated river. Crustacean zooplankton were dominant in the inter-reservoir zone of the river, an...

  1. Eestis ära põlatud leiutis teenib USA-s head kasumit / Sigrid Laev

    Index Scriptorium Estoniae

    Laev, Sigrid

    2005-01-01

    Tallinna Tehnikaülikooli materjaliteaduste instituudi vanemteaduri Vello Valdna poolt 1990. aastate lõpus leiutatud röntgenluminofoori tootmisse andmist Eestis takistas rahapuudus, leiutis sai patendi USA-s ja tema tootmist alustas USA röntgensüsteemide tootja Bruker. Kommenteerib Vello Valdna

  2. Berliini müür USA-s varisemas / Mehis Replik

    Index Scriptorium Estoniae

    Replik, Mehis

    1998-01-01

    USA-s on pankade liitumine lõppjärgus. Tabelid: Pankade Euromoney TOP 200, suurima turuväärtusega pangad juunis 1998, Ida- ja Kesk-Euroopa pankade võrdlus koguvarade alusel. Euroopa ühinevad pangad. Artiklis on käsitletud ka USA pangandusalaseid õigusakte läbi ajaloo

  3. 77 FR 6587 - Startek USA, Inc. Alexandria, LA; Startek USA, Inc., Collinsville, VA; Amended Certification...

    Science.gov (United States)

    2012-02-08

    ... published in the Federal Register on February 10, 2011 (76 FR 7587). On its own motion, the Department... Employment and Training Administration Startek USA, Inc. Alexandria, LA; Startek USA, Inc., Collinsville, VA..., applicable to workers of StarTek USA, Inc., Alexandria, Louisiana. The workers are engaged in the supply...

  4. China / USA - Climate at stake; Chine / USA - Le climat en jeu

    Energy Technology Data Exchange (ETDEWEB)

    Marechal, Jean-Paul

    2011-10-15

    Climate change is one of the major challenge that humanity will have to take up during the coming decades. The preparation in 2012 of the 'post-Kyoto' era, where all countries would take up their climate responsibilities, remains the hardest trial. However, all successive international summits did not lead to any constraining agreement between countries. The main reason is the rivalry and dependence relation which links China and the USA. It is now obvious that no major climate decision can be taken without the double determined commitment of these both giants, and so far it is not in their interest to lead by example. This book analyses the freeze of this situation in an historical perspective and identifies some paths of solution to this serious problem. (J.S.)

  5. Green electricity - experiences from USA; Groen el - erfarenheter fraan USA

    Energy Technology Data Exchange (ETDEWEB)

    Graens, N.

    1995-10-01

    Environmental concern has opened a market for electric power produced from renewable energy sources in USA. A number of American electric utilities have responded to the interest from the public and offered green electricity at a price somewhat above the normal rates. Most of these programs, that have existed for a few years, have succeeded quite well, giving the utilities better relations to their customers and experiences from marketing new products. The customers have been satisfied and shown enthusiasm for the new product. The present report reviews the attitudes to and drive behind green electricity from/relative to utilities, customers, environmental organizations and authorities. The programs and experiences of the utilities are described, and the prospects for green power on a deregulated market are discussed. Speculations about market responses to green power in Sweden are also made. 37 refs, 13 figs

  6. USA raport hoiatab tuumaterroristide eest / Karin Volmer

    Index Scriptorium Estoniae

    Volmer, Karin

    2007-01-01

    USA-s tegutseva tuumaterrori vastase organisatsiooni Nuclear Threat Initiative (NTI) raport kinnitab maailma edusamme tuumamaterjali turvalisuses, kuid on ka palju ohuallikaid. Analüütikud kahtlevad Venemaa ja Pakistani armee usaldusväärsuses tuumamaterjali hoidmisel. Lisa: Tuumaterrori raport

  7. Etteheide: USA okupeerib Haitit / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Prantsusmaa ja Brasiilia on esitanud protesti, sest USA sõjalennukitele on antud eelisõigus Haiti pealinna Port-au-Prince'i lennujaama kasutamisel. Paljude kommentaatorite hinnangul on Prantsusmaa püüdnud haarata prominentset rolli Haiti abistamisel, kuid USA on tegutsenud kiiremini ja jõulisemalt. Kaart

  8. Krossil on probleeme USA viisaga? / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2011-01-01

    Eesti Päevaleht esitas USA Eesti-saatkonnale järelepärimise seoses sellega, et Eerik-Niiles Krossi USA-viisa on tühistatud. Saatkonna pressi- ja kultuuriatašee James Landi vastusest. Eerik-Niiles Krossi kommentaare

  9. Bulgaaria valitsus tahab USA raketikilpi / Mihkel Niglas

    Index Scriptorium Estoniae

    Niglas, Mihkel

    2007-01-01

    Bulgaarias küsiti USA presidendilt George W. Bushilt, miks Poolasse ja Tšehhi kavandatav raketikilp ei hakka katma Bulgaariat. USA paigutab septembris Bulgaaria sõjabaasi üle 3000 sõduri. George W. Bush toetab Bulgaaria nõudmist Liibüale vabastada Bulgaaria meditsiiniõed

  10. Teadlased : USA liitub Kyoto protokolliga / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    USA ja Austraalia on ainsad riigid, mis pole Kyoto protokollile alla kirjutanud. Princetoni ülikooli professori Michael Oppenheimeri arvates võib USA president George W. Bush oma seisukohti keskkonnaküsimustes muuta, sest teiseks ametiajaks valitud presidendid ei pea mõtlema uuele kampaaniale ning püüavad enne Valgest Majast lahkumist oma mainet maailma silmis parandada

  11. Ideaalne torm USA majanduses / Ken Goldstein ; interv. Neeme Raud

    Index Scriptorium Estoniae

    Goldstein, Ken

    2008-01-01

    USA majandusuuringute organisatsiooni The Conference Board analüütik USA majanduse olukorrast, mõjust maailmamajandusele, arenguvõimalustest ning uue presidendi vajalikest sammudest majanduses. Lisa: Enamuse arvates on USA valel teel

  12. Modelling middle pliocene warm climates of the USA

    Science.gov (United States)

    Haywood, A.M.; Valdes, P.J.; Sellwood, B.W.; Kaplan, J.O.; Dowsett, H.J.

    2001-01-01

    The middle Pliocene warm period represents a unique time slice in which to model and understand climatic processes operating under a warm climatic regime. Palaeoclimatic model simulations, focussed on the United States of America (USA), for the middle Pliocene (ca 3 Ma) were generated using the USGS PRISM2 2?? ?? 2?? data set of boundary conditions and the UK Meteorological Office's HadAMS General Circulation Model (GCM). Model results suggest that conditions in the USA during the middle Pliocene can be characterised as annually warmer (by 2?? to 4??C), less seasonal, wetter (by a maximum of 4 to 8 mm/day) and with an absence of freezing winters over the central and southern Great Plains. A sensitivity experiment suggests that the main forcing mechanisms for surface temperature changes in near coastal areas are the imposed Pliocene sea surface temperatures (SST's). In interior regions, reduced Northern Hemisphere terrestrial ice, combined with less snow cover and a reduction in the elevation of the western cordillera of North America, generate atmospheric circulation changes and positive albedo feedbacks that raise surface temperatures. A complex set of climatic feedback mechanisms cause an enhancement of the hydrological cycle magnifying the moisture bearing westerly wind belt during the winter season (Dec., Jan., Feb.). Predictions produced by the model are in broad agreement with available geological evidence. However, the GCM appears to underestimate precipitation levels in the interior and central regions of the southern USA. Copyright: Palaeontological Association, 22 June 2001.

  13. Experience from Soybean Industry Development of Main Soybean Producing Countries

    Institute of Scientific and Technical Information of China (English)

    MA Zenglin; GUO Xiangyu

    2009-01-01

    Soybean output and trade are mainly operated in America, Brazil, Argentina and China in recent years, especially in America. For China, the import output is number one, and the export output is the forth. For this reason, the soybean industry of China got a huge lash, and the soybean farmers got a large loss, it influenced the building of new countryside construction in China. Both U.S.A's soybean output and trade amout are the number one in the world, this achievement should be contributed to U.S.A's advanced production ability and its favorable subsidy policies. Contrary to U.S.A's large subsidy and cheap loan, Brazil and Argentina raise their soybean output and trade amount by high production technology and "untying" policies, such as abolishing some unreasonable rules and tax. So if we want to develop Chinese soybean industry and make sure our soybean industry's safety, it's necessary for us to experience soybean industry development of other countries' and improve ours.

  14. Islámská lobby v USA

    OpenAIRE

    Baumgartnerová, Alice

    2012-01-01

    The main goal of this bachelor's thesis is to characterize the leading Islamic lobby groups in the United States and analyse their influence on the US foreign and domestic policy as well. Three chapters make the reader familiar at first with the term lobbying and the phenomenon of interest groups in the USA, then with the immigration and integration of Muslims in the United States and with mutual relations of Muslim and non-Muslim society after 9/11, and finally and most importantly, with par...

  15. Licensing reform in the USA

    International Nuclear Information System (INIS)

    The licensing process for nuclear power plants in the USA is currently in two distinct stages: the issuance of a construction permit followed later by the issuance of an operation license. The ''two-step'' process has come under heavy criticism from the U.S. nuclear industry on the grounds that it causes uncertainty and delays and therefore inhibits new commitments to nuclear power plants. In 1989 the NRC published new regulations for the licensing of nuclear power plants which provide for the issuance of early site permits, safety certifications of standard designs, and combined construction permits and operating licences. The new rule was challenged by intervenors representing antinuclear groups who filed a legal challenge seeking to have the rule set aside on the grounds that it violates the Atomic Energy Act which they allege makes two-step licensing mandatory. In November 1990 the US Court of Appeals upheld the NRC's authority to issue combined licenses. An appeal for a rehearing has been filed. The paper analyses the events and the possible consequences of an adverse court decision. It reviews the options open to the NRC and industry if the court decision is upheld. The possibility of congressional action to amend the Atomic Energy Act is discussed. (author)

  16. LHV soovib USA-s kohtuvälist kokkulepet / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2005-01-01

    Kohtuväline kokkulepe LHV ja USA väärtpaberituru järelevalveasutuse SEC vahel tähendaks külmutatud väärtpaberikontode avamist, ent tõenäoliselt ka seda, et LHV peab maksma trahvi. Kohtuistungil USA-s esindavad LHV töötajaid Kristjan Lepikut ja Oliver Peeki advokaadid. Lisa: Teisedki on "sundpuhkusel"

  17. Ilves kritiseeris USA juhtidega Venemaad / Dagne Hanschmidt

    Index Scriptorium Estoniae

    Hanschmidt, Dagne

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 21. apr. lk. 4. President Toomas Hendrik Ilves kohtus töövisiidil Ameerika Ühendriikidesse USA asepresidendi Dick Cheney ja riigisekretär Condoleezza Rice'iga. Arutusel olid Euroopa Liidu suhted Venemaaga, Venemaa käitumine Gruusiaga, NATO viimase tippkohtumise tulemused. USA välisminister C. Rice avaldas Eesti presidendile tänu Eesti silmapaistva panuse eest Afganistanis. Kohtumisi kommenteerivad Riigikogu Euroopa Liidu asjade komisjoni esimees Marko Mihkelson ja Riigikogu väliskomisjoni esimees Sven Mikser. Vt. samas: Euroliit andis USA viisavabadusele rohelise tee. Euroopa Liidu sise- ja justiitsministrite kohtumisel kiideti heaks otsused, mis võimaldavad Eestil liituda USA viisavabadusprogrammiga. Vabariigi President töövisiidil Ameerika Ühendriikides 17.-23.04.2008

  18. The American Eider in Maine

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The American eider, Maine's only breeding sea duck, is known to have nested on 215 coastal islands of the State in 1976. In Maine, eiders seem to prefer to nest on...

  19. USA võtab hoogu maha / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2010-01-01

    Pärast riiklike soodustuste lõppu koduostjatele on USA-s vähenenud kinnisvara soetamine, jaemüüjate käive langes juunis võrreldes maiga 0,5%. USA keskpanga presidendi Ben Bernanke hinnangul on USA majandus ebatavaliselt ebamäärane

  20. Quo vadis, USA dollar? : finantsturgude viimastest arengutest / Robert Liljequist

    Index Scriptorium Estoniae

    Liljequist, Robert

    2013-01-01

    Swedbank AB Soome strateegiajuht vastab küsimustele, mis puudutavad USA majandust alanud aastal, dollari n.-ö turvalise valuuta staatuse kaotamise ohtu, võlakirjade ostmise vähendamist ja selle mõju USA dollarile, Euroopa Keskpanga poliitika mõju euro ja USA dollari suhtele. Swebanki prognoos USA dollari kohta

  1. USA tahab Iraagilt täispuutumatust / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2008-01-01

    USA ja Iraagi läbirääkimised USA vägede staatuse üle venivad, USA soovib oma sõduritele täielikku immuniteeti. Iraak olevat nõus nende USA üksuste immuniteediga, kes on sõjalistes rajatistes või missioonil, milles on varem kokku lepitud

  2. USA suursaadik : hirmud on alistanud lootuse / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2004-01-01

    Eestist lahkuv USA suursaadik Joseph de Thomas andis USA iseseisvuspäeva kõnes hinnangu Eesti toetusele Iraagis ja USA Iraagi-poliitikale. Parlamendiliige Eiki Berg USA suursaadiku kõnest. Vt. ka: Suursaadiku sõnum lk. 10

  3. Lahingustress ajab USA sõdurid jooma / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 15. märts 2007, lk. 10. USA kaitseministeeriumi siseuurimuse kohaselt kasvas alkoholi kuritarvitamine tegevteenistuses olevate USA sõjaväelaste seas aastatel 2002-2005 enam kui 30%. Alkoholi ja uimastite tarvitamisest Iraagis ja Afganistanis teenivate USA sõdurite hulgas. Vt. samas: USA relvajõududes puhkes uus homoskandaal

  4. USA suhtub karmilt salainfo kasutamisse / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Juhtumitest USA-s, kus mitteavalikke pressiteateid on kasutatud ebaseadusliku tulu teenimiseks. Anonüümsust palunud Wall Streeti analüütiku sõnul võib LHV-ga seotud skandaal võtta halvema pöörde juhul, kui selgub, et äriuudisteagentuuris Business Wire'is oli keegi, kes tegi eestlastega koostööd

  5. USA Today: Accentuating the Positive: A Study of the Gannett Flagship Newspaper.

    Science.gov (United States)

    Wright, William F.

    To investigate whether "USA Today" emphasizes "good news" over "bad news," a study was conducted using 10 randomly selected adults in State College, Pennsylvania, over an 11-week period in 1985. Subjects were asked to rate 248 stories over 45 pages of main news columns in 10 issues on a scale ranging from 1 (very negative news) to 7 (very positive…

  6. The Role of Translators and Interpreters in Hybrid English-Spanish Contexts in the USA

    Science.gov (United States)

    Cortabarria, Beatriz

    2015-01-01

    This article presents the findings of a study of English-Spanish mediation in hospital and court settings in the USA. The study is based on two main issues: the linguistic and cultural diversity of Hispanics, and the specialized nature of the health and judicial systems. When encountering new or different health care and judicial systems in the…

  7. Didactics Textbooks in Germany and the USA: A Comparative Study of Eclecticism, Selection and Integration

    Science.gov (United States)

    Zierer, Klaus

    2011-01-01

    This article presents the results of a comparison of didactics textbooks in two countries: on the one hand it examines a textbook in the tradition of German Didaktik, and, on the other hand, a textbook in the tradition of "Instructional Design" from the USA. The main research question is: How do authors write didactics textbooks? Is it possible to…

  8. Iraagi sõjategevus tõmbab USA mainet maailmas veelgi alla / Liise Lehtsalu

    Index Scriptorium Estoniae

    Lehtsalu, Liise

    2006-01-01

    Washingtonis asuva Pew Global Attitudes Projecti läbiviidud küsitlus 15 riigis näitas, et enamikus uuringus osalenud riikides peetakse Iraagi konflikti ohtlikumaks kui Iraani tuumapüüdlusi, et USA maine maailmas langeb ning lõhe lääne- ja islamiriikide vahel süveneb. Lisa: Hiinlased rahul oma valitsusega

  9. Humboldt River main stem, Nevada

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data set contains the main stem of the Humboldt River as defined by Humboldt Project personnel of the U.S. Geological Survey Nevada District, 2001. The data...

  10. Clic ring to main Linac

    CERN Document Server

    Stulle, F; Snuverink, J; Latina, A; Molloy, S

    2010-01-01

    The low emittance transport had been identified as one of the feasibility issues for CLIC. We discuss beam dynamics challenges occurring in the beam lines connecting the damping rings and the main linac. And we outline how these motivate design choices for the general RTML layout as well as its integration into the overall CLIC layout. Constraints originating from longitudinal dynamics and stabilization requirements of beam energy and phase at the main linac entrance are emphasized.

  11. Environmental radon and cancer correlations in Maine.

    Science.gov (United States)

    Hess, C T; Weiffenbach, C V; Norton, S A

    1983-08-01

    The distribution of 222Rn has been measured in the sixteen counties of Maine, U.S.A. by liquid scintillation counting of water samples from more than two thousand public and private wells. Three hundred and fifty of these wells have been characterized for geology and hydrology. Airborne radon has been measured in seventy houses with grab samples and in eighteen houses for 5-7 days each with continuously recording diffusion-electrostatic radon detectors. Concentrations of radon in water ranged from 20 to 180,000 pCi/l. Granite areas yielded the highest average levels (mean = 22,100 pCi/l.; n = 136), with considerable intra-granite variation. Metasedimentary rocks yielded levels characteristic of the lithology for metamorphic grades ranging from chlorite to andalusite. Sillimanite and higher-grade rocks yielded higher 222Rn levels, probably due to the intrusion of uranium-bearing pegmatites in these terranes. Airborne 222Rn in homes ranged from 0.05 to 210 pCi/l. At the high end of this range, doses will exceed recommended industrial limits. In some homes only a small fraction of the airborne 222Rn was due to the water supply. Average 222Rn levels in domestic water supplies for each of the 16 counties, calculated by areally averaging rock types and their associated 222Rn levels, were found to be significantly correlated with rates for all cancers combined and rates for lung and reproductive cancers in the counties. Although numerous factors other than cancer induction by indoor daughter exposures may be responsible for the observed correlations, these have not been investigated in detail. PMID:6885433

  12. China-Latin America Relations: Main Themes, Main Problems

    DEFF Research Database (Denmark)

    Christensen, Steen Fryba; Silva Ramos Becard, Danielly

    2016-01-01

    The article discusses the research field of China-Latin American relations and suggests a broad and encompassing approach to the topic. It discusses the main themes and problem areas that analysts mostly emphasize in analyses of China-Latin America relations.......The article discusses the research field of China-Latin American relations and suggests a broad and encompassing approach to the topic. It discusses the main themes and problem areas that analysts mostly emphasize in analyses of China-Latin America relations....

  13. Non-main Stream Plays Main Role in Shipbuilding Market

    Institute of Scientific and Technical Information of China (English)

    Qin Ping

    2009-01-01

    @@ Comparing with both the major shipyards and shipping companies that were facing an market decline and hard time,the non-mainstream ship types,non-mainstream ship manufacturers and non-mainstream ship owners,as main roles,made a wonderful show of living and developing in 2009.

  14. I-WARP: Individual Water mAin Renewal Planner

    Directory of Open Access Journals (Sweden)

    Y. Kleiner

    2010-05-01

    Full Text Available I-WARP is based upon a nonhomogeneous Poisson approach to model breakage rates in individual water mains. The structural deterioration of water mains and their subsequent failure are affected by many factors, both static (e.g., pipe material, pipe size, age (vintage, soil type and dynamic (e.g., climate, cathodic protection, pressure zone changes. I-WARP allows for the consideration of both static and dynamic factors in the statistical analysis of historical breakage patterns. This paper describes the mathematical approach and demonstrates its application with the help of a case study. The research project within which I-WARP was developed, was jointly funded by the National Research Council of Canada (NRC, and the Water Research foundation (formerly known as the American Water Works Association Research Foundation – AwwaRF and supported by water utilities from USA and Canada.

  15. Smart Grids: short history, main components and perspectives

    International Nuclear Information System (INIS)

    This paper tries to describe the smart grids in their entirety. In a first part, two definitions are given for the smart grids, the main drivers for their development are briefly described, along with an overview of the initiatives and projects in different parts of the world: Europe, USA, Asia and Pacific area. The second part is devoted to the main components of the smart grids. The following are considered: distributed generation and renewables, energy storage, demand side integration, intelligent buildings, smart meters, communication infrastructures, distribution and transmission networks, micro-grids, flexibility of the generation park, electric vehicles and regulatory issues. Finally, the conclusion gives a short discussion of some important issues, as well as of the benefits of demonstration projects. (authors)

  16. Architectural Portfolio 2001: Main Winners.

    Science.gov (United States)

    American School & University, 2001

    2001-01-01

    Presents descriptions and photographs of the following two American School and University Architectural Portfolio main winners for 2001: Chesterton, Indiana's Chesterton High School and Lied Library at the University of Nevada, Las Vegas. Included are each project's vital statistics, the architectural firm involved, and a list of designers.(GR)

  17. Main Elements for Upscaling Recreation

    DEFF Research Database (Denmark)

    Zandersen, Marianne; Termansen, Mette

    2012-01-01

    This report provides information on the main elements used to scale up modelled local visitor flow data to regional level based on recreational de-mand models. These models are described in Report #1. This report also provides information on data sources such as spatial data (e.g. land cov......-timated value per site for car-borne visits....

  18. "Riia ring, "luurepost ja tööjaotus USA esindustest Baltikumis 1920. aastatel / Eero Medijainen""

    Index Scriptorium Estoniae

    Medijainen, Eero, 1959-

    2012-01-01

    Diplomaatilisest taustast. USA esinduste rajamisest Baltikumi. Olukorrast USA saatkonnas 1922. aastal. USA sõjalisest vaatlejast "Balti provintsides" 1919-1922. Luurekeskusest ja Sergius Riisist. "Vene sektsiooni" formaliseeerumisest.

  19. Overview: Main Fundamentals for Steganography

    CERN Document Server

    AL-Ani, Zaidoon Kh; Zaidan, B B; Alanazi, Hamdan O

    2010-01-01

    The rapid development of multimedia and internet allows for wide distribution of digital media data. It becomes much easier to edit, modify and duplicate digital information .Besides that, digital documents are also easy to copy and distribute, therefore it will be faced by many threats. It is a big security and privacy issue, it become necessary to find appropriate protection because of the significance, accuracy and sensitivity of the information. Steganography considers one of the techniques which used to protect the important information. The main goals for this paper, to recognize the researchers for the main fundamentals of steganography. In this paper provides a general overview of the following subject areas: Steganography types, General Steganography system, Characterization of Steganography Systems and Classification of Steganography Techniques.

  20. Energy prospects in the USA; Les perspectives energetiques aux USA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-03-01

    This article summarizes the main trends of the US national energy plan sustained by the administration of President Bush: national energy policy development (diversification of energy supplies, development of an hydrogen economy), energy legislation (energy saving, development of renewable energy sources, promoting national production, budget discussion), re-launching of the nuclear sector: situation of the nuclear operators, competitiveness of nuclear energy, impact of deregulation on fusion/acquisition operations, role and liability of the federal administration (development of the Yucca Mountain (Nevada) disposal site for spent fuels, 'Nuclear Power 2010' initiative, long-term 'Generation IV' program, advanced fuel cycle program, hydrogen initiative and project of very high temperature reactor (VHTR) at the Idaho national laboratory). (J.S.)

  1. Bush soovib rahajagamisega USA majandust turgutada / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2008-01-01

    USA presidendi George W. Bushi plaanist maksta igale maksumaksjale tagasi 800 ja peredele 1600 dollarit, et majandust tõusule juhtida. USA Keskpanga poliitikast ja maailma börside jätkuvast langusest. Kommenteerivad: Romet Tepper, Jaanus Pikkani

  2. "Disko ja tuumasõda" jõuab USA kinolevisse

    Index Scriptorium Estoniae

    Kilmi, Jaak, 1973-, režissöör. Disko ja tuumasõda (film)

    2010-01-01

    Jaak Kilmi ja Kiur Aarma dokumentaalfilm "Disko ja tuumasõda" hakkab alates 12. novembrist jooksma New Yorgi kinos Cinema Village. 26. novembrist saab filmi näha Los Angeleses. Filmi levitaja USA-s on Icarus Film

  3. Gridded bathymetry of Penguin Bank, Hawaii, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry (5 m cell size) of Penguin Bank, Hawaii, USA. The netCDF grid and ArcGIS ASCII file include multibeam bathymetry from the Simrad EM3002d, and...

  4. The USA: Challenges of the Superpower

    Directory of Open Access Journals (Sweden)

    Dr. Ketevan Rostiashvili

    2012-01-01

    Full Text Available Since the collapse of the Soviet Union function and mission of the United States in the contemporary world system is one of the most debatable problems of academic litera-ture. This article is an attempt to analyze most recent socioeconomic and political tendencies of the USA for better understanding the scale of ongoing transformation of the society. As the level of integration of contemporary world is very high, transfor-mation of the USA provokes tectonic changes and transformation of the world system, its structure and nature. This study argues that, although the US primacy in the world is significantly challenged and shaken by external and internal factors, the USA still preserves its traditional function of economic, financial, military and political superpow-er, but in a quite different environment. The article predominantly uses materials drawn from the Central Intelligence Agency (CIA, The World Fact book 2012; U.S. Census Bureau, Statistical Abstract of the USA - 2012, the US Federal Budgets 2010-2012, and other valuable literature and sources.

  5. Fosfomycin Resistance in Escherichia coli, Pennsylvania, USA.

    Science.gov (United States)

    Alrowais, Hind; McElheny, Christi L; Spychala, Caressa N; Sastry, Sangeeta; Guo, Qinglan; Butt, Adeel A; Doi, Yohei

    2015-11-01

    Fosfomycin resistance in Escherichia coli is rare in the United States. An extended-spectrum β-lactamase-producing E. coli clinical strain identified in Pennsylvania, USA, showed high-level fosfomycin resistance caused by the fosA3 gene. The IncFII plasmid carrying this gene had a structure similar to those found in China, where fosfomycin resistance is commonly described.

  6. Euroopa ja USA: liidus tulevikuks / Barack Obama

    Index Scriptorium Estoniae

    Obama, Barack, 1961-

    2010-01-01

    Ameerika Ühendriikide president kirjutab 19.-20. novembril Lissabonis toimuvast NATO tippkohtumisest, USA ja Euroopa vastastikusest vajalikkusest ning NATO-sisesest koostööst. Barack Obama leiab, et NATO ja Venemaa võiksid taaskäivitada oma suhted

  7. Compressing main memory index lists

    OpenAIRE

    Falk Nilsson, Max

    2015-01-01

    Index data structures are used in databases to get scalable access to rows in large tables for search conditions over indexed attributes. For each value of an indexed attribute, called the index key, the index associates a set of pointers, called the index list, to the rows where the value of the indexed attribute matches the key. If an index key over a very large collection has many duplicated values the index list can also become large. To make the indexes smaller and save space in main mem...

  8. Võidurelvastumise tagasitulek : USA kiiluvees Venemaa ja Hiina / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA eelarvekavas on ette nähtud kaitsekulutuste jätkuv suurenemine, suureneda võib ka relvajõudude isikkoosseis. Relvajõududele kulub USA-s ligi 4% SKT-st. Globaalselt liidetuna tõusid kõikide riikide kulutused relvajõududele 1990. aasta tasemele. Hiina ja Venemaa kaitsekulutustest. Lisad: Aasia riigid kasvatavad sõjalisi kulutusi; 25 riigil pole oma sõjaväge. Graafik: USA sõjalised kulutused

  9. USA suursaadik : toetame Eestit / Stanley Davis Phillips ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2007-01-01

    USA suursaadik Eestis Stanley Davis Phillips vastab küsimustele, mis puudutavad USA positsiooni Tõnismäe pronkssõduri suhtes, Eesti saatkonna piiramist Moskvas, USA ja Venemaa suhteid ning koostööd, sõda terrorismiga, USA kava paigutada Tšehhi ja Poolasse raketitõrjebaasid, Eesti presidendi Toomas Hendrik Ilvese visiiti USAsse. Lisa: Stanley Davis Phillips. Ilmunud ka: Postimees : na russkom jazõke 16. mai lk. 5

  10. Ilves kohtus esmaspäeval USA-s Barack Obamaga

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves kohtus 15. juunil 2009 Washingtonis USA presidendi Barack Obamaga ja vestles temaga nii majanduskriisist kui ka Eesti missioonist Afganistanis. Vabariigi President töövisiidil Ameerika Ühendriikides 9.-16.06.2009

  11. Energy Conferences and Symposia; (USA)

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, J.H.; Simpson, W.F. Jr. (eds.)

    1991-01-01

    Energy Conferences and Symposia, a monthly publication, was instituted to keep scientists, engineers, managers, and related energy professionals abreast of meetings sponsored by the Department of Energy (DOE) and by other technical associations. Announcements cover conference, symposia, workshops, congresses, and other formal meetings pertaining to DOE programmatic interests. Complete meeting information, including title, sponsor, and contact, is presented in the main section, which is arranged alphabetically by subject area. Within a subject, citations are sorted by beginning data of the meeting. New listings are indicated by a bullet after the conference number and DOE-sponsored conferences are indicated by a star. Two indexes are provided for cross referencing conference information. The Chronological Index lists conference titles by dates and gives the subject area where complete information they may be found. The Location Index is alphabetically sorted by the city where the conference will be held.

  12. Burden in the main caregiver

    Directory of Open Access Journals (Sweden)

    Fabiola Yonte Huete

    2010-09-01

    Full Text Available Objectives: The main objective is to determine the degree of burden in the main caregivers of dependent patients, to analyse the profile of informal caregivers and dependent patients. Their claims and help received with caring, the influence of mental deteriorate and duration of care giving regarding the burden of caregivers.Methods: Descriptive cross-sectional observational study amongst 50 caregivers and dependents. We used descriptive statistics and correlational studies. Results: 86 % of caregivers were women, middle aged, son/daughter of the dependent, married, with basic studies, no work outside the home, the average time in the role of caregiver was 16,96 hours a day and 2,1 free hours a day. 64 % of them received family support and 68 % wish to receive economic aid. It was found that for 38 % of the caregivers there was no burden at all, 34 % of them had a minimum burden and 28 % a greater burden.Conclusion: There are some caregivers with moderate or great burden. Our caregiver wishes to receive economic help. Our research shows that the decrease of mental health and the years of evolution do not have a significant statistically influence on caregivers. It is necessary prioritize the interventions and its recipients, provide solutions for caregivers with a greater burden, trying to keep away “caregiver syndrome”.

  13. Energetická bezpečnost USA

    OpenAIRE

    Avetisyan, Mihran

    2014-01-01

    The topic of this bachelor thesis is Energy security of the USA. In the first part I define the energy security. In second and third part I analyse energy resources of the USA, consumtion of energy, self-sufficiency of energy and then there is a SWOT analysis. The fourth part is dedicated to energy policy of USA.

  14. USA tunnistab valge fosfori relvana kasutamist Iraagis / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    Kui varem USA eitas valge fosfori kasutamist Iraagis Falluja linnas, siis nüüd on ta eitamisest loobunud. USA välisministeeriumi pressiteate kohaselt ei kasutatud fosforit keemiarelvana. Sütitavate relvade kasutamine tsiviilisikute vastu on keelatud. Vt. samas: Ahto Lobjakas. Europarlamendis USA hukkamõist

  15. USA-reis nõuab biomeetrilist passi / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2004-01-01

    USA-s pikendati viisavabastusprogrammi biomeetrilise passi tähtaega 2005. aasta 26. oktoobrini. USA Eesti-saatkonna töötaja Christopher Smithi sõnul ei kehti viisavabadusprogrammi raames reisimise puhul passid, mida ei saa masinaga lugeda

  16. Tšehhid protestisid USA raketikilbi vastu / Igor Taro

    Index Scriptorium Estoniae

    Taro, Igor

    2007-01-01

    USA soovib rajada oma ballistiliste rakettide eest kaitsva süsteemi rajatisi Poola ja Tšehhi territooriumile, mille vastu on protestinud ka Venemaa. Tšehhi Trokaveci küla elanike korraldatud referendumist ja Prahas toimunud meeleavaldustest USA raketikilbi radarijaama vastu. Lisa: USA raketikilp

  17. Tükeldatav Jukos üritab end päästa pankrotiavaldusega USA-s / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2004-01-01

    Venemaa naftakompanii Jukos esitas pankrotiavalduse USA-s, et saavutada kaitset oma varade sundmüügi vastu. Firma esindaja teatel võib Jukos esitada pankrotiavalduse kohtuliku kaitse saamiseks ka Venemaal

  18. Western Coal royalty issues: the federal factor. [USA - Rocky Mountains

    Energy Technology Data Exchange (ETDEWEB)

    Bartlett, E.; Lahr, M. (Western Energy Company, Butte, MT (USA))

    1990-01-01

    Most Western USA coal is produced from Federal coal leases and coal royalty rates and valuation are dictated by the Federal Government. In 1975 the Federal Government called for increased coal production and also changed the Federal royalty from a fixed amount per ton produced to an ad valorem basis. Production of coal mainly by surface mining in Western States increased but royalties increased dramatically to 12% of coal value under the 1976 Federal Coal Leasing Amendments Act. The effects of these changes are discussed. Further recent changes mean that severance and production taxes and other fees are added to royalties bringing the effective rate to 21%. Readjustments to and reductions of royalties are discussed. Several bills have been introduced in Congress to seek relief from royalty rates. The author advocates the industry should support efforts to reduce Federal royalties to reasonable rates. 15 refs.

  19. Earliest Cucurbita from the Great Lakes, Northern USA

    Science.gov (United States)

    Monaghan, G. William; Lovis, William A.; Egan-Bruhy, Kathryn C.

    2006-03-01

    Directly dated Cucurbita from archaeological sites near Lake Huron expand the range and human usage of adventive, cultivated wild gourds or squash into the Great Lakes region, USA, by 4000 14C yr BP. The data also show that domesticated C. pepo squash was cultivated there by 3000 14C yr BP. Although milder Hypsithermal climate may have been a contributing factor, squash and gourds expanded northward during the mid-Holocene mainly by human agency and may be the first human-introduced adventive plant in temperate North America. Even after 3000 14C yr BP, when domesticated squash generally replaced wild varieties at northern sites, squash stands were probably informally managed rather than intensively cultivated.

  20. Community sustainability in the year-round islands of Maine

    Directory of Open Access Journals (Sweden)

    Samuel A. McReynolds

    2014-05-01

    Full Text Available This article examines community sustainability in the year-round islands of Maine, USA, with a critical focus on the impacts of seasonal residents on sustainability. The context of this research is to provide foundational material to determine and measure sustainability in island communities. Data examined includes population, housing, housing affordability, housing occupancy, property valuation, and taxable sales. Food availability is an important secondary consideration. The overall finding is that the island communities as they have historically existed are not likely to be sustainable but may become sustainable in a new form. The overall impact of seasonal residents on sustainability is inconclusive except that there is a clear negative impact in the area of housing. Directions for additional research are discussed.

  1. Main injector synchronous timing system

    International Nuclear Information System (INIS)

    The Synchronous Timing System is designed to provide sub-nanosecond timing to instrumentation during the acceleration of particles in the Main Injector. Increased energy of the beam particles leads to a small but significant increase in speed, reducing the time it takes to complete a full turn of the ring by 61 nanoseconds (or more than 3 rf buckets). In contrast, the reference signal, used to trigger instrumentation and transmitted over a cable, has a constant group delay. This difference leads to a phase slip during the ramp and prevents instrumentation such as dampers from properly operating without additional measures. The Synchronous Timing System corrects for this phase slip as well as signal propagation time changes due to temperature variations. A module at the LLRF system uses a 1.2 Gbit/s G-Link chip to transmit the rf clock and digital data (e.g. the current frequency) over a single mode fiber around the ring. Fiber optic couplers at service buildings split off part of this signal for a local module which reconstructs a synchronous beam reference signal. This paper describes the background, design and expected performance of the Synchronous Timing System

  2. Main technical topics in 1999

    International Nuclear Information System (INIS)

    This Safety Authority annual report strives to present current organizational provisions and future trends in nuclear safety supervision in France and to describe the most outstanding occurrences during the past year. A first part presents nine documents concerning the main topics of 1999: aging of nuclear installations, the Offsite Emergency Plans (PPI), the impact of nuclear activities on man and the environment, the criticality hazards, EDF in 1999, the EPR project, the Andra in 1999, the transport incidents, the nuclear safety in eastern Europe. The second part presents the missions and actions of the Nuclear Installations Safety in the domains of the liabilities, the organization of the nuclear safety control, the regulations of the INB, the public information, the international relations, the crisis management, the radioactive materials transportation, the radioactive wastes. The equipment, the radiation protection and the exploitation of the pressurized water reactors are also treated just as the experimental reactors, the fuel cycle installations and the the nuclear installations dismantling. (A.L.B.)

  3. MEASURING AND DECOMPOSING OUTPUT GAP: A PRODUCTION FUNCTION APPROACH OF THE USA AND EU-27 COUNTRIES

    OpenAIRE

    Domicián Máté; Julianna Csugány

    2012-01-01

    The ICT-based techno-economic paradigm shift was sharpened by income inequalities in all over the world. The economic performance of USA and Europe were seemed to more different thanks to global economic events. The main purpose of this study is to estimate various macroeconomic variables such as GDP and labour for the period of 1993-2013. In order to indicate economic growth an alternative growth accounting method was used to decompose impacts of physical capital accumulation, technological ...

  4. Lead markets for clean coal technologies: A case study for China, Germany, Japan and the USA

    OpenAIRE

    Horbach, Jens; Chen, Qian; Rennings, Klaus; Vögele, Stefan

    2012-01-01

    Despite the high CO2 emission intensity of fossil and especially coal fired energy production, these energy carriers will play an important role during the coming decades. The case study identifies the main technological trajectories concerning more efficient fossil fuel combustion and explores the potentials for lead markets for these technologies in China, Germany, Japan and the USA taking into account the different regulation schemes in these countries. We concentrate on technologies that ...

  5. Segmenting the USA. Non-travel market

    OpenAIRE

    Smith, Wayne W.; Fralinger, Emily; Litvin, Stephen W.

    2011-01-01

    Tourism marketers focus on understanding the many different segments that comprise their visitors. Understanding these segments� motivations for travel is important in order to motivate repeat visitation and to attract like-minded consumers to visit. But how about those who do not travel? This surprisingly large percentage of the population is a lost opportunity for the industry. The research that follows, based upon a very significant USA-based sample of non-travelers, suggests that non-trav...

  6. Professional Training of Economists in the USA

    OpenAIRE

    Rudnitska Kateryna

    2014-01-01

    The article deals with the peculiarities of American professional undergraduate and graduate training in economics. The analysis of documents, scientific and educational literature demonstrates the diversity of the US training courses and combinations of disciplines in economics. It has been defined that leading position of the USA in the world and its impact on the economic life of other countries has predetermined the development of the internationalization of economic education at the unde...

  7. Mining industry in USA in 2010

    International Nuclear Information System (INIS)

    Total uranium drilling was 7209 holes covering 1493520 m in USA in 2010, uranium production reached 1628.55 t, total expenditure on uranium mine industry reached $ 2.77 × 107 in 2010, in which expenditures for uranium exploration was $ 3.45 × 107, making up 12.44% of the total expenditure for uranium mine industry. Drilling expenditure for uranium exploration was $ 4.46 × 107, making up 16.08% of total expenditure for uranium mine industry. (authors)

  8. Validating a Measure of Teacher Intentions to Integrate Technology in Education in Turkey, Spain and the USA

    Science.gov (United States)

    Perkmen, Serkan; Antonenko, Pavlo; Caracuel, Alfonso

    2016-01-01

    The main purpose of this study was to examine the validity of the Teacher Intentions to Integrate Technology in Education Scale using pre-service teacher samples from three countries on three continents--Turkey, Spain and the United States. Study participants were 550 pre-service teachers from three universities in Turkey, Spain and the USA (219,…

  9. The System of Environmental Education in the USA

    Directory of Open Access Journals (Sweden)

    Fasolya Oleg

    2016-09-01

    Full Text Available The article deals with studying the peculiarities of environmental education system in the USA. It has been defined that US environmental policy includes governmental actions at the federal, state and local level. It has been identified that US environmental education is characterized by an extraordinary variety of forms, directions and methodological approaches, deep penetration of the ideas of environmental ethics in the content of all the disciplines, extensive involvement of communities and, in particular, public non-governmental organizations in the process of forming US citizens’ careful and responsible attitude to the environment. It has been stated that the system of US Environmental Education aims to provide a solution to such problems: to ensure citizens’ close contact with the environment; to contribute to the forming of environmentally friendly styles of behaviour and activities; to form a set of knowledge about the environment as a system of interconnected natural, economic and social factors; to involve students in solving local environmental problems. It has been found out that since 1970 Environmental Protection Agency has been operating in the USA. It has been mentioned that Environmental Protection Agency implements an environmental law by writing regulations and set national environmental standards. It has been indicated that Environmental Protection Agency has created the Office of Environmental Education so that national leadership may be provided and environmental literacy may be increased. It has been denoted that main goals of the the Office of Environmental Education include design and implementation of curricula and training programs for environmental education for both pupils and adults; organization of seminars, conferences and discussions on ugent environmental issues; cooperation with state education departments and other agencies. Consequently, recommendations that may be used by native educators to improve the

  10. Transuranic radioactive (TRU) waste management in the USA

    International Nuclear Information System (INIS)

    In the United States of America (USA), the US Department of Energy (DOE) is responsible for the safe management and disposal of all transuranic radioactive (TRU) waste. Based on the promising characteristics of the 225-million-year-old stable sequence of evaporitic rocks (mainly rock salt) at the Waste Isolation Pilot Plant (WIPP) site, an underground test facility was developed in the early 1980s at a depth of approximately 655 meters in the candidate host salt formation. In 1994, after more than 20 years of characterizing and evaluating the WIPP site, the DOE concluded that available data and long-term performance assessments (PAs) strongly indicated the WIPP site exhibits very suitable natural characteristics for hosting a deep geologic disposal facility (repository) for TRU waste. In April 1994, the DOE Carlsbad Area Office (CAO) presented a new strategy and an accelerated schedule targeting June 1998 for the opening of a TRU waste repository at the WIPP site. The main objectives of this strategy are to: resolve regulatory compliance and technical issues; characterize the waste; address transportation and safety issues; and involve stakeholders (interested parties) in the regulatory compliance process

  11. USA relvastab araabia maid miljardite dollaritega / Kunnar Kukk

    Index Scriptorium Estoniae

    Kukk, Kunnar

    2007-01-01

    USA välisminister Condoleezza Rice ja kaitseminister Robert Gates tegid visiidi Saudi-Araabiasse. Arvatakse, et nad on pehmendamas katastroofi, mis järgneks USA vägede järk-järgulisele taandumisele Iraagist. USA kavatseb anda Pärsia riikidele sõjalist abi, et tuua Iraan kolmepoolsetele läbirääkimistele. Lisa: Kodusõda võib olla vältimatu

  12. USA erisaadik : USA investorid Eestis rahul / J. Frank Mermoud ; interv. Sirje Rank

    Index Scriptorium Estoniae

    Mermoud, J. Frank

    2004-01-01

    Ameerika Ühendriikide välisministri nõunik ja erisaadik majandusküsimustes kiidab Eesti edu, räägib USA investorite rahuolust Eesti majanduskeskkonnaga ja väljendab muret Euroopa Liidu kavade pärast maksude ühtlustamiseks

  13. The Penobscot River, Maine, USA: a Basin-Scale Approach to Balancing Power Generation and Ecosystem Restoration

    OpenAIRE

    Laura Rose Day; John Banks; Joshua Royte; Jeffrey J. Opperman; Colin Apse

    2011-01-01

    Although hydropower is a source of low-carbon energy, without careful consideration and management, dams have the potential to degrade river ecosystems and the goods and services they provide to society. Today, a broad range of hydropower interests and stakeholders are seeking approaches to hydropower development and operation that are more environmentally and socially sustainable. The Penobscot River Restoration Project ('the Project') illustrates that basin-scale approaches can pr...

  14. Bark and Ambrosia Beetles Show Different Invasion Patterns in the USA.

    Directory of Open Access Journals (Sweden)

    Davide Rassati

    Full Text Available Non-native bark and ambrosia beetles represent a threat to forests worldwide. Their invasion patterns are, however, still unclear. Here we investigated first, if the spread of non-native bark and ambrosia beetles is a gradual or a discontinuous process; second, which are the main correlates of their community structure; third, whether those correlates correspond to those of native species. We used data on species distribution of non-native and native scolytines in the continental 48 USA states. These data were analyzed through a beta-diversity index, partitioned into species richness differences and species replacement, using Mantel correlograms and non-metric multidimensional scaling (NMDS ordination for identifying spatial patterns, and regression on distance matrices to test the association of climate (temperature, rainfall, forest (cover area, composition, geographical (distance, and human-related (import variables with β-diversity components. For both non-native bark and ambrosia beetles, β-diversity was mainly composed of species richness difference than species replacement. For non-native bark beetles, a discontinuous invasion process composed of long distance jumps or multiple introduction events was apparent. Species richness differences were primarily correlated with differences in import values while temperature was the main correlate of species replacement. For non-native ambrosia beetles, a more continuous invasion process was apparent, with the pool of non-native species arriving in the coastal areas that tended to be filtered as they spread to interior portions of the continental USA. Species richness differences were mainly correlated with differences in rainfall among states, while rainfall and temperature were the main correlates of species replacement. Our study suggests that the different ecology of bark and ambrosia beetles influences their invasion process in new environments. The lower dependency that bark beetles have

  15. Bark and Ambrosia Beetles Show Different Invasion Patterns in the USA.

    Science.gov (United States)

    Rassati, Davide; Faccoli, Massimo; Haack, Robert A; Rabaglia, Robert J; Petrucco Toffolo, Edoardo; Battisti, Andrea; Marini, Lorenzo

    2016-01-01

    Non-native bark and ambrosia beetles represent a threat to forests worldwide. Their invasion patterns are, however, still unclear. Here we investigated first, if the spread of non-native bark and ambrosia beetles is a gradual or a discontinuous process; second, which are the main correlates of their community structure; third, whether those correlates correspond to those of native species. We used data on species distribution of non-native and native scolytines in the continental 48 USA states. These data were analyzed through a beta-diversity index, partitioned into species richness differences and species replacement, using Mantel correlograms and non-metric multidimensional scaling (NMDS) ordination for identifying spatial patterns, and regression on distance matrices to test the association of climate (temperature, rainfall), forest (cover area, composition), geographical (distance), and human-related (import) variables with β-diversity components. For both non-native bark and ambrosia beetles, β-diversity was mainly composed of species richness difference than species replacement. For non-native bark beetles, a discontinuous invasion process composed of long distance jumps or multiple introduction events was apparent. Species richness differences were primarily correlated with differences in import values while temperature was the main correlate of species replacement. For non-native ambrosia beetles, a more continuous invasion process was apparent, with the pool of non-native species arriving in the coastal areas that tended to be filtered as they spread to interior portions of the continental USA. Species richness differences were mainly correlated with differences in rainfall among states, while rainfall and temperature were the main correlates of species replacement. Our study suggests that the different ecology of bark and ambrosia beetles influences their invasion process in new environments. The lower dependency that bark beetles have on climate

  16. Bark and Ambrosia Beetles Show Different Invasion Patterns in the USA

    Science.gov (United States)

    Rassati, Davide; Faccoli, Massimo; Haack, Robert A.; Rabaglia, Robert J.; Petrucco Toffolo, Edoardo; Battisti, Andrea; Marini, Lorenzo

    2016-01-01

    Non-native bark and ambrosia beetles represent a threat to forests worldwide. Their invasion patterns are, however, still unclear. Here we investigated first, if the spread of non-native bark and ambrosia beetles is a gradual or a discontinuous process; second, which are the main correlates of their community structure; third, whether those correlates correspond to those of native species. We used data on species distribution of non-native and native scolytines in the continental 48 USA states. These data were analyzed through a beta-diversity index, partitioned into species richness differences and species replacement, using Mantel correlograms and non-metric multidimensional scaling (NMDS) ordination for identifying spatial patterns, and regression on distance matrices to test the association of climate (temperature, rainfall), forest (cover area, composition), geographical (distance), and human-related (import) variables with β-diversity components. For both non-native bark and ambrosia beetles, β-diversity was mainly composed of species richness difference than species replacement. For non-native bark beetles, a discontinuous invasion process composed of long distance jumps or multiple introduction events was apparent. Species richness differences were primarily correlated with differences in import values while temperature was the main correlate of species replacement. For non-native ambrosia beetles, a more continuous invasion process was apparent, with the pool of non-native species arriving in the coastal areas that tended to be filtered as they spread to interior portions of the continental USA. Species richness differences were mainly correlated with differences in rainfall among states, while rainfall and temperature were the main correlates of species replacement. Our study suggests that the different ecology of bark and ambrosia beetles influences their invasion process in new environments. The lower dependency that bark beetles have on climate

  17. Emergency braking systems for commercial vehicles in various markets shown for Europe and the USA; Marktspezifische Notbremssysteme im Nutzfahrzeug am Beispiel Europa und USA

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, Karsten; Hoffmann, Guido; Sandkuehler, Dirk [WABCO, Hannover (Germany)

    2008-07-01

    Today the main focus of driver assistance in commercial vehicles changes from pure comfort systems to safety related systems. Currently most development work is taking place for collision avoidance and collision mitigation systems, which is caused by various initiatives of the legislation organizations around the world. Since the world's markets have differing requirements, those systems are varying in their concept and design. In the following course a concept for autonomous braking in collision immanent situations and its different implementations are shown for systems in Europe and the USA. Especially the different integration into the vehicle electronic architecture and the brake control is described. (orig.)

  18. Läbikatsumine USA lennujaamades riivab siin tehtavast vähem / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2010-01-01

    USA sisejulgeoleku ministeeriumi privaatsuse ja andmekaitse juht Mary Ellen Callahan kinnitab, et USA-sse reisivate inimeste krediitkaardiandmeid kasutatakse vaid elektroonilise reisi autoriseerimise süsteemi jaoks ning andmeid säilitab USA rahandusministeerium. Ta on arvamusel, et USA-s on kehaskannerite kasutamisel reisija privaatsuse kaitse parem kui Euroopas

  19. INTELLECTUAL INVESTMENT. THE PROSPECTS IN EDUCATION IN THE USA AND IN THE EU

    Directory of Open Access Journals (Sweden)

    LOREDANA-IOANA PRIBAC

    2010-01-01

    Full Text Available This paper approaches a few theoretical issues related to the investments in intellectual capital and those in human capital, these investments influencing education system and society. As a particular case, we have analysed the education prospects for the next ten years in the USA and in the European Union, the education system being one of the most important immaterial investments, with a decisive impact over the society we live in. The main conclusion is this: a tendency of increase in the number of individuals who will hold a higher education diploma, both in the USA and in the European Union. In other words, the decrease in the number of secondary school graduates and high school graduates is desired.

  20. Main: 1GHR [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1GHR 大麦 Barley Hordeum vulgare l. Lichenase Ii Precursor Hordeum Vulgare 1,3-1,4-Be... T.P.J.Garrett J.N.Varghese, T.P.J.Garrett, P.M.Colman, L.Chen, P.J.Hoj, G.B.Fincher The Three-Dimensional S...cities Proc.Nat.Acad.Sci.Usa V. 91 2785 1994 EMBL; M13237; AAA32962.1; -.|PIR; A25455; A25455.|PDB; 1AQ0; X-...YGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAATPANARFYNQHLINHVGRGTPRHPGAIETYIFAMFNENQKDSGVEQNWGLFYPNMQHVYPINF barley_1GHR.jpg ...

  1. Short history of PACS. Part I: USA

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H.K., E-mail: hkhuang@aol.com [Departments of Radiology and Biomedical Engineering, University of Southern California (United States); Hong Kong Polytechnic University (Hong Kong); Shanghai Institute of Technical Physics, Chinese Academy of Sciences (China)

    2011-05-15

    This historical review covers the PACS development in the USA during the past 28 years from 1982 to 2010. General historical remarks of PACS and international scene in three stages from infancy, puberty to adolescence are presented. Early PACS development was mostly financed by the federal government including the National Institutes of Health (NIH) and the U.S. Army Medical Research and Materiel Command. PACS evolution went through several stages. The earliest stages included the definition of large-scale PACS, establishment of the DICOM and other standards, the development of some early key PACS related technologies, and PACS implementation strategies. The later stages were in the concept of enterprise PACS, IHE (Integrating the Healthcare Enterprise) workflow profiles, and ePR with image distribution. The current most excited accomplishment is in the development of the new field in medical imaging informatics. This review goes through these stages and events in the USA during these 28 years, whenever an event involved participants from other countries, the contributors are cited.

  2. Short history of PACS. Part I: USA

    International Nuclear Information System (INIS)

    This historical review covers the PACS development in the USA during the past 28 years from 1982 to 2010. General historical remarks of PACS and international scene in three stages from infancy, puberty to adolescence are presented. Early PACS development was mostly financed by the federal government including the National Institutes of Health (NIH) and the U.S. Army Medical Research and Materiel Command. PACS evolution went through several stages. The earliest stages included the definition of large-scale PACS, establishment of the DICOM and other standards, the development of some early key PACS related technologies, and PACS implementation strategies. The later stages were in the concept of enterprise PACS, IHE (Integrating the Healthcare Enterprise) workflow profiles, and ePR with image distribution. The current most excited accomplishment is in the development of the new field in medical imaging informatics. This review goes through these stages and events in the USA during these 28 years, whenever an event involved participants from other countries, the contributors are cited.

  3. 78 FR 8175 - Final Flood Hazard Determinations

    Science.gov (United States)

    2013-02-05

    ..., 4305 Memorial Drive, Decatur, GA 30032. Bracken County, Kentucky, and Incorporated Areas Docket No... Main Street, Augusta, KY 41002. Unincorporated Areas of Bracken County. Bracken County Courthouse,...

  4. Valitsus vaeb USA viisavabadusenõudeid / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2008-01-01

    USA viisavabaduse aluseks oleva vastastikuse mõistmise memorandumi projekt on täna valitsuse istungi päevakorras. Tšehhi ja USA on juba sõlminud kahepoolse memorandumi, mõnedel hinnangutel on Tšehhi järele andnud kogu ameeriklaste nõudmiste paketile. Lisa: Andmekaitsjad pole viimase seisuga kursis

  5. Oletus : USA luurevanglad on Poolas ja Rumeenias / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2005-01-01

    USA ajalehe Washington Post andmeil hoiab USA terrorismis kahtlustavaid Ida-Euroopa riikides. Poola ajalehe allikate väitel on üks neist riikidest Poola. Poola, Rumeenia, Bulgaaria tõrjuvad kahtlustusi, Tšehhi väitel on ameeriklaste palvele vange majutada ära öeldud

  6. USA kliimamuutuse vastu: Kopenhaagenis ja edaspidi / Michael C. Polt

    Index Scriptorium Estoniae

    Polt, Michael C., 1954-

    2009-01-01

    Käsitledes Kopenhaageni kliimakonverentsi, märgib USA Eesti-suursaadik, et USA on valmis paika panema eesmärgi vähendada kohalike seadustega kooskõlas 2020. aastaks kasvuhoonegaaside heitmete emissiooni tasemeni, mis oleks 17% väiksem 2005. aasta tasemest

  7. FY2015 Analysis of the Teamwork USA Program. Memorandum

    Science.gov (United States)

    Howard, Mark

    2015-01-01

    The Department of Research and Evaluation (DRE) has completed an analysis of the performance of students who participated in the Teamwork USA Program, administered in FY2014 at three District schools. Teamwork USA hopes to improve student achievement at select Title I elementary schools via its Instrumental Music Program grant. This memorandum to…

  8. USA üritab leida Teherani agente Iraagist / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA süüdistab Iraani, et see abistab Iraagis mahdiste, mida juhib Muqtada al-Sadri. Autori sõnul on Iraani eliitüksuse Qudsi korpuse koostööd al-Sadriga aga sama vähe tõestatud kui omal ajal USA väidet Saddam Husseini ja al-Qaida vahel

  9. Continental Tire to Build New Tire Plant in USA

    Institute of Scientific and Technical Information of China (English)

    Yuan Ye

    2012-01-01

    According to Tire Comments of USA, Continental Tire earlier announced that in order to meet the increasing market demand on replacement tires of USA, German Tire Company had negotiated and reached an agreement on production capacity expansion with the South Carolina Government.

  10. Ruslands betændte forhold til USA

    DEFF Research Database (Denmark)

    Skak, Mette

    2015-01-01

    Rusland udgør en anden stormagtsudfordring for USA. Rusland er en stormagt i forfald, som imidlertid har genopfundet sin gamle sovjetiske 'Manifest Destiny'.......Rusland udgør en anden stormagtsudfordring for USA. Rusland er en stormagt i forfald, som imidlertid har genopfundet sin gamle sovjetiske 'Manifest Destiny'....

  11. Siin ta siis ongi: USA õnnelikem inimene / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Uuringufirma Gallup ja tervise edendamisele pühendunud ettevõtte Healthways poolt läbiviidud uuringu käigus saadi teada, milline on statistiliselt USA kõige õnnelikum inimene. Ajaleht New York Times võttiski aluseks Gallupi andmed ja otsis üles statistilistelt näitajatelt kõige õnnelikuma USA inimese, kelleks osutus Alwin Wong

  12. 78 FR 44531 - Corporation for Travel Promotion (dba Brand USA)

    Science.gov (United States)

    2013-07-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE International Trade Administration Corporation for Travel Promotion (dba Brand USA) AGENCY: International Trade... Promotion (dba Brand USA). The purpose of the Board is to guide the Corporation for Travel Promotion...

  13. 77 FR 38039 - Corporation for Travel Promotion (dba Brand USA)

    Science.gov (United States)

    2012-06-26

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF COMMERCE International Trade Administration Corporation for Travel Promotion (dba Brand USA) AGENCY: International Trade... membership on the Board of Directors of The Corporation for Travel Promotion (Board) (dba Brand USA)....

  14. USA ja EL vähendavad kaubandustõkkeid / Kertu Ruus

    Index Scriptorium Estoniae

    Ruus, Kertu, 1977-

    2005-01-01

    Tippkohtumisel Washingtonis arutasid Euroopa Komisjoni president Jose Manuel Barroso ja USA president George W. Bush, kuidas EL-i ja USA majandussuhteid vabamaks muuta. Diagramm: EL-i kaubavahetus USA-ga

  15. Vaiksed professionaalid USA erivägedes on tulevased liidrid / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    USA eriüksuste juhid kinnitavad esiterrorist Osama bin Ladeni peatset tabamist. Floridas Tampas asuvast USA Lähis-Ida operatsioonide peastaabist. Lisa: USA erioperatsioonide keskused. Vt. samas: Ameerika pikk ja väsitav sõda

  16. USA politoloogid : Obama võit oleks ka Eesti oma / Laura Vetik

    Index Scriptorium Estoniae

    Vetik, Laura

    2008-01-01

    USA politoloogide sõnul oleks pingestunud Venemaa ja USA suhete taustal Eestile kasulikum, kui 56. USA presidendivalimised võidaks demokraat Barack Obama. Erinevate politoloogide hinnanguid. Vt. samas: Obama ja McCain loovad kabinette

  17. President Meri näitas USA-le vabaduse ilu / Daniel Fried ; interv. Kaarel Kaas

    Index Scriptorium Estoniae

    Fried, Daniel, 1952-

    2006-01-01

    USA abivälisminister Daniel Fried USA välispoliitika ühest eesmärgist - demokraatia levitamisest maailmas, demokraatia olukorrast Venemaal ning USA ja Venemaa vahelistest suhetest. Lisa: Daniel Fried

  18. Ameerikat sõtta õhutanud Iraagi prominent kaotas USA soosingu / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Iraaklase Ahmed Chalabi tegevusest ja lubadustest USA Iraagi-vastase sõja alustamiseks. USA toetuse kahanemisest Chalabile ja süüdistustest, et ta andis salajast infot Iraanile USA vägede tegevuse kohta Iraagis

  19. Paragonimus kellicotti flukes in Missouri, USA.

    Science.gov (United States)

    Lane, Michael A; Marcos, Luis A; Onen, Nur F; Demertzis, Lee M; Hayes, Ericka V; Davila, Samuel Z; Nurutdinova, Diana R; Bailey, Thomas C; Weil, Gary J

    2012-08-01

    Paragonimiasis is an infection caused by lung flukes of the genus Paragonimus. In Asia, P. westermani infections are relatively common because of dietary practices. However, in North America, cases of paragonimiasis, which are caused by P. kellicotti flukes, are rare. Only 7 autochthonous cases of paragonimiasis were reported during 1968-2008. In 2009, we reported 3 new case-patients with paragonimiasis who had been seen at our medical center over an 18-month period. Six additional case-patients were identified in St. Louis, Missouri, USA, and treated at Washington University-affiliated health centers in 2009-2010. We report detailed descriptions of these case-patients, which includes unusual clinical manifestations. We also describe public health interventions that were undertaken to inform the general public and physicians about the disease and its mode of transmission.

  20. [Murder. Italy-USA comparative profiles].

    Science.gov (United States)

    Palermo, George B; Mastronardi, Vincenzo

    2012-01-01

    This paper, through illustrative cases of homicidal typologies, examines the generally accepted theories on the subject: 1) sociological ones by Lorenz to Sutherland and Cressey, by Berkowitz to Wolfgang and Ferracuti and others; 2) neurobiological ones, which include the involvement of the limbic, hippocampal and parietal lobes of the brain; 3) the psychological (psychodynamic) ones which are not disjoint from the types of individual criminal homicide and related aspects. In the discussion of the types of murders, family and extrafamilial murders are then taken into consideration, with the various meanings of revenge, challenge, other reasons linked to robbery, theft, settling scores leading to youth gangs and drive-by-shootings of marginalized adolescents, crimes related to drugs and to mental disorders. Infanticide and multiple murder, including mass murder and serial killer, conclude the work together with the statistics of murders and family murders in Italy compared to USA, specifically to the crime clock.

  1. SAT for NPP personnel training in USA

    International Nuclear Information System (INIS)

    This discussion addressed the experience with the application of SAT at USA NPPs. In particular, the transition of NPP training processes, staff composition, and reporting structure from the TMI accident to present. As well, oversight and guidance activities of the INPO and more intensive inspection by the NRC began during this period. The average NPP training staff grew to 30-40 per unit, along with a change in reporting line from plant to corporate management. With the reduction of resources occurring in the late 1980s, overall training staff size decreased, the composition changed, and reporting line reverted to plant management. The overall lessons-learned for application of the SAT consisted of the need for simplification, management involvement, and exploitation of the technology

  2. Living donor liver transplantation in the USA.

    Science.gov (United States)

    Kim, Peter T W; Testa, Giuliano

    2016-04-01

    Living donor liver transplant (LDLT) accounts for a small volume of the transplants in the USA. Due to the current liver allocation system based on the model for end-stage liver disease (MELD), LDLT has a unique role in providing life-saving transplantation for patients with low MELD scores and significant complications from portal hypertension, as well as select patients with hepatocellular carcinoma (HCC). Donor safety is paramount and has been a topic of much discussion in the transplant community as well as the general media. The donor risk appears to be low overall, with a favorable long-term quality of life. The latest trend has been a gradual shift from right-lobe grafts to left-lobe grafts to reduce donor risk, provided that the left lobe can provide adequate liver volume for the recipient. PMID:27115007

  3. Explosion-safety in Europe and the USA; Explosionsschutz in Europa und in USA

    Energy Technology Data Exchange (ETDEWEB)

    Maisch, D. [IMI Norgren-Herion Fluidtronic Gmbh und Co. KG, Fellbach (Germany)

    2000-12-01

    Acts of Parliament, regulations and standards governing both the construction of equipment and the conditions of installation in explosion-endangered areas have been issued in order that safety in such danger zones is not left to chance. These provisions differ from country to country. The following article discusses the relevant requirements in both the European community and the USA. (orig.) [German] Um die Sicherheit in explosionsgefaehrdeten Bereichen nicht dem Zufall zu ueberlassen, wurden Gesetze, Vorschriften und Normen erstellt, die sowohl Baubestimmungen fuer Geraete als auch die Installationsbedingungen fuer explosionsgefaehrdete Bereiche regeln. Diese Bestimmungen differieren von Land zu Land. Im folgenden wird naeher auf die Anforderungen in der Europaeischen Gemeinschaft und in USA eingegangen. (orig.)

  4. Review: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008) Buchbesprechung: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008)

    OpenAIRE

    Hans-Bernd Zöllner

    2009-01-01

    Review of the monograph: Grigoleit, Grit (2008), Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 pages Besprechung der Monographie: Grigoleit, Grit (2008), Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 Seiten

  5. Review: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008 Buchbesprechung: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008

    Directory of Open Access Journals (Sweden)

    Hans-Bernd Zöllner

    2009-07-01

    Full Text Available Review of the monograph: Grigoleit, Grit (2008, Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 pages Besprechung der Monographie: Grigoleit, Grit (2008, Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 Seiten

  6. eLearning in the USA: The Standard? The Benchmark?

    Directory of Open Access Journals (Sweden)

    Rolf Schulmeister

    2007-07-01

    Full Text Available More than 3 million enrolments in online courses in the USA are reported by American sources. The essay investigates the role of online studies within the American educational system and tries to find out more about the exact meaning of these extremely high figures. The research discovers astonishing facts and relations: Public schools offer more online courses (82% than private schools, and 52% of all online courses are offered by 2-year colleges for the associate degrees (and only 8% for the bachelor. A majority of online courses fulfill the role as "remedial courses" that serve for "credit recovery" (U.S. department of Education.The quality of these courses is not very high. This applies to the use of media as well as to the didactic concept. The teaching staff mainly consists of hired part-time lecturers who are still at the very entrance level to an academic career.The essay wants to initiate a discussion about the question if the European study system is in danger to imitate the shortcomings and consequences of the American educational system, because the European system is approximating the American due to recent political decisions. Can we still pursue the aims that we proclaimed when starting with eLearning, if in future eLearning will have to be used to repair the consequences of the bachelor?

  7. Medierne tager stilling : de amerikanske mediers rolle under USA's krige i det tyvende århundrede

    DEFF Research Database (Denmark)

    Pedersen, Carl George

    2005-01-01

    USA ; medier ; krige ; nyhedsformidling ; journalistik ; pressedækning ; krigsjournalistik ; historie......USA ; medier ; krige ; nyhedsformidling ; journalistik ; pressedækning ; krigsjournalistik ; historie...

  8. Iowa valus hoop Hillary Clintonile segas USA presidendivalimistel kaarte / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    USA presidendivalimiste eelvalimistel võitis demokraat Barack Obama. Presidendikandidaatide seisukohtadest. Tabel: USA presidendivalimised. Tulemused Iowas. Vt. samas: Tähtsaimaks osutusid majandus ja Iraagi sõda

  9. Main results of the 4th International PIV Challenge

    Science.gov (United States)

    Kähler, Christian J.; Astarita, Tommaso; Vlachos, Pavlos P.; Sakakibara, Jun; Hain, Rainer; Discetti, Stefano; La Foy, Roderick; Cierpka, Christian

    2016-06-01

    In the last decade, worldwide PIV development efforts have resulted in significant improvements in terms of accuracy, resolution, dynamic range and extension to higher dimensions. To assess the achievements and to guide future development efforts, an International PIV Challenge was performed in Lisbon (Portugal) on July 5, 2014. Twenty leading participants, including the major system providers, i.e., Dantec (Denmark), LaVision (Germany), MicroVec (China), PIVTEC (Germany), TSI (USA), have analyzed 5 cases. The cases and analysis explore challenges specific to 2D microscopic PIV (case A), 2D time-resolved PIV (case B), 3D tomographic PIV (cases C and D) and stereoscopic PIV (case E). During the event, 2D macroscopic PIV images (case F) were provided to all 80 attendees of the workshop in Lisbon, with the aim to assess the impact of the user's experience on the evaluation result. This paper describes the cases and specific algorithms and evaluation parameters applied by the participants and reviews the main results. For future analysis and comparison, the full image database will be accessible at http://www.pivChallenge.org .

  10. MAIN FACTORS DRIVING SOCIAL PUBLIC SERVICES IN INTERNATIONAL CONTEXT

    Directory of Open Access Journals (Sweden)

    Mihaela, GHENTA

    2014-03-01

    Full Text Available Literature and the latest reports point out that not only in Europe, but all over the world there is a growing demand for social services. As social needs have diversified, the number of potential users of social services has increased and this has generated increased complexity of social services. This paper highlights some of the results of a study conducted by the author in the doctoral studies program. One of the aims of this study was to identify the main factors that cause the current configuration of social services at global level. The research analysed the demographic changes and the impact of the crisis in social services for Europe, the United States of America (USA and Japan based on statistical data provided by the national statistics institutes for the regions considered. The results highlight the necessity of continuous development and reconfiguration of social services in order to meet the social and economic demands and to ensure a better organisation of these type of services.

  11. Comparing forest fragmentation and its drivers in China and the USA with Globcover v2.2

    Science.gov (United States)

    Li, M.; Mao, L.; Zhou, C.; Vogelmann, J.E.; Zhu, Z.

    2010-01-01

    Forest loss and fragmentation are of major concern to the international community, in large part because they impact so many important environmental processes. The main objective of this study was to assess the differences in forest fragmentation patterns and drivers between China and the conterminous United States (USA). Using the latest 300-m resolution global land cover product, Globcover v2.2, a comparative analysis of forest fragmentation patterns and drivers was made. The fragmentation patterns were characterized by using a forest fragmentation model built on the sliding window analysis technique in association with landscape indices. Results showed that China's forests were substantially more fragmented than those of the USA. This was evidenced by a large difference in the amount of interior forest area share, with China having 48% interior forest versus the 66% for the USA. China's forest fragmentation was primarily attributed to anthropogenic disturbances, driven particularly by agricultural expansion from an increasing and large population, as well as poor forest management practices. In contrast, USA forests were principally fragmented by natural land cover types. However, USA urban sprawl contributed more to forest fragmentation than in China. This is closely tied to the USA's economy, lifestyle and institutional processes. Fragmentation maps were generated from this study, which provide valuable insights and implications regarding habitat planning for rare and endangered species. Such maps enable development of strategic plans for sustainable forest management by identifying areas with high amounts of human-induced fragmentation, which improve risk assessments and enable better targeting for protection and remediation efforts. Because forest fragmentation is a long-term, complex process that is highly related to political, institutional, economic and philosophical arenas, both nations need to take effective and comprehensive measures to mitigate the

  12. Ameerika suursaadik Aldona Sofia Wos : toon kättpidi USA suurfirmad Eestisse / Aldona Zofia Wos ; interv. Airi Ilisson

    Index Scriptorium Estoniae

    Wos, Aldona Zofia

    2005-01-01

    USA suursaadik Eestis vastab küsimustele, mis on seotud Londonis USA riigidepartemangu korraldatud konverentsiga, kus Balti riikide juhid rääkisid USA ettevõtete esindajatele, miks tuleks investeerida Balti riikidesse. USA tehtud investeeringutest Eestisse, Eesti ettevõtjate võimalustest USA-s. Lisa: Tõhus rahapüüdja

  13. The art of scab-vending : tattoo practices in Seattle, USA

    OpenAIRE

    2002-01-01

    This paper is based on fieldwork conducted in Seattle, U.S.A., mainly amongst the buzz of electric needles and the smell of green soap in a selection of local tattoo shops. Tattooing and tattoos in modern day Seattle are created and enacted in a complex and contested matrix of motivations and interpretations that refer to the western tattoo's specific history as a mark of enforced or self-inscribed marginality, to other tattoo practices and discourses around the world, and to the relation bet...

  14. II. GULF WAR, USA, GREAT MIDDLE EAST PROJECT AND TURKEY

    OpenAIRE

    LEVENT GOKDEMIR

    2009-01-01

    Middle East has always been the region having the first priority in the cynosure of USA because of two reasons. The first and the most important reason is petroleum. 61.9 % of petroleum reserves on the Earth are located in Middle East region. Therefore, meeting the petroleum need of the USA and its allies with a reasonable price and providing the constant petroleum flow from this region have been two important factors in the policy that the USA developed for the region. The global petroleum n...

  15. About the treaty of complete nuclear test ban: the USA between unilateralism and multilateralism; A propos du traite sur l'interdiction complete des essais nucleaires: les Etats-Unis entre l'unilateralisme et le multilateralisme

    Energy Technology Data Exchange (ETDEWEB)

    Sur, S. [Universite Pantheon-Assas, 75 - Paris (France); Centre Thucydide, Analyse et Recherche en Relations Internationales, 75 - Paris (France)

    2000-07-01

    This article analyses the possible reasons that have led the US Senate to reject the treaty of comprehensive nuclear test ban. Even if this decision did not retained the attention of the international public opinion, it appears as surprising because the USA have worked a lot for the elaboration of this treaty and were considered as the main beneficiaries of it. Three interpretations are proposed by the author: some purely internal disputes inside Clinton's administration, a real will of the USA to abandon the arms control policy, or an intermediate attitude which allows the USA to act on different levels and to get rid of common rules. (J.S.)

  16. Southwestern USA Drought over Multiple Millennia

    Science.gov (United States)

    Salzer, M. W.; Kipfmueller, K. F.

    2014-12-01

    Severe to extreme drought conditions currently exist across much of the American West. There is increasing concern that climate change may be worsening droughts in the West and particularly the Southwest. Thus, it is important to understand the role of natural variability and to place current conditions in a long-term context. We present a tree-ring derived reconstruction of regional-scale precipitation for the Southwestern USA over several millennia. A network of 48 tree-ring chronologies from California, Nevada, Utah, Arizona, New Mexico, and Colorado was used. All of the chronologies are at least 1,000 years long. The network was subjected to data reduction through PCA and a "nested" multiple linear regression reconstruction approach. The regression model was able to capture 72% of the variance in September-August precipitation over the last 1,000 years and 53% of the variance over the first millennium of the Common Era. Variance captured and spatial coverage further declined back in time as the shorter chronologies dropped out of the model, eventually reaching 24% of variance captured at 3250 BC. Results show regional droughts on decadal- to multi-decadal scales have been prominent and persistent phenomena in the region over the last several millennia. Anthropogenic warming is likely to exacerbate the effects of future droughts on human and other biotic populations.

  17. A BWR licensing experience in the USA

    International Nuclear Information System (INIS)

    The US-Advanced Boiling Water Reactor (A BWR), certified by the United States Nuclear Regulatory Commission (US NRC), is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (STP3-4) Combined License Application (Cola). Nuclear Innovation North America (Nina) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The STP3-4 project has finished the US NRC technical review of the Cola through the final meeting of the Advisory Committee on Reactor Safeguards (ACRS), and the Final Safety Evaluation Report (FSER) is scheduled to be issued by the US NRC in the middle of 2015. The next steps are to support the Mandatory Hearing process, and voting by the NRC commissioners on the motion to grant the Combined License, which is scheduled beginning of 2016 according to US NRC schedule as of March 30, 2015. This paper summarizes the history and progress of the US-A BWR licensing, including the experiences of the Licensee, Nina, and Toshiba as the Epc team worked through the Code of Federal Regulations Title 10 (10-Cfr) Part 52 process, and provides some perspectives on how the related licensing material would also be of value within a 10-Cfr Part 50, two-step process to minimize schedule and financial risks which could arise from ongoing technical developments and regulatory reviews. (Author)

  18. A BWR licensing experience in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Powers, J.; Ogura, C. [Toshiba America Nuclear Energy, Charlotte, North Carolina (United States); Arai, K. [Toshiba Corporation, Yokohama, Kanagawa (Japan); Thomas, S.; Mookhoek, B., E-mail: jim.powers@toshiba.com [Nuclear Innovation North America, Lake Jackson, Texas (United States)

    2015-09-15

    The US-Advanced Boiling Water Reactor (A BWR), certified by the United States Nuclear Regulatory Commission (US NRC), is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (STP3-4) Combined License Application (Cola). Nuclear Innovation North America (Nina) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The STP3-4 project has finished the US NRC technical review of the Cola through the final meeting of the Advisory Committee on Reactor Safeguards (ACRS), and the Final Safety Evaluation Report (FSER) is scheduled to be issued by the US NRC in the middle of 2015. The next steps are to support the Mandatory Hearing process, and voting by the NRC commissioners on the motion to grant the Combined License, which is scheduled beginning of 2016 according to US NRC schedule as of March 30, 2015. This paper summarizes the history and progress of the US-A BWR licensing, including the experiences of the Licensee, Nina, and Toshiba as the Epc team worked through the Code of Federal Regulations Title 10 (10-Cfr) Part 52 process, and provides some perspectives on how the related licensing material would also be of value within a 10-Cfr Part 50, two-step process to minimize schedule and financial risks which could arise from ongoing technical developments and regulatory reviews. (Author)

  19. Professional Training of Economists in the USA

    Directory of Open Access Journals (Sweden)

    Rudnitska Kateryna

    2014-12-01

    Full Text Available The article deals with the peculiarities of American professional undergraduate and graduate training in economics. The analysis of documents, scientific and educational literature demonstrates the diversity of the US training courses and combinations of disciplines in economics. It has been defined that leading position of the USA in the world and its impact on the economic life of other countries has predetermined the development of the internationalization of economic education at the undergraduate and graduate level: by offering courses in International Economics as well as introductory programs for international Internships for students and teachers. The program of study in economics provides various forms of learning, number of major, minor and elective courses. It has been determined that economics majors include variety of courses, ranging from those which are intensely mathematical like Principles of Economics, Microeconomic, Macroeconomics and Econometrics, to more philosophical courses like History of Economic Thought. Moreover, courses in Survey Design, Political Science and Computer Science are also highly recommended and essential for future success. In order to achieve the objectives in economists' training in high school a system of new methods, means and approaches (“Chalk and Talk”, “Proficiency Approach”, “Peaconomics”, “Writing Intensive” are used to stimulate and motivate students to cognitive functions. The educational process and control by teachers through traditional and innovative techniques provides effective feedback.

  20. Riigikogu maine ja armastus / Aune Past

    Index Scriptorium Estoniae

    Past, Aune, 1954-

    2007-01-01

    Autor arutleb Riigikogu maine üle, toetudes TÜ ajakirjanduse ja kommunikatsiooni osakonna 2007. aastal tehtud uuringu tulemustele. Riigikogu liikmete maine paraneks, kui neil endil oleks selge, mis eesmärgil Toompeale mindi ja sellest siis ka rahvale kõneldaks

  1. Maine's Employability Skills Program

    Science.gov (United States)

    McMahon, John M.; Wolffe, Karen E.; Wolfe, Judy; Brooker, Carrie

    2013-01-01

    This Practice Report describes the development and implementation of the "Maine Employability Skills Program," a model employment program developed by the Maine Division for the Blind and Visually Impaired (DBVI). The program was designed to support the efforts of the chronically unemployed or underemployed. These consumers were either…

  2. Reson 8101 Backscatter imagery of Penguin Bank, Molokai, Hawaii, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Backscatter imagery extracted from gridded bathymetry of Penguin Bank, Molokai, Hawaii, USA. These data provide almost complete coverage between 0 and 100 meters....

  3. USA uus ÜRO saadik alustas pealetungi / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Ameerika Ühendriikide uus ÜRO suursaadik John Bolton nõuab 190 liikmesriigile saadetud kirjas ÜRO reformikavades suurte ja oluliste muudatuste tegemist: reformikavast peaks USA arvates kustutama vähemalt 400 paragrahvi

  4. Biochar in the USA. Starting new methods for green energy

    Energy Technology Data Exchange (ETDEWEB)

    Meehan, Chris

    2012-07-01

    Companies in the USA develop pyrolysis and gasification systems to generate electricity from biomass and sell the by-product. Up to now it is interesting for agriculture and livestock producers. (orig.)

  5. CIA salalennud varjutasid USA-Saksa kohtumist / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Saksa välisministri Frank-Walter Steinmeieri visiidist Washingtoni. Vahetult enne välisministri visiiti selgus, et USA Luure Keskagentuuri salalennukid terrorismisõjas vahistatutega võisid maanduda ka Saksamaal

  6. Ämari baas sobib USA-le ja brittidele

    Index Scriptorium Estoniae

    2013-01-01

    Eelmisel nädalal Eestit külastanud USA ja Ühendkuningriigi sõjalised esindajad NATO juures kindralleitnandid David R. Hogg ja Christopher Harper kinnitasid, et on valmis oma lennukeid Ämari baasist opereerima

  7. USA valitsus sõdib New Yorgi suurlehega / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    New York Timesi tembeldamine USA ebapatriootlikemaks ajaleheks, sest see uuris Bushi administratsiooni salajasi jälgimisprogramme, on tekitanud küsimuse, kas tegu pole poliitilise aktsiooniga õõnestada lehe usaldusväärsust

  8. USAs teevad kirbud elevantidele ära / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2002-01-01

    Peale 2001. aasta terrorirünnakuid raskustesse sattunud USA lennunduses tõusevad esile väikesed lennufirmad, mis pakuvad kvaliteetset teenust ülisoodsa hinna eest. Ameerika lennufirma Southwest Airlines'i näide

  9. News and Features Updates from USA.gov

    Data.gov (United States)

    General Services Administration — Stay on top of important government news and information with the USA.gov Updates: News and Features RSS feed. We'll update this feed when we add news and featured...

  10. Ocean Biogeographic Information System (OBIS) - USA Dataset Collection

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — OBIS-USA provides aggregated, interoperable biogeographic data collected primarily from U.S. waters and oceanic regions--the Arctic, the Atlantic and Pacific...

  11. USA paisutas mullu maailma sõjalisi kulutusi

    Index Scriptorium Estoniae

    2007-01-01

    Stockholmi rahvusvahelise rahu-uuringute instituudi (SIPRI) raporti kohaselt on kasvasid riikide kulutused relvajõududele aastaga 3,5%, viimase 10 aastaga 37%. USA relvajõududele kulus 396 miljardit

  12. USA ärgitab Saddami eksiili saatma / Sten A Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Sten A., 1979-

    2003-01-01

    USA kaitseminister Donald Rumsfeld, välisminister Colin Powell ja riikliku julgeoleku nõunik Condoleezza Rice toetavad ideed saata Iraagi president Saddam Hussein eksiili. Iraagi erisaadik lükkas selle võimaluse tagasi

  13. USA politsei valusad küsimused / Eve Tisler

    Index Scriptorium Estoniae

    Tisler, Eve

    2015-01-01

    Ameerika Ühendriikide õiguskaitseorganite viimase aja suurimad probleemid on seotud süüdistustega, et USA politsei kasutab oma töös liigset jõudu ja teeb seda eelkõige mustanahaliste inimestega suheldes

  14. Iraagis on surma saanud juba 2000 USA sõjaväelast / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    USA-s suri 2000. sõjaväelane Iraagis saadud haavadesse. Kui USA juhitud välismaiste relvajõudude esindaja Bagdadis kutsus meediat seda arvu mitte üle tähtsustama, siis USA meedia seevastu pidas seda just oluliseks märgiks. Diagrammid: Iraagi sõja inimkaotused

  15. Clinton: USA kaotab infosõjas Hiina, Venemaa ja Al Jazeeraga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    USA välisministri Hillary Clintoni hinnangul on USA propaganda nõrgenenud ning USA mõjuvõim väheneb pidevalt. H. Clintoni vastusest Senati väliskomisjonis senaator Richard Lugari küsimusele USA pingutustest diplomaatilise kommunikatsiooni vallas

  16. USA kindral ei soovita sõjalist kohalolekut Iraagis niipea vähendada / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2007-01-01

    USA vägede juhataja Iraagis David Petraeus ja suursaadik Iraagis Ryan Cocker käsitlesid USA Esindajatekoja relvajõudude ja väliskomitee ühisistungil olukorda Iraagis ja USA sõjalist kohalolekut. Nad soovisid Kongressilt USA vägede säilitamist enam-vähem praegusel tasemel kuni 2008. aasta suveni

  17. USA salajane riigiametnike komisjon võib panna ka oma kodanikud tapanimekirja / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Jeemenis USA droonirünnakus hukkunud Anwar al-Awlaki, keda USA valitsusesindajad nimetasid al-Qaida talendiotsijaks ja värvatute motiveerijaks, oli väidetavalt esimene USA kodanik, kes oli pandud USA vastu võitlevate terroristide nn. tapanimekirja

  18. USA järelevalve e-side üle maailmas tugevneb / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2007-01-01

    USA Kongress võttis vastu seaduse, mis annab eriteenistustele suurema tegutsemisvabaduse rahvusvahelise e-side jälgimisel ning nõuab USA-d külastavate viisavabade riikide ärimeestelt eelinfot oma tegevuse kohta. Lisa: USA-s heakskiidetud terrorismivastased abinõud

  19. 78 FR 14400 - Southern USA Resources, Inc., Order of Suspension of Trading

    Science.gov (United States)

    2013-03-05

    ... COMMISSION Southern USA Resources, Inc., Order of Suspension of Trading March 1, 2013. It appears to the... securities of Southern USA Resources, Inc. (``Southern USA'') because of questions regarding the accuracy of... company's outstanding shares. Southern USA's securities are quoted on the OTC Link, operated by...

  20. Application of radioisotopes for diagnosis and therapy in USA

    International Nuclear Information System (INIS)

    Insights into the application of radionuclides for diagnosis and therapy of diseases and role of the nuclear medicine in USA are reviewed. Evaluation data on the forecast future demand for 67Cu, 123I, 111In, 103Pd, 188W → 188Re, 117Sn, 127Xe medical isotopes in USA are tabulated. Some medical radionuclides, their application and preparation are demonstrated. Three groups of priority medicine isotopes are listed. Forecast future demand of radionuclides to 2020 is given

  1. Students’ Perception About Management Education in India and USA

    OpenAIRE

    Shetty, Bhavna R.; Gujarathi, Rajashree

    2013-01-01

    The purpose of this research was to gain an insight into students’ perception about the quality of management education especially the Masters of Business Administration (MBA) program; as structured and taught in India and USA. Specific objectives were comparing students’ perception regarding the quality parameters input, process and output of the two MBA programs. The study covered students who had successfully completed MBA in India and those Indians who had pursued an MBA in USA. The hypot...

  2. Bush võitleb tugeva presidendi maine nimel / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 13. juuni 2007, lk. 5. USA president George W. Bush pidi sekkuma immigratsioonireformi debatti. Vt. samas: Malta ja Rootsi nõuavad sisserändajate jagamist

  3. ECONOMIC INTERDEPENDENCE BETWEEN THE USA AND CHINA

    OpenAIRE

    MANTEA Alin

    2012-01-01

    Interdependence is one of the main concepts in international relations. The idea of this theory appears for the first time within Robert Keohane and Joseph Nye`s research ?Power and Interdependence?, in the mid 70`s. They focus mainly on liberalism, economy, international organizations and transnational corporations.We can speak about interdependence both at the global level, between all international actors as well as at the bilateral level, between two states. First part of the paper is abo...

  4. Health Care Reform in the USA

    OpenAIRE

    Zemanová, Iva

    2011-01-01

    This thesis is concerned with US health care. It is focused especially on the health insurance market. It introduces basic characteristics of the US insurance system and discusses its main problems. The goal of this thesis is to determine whether voluntary private insurance is the main source of problems that the US health care system currently experiences. In order to do that, greatest deficiencies of US insurance policies, especially private ones, are identified based on the efficiency crit...

  5. Tuleohutud sigaretid vähendasid hukkunute arvu USA-s veerandi võrra / Priit Laaniste

    Index Scriptorium Estoniae

    Laaniste, Priit

    2007-01-01

    Paljudes USA osariikides ning Kanadas on müügil ainult tuleohutud sigaretid. Tuleohutute sigarettide kasutamist nõudvad seadused on vastu võetud 21 USA osariigis ja Kanadas. Euroopa Komisjonil on valminud otsuse eelnõu, millega soovitakse kehtestada ohutusnõuded Euroopa Liidus käibel olevate sigarettide kohta. Kommenteerib majandus- ja kommunikatsiooniministeeriumi siseturuosakonna peaspetsialist Kristel Kõiv. Lisatud: kustutamata suitsukonist alguse saanud traagilisemad tulekahjud

  6. Correlates of consistent condom use with main-new and main-old sexual partners.

    Science.gov (United States)

    Wiemann, Constance M; Chacko, Mariam R; Kozinetz, Claudia A; DiClemente, Ralph; Smith, Peggy B; Velasquez, Mary M; von Sternberg, Kirk

    2009-09-01

    An exploratory study identified correlates of consistent condom use for young women reporting Main-new or Main-old partners in the past 3 months: frequency of vaginal sex (across partner types); perceived likelihood of getting a STI (Main-new); age and STI history (Main-old). To enhance programmatic efficacy in community clinics, these key correlates of condom use for main partner types should be incorporated in STI risk reduction counseling. PMID:19699427

  7. Mercury in bird eggs from coastal Maine

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Maine's coastal islands and beaches provide important nesting habitat for piping plover (Charadrius melodus), least tern (Sterna antillarum), common tern (Sterna...

  8. Alcid Nesting Habitat on the Maine Coast

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Maine supports an extensive seabird population because of the abundance of relatively inaccessible rocky coastal islands which are ideal nesting grounds for many...

  9. Station Management Plan Maine Coastal Refuges

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This management plan outlines how four Maine refuges and twelve islands and one peninsula should be managed over the next three to five years. Plan results are...

  10. Libraries in Maine: MedlinePlus

    Science.gov (United States)

    ... weebly.com/ Bar Harbor The Jackson Laboratory The Joan Staats Library 600 Main Street Bar Harbor, ME ... Health and Human Services National Institutes of Health Page last updated on 6 October 2016

  11. Distributed PV Adoption in Maine Through 2021

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter; Sigrin, Ben

    2015-11-06

    NREL has used its dSolar (distributed solar) model to generate low-medium-high estimates of distributed PV adoption in Maine through 2021. This presentation gives a high-level overview of the model and modeling results.

  12. Seasonal Composite Chlorophyll Concentrations - Gulf of Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This personal geodatabase contains raster images of chlorophyll concentrations in the Gulf of Maine. These raster images are seasonal composites, and were...

  13. Monthly Composite Chlorophyll Concentrations - Gulf of Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This personal geodatabase contains raster images of chlorophyll concentrations in the Gulf of Maine. These raster images are monthly composites, and were calculated...

  14. Hillshades for the main 8 Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These hillshade datasets were derived from USGS 7.5' DEM Quads for the main 8 Hawaiian Islands. Individual DEM quads were first converted to a common datum, and...

  15. Crash Recovery for Embedded Main Memory Database

    Directory of Open Access Journals (Sweden)

    Fang Ye

    2012-10-01

    Full Text Available In the last years, the deployment of embedded real-time communication systems has increased dramatically. At the same time, the amount of data that needs to be managed by embedded real-time main memory databases is increasing, thus requiring an efficient data management. However, system crash will cause data loss in main memory, which will seriously affect the normal operation of the entire communication system. This paper introduces an algorithm of system crash recovery applied in main memory database of embedded real-time communication system. This paper expatiates the software architecture of SDR base station, the cause of crash occurring, and proposes the flash recovery algorithm using for system recovery. A main memory database using this algorithm has been applied in a real communication system——multimode SDR base station communication system.

  16. SERVICE QUALITY — MAIN CONCEPTUALIZATIONS AND CRITIQUE

    OpenAIRE

    Maive Suuroja

    2003-01-01

    Conceptualization and measurement of service quality perceptions have been the most debated and controversial topics in the services marketing literature to date. The current paper analyzes the main debates about how to conceptualize service quality — about the nature of perceived service quality (perception of performance vs. disconfirmation) and the formation of service quality (single construct vs. aggregation of several dimensions). The paper explores the main theoretical viewpoints and s...

  17. The new institutional economics - main theories

    OpenAIRE

    Emilia Obińska-Wajda

    2016-01-01

    The aim of this arti cle is to show that the New Insti tuti onal Economics is an interdisciplinary stream combining economics, law, organizati on theory, politi cal sciences, sociology, and anthropology. The main theories which are part of the New Insti tuti onal Economics are: Agency Theory, Property Rights Theory and Transaction Costs Theory. The basic assumptions of these theories are mentioned in this paper. This article is an introduction to the New Institutional Economics and its main t...

  18. Main Features of SMEs Organisation System

    OpenAIRE

    Ovidiu NICOLESCU

    2009-01-01

    SMEs present many particularities which influence to a large extend their functionality and performance. A very deep investigation of more than 60 SMEs has revealed what are the major variables having influence on SMEs organisation and the main features of organisation system. In the first part the paper indicate the variables influencing the SMEs. In the second part there are presented the nine main features of SMEs organisation system.

  19. Molecular clusters of the main group elements

    CERN Document Server

    Driess, Matthias

    2008-01-01

    ""To summarize, Molecular Clusters of the Main Group Elements is certainly not a popular science book, nor is it a textbook; it is a very good, up-to-date collection of articles for the specialist. Als Fazit bleibt: Molecular Clusters of the Main Group Elements ist sicher kein populissenschaftliches Werk, auch kein Lehrbuch, aber eine gelungene, hoch aktuelle Zusammenstellung fen interessierten Fachmann."" -Michael Ruck, TU Dresden, Angewandte Chemie, 2004 - 116/36 + International Edition 2004 - 43/36

  20. 77 FR 27082 - StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc., 1250 H Street, Greeley, CO...

    Science.gov (United States)

    2012-05-08

    ... December 28, 2010, applicable to workers and former workers of StarTek USA, Inc., Greeley, Colorado. The Department's notice of determination was published in the Federal Register on January 14, 2011 (76 FR 2717... Employment and Training Administration StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA,...

  1. Main building fire drill safely concluded

    CERN Multimedia

    CERN Bulletin

    2015-01-01

    Last week, a simulated fire in the stairwell of the Main Building put CERN’s emergency response procedures to the test.   Firefighters descend the stairwell in the Main Building as the simulated fire rises.   At 2 p.m. on 22 September, alarms sounded around CERN’s Main Building as an evacuation exercise got underway. A simulated fire in the  stairwell, complete with very realistic smoke, led to the evacuation of one of the busiest places at CERN. The Main Building complex includes the Carlson Wagonlit travel agency, the post office, UBS, Uniqa, the Users Office, the Staff Association and the Novae restaurant as well as the Main Auditorium, the Council Chamber and the Charpak meeting room. It was impressive to see how quickly the smoke propagated in the staircase as well as into the corridors, and equally impressive to see how smoothly, quickly and efficiently the evacuation proceeded. The...

  2. Main Coast Winds - Final Scientific Report

    Energy Technology Data Exchange (ETDEWEB)

    Jason Huckaby; Harley Lee

    2006-03-15

    The Maine Coast Wind Project was developed to investigate the cost-effectiveness of small, distributed wind systems on coastal sites in Maine. The restructuring of Maine's electric grid to support net metering allowed for the installation of small wind installations across the state (up to 100kW). The study performed adds insight to the difficulties of developing cost-effective distributed systems in coastal environments. The technical hurdles encountered with the chosen wind turbine, combined with the lower than expected wind speeds, did not provide a cost-effective return to make a distributed wind program economically feasible. While the turbine was accepted within the community, the low availability has been a negative.

  3. Evolving plans for the USA National Phenology Network

    Science.gov (United States)

    Betancourt, Julio L.; Schwartz, Mark D.; Breshears, David D.; Brewer, Carol A.; Frazer, Gary; Gross, John E.; Mazer, Susan J.; Reed, Bradley C.; Wilson, Bruce E.

    2007-01-01

    Phenology is the study of periodic plant and animal life cycle events, how these are influenced by seasonal and interannual variations in climate, and how they modulate the abundance, diversity, and interactions of organisms. The USA National Phenology Network (USA-NPN) is currently being organized to engage federal agencies, environmental networks and field stations, educational institutions, and citizen scientists. The first USA-NPN planning workshop was held August 2005, in Tucson, Ariz. (Betancourt et al. [2005]; http://www.uwm.edu/Dept/Geography/npn/; by 1 June 2007, also see http://www.usanpn.org). With sponsorship from the U.S. National Science Foundation, the U.S. Geological Survey (USGS), the U.S. Fish and Wildlife Service, and NASA, the second USA-NPN planning workshop was held at the University of Wisconsin-Milwaukee on 10–12 October 2006 to (1) develop lists of target species and observation protocols; (2) identify existing networks that could comprise the backbone of nationwide observations by 2008; (3) develop opportunities for education, citizen science, and outreach beginning in spring 2007; (4) design strategies for implementing the remote sensing component of USA-NPN; and (5) draft a data management and cyberinfrastructure plan.

  4. 1.An Examination of Malaysia’s Structural Breaks Vis-À-Vis Japan and the USA

    Directory of Open Access Journals (Sweden)

    Md. Wahid Murad

    2012-12-01

    Full Text Available This paper primarily examines whether Malaysia has had experienced any structural breaks in comparison with its main two trading partners, namely the USA and Japan in 1970s, 1980s, 1990s and 2000s. It also discusses the implications of such structural breaks to Malaysia’s economic globalization at the international level. Using some econometric and statistical tools such as the ADF test, transformed lag equation, Chow Breakpoint test, and CUSUM test, the study reveals that only at 1% level of significance income ratio of Japan and Malaysia has had experienced structural breaks in terms ofGDP during the periods 1980s, 1990s, and 2000s. In respect of GNI, the study reveals that only at 5% level of significance their income ratio has had experienced structural breaks during these periods. The study further reveals that income ratio of the USA and Malaysia does not have any structural break both in respect of GNI and GDP.

  5. D.E.R. 92 - Main facts

    International Nuclear Information System (INIS)

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  6. Water Hammer in Pumped Sewer Mains

    DEFF Research Database (Denmark)

    Larsen, Torben

    This publication is intended for engineers seeking an introduction to the problem of water hammer in pumped pressure mains. This is a subject of increasing interest because of the development of larger and more integrated sewer systems. Consideration of water hammer is essential for structural...

  7. Kommunikatsioon ja maaelu maine / Ants Laansalu

    Index Scriptorium Estoniae

    Laansalu, Ants, 1938-2011

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 156-159. Autori hinnangul mõjutas meedias EL-i põllumajanduspoliitika kohta loodud negatiivne maine oluliselt Eesti põllumajanduspoliitika kujundamist riigi tasandil kuni 2000. a. ja ettevõtlus tasandil kuni 2003. a.

  8. Foreign Body in Left Main Bronchus.

    Science.gov (United States)

    Dhadke, Shubhangi V; Chaudhari, Amit L; Deshpande, Neelima S; Dhadke, Vithal N; Sangle, Shashikala A

    2015-07-01

    Tracheobronchial foreign body (TFB) aspiration is rare in adults, although incidence rates increases with advancing age. We report a case of foreign body in left main bronchus in an adult female who had no risk factor. She was successfully treated with removal of betel nuts by bronchoscopy. Unusual presentation and high index of suspicion can help in proper management. PMID:26731835

  9. Maine KIDS COUNT 2002 Data Book.

    Science.gov (United States)

    Maine Children's Alliance, Augusta.

    This KIDS COUNT data book details statewide trends in the well-being of Maine's children. Following a brief overview of the data book and a summary of indicators, state trend data are presented in the areas of: (1) poverty; (2) child and adolescent suicide; (3) public high school dropouts; (4) teen pregnancy; (5) public high school graduates…

  10. 76 FR 59177 - Maine Disaster #ME-00029

    Science.gov (United States)

    2011-09-23

    ... ADMINISTRATION Maine Disaster ME-00029 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a Notice of the Presidential declaration of a major ] disaster for Public Assistance Only for the... Kingsport Road, Fort Worth, TX 76155. FOR FURTHER INFORMATION CONTACT: A. Escobar, Office of...

  11. Main facts 1995; Faits marquants 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations.

  12. Geomagnetic main field modeling with DMSP

    Science.gov (United States)

    Alken, P.; Maus, S.; Lühr, H.; Redmon, R. J.; Rich, F.; Bowman, B.; O'Malley, S. M.

    2014-05-01

    The Defense Meteorological Satellite Program (DMSP) launches and maintains a network of satellites to monitor the meteorological, oceanographic, and solar-terrestrial physics environments. In the past decade, geomagnetic field modelers have focused much attention on magnetic measurements from missions such as CHAMP, Ørsted, and SAC-C. With the completion of the CHAMP mission in 2010, there has been a multiyear gap in satellite-based vector magnetic field measurements available for main field modeling. In this study, we calibrate the special sensor magnetometer instrument on board DMSP to create a data set suitable for main field modeling. These vector field measurements are calibrated to compute instrument timing shifts, scale factors, offsets, and nonorthogonality angles of the fluxgate magnetometer cores. Euler angles are then computed to determine the orientation of the vector magnetometer with respect to a local coordinate system. We fit a degree 15 main field model to the data set and compare with the World Magnetic Model and Ørsted scalar measurements. We call this model DMSP-MAG-1, and its coefficients and software are available for download at http://geomag.org/models/dmsp.html. Our results indicate that the DMSP data set will be a valuable source for main field modeling for the years between CHAMP and the recently launched Swarm mission.

  13. D.E.R. 91 main facts

    International Nuclear Information System (INIS)

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: New applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  14. Assisted reproductive technology in the USA: Is more regulation needed?

    Science.gov (United States)

    Frith, Lucy; Blyth, Eric

    2014-10-01

    The regulation of assisted reproductive technologies is a contested area. Some jurisdictions, such as the UK and a number of Australian states, have comprehensive regulation of most aspects of assisted reproductive technologies; others, such as the USA, have taken a more piecemeal approach and rely on professional guidelines and the general regulation of medical practice to govern this area. It will be argued that such a laissez-faire approach is inadequate for regulating the complex area of assisted reproductive technologies. Two key examples, reducing multiple births and registers of donors and offspring, will be considered to illustrate the effects of the regulatory structure of assisted reproductive technologies in the USA on practice. It will be concluded that the regulatory structure in the USA fails to provide an adequate mechanism for ensuring the ethical and safe conduct of ART services, and that more comprehensive regulation is required. PMID:25171854

  15. A geochemical atlas of North Carolina, USA

    Science.gov (United States)

    Reid, J.C.

    1993-01-01

    A geochemical atlas of North Carolina, U.S.A., was prepared using National Uranium Resource Evaluation (NURE) stream-sediment data. Before termination of the NURE program, sampling of nearly the entire state (48,666 square miles of land area) was completed and geochemical analyses were obtained. The NURE data are applicable to mineral exploration, agriculture, waste disposal siting issues, health, and environmental studies. Applications in state government include resource surveys to assist mineral exploration by identifying geochemical anomalies and areas of mineralization. Agriculture seeks to identify areas with favorable (or unfavorable) conditions for plant growth, disease, and crop productivity. Trace elements such as cobalt, copper, chromium, iron, manganese, zinc, and molybdenum must be present within narrow ranges in soils for optimum growth and productivity. Trace elements as a contributing factor to disease are of concern to health professionals. Industry can use pH and conductivity data for water samples to site facilities which require specific water quality. The North Carolina NURE database consists of stream-sediment samples, groundwater samples, and stream-water analyses. The statewide database consists of 6,744 stream-sediment sites, 5,778 groundwater sample sites, and 295 stream-water sites. Neutron activation analyses were provided for U, Br, Cl, F, Mn, Na, Al, V, Dy in groundwater and stream water, and for U, Th, Hf, Ce, Fe, Mn, Na, Sc, Ti, V, Al, Dy, Eu, La, Sm, Yb, and Lu in stream sediments. Supplemental analyses by other techniques were reported on U (extractable), Ag, As, Ba, Be, Ca, Co, Cr, Cu, K, Li, Mg, Mo, Nb, Ni, P, Pb, Se, Sn, Sr, W, Y, and Zn for 4,619 stream-sediment samples. A small subset of 334 stream samples was analyzed for gold. The goal of the atlas was to make available the statewide NURE data with minimal interpretation to enable prospective users to modify and manipulate the data for their end use. The atlas provides only

  16. THE MAIN PRINCIPLES OF TOTAL QUALITY MANAGEMENT

    Directory of Open Access Journals (Sweden)

    Andrei DIAMANDESCU

    2016-06-01

    Full Text Available Nowadays the industry is one of the main economic sectors, with a major contribution to achieving and maintaining a high rate of economic growth. The processing industry operation to high economic performance requires changes in structural terms, the re-engineering of processes and management. In this regard, one of the main actions taken at the level of companies in the manufacturing industry is the implementation of quality systems. Practicing quality management system not only allows businesses to react to changes taking place in business, but also to inflict them by the controlling of the future. This paper aims to analyze the principles of Total Quality Management – TQM and will highlight the advantages that organizations could obtain by applying each principle separately in the process of management.

  17. Organization structure. Main activities of the Division

    International Nuclear Information System (INIS)

    In this chapter the organization structure as well as main activities of the Division for radiation safety, NPP decommissioning and radioactive waste management are presented. This Division of the VUJE, a.s. consists of the following sections and departments: Section for economic and technical services; Section for radiation protection of employees; Department for management of emergency situations and risk assessment; Department for implementation of nuclear power facilities decommissioning and RAW management; Department for personnel and environmental dosimetry; Department for preparation of NPP decommissioning; Department for RAW treatment technologies; Department for chemical regimes and physico-chemical analyses; Department for management of nuclear power facilities decommissioning and RAW management. Main activities of this Division are presented.

  18. Spiropyran main-chain conjugated polymers.

    Science.gov (United States)

    Sommer, Michael; Komber, Hartmut

    2013-01-11

    The first main-chain conjugated copolymers based on alternating spiropyran (SP) and 9,9-dioctylfluorene (F8) units synthesized via Suzuki polycondensation (SPC) are presented. The reaction conditions of SPC are optimized to obtain materials of type P(para-SP-F8) with appreciably high molecular weights up to M(w) ≈ 100 kg mol(-1). (13)C NMR is used to identify the random orientation of the non-symmetric SP unit in P(p-SP-F8). Ultrasound-induced isomerization of P(p-SP-F8) to the corresponding merocyanine form P(p-MC-F8) yields a deep-red solution. This isomerization reaction is followed by (1)H NMR in solution using sonication, whereby the color increasingly changes to deep red. The possibility to incorporate multiple SP units into main-chain polymers significantly broadens existing SP-based polymeric architectures.

  19. Early history of the Fermilab Main Ring

    Energy Technology Data Exchange (ETDEWEB)

    Malamud, E.; /Fermilab

    1983-10-01

    This note is written in response to a request from Phil Livdahl for corrections, and additions to a TM he is writing on Staffing Levels at Fermilab during Initial Construction Years and to a note that Hank Hinterberger is preparing on milestones. In my spare time over the past few years I have taken the original files of the Main Ring Section, my own notes from that period, and various other collections of relevant paper, and arranged them in a set of 44 large loose leaf binders in chronological order. I call this set of volumes the 'Main Ring Chronological Archives'. In response to Phil's request I have recently skimmed through these records of the period and extracted a small subset of documents which relate to the specific questions that Phil is addressing: staffing. administration, and milestones.

  20. [The main schools of TCM in Zhejiang].

    Science.gov (United States)

    Chen, C

    1999-10-01

    The history of the main academic TCM schools is described, beginning from Danxi school of Zhu Zhenheng of the Yuan dynasty to the 1980s. Established the theory of "exuberant yang and insufficient yin", Zhu set up the therapy of nourishing yin to decrease fire. In the late Ming dynasty, Zhao Xianke and Zhing Jingyue founded the warm - tonification school, Zhao's theory on vital gate exerted profound influence on the basic theory of later ages. At the turn of Ming - Qing dynasties, a Qiantang school was set up by Zhang Shuichen, Zhang Zhicong and Zhang Xijun, Zhang Zhi cong being the synthetizen. The Shao school of cold-disease refers mainly to the physicians in the shaoxin region who studied the warm heat disorders (especially damp - warm diseases) which was mature at the turn of Qing dynasty and the Republican period, whose influence remained until the 1980s. PMID:11624245

  1. Post-main-sequence planetary system evolution.

    Science.gov (United States)

    Veras, Dimitri

    2016-02-01

    The fates of planetary systems provide unassailable insights into their formation and represent rich cross-disciplinary dynamical laboratories. Mounting observations of post-main-sequence planetary systems necessitate a complementary level of theoretical scrutiny. Here, I review the diverse dynamical processes which affect planets, asteroids, comets and pebbles as their parent stars evolve into giant branch, white dwarf and neutron stars. This reference provides a foundation for the interpretation and modelling of currently known systems and upcoming discoveries. PMID:26998326

  2. Water Hammer in Pumped Sewer Mains

    OpenAIRE

    Larsen, Torben

    2012-01-01

    This publication is intended for students and engineers seeking an introduction to the problem of water transients in pumped sewer and water mains. This is a subject of increasing interest because of the development of larger and more integrated systems. Consideration of transients is essential for the structural design of pipelines and for the planning of the proper function of the systems.The text is written by Torben Larsen, who is a professor of environmental hydraulics at the Department ...

  3. Flood Frequency Analysis of Main Nara Valley

    OpenAIRE

    Manohar Lal; Bakhshal Khan Lashari; Khalifa Qasim Laghari

    2011-01-01

    This paper deals with the flood of 2007 and its frequency analysis at MNY (Main Nara Valley), and generally describe flood of 2010 in Sindh Pakistan. Heavy monsoon rain and cyclones cause the flood conditions in Sindh. The damages happened to the infrastructure of the MNVD from RD (Reduced Distance) 0-100 and the ecological impacts of the flood on the local region of Taluka Johi, District Dadu. For flood risk assessment and its description, knowledge of extreme flood events and...

  4. Swiss survey on salt intake: main results

    OpenAIRE

    Chappuis Aline; Bochud Murielle; Glatz Nicolas; Vuistiner Philippe; Paccaud Fred; Burnier Michel

    2011-01-01

    [Contents] 1. Executive summary. 2. Introduction. 3. Methods. 4. Main results. 4.1. Participants. 4.2. Estimation of dietary salt intake using 24-hour urine collection. 4.3. Blood pressure and hypertension. 4.4. Anthropometric data (Body weight, height and body mass index BMI; prevalence of overweight and obesity; waist circumference;...). 4.5. Knowledge and behaviors towards salt. 5. Discussion.

  5. CNPC Sets 2002 Targets for Main Businesses

    Institute of Scientific and Technical Information of China (English)

    Wang Keyu

    2002-01-01

    @@ CNPC President Ma Fucai outlined the main tasks of the country's oil giant at the CNPC 2002 Work Conference that was held in late January. Ma said that CNPC would focus on petroleum exploration to increase the high-quality recoverable reserves, adding that the efforts would be strengthened for assessment of the key strategic exploration regions, such as Ordos basin, Junggar basin, Tarim Basin and Songliao basin.

  6. Dark current model for ILC main linac

    Energy Technology Data Exchange (ETDEWEB)

    Solyak, N.; Romanov, G.; Mokhov, N.V.; /Fermilab; Eidelman, Y.; /Novosibirsk, IYF; Tam, Wai-Ming; /Indiana U.

    2008-06-01

    In the ILC Main Linac, the dark current electrons, generated in SRF cavity can be accelerated to hundreds of MeV before being kicked out by quadrupoles and thus will originate electromagnetic cascade showers in the surrounding materials. Some of the shower secondaries can return back into vacuum and be re-accelerated again. The preliminary results of simulation of the dark current generation in ILC cavity, its dynamics in linac are discussing in this paper.

  7. Post-main-sequence planetary system evolution

    CERN Document Server

    Veras, Dimitri

    2016-01-01

    The fates of planetary systems provide unassailable insights into their formation and represent rich cross-disciplinary dynamical laboratories. Mounting observations of post-main-sequence planetary systems necessitate a complementary level of theoretical scrutiny. Here, I review the diverse dynamical processes which affect planets, asteroids, comets and pebbles as their parent stars evolve into giant branch, white dwarf and neutron stars. This reference provides a foundation for the interpretation and modelling of currently known systems and upcoming discoveries.

  8. Indigenous Transmission for Main Battle Tank

    OpenAIRE

    Natarajan, M

    1985-01-01

    Significant technical advances have been made in the design, development and in bringing out prototypes of most modern transmission for the Main Battle Tank by the CVRDE, Avadi. The transmission has been designed as a semi-automatic, heavy duty, power-transmission-cum-steering unit to provide for four forward and two reverse speeds with a steplessly variable radii of turn in each gear together with neutral turn capability. Test bed results are very encouraging and have shown the transmission'...

  9. Space shuttle main engine vibration data base

    Science.gov (United States)

    Lewallen, Pat

    1987-01-01

    In order to evaluate Space Shuttle Main Engine (SSME) vibration data without having to constantly replay analog tapes, the SSME Vibration Data Base was developed. This data base contains data that have been digitized at a high sample rate for the entire test duration. It provides quick and efficient recall capabilities for numerious computation and display routines. The data base components are described as well as some of the compution and display features.

  10. Isolated systems with wind power. Main report

    Energy Technology Data Exchange (ETDEWEB)

    Lundsager, P.; Bindner, H.; Clausen, N.E.; Frandsen, S.; Hansen, L.H.; Hansen, J.C.

    2001-06-01

    The overall objective of this research project is to study the development of methods and guidelines rather than 'universal solutions' for the use of wind energy in isolated communities. The main specific objective of the project is to develop and present a more unified and generally applicable approach for assessing the technical and economical feasibility of isolated power supply systems with wind energy. As a part of the project the following tasks were carried out: Review of literature, field measurements in Egypt, development of an inventory of small isolated systems, overview of end-user demands, analysis of findings and development of proposed guidelines. The project is reported in one main report and four topical reports, all of them issued as Risoe reports. This is the Main Report Risoe-R-1256, summing up the activities and findings of the project and outlining an Implementation Strategy for Isolated Systems with Wind Power, applicable for international organisations such as donor agencies and development banks. (au)

  11. DCS HYDRAULICS Submission for City of Augusta, Butler County KS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  12. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, AUGUSTA COUNTY, VIRGINIA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  13. USA kongresmen Chandler - sõber, kes aitas Eestil tunnustust leida / Eric A. Johnson, Oliver Prits

    Index Scriptorium Estoniae

    Johnson, Eric A.

    2008-01-01

    Advokaadi ja USA kongressi liikme Walter M. Chandleri (1867-1935) tegevusest Balti riikide de jure tunnustamiseks. Lisatud: USA valitsuse avaldus Balti riikide tunnustamisest ; väike elulugu : Jeesuse advokaat

  14. Dalai-laama saab hoolimata Hiina vihahoost USA medali / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2007-01-01

    Dalai-laama saab Kongressi kuldmedali USA presidendilt George W. Bushilt, kes esimese võimul oleva USA presidendina ilmub dalai-laamaga avalikkuse ette. Hiina on teravalt reageerinud dalai-laama austamisele

  15. USA finantskriis tabas Eestit eriti halval ajal / Lemmi Kann, Kaisa Tahlfeld

    Index Scriptorium Estoniae

    Kann, Lemmi

    2008-01-01

    USA-s puhkenud finantskriis ja Euroopa jahenev majanduskliima takistab Eesti majanduse taastumist. Küsimustele vastab Eesti Panga asepresident Andres Sutt. Kommenteerivad Aare Järvan ja Rain Tamm. Diagramm: Dow Jonesi ja OMXT indeksite muutus

  16. National Assessment of Tree City USA Participation According to Geography and Socioeconomic Characteristics

    Science.gov (United States)

    Tree City USA is a national program that recognizes municipal commitment to community forestry. In return for meeting program requirements, Tree City USA participants expect social, economic, and/or environmental benefits. Understandingthe geographic distribution and socioeconomi...

  17. USA seab tõkkeid odavatele Hiinas toodetud kaupadele / Sirje Rank

    Index Scriptorium Estoniae

    Rank, Sirje, 1966-

    2003-01-01

    USA kaubandusdefitsiit Hiinaga kasvab, USA Kongress süüdistab Hiinat ebaausas konkurentsis ja on seadmas Hiina kaupadele impordipiiranguid. Hiina kaalub vastusanktsioone. Diagramm: Kaubandusdefitsiit Hiinaga süveneb

  18. USA valitsus keelitab teadlasi tõtt väänama / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 1. veebr. 2007, lk. 10. USA teadlased tunnistavad uurimuses, et USA presidendi George W. Bushi valitsus on avaldanud survet kliimasoojenemise kohta käiva info varjamiseks või moonutamiseks

  19. 78 FR 32458 - Manufacturer of Controlled Substances; Notice of Application; Siegfried USA, LLC

    Science.gov (United States)

    2013-05-30

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried USA, LLC... April 18, 2013, Siegfried USA, LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070,...

  20. 77 FR 70825 - Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC

    Science.gov (United States)

    2012-11-27

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC... November 5, 2012, Siegfried (USA) LLC, 33 Industrial Park Road, Pennsville, New Jersey 08070,...

  1. 78 FR 46613 - Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC

    Science.gov (United States)

    2013-08-01

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC... 10, 2013, Siegfried (USA), LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070,...

  2. 75 FR 11937 - Ternium USA, Inc.; Shreveport, LA; Notice of Termination of Investigation

    Science.gov (United States)

    2010-03-12

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF LABOR Employment and Training Administration Ternium USA, Inc.; Shreveport, LA; Notice of Termination of..., USA, Inc., Shreveport, Louisiana. The petitioner has requested that the petition be...

  3. 78 FR 5500 - Manufacturer of Controlled Substances, Notice of Application; Siegfried (USA)

    Science.gov (United States)

    2013-01-25

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances, Notice of Application; Siegfried (USA... 19, 2012, Siegfried (USA), 33 Industrial Park Road, Pennsville, New Jersey 08070, made application...

  4. "Disko ja tuumasõda" jõuab USA-sse

    Index Scriptorium Estoniae

    2010-01-01

    Jaak Kilmi ja Kiur Aarma dokumentaalfilm "Disko ja tuumasõda" hakkab alates 12. novembrist jooksma New Yorgi kinos Cinema Village. 26. novembrist saab filmi näha Los Angeleses. Filmi levitaja USA-s on Icarus Film

  5. Engage the Public in Phenology Monitoring: Lessons Learned from the USA National Phenology Network

    Science.gov (United States)

    Crimmins, T. M.; Lebuhn, G.; Miller-Rushing, A. J.

    2009-12-01

    The USA National Phenology Network (USA-NPN) is a recently established network that brings together citizen scientists, government agencies, non-profit groups, educators and students of all ages to monitor the impacts of climate change on plants and animals in the United States. Though a handful of observers participated in the USA-NPN monitoring program in 2008, 2009 was the first truly operational year for the program. With a goal of 100,000 observers for this nationwide effort, we are working to engage participants both directly and through established organizations and agencies. The first year of operational monitoring and program advertisement has yielded many insights that are shaping how we move forward. In this presentation, we will highlight some of our most prominent “lessons learned” from our experience engaging participants, mainly through partnerships with organizations and agencies. One successful partnership that the USA-NPN established in 2009 was with the Great Sunflower Project, a citizen science effort focused on tracking bee activity. By piggy-backing on this established program, we were able to invite tens of thousands of self-selected individuals to learn about plant phenology and to contribute to the program. A benefit to the Great Sunflower Project was that monitoring phenology of their sunflowers gave observers something to do while waiting for the plant to attract bees. Observers’ experiences, data, and comments from the 2009 season are yielding insights into how this partnership can be strengthened and USA-NPN and GSP goals can more effectively be met. A second partnership initiated in 2009 was with the US National Park Service (NPS). Partnering with federal and state agencies offers great opportunities for data collection and education. In return, agencies stand to gain information that can directly influence management decisions. However, such efforts necessitate careful planning and execution. Together the USA-NPN and NPS drafted

  6. Causes of sinks near Tucson, Arizona, USA

    Science.gov (United States)

    Hoffmann, John P.; Pool, Donald R.; Konieczki, A. D.; Carpenter, Michael C.

    Land subsidence in the form of sinks has occurred on and near farmlands near Tucson, Pima County, Arizona, USA. The sinks occur in alluvial deposits along the flood plain of the Santa Cruz River, and have made farmlands dangerous and unsuitable for farming. More than 1700 sinks are confined to the flood plain of the Santa Cruz River and are grouped along two north-northwestward-trending bands that are approximately parallel to the river and other flood-plain drainages. An estimated 17,000m3 of sediment have been removed in the formation of the sinks. Thirteen trenches were dug to depths of 4-6m to characterize near-surface sediments in sink and nonsink areas. Sediments below about 2m included a large percentage of dispersive clays in sink areas. Sediments in nonsink areas contain a large component of medium- to coarse-grained, moderately to well sorted sand that probably fills a paleochannel. Electromagnetic surveys support the association of silts and clays in sink areas that are highly electrically conductive relative to sand in nonsink areas. Sinks probably are caused by the near-surface process of subsurface erosion of dispersive sediments along pre-existing cracks in predominantly silt and clay sediments. The pre-existing cracks probably result from desiccation or tension that developed during periods of water-table decline and channel incision during the past 100 years or in earlier periods. Résumé Des effondrements en forme d'entonnoir se sont produits sur et près d'exploitations agricoles de Pima (Arizona). Ces entonnoirs apparaissent dans les alluvions le long de la plaine d'inondation de la rivière Santa Cruz ; ils ont rendu ces terrains dangereux et inexploitables pour l'agriculture. Plus de 1700 entonnoirs existent dans la plaine d'inondation de la rivière Santa Cruz et sont groupés en deux bandes orientées nord-nord-ouest, approximativement parallèles à la rivière et aux autres chenaux de la plaine d'inondation. Un volume de sédiments estim

  7. Isolated systems with wind power. Main report

    DEFF Research Database (Denmark)

    Lundsager, P.; Bindner, Henrik W.; Clausen, Niels-Erik;

    2001-01-01

    approach for assessing the technical and economical feasibility of isolated power supply systems with wind energy. As a part of the project the following tasks were carried out: Review of literature, fieldmeasurements in Egypt, development of an inventory of small isolated systems, overview of end......The overall objective of this research project is to study the development of methods and guidelines rather than "universal solutions" for the use of wind energy in isolated communities. The main specific objective of the project is to develop and present amore unified and generally applicable...... for Isolated Systems with Wind Power, applicable for international organisations such as donoragencies and development banks....

  8. Impact of Main Macroeconomic Indicators on Happiness

    Directory of Open Access Journals (Sweden)

    Yavuz Agan

    2016-01-01

    Full Text Available The relationship between economic welfare and happiness has been compounded by different conceptualizations and statistical approaches. Economic conditions influence the welfare and social well-being of the society. While the literature indicates a positive relationship between income levels and life satisfaction, it indicates negative relationships between inflation, unemployment and life satisfaction. In this paper we analyze the relationship between main macroeconomic variables of unemployment, inflation, per capita GDP and life satisfaction using data from 57 countries. We make use of the standard regression analysis and conclude that our method is sufficient to examine the relations and the stated macro variables are significantly affecting life satisfaction towards expected directions.

  9. Space shuttle main engine hardware simulation

    Science.gov (United States)

    Vick, H. G.; Hampton, P. W.

    1985-01-01

    The Huntsville Simulation Laboratory (HSL) provides a simulation facility to test and verify the space shuttle main engine (SSME) avionics and software system using a maximum complement of flight type hardware. The HSL permits evaluations and analyses of the SSME avionics hardware, software, control system, and mathematical models. The laboratory has performed a wide spectrum of tests and verified operational procedures to ensure system component compatibility under all operating conditions. It is a test bed for integration of hardware/software/hydraulics. The HSL is and has been an invaluable tool in the design and development of the SSME.

  10. A gap clearing kicker for Main Injector

    CERN Document Server

    Kourbanis, I; Biggs, J; Brown, B; Capista, D; Jensen, C C; Krafczyk, G E; Morris, D K; Scott, D; Seiya, K; Ward, S R; Wu, G; Yang, M -J

    2012-01-01

    Fermilab Main Injector has been operating at high Beam Power levels since 2008 when multi-batch slip stacking became operational. In order to maintain and increase the beam power levels the localized beam loss due to beam left over in the injection kicker gap during slip stacking needs to be addressed. A set of gap clearing kickers that kick any beam left in the injection gap to the beam abort have been built. The kickers were installed in the summer of 2009 and became operational in November of 2010. The kicker performance and its effect on the beam losses will be described.

  11. Main Factors Effecting Anaerobic Ammonium Oxidation

    Institute of Scientific and Technical Information of China (English)

    YANG Xiao-fei

    2014-01-01

    Anaerobic Ammonium Oxidation (ANAMMOX) drew more attentions because of its denitrification in wastewater with low carbon resource. The external conditions of ANAMMOX are relatively harsh,however this reaction does not require the participation of oxygen and organics. So the research and technology development of ANAMMOX has the significance of sustainable development.In this paper, the main influencing factors of ANAMMOX were summarized,Combined with recent research status of ANAMMOX technology, the development trend of the anaerobic ammonium oxidation technology was prospected.

  12. Impact of Main Macroeconomic Indicators on Happiness

    Directory of Open Access Journals (Sweden)

    Yavuz Agan

    2009-10-01

    Full Text Available The relationship between economic welfare and happiness has been compounded by different conceptualizations and statistical approaches. Economic conditions influence the welfare and social well-being of the society. While the literature indicates a positive relationship between income levels and life satisfaction, it indicates negative relationships between inflation, unemployment and life satisfaction. In this paper we analyze the relationship between main macroeconomic variables of unemployment, inflation, per capita GDP and life satisfaction using data from 57 countries. We make use of the standard regression analysis and conclude that our method is sufficient to examine the relations and the stated macro variables are significantly affecting life satisfaction towards expected directions

  13. Main Ocular Manifestations in Rheumatoid Arthritis

    Directory of Open Access Journals (Sweden)

    Sandra Saray Quignon Santana

    2009-12-01

    Full Text Available Rheumatoid arthritis is considered an autoimmune disease in which articular and extra articular manifestations are produced and contribute to alter the functional capacity of the individual. This study consists on performing a bibliographical review showing the main ocular manifestations in patients with rheumatoid arthritis. It is our purpose to give you our experiences to the students as well as the internal medicine, ophthalmology and rheumatologist residents about this topic. The ophthalmological consultation of sick patients contributes to the prevention of ocular illnesses which are characteristic of the base disease and improve the ocular health.

  14. Water Hammer in Pumped Sewer Mains

    DEFF Research Database (Denmark)

    Larsen, Torben

    This publication is intended for students and engineers seeking an introduction to the problem of water transients in pumped sewer and water mains. This is a subject of increasing interest because of the development of larger and more integrated systems. Consideration of transients is essential for...... simulations of transients in pumped pipeline systems. This present publication can be understood as the second and revised edition of the pamphlet ”Transients in pumped sewer mains” (2006) which was published as a technical report by The EVA committee under The Danish Water Pollution Committee (The Danish...

  15. Additively Manufactured Main Fuel Valve Housing

    Science.gov (United States)

    Eddleman, David; Richard, Jim

    2015-01-01

    Selective Laser Melting (SLM) was utilized to fabricate a liquid hydrogen valve housing typical of those found in rocket engines and main propulsion systems. The SLM process allowed for a valve geometry that would be difficult, if not impossible to fabricate by traditional means. Several valve bodies were built by different SLM suppliers and assembled with valve internals. The assemblies were then tested with liquid nitrogen and operated as desired. One unit was also burst tested and sectioned for materials analysis. The design, test results, and planned testing are presented herein.

  16. Reflections on Women and the Law in the USA

    Science.gov (United States)

    Epstein, Cynthia Fuchs

    2008-01-01

    The USA has undergone extraordinary changes over the past 35 years with respect to women's access to equality in education, employment and participation in political life. This has come about because of the introduction of anti-discrimination legislation and because of the activities of professional organisations in activating the implementation…

  17. Napier ootab USA aktsiatelt 30% tõusu / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2010-01-01

    Prantsusmaa suurpanga Credit Agricole üksuse CLSA strateegi Russell Napieri arvates on USA aktsiad karjuvalt madalalt hinnatud võrrreldes aktsiate dividendide ja ettevõtete kasumitega. Investeerimisel on tema soosingus kõrge dividenditootlusega aktsiad. Tema arvates hakkavad võlakirja tootlused järjekindlalt tõusma

  18. USA300 Methicillin-resistant Staphylococcus aureus in Cuba

    Directory of Open Access Journals (Sweden)

    Hopman Joost

    2012-01-01

    Full Text Available Abstract Background Methicillin-resistant Staphylococcus aureus is an increasing problem in the Caribbean. We investigated the molecular epidemiology of MRSA isolates on Cuba. Findings The predominant clone was of the spa type t149, followed by community-associated MRSA USA300. Conclusions We report the first molecular typing results of MRSA isolates from Cuba.

  19. 76 FR 25527 - Law Day, U.S.A., 2011

    Science.gov (United States)

    2011-05-05

    ... States of America the two hundred and thirty-fifth. (Presidential Sig.) [FR Doc. 2011-11068 Filed 5-4-11...#0;#0; ] Proclamation 8665 of April 29, 2011 Law Day, U.S.A., 2011 By the President of the United States of America A Proclamation At the core of our Nation's values is our faith in the ideals...

  20. Vaccinia virus infections in martial arts gym, Maryland, USA, 2008.

    Science.gov (United States)

    Hughes, Christine M; Blythe, David; Li, Yu; Reddy, Ramani; Jordan, Carol; Edwards, Cindy; Adams, Celia; Conners, Holly; Rasa, Catherine; Wilby, Sue; Russell, Jamaal; Russo, Kelly S; Somsel, Patricia; Wiedbrauk, Danny L; Dougherty, Cindy; Allen, Christopher; Frace, Mike; Emerson, Ginny; Olson, Victoria A; Smith, Scott K; Braden, Zachary; Abel, Jason; Davidson, Whitni; Reynolds, Mary; Damon, Inger K

    2011-04-01

    Vaccinia virus is an orthopoxvirus used in the live vaccine against smallpox. Vaccinia virus infections can be transmissible and can cause severe complications in those with weakened immune systems. We report on a cluster of 4 cases of vaccinia virus infection in Maryland, USA, likely acquired at a martial arts gym.

  1. Bush lubas Bagdadi rohkem USA sõdureid / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 28. juuli lk. 10. Iraagi peaministri Nuri Kamal al-Maliki USA visiidist, mille käigus ilmnesid kahe riigi vahelised erimeelsused, kokku lepiti lisajõudude saatmises Bagdadi. Lisa: Bagdadi julgeolek

  2. USA folkloristid tutvustavad Eestis afroameerika rahvamuusikat / Andres Roost

    Index Scriptorium Estoniae

    Roost, Andres

    2008-01-01

    9. veebruaril tutvustavad USA folkloristid Anna Lomax Wood ja Todd Dunham Harvey Eesti Kirjandusmuuseumi saalis Tartus John A. Lomaxi (1867-1948) ja Alan Lomaxi (1915-2002) kogutud afroameerika folkloori, näidatakse dokumentaalfilmi "Land Where the Blues Began"

  3. USA on Iraagis ülbe ja rumal? / Tõnis Erilaid

    Index Scriptorium Estoniae

    Erilaid, Tõnis, 1943-

    2006-01-01

    USA välisministeeriumi ühe büroo avaliku diplomaatia direktor Alberto Fernandez tunnistas väidetavalt Al-Jazeera telekanalis esinedes, et ameeriklased olid Iraagis ülbed ja rumalad ning nüüd on vaja kõigi sealsete esindajatega läbirääkimisi pidada

  4. Clintonite uus tulek USA tipp-poliitikasse / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2007-01-01

    USA presidendiks pürgiv Hillary Clinton on suutnud koguda oma valimisfondi rohkem raha kui tema konkurendid, ta on ka populaarseim kandidaat. Kui Valgest Majast lahkudes olid Clintonid võlgu miljon dollarit, siis nüüd läheneb nende isiklik vara 50 miljonile dollarile

  5. President Ilves töövisiidil USAs

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves alustas töövisiiti USA läänerannikul, teadus- ja kõrgtehnoloogia keskuses Silicon Valley's. Riigipea kohtus ka San Francisco linnapea Gavin Newsom'iga ja Stanfordi Ülikooli rektori John L. Hennessy'ga. Vabariigi President töövisiidil Ameerika Ühendriikides 9.-16.06.2009

  6. Järelkajad Eesti presidendi visiidist USA-sse

    Index Scriptorium Estoniae

    2006-01-01

    Töövisiit Ameerika Ühendriikidesse 17.-21.01.2006. Ülevaade president Arnold Rüütli USA-vsiidist, kohtumisest San Francisco ja Sunnyvale'i linnapeadega, investor Steve Jürvetsoniga, kohalike väliseestlastega, külaskäigust Silicon Valley tehnoloogiaettevõtetesse, California Ülikooli biotehnoloogia uurimiskeskusesse

  7. USA kriitikud pärjasid Clint Eastwoodi / A. F.

    Index Scriptorium Estoniae

    A. F.

    2006-01-01

    USA rahvuslik filmikriitikute ühing (National Society of Film Critics) valis aasta parimaks filmiks Clint Eastwoodi "Kirjad Iwo Jimalt" ("Letters from Iwo Jima"), parimaks režissööriks Martin Scorsese ja parimaks võõrkeelseks filmiks Pedro Almodovari "Tagasitulek" ("Volver"). Sõnumis on ekslikult Iowa pro Iwa ja Almadovar pro Almodovar

  8. 77 FR 76006 - Star Networks USA, LLC; Complaint

    Science.gov (United States)

    2012-12-26

    ...Under provisions of its Rules of Practice for Adjudicative Proceeding (16 CFR part 1025), the Consumer Product Safety Commission must publish in the Federal Register Complaints which it issues. Published below is a Complaint: In the Matter of Star Networks USA, LLC.\\1\\...

  9. Reasons For Culture Differences Between Sino--USA

    Institute of Scientific and Technical Information of China (English)

    Sun Wen Xu; Jing Jing

    2014-01-01

    Culture is about survival of the human species. One key goal in the study of cultures is in assessing the survival and predictability of values across the history of humankind. As for China and USA, both countries have their own cultures. of course, they have a lot of difference between each other. Every culture has its own reason to exist in the world.

  10. USA ajakirjaniku teos paljastab CIA nõrkusi / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 30. juuli 2007, lk. 6. New York Timesi ajakirjanik Tim Weiner annab oma äsjailmunud raamatus "Legacy of ashes: the history of the USA" põhjaliku ülevaate CIA ajaloost. Lisa: CIA läbikukkumiste jada

  11. USA sõdib terrorismi vastu sobimatul moel / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Mõttekoja Rand Corporation analüüsi kohaselt ei piisa USA-l islamiekstremistidega võitlemisel vaid vägede suurendamisest, panustada tuleb kohalike võimude tõhustamisse, nende paremasse koolitamisse ja infovahetusse. Lisa: Guantanamo kuuik kohtu all

  12. Exploring Air-Climate-Energy Impacts with GCAM-USA

    Science.gov (United States)

    The Global Climate Assessment Model (GCAM) is a global integrated assessment model used for exploring future scenarios and examining strategies that address air pollution, climate change and energy (ACE) goals. My research focuseson integration of impact factors in GCAM-USA and a...

  13. Sourcing USA Summit Engages Global Cotton Industry Leaders

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    From November 9-12,the"6th Biennial Sourcing USA Summit,"organized by Cotton Council International and Cotton Incorporated and with the support of the U.S.cotton industry and USDA, took place at Terranea in Rancho Palos Verdes,

  14. Status and migration of irrigation in the USA

    Science.gov (United States)

    Irrigated agriculture produces 49% of crop market value on 18% of cropped lands in the USA. Irrigation is essential to the most highly productive, intensely managed, and internationally competitive sectors of our agricultural economy, which play a key role in meeting growing global food, fiber, and ...

  15. USA kiidetud noise-rock Eestis / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2008-01-01

    Müra-rock'i viljelevast USA duost Magik Markers (ansambel osaleb režissöör Veiko Õunapuu uue mängufilmi "Püha Tõnu kiusamine" võtetel ja annab kaks kontserti - 13. nov. Tallinnas klubis Tapper ja 15. nov. Tartus klubis Trehv)

  16. USA kapitalivoog jõuab Eestisse / Roland Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Roland

    2012-01-01

    Autor leiab, et on soodne hetk hakata arendama rohkem start-up ettevõtteid, kuna USA Föderaalreserv on aasta jooksul juurde trükkinud 600 miljardit dollarit ning Eesti Arengufondil ja riskikapitalifondidel nagu ASI on vajalik investeerimisraha olemas

  17. Bin Laden sekkus USA valimisvõitlusesse / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Terroripealik Osama bin Laden pöördus 29. oktoobril meedia vahendusel ameeriklaste poole ning märkis, et kui USA soovib vältida uusi 11. septembri laadseid rünnakuid, peab ta lõpetama moslemite julgeoleku ohustamise

  18. Opsigtsvækkende nyt om derivater fra USA

    DEFF Research Database (Denmark)

    Thinggaard, Frank

    1997-01-01

    Der er opsigsvækkende nyt fra USA om den regnskabsmæssige behandling af derivater som terminskontrakter, futures, optioner, swaps m.v. Glem alt om historiske anskaffelsespriser. For derivater er der kun ét mål, som kan bruges: markedsværdier (fair-values). Glem alt om snakken om 'off-balance-sheet...

  19. Core collections of potato (Solanum) species native to the USA

    Science.gov (United States)

    Potato has two wild relatives native to the USA, Solanum jamesii (jam) and S. fendleri (fen). Core collections are a useful tool for genebanks, identifying a ranked minimum number of samples that together encompass most of the total diversity. With diversity measured as presence of AFLP bands, core ...

  20. Rethinking Postgraduate Geography Education in the USA: Issues and Concerns

    Science.gov (United States)

    Foote, Kenneth; Bednarz, Sarah; Monk, Janice; Solem, Michael; Stoltman, Joseph

    2012-01-01

    Postgraduate geography education in the USA is growing and changing. In recent years, the number of postgraduate programs has increased at both the doctoral and master's levels. Interest in improving and reforming doctoral education has increased dramatically both inside and outside geography, and geography has been involved in these reforms.…

  1. USA sepitseb uusi plaane Iraani mahasurumiseks / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Kommenteerides ÜRO ja Iraani tuumakõneluste ummikseisust väljumise võimalusi, tunnistas USA välisministeeriumi poliitikanõunik Nicholas Burns, et diplomaatia abil on keeruline veenda Iraani loobuma tuumatehnoloogia väljatöötamisest

  2. USA meedia kritiseerib Obama välispoliitikat / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2009-01-01

    ÜRO peaassambleel võeti vastu Ameerika Ühendriikide presidendi juhtimisel resolutsioon, kus kinnitatakse taas tahet muuta maailm tuumarelvavabaks, kuid USA ajakirjanikud ja poliitikud leiavad, et president ei ole maailmapoliitikas eriti midagi saavutanud. 25. septembril toimunud G20 tippkohtumisel otsustati, et globaalset majandust puudutavates küsimustes võetakse G8-lt juhiroll üle

  3. Knemidocoptic Mange in Wild Golden Eagles, California, USA

    Centers for Disease Control (CDC) Podcasts

    2014-09-21

    Dr. Mike Miller reads an abridged version of the article, Knemidocoptic Mange in Wild Golden Eagles, California, USA .  Created: 9/21/2014 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 10/15/2014.

  4. Kuhu USAs investeerida, kui võidab...? / Mati Feldmann

    Index Scriptorium Estoniae

    Feldmann, Mati, 1961-

    2008-01-01

    Autor analüüsib investorite investeerimisvõimalusi sõltuvalt sellest, kas USA presidendivalimised võidab Barack Obama või John McCain. Vt. samas: Investoritel oleks mõttekas investeerida sõltuvalt võitjast

  5. Kas maailm vajab USA-vastast allianssi? / Mihhail Gorbatshov

    Index Scriptorium Estoniae

    Gorbatšov, Mihhail, 1931-

    2007-01-01

    Kasvanud on Brasiilia, Venemaa, India ja Hiina majanduslik võimsus ja poliitiline tähtsus, neid riike ei saa enam kohelda maailmaasjades alandavalt, ütleb autor. USA püüdlustest võtta endale maailma liidriroll ja rakendada seda peamiselt sõjaliste vahenditega

  6. Homeschooling in the USA: Past, Present and Future

    Science.gov (United States)

    Gaither, Milton

    2009-01-01

    This article first examines why the homeschooling movement in the USA emerged in the 1970s, noting the impact of political radicalism both right and left, feminism, suburbanization, and public school bureaucratization and secularization. It then describes how the movement, constituted of left- and right-wing elements, collaborated in the early…

  7. Titanium Technology in the USA-an Overview

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The state of Ti research, development and industry is reviewed in this article. The fifty-year anniversary of Ti technology commercialization in the USA provides an opportunity for a historical perspective. Incorporation of "information-age" tools into alloy development, processing, and production invigorates the technology. Consolidation, diversification and globalization have been transforming the Ti industry in the recent years.

  8. Experiencing Second-Wave Feminism in the USA

    Science.gov (United States)

    Biklen, Sari; Marshall, Catherine; Pollard, Diane

    2008-01-01

    How has feminism mattered in the lives of particular academic feminists? Three scholars in education whose careers developed during the era of second-wave feminism describe how their personal and political stances were affected by theories, methodological advances, the milieus of academia as well as legal, and political events in the USA. The…

  9. Protecting nature : organizations and networks in Europe and the USA.

    NARCIS (Netherlands)

    Koppen, van C.S.A.; Markham, W.T.

    2007-01-01

    This book offers a comparative analysis of organizations and networks involved in nature protection in France, Germany, Italy, the Netherlands, Norway, Poland, Sweden, the UK and the USA. It traces their development from their origins, more than a century ago, to the present day. Throughout this per

  10. 78 FR 53728 - Corporation for Travel Promotion (dba Brand USA)

    Science.gov (United States)

    2013-08-30

    ... International Trade Administration Corporation for Travel Promotion (dba Brand USA) AGENCY: International Trade Administration, U.S. Department of Commerce. ACTION: Notice of an opportunity for travel and tourism industry... law by President Obama on March 4, 2010. The TPA established the Corporation for Travel Promotion...

  11. Knemidocoptic Mange in Wild Golden Eagles, California, USA

    Science.gov (United States)

    Stephenson, Nicole; Rogers, Krysta; Hawkins, Michelle G.; Sadar, Miranda; Guzman, David Sanchez-Migallon; Bell, Douglas A.; Smallwood, Kenneth S.; Wells, Amy; Shipman, Jessica; Foley, Janet

    2014-01-01

    During 2012–2013 in California, USA, 3 wild golden eagles were found with severe skin disease; 2 died. The cause was a rare mite, most closely related to Knemidocoptes derooi mites. Cautionary monitoring of eagle populations, habitats, and diseases is warranted. PMID:25271842

  12. 75 FR 24369 - Law Day, U.S.A., 2010

    Science.gov (United States)

    2010-05-05

    ... States of America the two hundred and thirty-fourth. (Presidential Sig.) [FR Doc. 2010-10746 Filed 5-4-10...#0;#0; ] Proclamation 8511 of April 29, 2010 Law Day, U.S.A., 2010 By the President of the United States of America A Proclamation For over two centuries, our Nation has adhered to the rule of law as...

  13. 77 FR 26653 - Law Day, U.S.A., 2012

    Science.gov (United States)

    2012-05-04

    ... Independence of the United States of America the two hundred and thirty-sixth. (Presidential Sig.) [FR Doc...;#0; ] Proclamation 8810 of May 1, 2012 Law Day, U.S.A., 2012 By the President of the United States of America A Proclamation When President Dwight D. Eisenhower established Law Day in 1958, he proclaimed...

  14. USA sõdurid tulevad Paidesse ja Türile

    Index Scriptorium Estoniae

    2015-01-01

    USA laseb Eestisse toodud Strykeri soomukitel läbi kuue riigi Saksamaale kodubaasi sõita. 1700-kilomeetrise retke eesmärk on näidata nii eurooplastele kui ka Venemaale, et NATO suudab sõjatehnikat kiiresti ja lihtsalt üle riigipiiride liigutada. Peatutakse ka Paides ja Türil

  15. Õhuvägi loobus USA pakutud lennukitest

    Index Scriptorium Estoniae

    2016-01-01

    Eesti õhuvägi loobus USA poolt kingituseks pakutud kahest sõjaväe transportlennukist Sherpa C-23B+. Põhjalikuma analüüsi tulemusel on kaalumisel alternatiivsed variandid ja Sherpasid õhuvägi praeguse seisuga kasutusse ei võta, ütles kaitseväe peastaabi pressiesindaja

  16. Comparing Teacher Dispositions in China and the USA

    Science.gov (United States)

    Shao, Kun; Tamashiro, Roy

    2013-01-01

    In studies conducted in the USA, teacher dispositional factors such as enthusiasm, professional esteem and learning motivation often emerge as the most significant variables affecting student learning and achievement from the primary grades through higher education. Do these factors play as significant a role in student learning and achievement in…

  17. Sexual Orientation Topics in Educational Leadership Programmes across the USA

    Science.gov (United States)

    Jennings, Todd

    2012-01-01

    This investigation examines the inclusion of sexual orientation topics within the formal curriculum of 55 public college and university educational administration/leadership programmes across the USA. The findings indicate that programmes place a low priority upon sexual orientation compared to other diversity topics and that 59.5% of programmes…

  18. USA ärritab Poolat ideega ehitada raketikilp hoopis Leetu / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2008-01-01

    Kuigi USA ja Poola vahel jätkuvad läbirääkimised raketikilbi üle, on rahvusvahelisse meediasse imbunud oletus, et USA võib raketikilbi paigutada hoopis Leetu. Poola asevälisministri Witold Waszczykowski hinnangul kasutab USA Leedut survestusvahendina. Nii Leedu välisministeerium kui ka USA-poolne kõneluste juht John Rood kinnitavad, et raketikilbiküsimust on riigid omavahel arutanud

  19. Afganistan ja USA tülitsevad vangide ja oopiumi pärast / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2005-01-01

    USA presidendi George W. Bushiga kohtumise järel nõudis Afganistani president Hamid Karzai USA käes olevate Afganistani vangide väljaandmist, ta oli nördinud teadete üle, kuidas vange on koheldud. Karzai nõudis kontrolli Afganistanis viibivate USA sõdurite üle ja relvastatud reidide lõpetamist afgaanide kodudesse. Lisa: USA ründab Afganistani narkoäri

  20. Eesti saab tõenäoliselt USA-lt pooletoobise viisavabaduse / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2008-01-01

    Algasid läbirääkimised USA-ga viisavabaduse saavutamiseks. USA eksperdid tulevad hindama Eesti riigipiiri pidavust, koostatakse vastastikuse arusaamise memorandum. Tõenäoliselt hakkab Eesti puhul kehtima teistsugune süsteem kui on praegu 27 riigil, kellel on USA-ga viisavabadus ja kellest 15 on EL-i nn vanad riigid. USA sisejulgeoleku ministeeriumi asekantsleri Richard Barthi seisukohti. Vt. samas: Eesti näide võib tekitada vastuolulist reaktsiooni

  1. The USA-National Phenology Network Biophysical Program

    Science.gov (United States)

    Losleben, M. V.; Crimmins, T. M.; Weltzin, J. F.

    2009-12-01

    On January 1, 2009, the USA National Phenology Network (USA-NPN, www.usanpn.org) launched the USA-NPN Biophysical Program. The overarching goal of the Biophysical Program (BP) is to link phenology, the study of recurring plant and animal life cycle stages, with climate through the integration of phenology observations, meteorological, and spectral remote sensing measurements at sites across a broad a spectrum of environments. Phenology is critical for understanding a changing world. Many of the recurring plant and animal life cycle stages such as leafing and flowering of plants, maturation of agricultural crops, emergence of insects, and migration of birds are sensitive to climatic variation and change, and are simple to observe and record. Such changes can effect, for example, timing mismatches between the emergence of food sources and the arrival of migrating populations, or create new disease and invasive species vectors via increasingly suitable growing seasons relative to the climatic life cycle requirements of hosts or the organisms themselves. New vectors or crashing populations can have major repercussions on entire ecosystems and regional economics. Thus, to track phenology and build a national database, the USA-NPN is providing standard phenology monitoring protocols. Further, the integration of weather stations with phenological data provides an opportunity to understand how a changing climate is altering phenology. Thus, the USA-NPN Biophysical Program is developing an integrative biology-climate site template for widespread dissemination, in collaboration with the Rocky Mountain Biological Laboratory (RMBL, http://rmbl.org/rockymountainbiolab/). This poster presents the USA-NPN Biophysical Program, and the results of the collaboration with RMBL during the summer of 2009, including the installation of an elevational network of climate stations. The National Science Foundation’s Major Research Instrumentation (NSF’s MRI) program provides funding

  2. The Mammoth Cave system, Kentucky, USA

    International Nuclear Information System (INIS)

    Mammoth Cave is the main attraction of Mammoth Cave National Park. For several decades it has been the longest known cave in the world and currently contains 652 km in 2016 of surveyed passages. It is located in the heart of an extensive karst plateau, in which the stratal dip averages only one degree. The cave is part of a drainage basin of more than 200 km2. The cave has been known to local inhabitants for several millennia and contains a rich trove of archaeological and historical artifacts. It contains many speleo biota including several rare and endangered species and has been designated a World Heritage Site and an International Biosphere Reserve (UNESCO). Its many passage levels and sediments contain a record of the fluvial history of most of south-eastern North America. (Author)

  3. Flood Frequency Analysis of Main Nara Valley

    Directory of Open Access Journals (Sweden)

    Manohar Lal

    2011-01-01

    Full Text Available This paper deals with the flood of 2007 and its frequency analysis at MNY (Main Nara Valley, and generally describe flood of 2010 in Sindh Pakistan. Heavy monsoon rain and cyclones cause the flood conditions in Sindh. The damages happened to the infrastructure of the MNVD from RD (Reduced Distance 0-100 and the ecological impacts of the flood on the local region of Taluka Johi, District Dadu. For flood risk assessment and its description, knowledge of extreme flood events and their return periods is important. This is achieved by regional flood frequency analysis, which deals with using flood information from different sites within a hydrologically homogeneous region. At the study area and its surroundings, information of previous 12 peak floods of 50 years have been collected and analyzed for flood frequency analysis. The Gumble\\'s flood frequency and analytical methods have been used for obtaining the flood frequency. Generally, flood threat to this area is mainly from Nai Gaj River and rarely from flash floods from Balouchistan. The disastrous flood of 2007 and 2010 were the examples of the heavy floods in the last 50 years history at the study area. Analysis results suggest constructing small reservoirs in order to permanently solve the flood problems and to use the stored water for agricultural and other needs.

  4. Main Issues in Big Data Security

    Directory of Open Access Journals (Sweden)

    Julio Moreno

    2016-09-01

    Full Text Available Data is currently one of the most important assets for companies in every field. The continuous growth in the importance and volume of data has created a new problem: it cannot be handled by traditional analysis techniques. This problem was, therefore, solved through the creation of a new paradigm: Big Data. However, Big Data originated new issues related not only to the volume or the variety of the data, but also to data security and privacy. In order to obtain a full perspective of the problem, we decided to carry out an investigation with the objective of highlighting the main issues regarding Big Data security, and also the solutions proposed by the scientific community to solve them. In this paper, we explain the results obtained after applying a systematic mapping study to security in the Big Data ecosystem. It is almost impossible to carry out detailed research into the entire topic of security, and the outcome of this research is, therefore, a big picture of the main problems related to security in a Big Data system, along with the principal solutions to them proposed by the research community.

  5. Nucleosynthesis involving mainly neutron capture processes IV

    International Nuclear Information System (INIS)

    Nucleosynthesis plays a crucial role in the physics of stellar evolution. Heavy nuclei abundances in the universe provide a concrete evidence for the operation of specific nucleosynthesis processes. The slow (s-) and rapid (r-) processes are the main processes responsible for the synthesis of nuclei beyond iron. i.e. synthesis of nuclei heavier than Fe by neutron capture. In the preceding papers, (Paper I, Paper II, Paper III) we have reviewed important neutron capture processes in investigating the mechanism of stellar nucleosynthesis, i.e. various neutron producing reactions (neutron sources) during stellar nucleosynthesis in different evolving stages - main sequence stage, red giant stage, supernova stage and neutron star stage. Neutrons produced in one stage come into next stage as remnant and play an active role to begin nucleosynthesis in the next stage, and ultimately to the formation of neutron star. We have indicated various constraints and unsolved problems in each stage. With the help of advanced observational technology and numerical simulations considerable efforts have been made to resolve the unsolved problems in nuclear astrophysics in recent years. Analysis of those observed parameters may give rise to significant improvement towards understanding the physics of stellar nucleosynthesis. In the present review, we have updated our previous attempt by incorporating those significant improvements in the theory of neutron capture nucleosynthesis based upon observations, theoretical calculations and numerical simulations. (author)

  6. MAIN TOPICS,ABSTRACTS & KEY WORDS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Design and implementation of a power control system for electron beam welder HE Shaojia, LI Jianling, MO Jinhai, LI Haibiao (School of Mechanical & Electrical Engineering, Guilin University of Electronic Technology, Guilin 541004, China). ppl-5, 12 Abstract: Stability of output voltage of high-voltage accelerating stabilized power supply for electron beam welder (EBW) is a prerequisite to ensure the electron beam welding quality. The common power supplies have the disadvantages of circuit complexity and bulkiness. A novel control system of higholtage accelerating stabilized power supply for EBW was designed. Its main circuit is based on pulse-width modulation (PWM) buckboost converter topology. Compared with common EBW power supplies, this new power supply requires a much lower voltage grade transformer because of the converter's effect for rising voltage, so its volume is smaller and the circuit is simpler. The sys- tem main circuit characteristics and its working process were analyzed. The system circuit's small-signal mathematical model was created, and lag-lead correction compensation control was em- ployed in the system to achieve static and dynamic performance requirements. The results displayed that this unit had the characteristics of fast response, high reliability, high control precision and anti-interference capability.

  7. The evolution of nuclear power in the USA

    International Nuclear Information System (INIS)

    The development and deployment of commercial nuclear power in the USA has been impressive since the programme began in the early 1950s. Today there are 73 commercial power reactors operating in the USA with combined capacity of about 56 GW(e). By 1990, an additional 64 nuclear power plants with a total capacity of approximately 123 GW(e) will be in operation supplying about 25% of US electrical energy requirements. Despite the cancellation of 91 new units since 1972 and lack of any new plant orders, there is a clear and continuing role for nuclear energy in the USA if we are to experience continued economic growth. New growth for US nuclear industry requires several things to happen. The prospective demand for electricity and new generating plants must increase; the US Government must show that it will fulfill its responsibilities to dispose of nuclear waste; a more stable regulatory process must be implemented so that nuclear power plants can be built with a reasonable degree of assurance beforehand as to what the final design, cost and schedule will be. President Reagan's July 1981 policy statement on Non-Proliferation and Peaceful Nuclear Co-operation and October 1981 Domestic Nuclear Policy Statement provide the policy framework necessary for the USA to maintain a viable domestic nuclear industry to enable nuclear power to make its essential contribution to future US energy needs and to re-establish the USA as a predictable and reliable partner for international nuclear co-operation under adequate safeguards. The US Government has structured its programmes and activities to implement these policies and initiatives. (author)

  8. Homeschooling as an Alternative Form of Educational Provision in South Africa and the USA

    Science.gov (United States)

    de Waal, Esther; Theron, Tinie

    2003-01-01

    This paper studies homeschooling as an alternative form of educational provision in South Africa and USA to determine what knowledge and experiences from research on homeschooling in the USA may be relevant to the South Africa situation. Homeschooling in the USA has a sound legal foundation and has become an acceptable educational alternative.…

  9. USA välisminister kaitses CIA salaaktsioone vangidega / Aadu Hiietamm

    Index Scriptorium Estoniae

    Hiietamm, Aadu, 1954-

    2005-01-01

    USA välisminister Condoleezza Rice kaitses Berliinis USA Luure Keskagentuuri (CIA) salaaktsioone. Välisminister teatas, et USA ei piina vange ning kinnipeetavate välisriikidesse toimetamise eesmärk on vältida terrorirünnakuid ja päästa inimelusid

  10. USA moos määrib Eesti naabritest mõjukamaks / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2007-01-01

    Sel sügisel on toimunud mitu Eesti ja USA poliitikute kohtumist. Peaminister Andrus Ansipi ja kaitseminister Jaak Aaviksoo USA-visiitide korraldamisega kursis olevad ametnikud ei nõustu, et kohtumiste taga oleks olnud USA lobitöö Iraagi missiooni pikendamiseks

  11. USA : rünnak võib olla parim kaitse / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    USA uues rahvusliku julgeoleku strateegias rõhutatakse, et tuumaambitsioonidega Iraak kujutab USA jaoks suurimat strateegilist väljakutset ning märgitakse, et teatud juhtudel on ohtude ennetamiseks vajalik jõu kasutamine. Vt. samas: Ameeriklaste toetus Iraagi sõjale väheneb. Lisa: Pessimistlik USA

  12. EL taotleb USA-lt viisavabaduse võrdsust / Ahto Lobjakas, Anneli Ammas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Euroopa Komisjon soovib, et USA kiirendaks EL-i uute liikmesriikide kaasamist oma viisavabastusprogrammi. USA peab illegaalseid tööotsijaid üheks peamiseks tõkkeks viisavabaduse saavutamise teel. Kriteeriumidest, millele peavad USA-ga viisavabadust taotlevad riigid vastama

  13. USA saadik : Lihula sammas oli solvav / Aldona Zofia Wos ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Wos, Aldona Zofia

    2005-01-01

    USA suursaadik Eestis vastab küsimustele, mis puudutavad Eesti-USA suhteid, eestlaste võimalust saada kunagi sõita USA-sse ilma viisata, Lihula mälestusmärgi mahavõtmist, valimisi ja jätkuvat vägivalda Iraagis, HI-viiruse levikut

  14. Valge Maja hämab USA vägede tulevikust Iraagis / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Kuigi USA president George W. Bush on kõnelenud ja USA vägede ülemjuhataja Iraagis George Casey esitanud konkreetse plaani USA vägede väljatoomisest Iraagist, pole Valge Maja konkreetset plaani ametlikult kinnitanud. Lisa: Sõjatandrilt lahkumine

  15. ÜRO asesekretäri kriitika USA suunal ajas viimase marru / Liise Lehtsalu

    Index Scriptorium Estoniae

    Lehtsalu, Liise

    2006-01-01

    ÜRO asesekretär Malloch Brown kritiseeris oma kõnes USA tahtmatust teavitada ameeriklasi ÜRO osast USA välispoliitikas. USA ÜRO-suursaadiku John Boltoni reageering Browni märkustele. Lisa: Rikaste ja vaeste riikide vastuolud

  16. Eesti-USA suhetes loevad väärtused / Vello Andres Pettai

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2006-01-01

    Ilmunud ka: Järva Teataja 30. nov. lk. 6 lüh. Tartu Ülikooli võrdleva poliitika professor vastab Postimees Online'i lugejate küsimustele, mis puudutavad USA presidendi visiiti Eestisse, viisavabadust USA-ga, USA presidendi võimu, NATO-t, välispoliitikat, riikidevahelisi suhteid, ajakirjandusvabadust, inimõigusi ja demokraatiat

  17. Blair üritab muuta USA Euroopa-meelsemaks / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    USA presidendi George W. Bushi ja Suurbritannia peaministri Tony Blairi kohtumine Valges Majas. Blairi parteikaaslase Helen Jacksoni kriitika Blairi USA-poliitika kohta. Suurbritannia endise välisministri Robin Cooki sõnul on USA ja Euroopa poliitilised väärtushinnangud pigem lahknemas kui ühtimas

  18. USA saadik loodab võita eestlaste poolehoiu / Joseph M. DeThomas

    Index Scriptorium Estoniae

    DeThomas, Joseph M.

    2003-01-01

    USA suursaadik Eestis Joseph DeThomas vastab on-line intervjuus Eesti Päevalehe lugejate küsimustele Iraagi ründamise, USA ja Euroopa vahelise lõhe, USA Eesti saatkonna võimaliku ümberkolimise kohta

  19. Tšehhi võimud tahavad endale USA raketikilpi / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2006-01-01

    USA rajab 2011. aastaks raketirünnakute tõrje süsteemi. Raketikilbi Euroopa-keskuse asukohale kandideerivad Tšehhi ja Poola, samas on suur osa tshehhe USA baasi rajamise vastu. Skeem: USA tähesõdade programm. Lisa: Peaminister vaid nime poolest

  20. S&P: meie kohus oli USA riigireitingut alandada / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Standard & Poor´s langetas USA reitingut tasemelt AAA tasemeni AA+. Agentuuri esindaja sõnul oli reitingu alandamine nende kohustus, sest nende arvates oli USA senine reiting liiga kõrge. Hiina nõuab, et USA hakkaks oma võlaprobleemiga tegelema. AAA reiting on nüüd vaid 15 riigil või territooriumil maailmas

  1. 75 FR 22411 - Fonterra (USA) Inc.; Filing of Food Additive Petition

    Science.gov (United States)

    2010-04-28

    ... HUMAN SERVICES Food and Drug Administration Fonterra (USA) Inc.; Filing of Food Additive Petition AGENCY... announcing that Fonterra (USA) Inc. has filed a petition proposing that the food additive regulations be... Fonterra (USA), Inc., c/o Burdock Group, 801 N. Orange Ave., Suite 710, Orlando FL, 32801. The...

  2. 76 FR 62785 - Nordica USA, Provisional Acceptance of a Settlement Agreement and Order

    Science.gov (United States)

    2011-10-11

    ... COMMISSION Nordica USA, Provisional Acceptance of a Settlement Agreement and Order AGENCY: Consumer Product... Agreement with Nordica USA, containing a civil penalty of $214,000.00. DATES: Any interested person may ask... Agreement 1. In accordance with 16 CFR 1118.20, Nordica USA (``Nordica'') and staff of the United...

  3. 78 FR 24206 - Agency Information Collection Activities; Information Collection; USA Spending

    Science.gov (United States)

    2013-04-24

    ... ADMINISTRATION Agency Information Collection Activities; Information Collection; USA Spending AGENCY: Interagency... requirement regarding USA Spending. DATES: Submit comments on or before June 24, 2013. ADDRESSES: Submit comments identified by Information Collection 3090- 00xx, USA Spending, by any of the following...

  4. 78 FR 4400 - Eni USA Gas Marketing LLC; Application for Blanket Authorization To Export Previously Imported...

    Science.gov (United States)

    2013-01-22

    ... USA Gas Marketing LLC; Application for Blanket Authorization To Export Previously Imported Liquefied... and order (Order No. 2923) that granted Eni USA Gas Marketing authority to export a cumulative total... Application, Eni USA Gas Marketing requests blanket authorization to export LNG from the Cameron Terminal...

  5. Contrasting Policies towards (Mainly) Christian Education in Different Contexts

    Science.gov (United States)

    Watson, Keith

    2010-01-01

    During the past 10 to 15 years there has been a renewed interest in the place of religion, religious education and religious schools in different parts of the world. This began in the USA and Europe with the development of private Christian schools. It was later followed by the resurgence of religious schools in the former parts of the Soviet…

  6. Measuring and decomposing output gap: A production function approach of the USA and EU-27 countries

    Directory of Open Access Journals (Sweden)

    Domicián Máté

    2012-11-01

    Full Text Available The ICT-based techno-economic paradigm shift was sharpened by income inequalities in all over the world. The economic performance of USA and Europe were seemed to more different thanks to global economic events. The main purpose of this study is to estimate various macroeconomic variables such as GDP and labour for the period of 1993-2013. In order to indicate economic growth an alternative growth accounting method was used to decompose impacts of physical capital accumulation, technological changes and labour. Analysing the time series data of various OECD countries we could conclude that a large part of the variations in the output gap stem from the cyclical variations of total labour input and the total factor productivity (TFP. Hence, our results were reflected the relevance of technological progress.

  7. Main clinical epidemiological features of lung cancer

    International Nuclear Information System (INIS)

    A descriptive and cross-sectional study of 95 patients with lung cancer, discharged from Neumology Service at 'Dr Juan Bruno Zayas Alfonso' General Hospital in Santiago de Cuba, was carried out from January, 2008 to December, 2008 in order to identify the main clinical epidemiological features of the aforementioned disease. A malignancy predominance among men aged between 56 and 65 years old, belonging to urban areas and being heavy smoker (out of 30 cigarettes per day over 30 years ), was found. Those affected without a confirmed histological type and IV clinical stage epidermoid carcinoma were predominant. Most of them had the opportunity to be treated. Increasing and intensifying health promotion and disease prevention campaigns were recommended so as to achieve the population to avoid or quit the smoking habit. (author)

  8. Generation risk assessment of main output transformers

    International Nuclear Information System (INIS)

    The loss of large power transformers may have major implications for plant operation, performance, safety, and economics. This paper examines the generation risk associated with main output transformers (MOTs) at a large nuclear station using the Monte Carlo simulation approach. The developed methodology is used for spare inventory optimization and making transformer replacement projections, while taking into account the specific demographics and condition of the transformer population. The transformer reliability is described using a flexible, three parameter mixed Exponential/Weibull lifetime distribution. The results of the study indicate that, due to the long procurement time for large transformers, at least 1 or 2 spare transformers are needed immediately to minimize the risk to the station. Delaying the investment, even for a single year, would increase the risk significantly. (author)

  9. CBA main magnet power supply ripple reduction

    Energy Technology Data Exchange (ETDEWEB)

    Bagley, G.; Edwards, R.J.

    1983-01-01

    The preliminary results of a development program to minimize beam perturbation resulting from ripple current generated by the CBA Main Magnet Power Supply are presented. The assessment of the magnitude and causes of the ripple generated led to a modification of the SCR Gate Driver and the addition of a bandpass amplifier correction loop which gave significant improvement. A description of the changes made and the results obtained are included. A second design approach was developed in which the timing of the SCR gate pulses is directly determined by a VCO. The results reported with this VCO Loop indicate superior performance particularly at frequencies below 60 Hz. A shunt transistor regulator design is proposed to minimize higher SCR switching frequency harmonics.

  10. Interaction between main components in wind farms

    DEFF Research Database (Denmark)

    Holdyk, Andrzej; Koldby, Erik

    The purpose of the research documented in this thesis was to establish technical and scientific methods and tools for characterizing offshore wind farms’ electrical main components and their interaction in medium- and high-frequency, taking into account different electrical conditions and wind...... with Frequency Domain Severity Factor proved to be a robust tool in assessing stresses on electric components arising from transient phenomena in offshore wind farms, including the voltage magnitude and frequency of oscillations. Quarter-wave resonance frequency is a good approximation of resonance frequency...... farms’ topology. The research task formulated in this way encloses large variety of research areas and had to be limited. The focus was put on wide band modelling of power transformers, validating existing models of submarine cables, defining methods for developing black-box linear models of multiports...

  11. Natural syntax : English interrogative main clauses

    Directory of Open Access Journals (Sweden)

    Janez Oresnik

    2007-12-01

    Full Text Available Natural Syntax is a developing deductive theory, a branch of Naturalness Theory. The naturalnessjudgements are couched in naturalness scales, whichfollow from the basic parameters (or «axioms» listed at the beginning of the paper. The predictions of the theory are calculated in deductions, whose chief components are apair of naturalness scales and the rules governing the alignment of corresponding naturalness values. Parallel and chiastic alignments are distinguished, in complementary distribution. Chiastic alignment is mandatory in deductions limited to unnatural environments. The paper deals with English interrogative main clauses. Within these, only the interrogatives containing wh-words exclusively insitu constitute an extremely unnatural environment and require chiastic alignment. Otherwiseparallel alignment is used. Earlier publications on Natural Syntax: Kavcic 2005a,b, Oresnik 1999, 2000a,b, 200la-f   2002, 2003a-c, 2002/03, 2004. This list cites only works written in English.

  12. Main injector particle production experiment at Fermilab

    Indian Academy of Sciences (India)

    Sonam Mahajan; Ashok Kumar; Rajendran Raja

    2012-11-01

    The main injector particle production (MIPP) experiment at Fermilab uses particle beams of charged pions, kaons, proton and antiproton with beam momenta of 5–90 GeV/c to measure particle production cross-sections of various nuclei including liquid hydrogen, MINOS target and thin targets of beryllium, carbon, bismuth and uranium. The physics motivation to perform such cross-section measurements is described here. Recent results on the analysis of NuMI target and forward neutron cross-sections are presented here. Preliminary cross-section measurements for 58 GeV/c proton on liquid hydrogen target are also presented. A new method is described to correct for low multiplicity inefficiencies in the trigger using KNO scaling.

  13. BANKING ETHICS: MAIN CONCEPTIONS AND PROBLEMS

    Directory of Open Access Journals (Sweden)

    VALENTINA FETINIUC

    2014-10-01

    Full Text Available Banking ethics is a specialized set of ethical standards and rules that should be followed in the activities of financial institutions and employees of the banking sector. But despite the simplicity of the definition, in the modern world, this concept becomes complex and ambiguous. The importance of studying this subject is defined by the fact that the ethical behavior of the bank and bank employees promotes banking. At present there are several conceptions of banking ethics: general ethics, regulated ethics and ethical bank. The most common practice is to regulate internal and external relations of banks and bank workers with ethical codes. At the same time, studies show the existence of problems in the banking standards of ethics, which negatively affects the financial institution. This article is intended to reflect main tendencies and problems of banking ethics at international level and experience of Republic of Moldova in this field.

  14. PS main supply: motor-generator set.

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    In picture 04 the motor is on the right in the background and the main view is of the generator. The peak power in each PS cycle drawn from the generator, up to 96 MW, is taken from the rotational kinetic energy of the rotor (a heavy-weight of 80 tons), which makes the rotational speed drop by only a few percent. The motor replenishes the average power of 2 to 4 MW. Photo 05: The motor-generator set is serviced every year and, in particular, bearings and slip-rings are carefully checked. To the left is the motor with its slip-rings visible. It has been detached from the axle and moved to the side, so that the rotor can be removed from the huge generator, looming at the right.

  15. Musculoskeletal disorders in main battle tank personnel

    DEFF Research Database (Denmark)

    Nissen, Lars Ravnborg; Guldager, Bernadette; Gyntelberg, Finn

    2009-01-01

    PURPOSE: To compare the prevalence of musculoskeletal disorders of personnel in the main battle tank (MBT) units in the Danish army with those of personnel in other types of army units, and to investigate associations between job function in the tank, military rank, and musculoskeletal problems....... METHOD: An epidemiologic cross-sectional questionnaire-based examination of an exposed group (MBT personnel) and a reference group (army personnel from other units than MBT units) was conducted. Outcome measures were 1-year prevalence of pain in the anatomical locations of neck, shoulder, low back, knee......, and ankle. RESULTS AND CONCLUSIONS: There were only 4 women in the MBT group; as a consequence, female personnel were excluded from the study. The participation rate was 58.0% (n = 184) in the MBT group and 56.3% (n = 333) in the reference group. The pattern of musculoskeletal disorders among personnel...

  16. A random walk down Main Street

    Directory of Open Access Journals (Sweden)

    David Matthew Levinson

    2016-08-01

    Full Text Available US suburbs have often been characterized by their relatively low walk accessibility compared to more urban environments, and US urban environments have been char- acterized by low walk accessibility compared to cities in other countries. Lower overall density in the suburbs implies that activities, if spread out, would have a greater distance between them. But why should activities be spread out instead of developed contiguously? This brief research note builds a positive model for the emergence of contiguous development along “Main Street” to illustrate the trade-offs that result in the built environment we observe. It then suggests some policy interventions to place a “thumb on the scale” to choose which parcels will develop in which sequence to achieve socially preferred outcomes.

  17. Remotely triggered earthquakes following moderate main shocks

    Science.gov (United States)

    Hough, S.E.

    2007-01-01

    Since 1992, remotely triggered earthquakes have been identified following large (M > 7) earthquakes in California as well as in other regions. These events, which occur at much greater distances than classic aftershocks, occur predominantly in active geothermal or volcanic regions, leading to theories that the earthquakes are triggered when passing seismic waves cause disruptions in magmatic or other fluid systems. In this paper, I focus on observations of remotely triggered earthquakes following moderate main shocks in diverse tectonic settings. I summarize evidence that remotely triggered earthquakes occur commonly in mid-continent and collisional zones. This evidence is derived from analysis of both historic earthquake sequences and from instrumentally recorded M5-6 earthquakes in eastern Canada. The latter analysis suggests that, while remotely triggered earthquakes do not occur pervasively following moderate earthquakes in eastern North America, a low level of triggering often does occur at distances beyond conventional aftershock zones. The inferred triggered events occur at the distances at which SmS waves are known to significantly increase ground motions. A similar result was found for 28 recent M5.3-7.1 earthquakes in California. In California, seismicity is found to increase on average to a distance of at least 200 km following moderate main shocks. This supports the conclusion that, even at distances of ???100 km, dynamic stress changes control the occurrence of triggered events. There are two explanations that can account for the occurrence of remotely triggered earthquakes in intraplate settings: (1) they occur at local zones of weakness, or (2) they occur in zones of local stress concentration. ?? 2007 The Geological Society of America.

  18. Replacement of heavy components of the Main Primary System (MPS). Recent innovations made by Framatome ANP

    International Nuclear Information System (INIS)

    The replacement of heavy components is the result of widespread stress corrosion of Inconel 600 (and alloys 82/182) in the primary system. Following the corrosion of steam generator tubes, which led to the first steam generator replacement (SGR) operations, work has begun on reactor vessel head replacements (RVHR) and pressurizer replacements, pending treatment of the dissimilar butt welds (DBW). The replacement of sections of the Main Primary System is one way of optimizing plant lifetime besides preventing stress corrosion in primary components and combating phenomena as thermal fatigue or certain metallurgical weaknesses. The increase in the number of major operations carried out in the reactor building on PWR and BWR reactor geometries has called for major technical innovations. AREVA, has over the past twenty years carried out more than forty SGRs throughout the world, including the supply of 115 steam generators of all types. This equates to over 60% of all SGR operations performed in Europe and the USA. Today, most SGR operations are performed in the USA, though some still continue in Europe and Asia. Operations have been planned until 2015. The first RVHR operations were carried out in France in 1993, and have been widespread in Europe since 1996 (Spain and Belgium), and in the USA since 2002 (Davis Besse). Since 1993 AREVA, through its subsidiaries Framatome ANP, Jeumont SA and SGT, has performed 72 RVHRs, i.e. most of those carried out in Europe and the USA. Today, RVHR operations take place throughout the world and have been planned until 2014. The first pressurizer replacement took place in the fall of 2005 in Saint Lucie, USA. Others are to follow (Fort Calhoun, Millestone). A significant number of partial or complete pressurizer replacements are now being scheduled. Special focus must be given to this new operation, as a decision is required between the following types of replacements, taking into account the number of pressurizer heaters and the

  19. Maine Environmental Vulnerability Index (EVI) Atlas, Maine - 2007, maps in portable document format (NODC Accession 0036827)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This four volume set of Environmental Vulnerability Index Maps depicts environmental resources along the coast of Maine most at risk from oil spilled into the...

  20. Comparative attributes of effective health services managers and definitions of organizational effectiveness in Australia, the UK and the USA.

    Science.gov (United States)

    Boldy, D; Jain, S; Chen, G

    1996-02-01

    This paper explores and contrasts the perceptions of 855, mainly health services managers and 1452 students from three major English-speaking countries regarding the attributes needed for becoming effective managers in their country. Also addressed are country differences and similarities in the perceived relevance of particular indicators of organizational effectiveness. Despite Australia's British heritage, respondents from this country were found to be more similar to those from the USA, than those from the UK, in their views regarding the attributes of effective managers. Australian and American respondents rated 'nurturing' personality skills relatively highly, as they did 'classical' management skills. UK respondents rated 'classical' management skills as more important than 'political' skills.

  1. Flood of April 2007 in Southern Maine

    Science.gov (United States)

    Lombard, Pamela J.

    2009-01-01

    Up to 8.5 inches of rain fell from April 15 through 18, 2007, in southern Maine. The rain - in combination with up to an inch of water from snowmelt - resulted in extensive flooding. York County, Maine, was declared a presidential disaster area following the event. The U.S. Geological Survey, in cooperation with the Federal Emergency Management Agency (FEMA), determined peak streamflows and recurrence intervals at 24 locations and peak water-surface elevations at 63 sites following the April 2007 flood. Peak streamflows were determined with data from continuous-record streamflow-gaging stations where available and through hydraulic models where station data were not available. The flood resulted in peak streamflows with recurrence intervals greater than 100 years throughout most of York County, and recurrence intervals up to 50 years in Cumberland County. Peak flows for selected recurrence intervals varied from less than 10 percent to greater than 100 percent different than those in the current FEMA flood-insurance studies due to additional data or newer regression equations. Water-surface elevations observed during the April 2007 flood were bracketed by elevation profiles in FEMA flood-insurance studies with the same recurrence intervals as the recurrence intervals bracketing the observed peak streamflows at seven sites, with higher elevation-profile recurrence intervals than streamflow recurrence intervals at six sites, and with lower elevation-profile recurrence intervals than streamflow recurrence intervals at one site. The April 2007 flood resulted in higher peak flows and water-surface elevations than the flood of May 2006 in coastal locations in York County, and lower peak flows and water-surface elevations than the May 2006 flood further from the coast and in Cumberland County. The Mousam River watershed with over 13 dams and reservoirs was severely impacted by both events. Analyses indicate that the April 2007 peak streamflows in the Mousam River watershed

  2. Brand new hall in the main building

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The renovation of the UNIQA and post office premises is getting under way, with their reopening scheduled for the spring.   The renovation of the large hall in the main building (Building 500) has finally reached the home straight. As of this week, building contractors will get to work on the last part – the offices of UNIQA and La Poste. In the last week of November, the two concessions moved their offices across Route Scherrer to the same part of Building 510 where UBS was temporarily housed during the bank’s refurbishment. Their services were therefore unavailable for one day. The renovation work will last until the spring, with the new offices expected to open in May 2015. Between now and then, the windows and insulation will be completely refitted, with a view to reducing heat loss considerably, and, above all, the premises will be modernised to improve customer reception and service. For example, UNIQA’s new premises will feature a confidential area, guarantee...

  3. Prototype fast breeder reactor main options

    International Nuclear Information System (INIS)

    Fast reactor programme gets importance in the Indian energy market because of continuous growing demand of electricity and resources limited to only coal and FBR. India started its fast reactor programme with the construction of 40 MWt Fast Breeder Test Reactor (FBTR). The reactor attained its first criticality in October 1985. The reactor power will be raised to 40 MWt in near future. As a logical follow-up of FBTR, it was decided to build a prototype fast breeder reactor, PFBR. Considering significant effects of capital cost and construction period on economy, systematic efforts are made to reduce the same. The number of primary and secondary sodium loops and components have been reduced. Sodium coolant, pool type concept, oxide fuel, 20% CW D9, SS 316 LN and modified 9Cr-1Mo steel (T91) materials have been selected for PFBR. Based on the operating experience, the integrity of the high temperature components including fuel and cost optimization aspects, the plant temperatures are recommended. Steam temperature of 763 K at 16.6 MPa and a single TG of 500 MWe gross output have been decided. PFBR will be located at Kalpakkam site on the coast of Bay of Bengal. The plant life is designed for 30 y and 75% load factor. In this paper the justifications for the main options chosen are given in brief. (author). 2 figs, 2 tabs

  4. Flood inundation map library, Fort Kent, Maine

    Science.gov (United States)

    Lombard, Pamela J.

    2012-01-01

    Severe flooding occurred in northern Maine from April 28 to May 1, 2008, and damage was extensive in the town of Fort Kent (Lombard, 2010). Aroostook County was declared a Federal disaster area on May 9, 2008. The extent of flooding on both the Fish and St. John Rivers during this event showed that the current Federal Emergency Management Agency (FEMA) Flood Insurance Study (FIS) and Flood Insurance Rate Map (FIRM) (Federal Emergency Management Agency, 1979) were out of date. The U.S. Geological Survey (USGS) conducted a study to develop a flood inundation map library showing the areas and depths for a range of flood stages from bankfull to the flood of record for Fort Kent to complement an updated FIS (Federal Emergency Management Agency, in press). Hydrologic analyses that support the maps include computer models with and without the levee and with various depths of backwater on the Fish River. This fact sheet describes the methods used to develop the maps and describes how the maps can be accessed.

  5. Detecting Mass Loss in Main Belt Asteroids

    Science.gov (United States)

    Sandberg, Erik; Rajagopal, Jayadev; Ridgway, Susan E.; Kotulla, Ralf C.; Valdes, Francisco; Allen, Lori

    2016-01-01

    Sandberg, E., Rajagopal, J., Ridgway, S.E, Kotulla, R., Valdes, F., Allen, L.The Dark Energy Camera (DECam) on the 4m Blanco telescope at the Cerro Tololo Inter-American Observatory (CTIO) is being used for a survey of Near Earth Objects (NEOs). Here we attempt to identify mass loss in main belt asteroids (MBAs) from these data. A primary motivation is to understand the role that asteroids may play in supplying dust and gas for debris disks. This work focuses on finding methods to automatically pick out asteroids that have qualities indicating possible mass loss. Two methods were chosen: looking for flux above a certain threshold in the asteroid's radial profile, and comparing its PSF to that of a point source. After sifting through 490 asteroids, several have passed these tests and should be followed up with a more rigorous analysis.Sandberg was supported by the NOAO/KPNO Research Experience for Undergraduates (REU) Program which is funded by the National Science Foundation Research Experiences for Undergraduates Program (AST-1262829)

  6. Nature and main kinds of psychopathological mechanisms

    Directory of Open Access Journals (Sweden)

    Panagiotis Oulis

    2010-12-01

    Full Text Available The paper deals with two central issues in the philosophy of neuroscience and psychiatry, namely those of the nature and the major kinds and types of psychopathological mechanisms. Contrary to a widespread view, I argue that mechanisms are not kinds of systems but kinds of processes unfolding in systems or between systems. More precisely, I argue that psychopathological mechanisms are sets of actions and interactions between brain-systems or circuits as well as between the latter and other systems in one's body and external environment, both physical and social, involved in human psychopathology. According to the kinds of properties of the interacting systems or their component-parts, psychopathological mechanisms may be physical, chemical, biological, psychological, social, or, typically, mixed ones. Furthermore, I focus on two main kinds of psychopathological mechanisms involved in the causation of mental disorders, namely the pathogenetic and pathophysiological ones, stressing the importance of their careful distinction for the integrative understanding of otherwise disparate and apparently incommensurable psychiatric research findings. I illustrate my analysis with an example drawn from contemporary research on the mechanisms of acute psychosis. Finally, I stress the relevance of psychopathological mechanisms to a more scientifi cally-grounded classifi cation of mental disorders.

  7. Proposed Fermilab upgrade main injector project

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE) proposes to construct and operate a ''Fermilab Main Injector'' (FMI), a 150 GeV proton injector accelerator, at the Fermi National Accelerator Laboratory (Fermilab) in Batavia, Illinois. The purpose and need for this action are given of this Environmental Assessment (EA). A description of the proposed FMI and construction activities are also given. The proposed FMI would be housed in an underground tunnel with a circumference of approximately 2.1 miles (3.4 kilometers), and the construction would affect approximately 135 acres of the 6,800 acre Fermilab site. The purpose of the proposed FMI is to construct and bring into operation a new 150 GeV proton injector accelerator. This addition to Fermilab's Tevatron would enable scientists to penetrate ever more deeply into the subatomic world through the detection of the super massive particles that can be created when a proton and antiproton collide head-on. The conversion of energy into matter in these collisions makes it possible to create particles that existed only an instant after the beginning of time. The proposed FMI would significantly extend the scientific reach of the Tevatron, the world's first superconducting accelerator and highest energy proton-antiproton collider

  8. THINKING SKILL - THE MAIN LEARNING TOOL

    Directory of Open Access Journals (Sweden)

    Daniela Koteková

    2010-06-01

    Full Text Available The method of teaching with help of four elementary skills - reading, speaking, writing and listening is definitely inconceivable to teaching any foreign language. But automatic answers following the exercise and students passive memorising does not make speaking language and its learning very natural. This has forced me to find and create the way how to make learners think and realise the point and meaning of learning itself. My paper is about special skill I have tried to apply –thinking skill. I have chosen it to complement other four which teacher normally uses when teaching foreign language (reading, speaking, listening skills. At the same time I put thinking skill into a role to support and enhance learning process. To find and use some methods how to make students think, make their own opinion and also teach them to apply their own experience to learning process was the main goal of this survey. The methods I have applied were provoking students to think before they learn.

  9. Hotel Intercontinental, en Frankfurt-Main (Alemania

    Directory of Open Access Journals (Sweden)

    Apel, Otto

    1966-09-01

    Full Text Available This building has basements, and 21 storeys above the ground. The basements are occupied with the usual services, and a garage, for clients, capable of holding 500 cars. The concierge’s office, the reception office, main hall, restaurant and services are on the ground floor. On the first floor there is a large ball room, where 600 people can assemble, as well as other reception halls. On each of the 2nd to 18th floors there are thirty rooms of one type, and eighteen of another. A luxury apartment occupies the 19th floor, and a restaurant for 200 people as well as a bar is on the top floor. This hotel, which is slab shaped, fits well with its environment and is very pleasantly proportioned.Consta de: planta de sótanos, planta baja y 20 plantas de altura. La planta de sótano contiene las distintas instalaciones; dependencias del personal, etcétera, y un garaje, reservado para los viajeros, capaz de albergar 500 coches. La planta baja comprende: la conserjería, recepción, hall, restaurantes, etc. En la planta primera existe una gran sala de baile para 600 personas, salas de reuniones, etc. Las plantas, de la 2.ª a la 18.ª contienen treinta habitaciones de un tipo y dieciocho de otro, en cada planta. En la planta 19.ª hay un apartamento de lujo. Y en la última planta se distribuyen: un restaurante para 200 personas, bar, etc. El bloque, dentro de su configuración paralelepipédica, es de forma armónica y está perfectamente encajado en el paisaje urbano circundante.

  10. MAIN PROBLEMS OF CONTROLLING OF THE QUALITY

    Directory of Open Access Journals (Sweden)

    Orlov A. I.

    2015-09-01

    Full Text Available Controlling of statistical methods to ensure product quality is the special case of controlling organizational and economic methods of management. Today, controlling in the practice of management of Russian companies is understood as "the system of information-analytical and methodological support to achieve their goals." The controller is developing a decision-making rules, the head takes decisions on the basis of these rules. We proved the concept of "controlling of methods". Innovation in management is based, in particular, on the use of new adequate organizational-economic (as well as economicmathematical and statistical methods. Controlling in this area - is the development and application procedures of compliance management used and newly developed (implemented organizationaleconomic methods for the task. Thus, the methodology for controlling is of great practical value in any field in which the actions (operations must be carried out in accordance with certain rules (regulations, standards, guidelines, as in any such area in which we need to use development and application procedures of compliance management used and the newly established (implemented rules for solution of tasks assigned to the organization. In this article, we select a area of controlling as controlling quality, and we discuss its main issues. This is about controlling of organizational-economic methods to ensure product quality, especially about the statistical methods based on probability theory and mathematical statistics. We consider the analysis and synthesis of plans of statistical quality control, optimization options plans of statistical control, truncated plans. Are discussed the differences control plans provider and the consumer, the allocation of units formless (liquid, gas products, the selection of a random sample of the statistical quality control of products, lower estimate of the required sample size. It is established, that is not always necessary

  11. Gas Main Sensor and Communications Network System

    Energy Technology Data Exchange (ETDEWEB)

    Hagen Schempf

    2006-05-31

    Automatika, Inc. was contracted by the Department of Energy (DOE) and with co-funding from the Northeast Gas Association (NGA), to develop an in-pipe natural gas prototype measurement and wireless communications system for assessing and monitoring distribution networks. This projected was completed in April 2006, and culminated in the installation of more than 2 dozen GasNet nodes in both low- and high-pressure cast-iron and steel mains owned by multiple utilities in the northeastern US. Utilities are currently logging data (off-line) and monitoring data in real time from single and multiple networked sensors over cellular networks and collecting data using wireless bluetooth PDA systems. The system was designed to be modular, using in-pipe sensor-wands capable of measuring, flow, pressure, temperature, water-content and vibration. Internal antennae allowed for the use of the pipe-internals as a waveguide for setting up a sensor network to collect data from multiple nodes simultaneously. Sensor nodes were designed to be installed with low- and no-blow techniques and tools. Using a multi-drop bus technique with a custom protocol, all electronics were designed to be buriable and allow for on-board data-collection (SD-card), wireless relaying and cellular network forwarding. Installation options afforded by the design included direct-burial and external polemounted variants. Power was provided by one or more batteries, direct AC-power (Class I Div.2) and solar-array. The utilities are currently in a data-collection phase and intend to use the collected (and processed) data to make capital improvement decisions, compare it to Stoner model predictions and evaluate the use of such a system for future expansion, technology-improvement and commercialization starting later in 2006.

  12. Main tendencies meeting future energy demands

    International Nuclear Information System (INIS)

    The economic development in the German Democratic Republic within the preceding 10 years has proved that future stable economic growth of about 4 to 4.5% per annum is only achievable by ways including methods of saving resources. This requires due to the close interdependences between the social development and the level of the development in the energy sector long-term growth rates of the national income of 4 to 4.5% per annum at primary energy growth rates of less than 1% per annum. It comprises three main tendencies: 1. Organization of a system with scientific-technical, technological, economic structural-political and educational measures ensuring in the long term less increase of the energy demand while keeping the economic growth at a constant level. 2. The long-term moderate extension and modernization of the GDR's energy basis is characterized by continuing use of the indigenous brown coal resources for the existing power plant capacities and for district heating. 3. The use of modern and safe nuclear power technologies defines a new and in future more and more important element of the energy basis. Currently about 10% of electricity in the GDR are covered by nuclear energy, in 2000 it will be one third, after 2000 the growth process will continue. The experience shows: If conditions of deepened scientific consideration of all technological processes and the use of modern diagnosis and computer technologies as well as permanent improvement of the safety-technological components and equipment are guaranteed an increasing use of such systems for the production of electricity and heat is socially acceptable. Ensuring a high level of education and technical training of everyone employed in the nuclear energy industry, strict safety restrictions and independent governmental control of these restrictions are important preconditions for the further development in this field. 3 refs, 5 tabs

  13. GAS MAIN SENSOR AND COMMUNICATIONS NETWORK SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Hagen Schempf

    2004-09-30

    Automatika, Inc. was contracted by the Department of Energy (DOE) and with co-funding from the New York Gas Group (NYGAS), to develop an in-pipe natural gas prototype measurement and wireless communications system for assessing and monitoring distribution networks. In Phase II of this three-phase program, an improved prototype system was built for low-pressure cast-iron and high-pressure steel (including a no-blow installation system) mains and tested in a serial-network configuration in a live network in Long Island with the support of Keyspan Energy, Inc. The experiment was carried out in several open-hole excavations over a multi-day period. The prototype units (3 total) combined sensors capable of monitoring pressure, flow, humidity, temperature and vibration, which were sampled and combined in data-packages in an in-pipe master-repeater-slave configuration in serial or ladder-network arrangements. It was verified that the system was capable of performing all data-sampling, data-storage and collection as expected, yielding interesting results as to flow-dynamics and vibration-detection. Wireless in-pipe communications were shown to be feasible and the system was demonstrated to run off in-ground battery- and above-ground solar power. The remote datalogger access and storage-card features were demonstrated and used to log and post-process system data. Real-time data-display on an updated Phase-I GUI was used for in-field demonstration and troubleshooting.

  14. Activating main belt comets by collisions

    Science.gov (United States)

    Maindl, T. I.; Haghighipour, N.; Schäfer, C.; Speith, R.

    2016-02-01

    Since their identification as a new class of bodies by Hsieh and Jewitt in 2006 active asteroids (or Main Belt Comets, MBCs) have attracted a great deal of interest. Given that sublimation of volatile material (presumably water-ice) drives MBC activity, these bodies are probable candidates for delivering a significant amount of Earth's water. Dynamical studies suggest in-situ formation of MBCs as the remnants of the break-up of large icy asteroids. Also, collisions between MBCs and small objects might have exposed sub-surface water-ice triggering the cometary activity of these bodies. In order to advance the effort of understanding the nature of MBC activation, we have investigated these collision processes by simulating the impacts in detail using a smooth particle hydrodynamics (SPH) approach that includes material strength and fracture models. Our simulations cover a range of impact velocities (between 0.5 km/s and 5.3 km/s) and angles, allowing m-sized impactors to erode enough of an MBC's surface to expose volatiles and trigger its activation. We also varied the material strength of the active asteroid's surface to study its influence on crater depths and shapes. As expected, depending on the impact energy, impact angle, and MBC's material strength we observe different crater depths. Across all scenarios however, our results show that the crater depths do not exceed a few meters. This implies that if the activity of MBCs is due to sublimating water-ice, ice has to exist in no deeper than a few meters from the surface.

  15. Aqueous alteration on main-belt asteroids

    Science.gov (United States)

    Fornasier, S.; Lantz, C.; Barucci, M.; Lazzarin, M.

    2014-07-01

    The study of aqueous alteration is particularly important for unraveling the processes occurring during the earliest times in Solar System history, as it can give information both on the thermal processes and on the localization of water sources in the asteroid belt, and for the associated astrobiological implications. The aqueous alteration process produces the low temperature (< 320 K) chemical alteration of materials by liquid water which acts as a solvent and produces materials like phyllosilicates, sulphates, oxides, carbonates, and hydroxides. This means that liquid water was present in the primordial asteroids, produced by the melting of water ice by heating sources, very probably by ^{26}Al decay. Hydrated minerals have been found mainly on Mars surface, on primitive main-belt asteroids (C, G, B, F, and P-type, following the classification scheme by Tholen, 1984) and possibly also on few transneptunian objects. Reflectance spectroscopy of aqueous altered asteroids shows absorption features in the 0.6-0.9 and 2.5-3.5-micron regions, which are diagnostic of, or associated with, hydrated minerals. In this work, we investigate the aqueous alteration process on a large sample of 600 visible spectra of C-complex asteroids available in the literature. We analyzed all these spectra in a similar way to characterize the absorption-band parameters (band center, depth, and width) and spectral slope, and to look for possible correlations between the aqueous alteration process and the asteroids taxonomic classes, orbital elements, heliocentric distances, albedo, and sizes. We find that 4.6 % of P, 7.7 % of F, 9.8 % of B, 50.5 % of C, and 100 % of the G-type asteroids have absorption bands in the visible region due to hydrated silicates. Our analysis shows that the aqueous alteration sequence starts from the P-type objects, practically unaltered, and increases through the P → F → B → C → G asteroids, these last being widely aqueously altered, strengthening thus

  16. USA toetab arvatust enam Ukraina opositsiooni / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Briti ajalehe The Guardian kommentaatori Ian Traynor'i sõnul on Ukraina sündmuste puhul tegemist viimase nelja aasta jooksul juba neljanda USA poolt korraldatud ja finantseeritud ettevõtmisega endises idablokis, kus soovitakse vanameelseid režiime võimult tõugata. Sarnase skeemi järgi on tema hinnangul toimunud valimistejärgsed rahutused Jugoslaavias, Gruusias ja Valgevenes

  17. SEGMENTING THE U.S.A. NON-TRAVEL MARKET

    OpenAIRE

    Smith, Wayne W.; Emily Fralinger; Litvin, Stephen W.

    2011-01-01

    Tourism marketers focus on understanding the many different segments that comprise their visitors. Understanding these segments’ motivations for travel is important in order to motivate repeat visitation and to attract like-minded consumers to visit. But how about those who do not travel? This surprisingly large percentage of the population is a lost opportunity for the industry. The research that follows, based upon a very significant USA-based sample of non-travelers, suggests that non-trav...

  18. Rozpočty EU a USA

    OpenAIRE

    Zlatníková, Tereza

    2013-01-01

    The aim of this thesis is to examine the budgets of the European Union and the United States of America especially in terms of territorial redistribution of funds to member states and subsequently identify similar and different featues. Extra attention is paid to the revenue and expenditure sides of the both budgets, factors affecting financial resource allocation and impact of the fiscal redistribution on the economy of the member states of the EU and the USA. The thesis is logically divided...

  19. Reasons For Culture Differences Between Sino——USA

    Institute of Scientific and Technical Information of China (English)

    Sun; Wen; Xu; Jing; Jing

    2014-01-01

    Culture is about survival of the human species.One key goal in the study of cultures is in assessing the survival and predictability of values across the history of humankind.As for China and USA,both countries have their own cultures.of course,they have a lot of difference between each other.Every culture has its own reason to exist in the world.

  20. Maintenance program developmentandImport /Export of Aircraft in USA

    OpenAIRE

    Takele, Teklu

    2009-01-01

    AbstractThis thesis discuss how United Parcel Service (UPS) develop its aircraft maintenanceprogram after import of McDonnell Douglas MD-11aircraft and the process of exporting newMD-11 aircraft from manufacturer in USA to European operator as passenger aircraft. It alsodiscusses the process of importing the same types of aircraft as freight carrier. The aircraftundergo, through different modifications at Singapore Technologies Aerospace (STA)conversion from passenger to freight carrier, a pr...

  1. Nye mål for naturfagsundervisning i USA

    DEFF Research Database (Denmark)

    Evans, Robert Harry; Horst, Sebastian

    2012-01-01

    Analysen ser nærmere på den nye ramme for naturfagsundervisning i USA som udkom i 2011, og som i år bliver udmøntet i nye målbeskrivelser. Den nye ramme er opbygget ud fra tre dimensioner: praksisser inden for naturvidenskab og ingeniørarbejde, tværgående begreber og faglige kerneidéer. Rammen...

  2. GIS tool to locate major Sikh temples in USA

    Science.gov (United States)

    Sharma, Saumya

    This tool is a GIS based interactive and graphical user interface tool, which locates the major Sikh temples of USA on a map. This tool is using Java programming language along with MOJO (Map Object Java Object) provided by ESRI that is the organization that provides the GIS software. It also includes some of the integration with Google's API's like Google Translator API. This application will tell users about the origin of Sikhism in India and USA, the major Sikh temples in each state of USA, location, name and detail information through their website. The primary purpose of this application is to make people aware about this religion and culture. This tool will also measure the distance between two temple points in a map and display the result in miles and kilometers. Also, there is an added support to convert each temple's website language from English to Punjabi or any other language using a language convertor tool so that people from different nationalities can understand their culture. By clicking on each point on a map, a new window will pop up showing the picture of the temple and a hyperlink that will redirect to the website of that particular temple .It will also contain links to their dance, music, history, and also a help menu to guide the users to use the software efficiently.

  3. Capital costs of light water reactors: the USA

    International Nuclear Information System (INIS)

    The cost of building a modern nuclear power plant is greater than that of almost any other single civilian project - costs of individual plants are reckoned in hundreds of millions of pounds in the UK, and up to a billion dollars or more in the USA. Hence, depending on the size of nuclear programmes and their funding, escalation of nuclear capital costs may have important economic and social consequences through its effects on overall resource allocation. It is therefore important to analyse the extent and, as far as possible, the sources of cost increases and escalation, in order to see if the experience yields implications for technology policy. The USA has much the greatest experience in nuclear construction: it also has by far the largest amount of published information on the subject of capital costs. As all other countries lack either sufficient experience and/or adequate published cost information, it is impossible to conduct a genuine international comparison, and this paper is confined to an examination of US experience. This paper therefore assembles and evaluates currently available data on light water reactor (PWR and BWR) capital costs in the USA. (author)

  4. Coal mine safety regulation in China and the USA

    Energy Technology Data Exchange (ETDEWEB)

    Homer, A.W. [Tulane University, New Orleans, LA (United States). School of Law

    2009-07-01

    The People's Republic of China (PRC) and the USA are, by long measure, the world's largest producers and consumers of coal. Coal production is inherently risky, and fatalities are unavoidable in these large coal economies. Both countries have developed complex systems of law to regulate coal mine safety. These systems share many attributes. Despite similarities between the separate systems of mining law, the PRC significantly trails the USA in terms of coal mine safety. Due to large disparity in economic development, it may be inappropriate to compare these two countries. However, the PRC's mine safety record is significantly worse than that of other large producers who are similarly underdeveloped. It appears that the PRC has failed to effectively implement its mining safety laws. Several arguments have been made as to the cause of this failure, including lack of judicial review of agency actions, lack of meaningful trade unions, government corruption and geographical difficulties of controlling rural mines with a central government. This article explores similarities and differences between the coal economies of the USA and PRC, and introduces some of the arguments used to explain the gap in safety.

  5. Eesti arst osales USA-s uudsel südamelõikusel : Ameerika arstid tegid südameoperatsiooni ärkvel olevale mehele / Urmo Kübar

    Index Scriptorium Estoniae

    Kübar, Urmo, 1978-

    2000-01-01

    Vt. ka Zdorovje dlja Vsehh okt., lk. 10. Pittsburghi ülikoolis töötav Eesti narkoosiarst Juhan Paiste kuulus operatsioonimeeskonda, kes lõikas suvel esmakordselt USA-s südame pärgarterit ärkvel oleval patsiendil. Lisa: Südamelõikused Eestis

  6. 75 FR 6397 - AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

    Science.gov (United States)

    2010-02-09

    ... and Partner Companies, and International First Service USA, Inc. a/k/a IFS USA, Inc. d/b/a Global Wine....''); International First Service USA, Inc. a/ k/a IFS USA, Inc. (``IFS USA'') d/b/a/Global Wine Logistics USA Inc. a... AMC USA, Inc. v. International First Service S.A. a/k/a IFS S.A, its Agents, Affiliated, Related...

  7. American Uveitis Society Meeting October 30, 1995 Marriott Marquis Hotel, Atlanta, GA, USA.

    Science.gov (United States)

    Meisler, D M; Chern, K C

    1996-01-01

    1 Retinal vascular occlusion and scleroderma. Tessler H, Flores-Guevara J, Goldstein D, Chicago, IL, USA. 2 MHC Class II antigen expression in ciliary body in spontaneous and experimental uveitis. Kalsow C, Zhavoronkova M, Dwyer A, Rochester, NY & Scottsville, NY, USA. 3 IL-10 in the vitreous of patients with intraocular lymphoma. Whitcup S, Solomon D, Nussenblatt R, Chan C-C, Bethesda, MD, USA 4 Iris juvenile xanthogranuloma studied by immunohistochemistry. Shields J, Shields C, Eagle R, DePotter P, Collins M, Philadelphia, PA, USA. 5 Outcomes analysis in with JRA-associated uveitis. Dana M-R, Merayo-Lloves J, Foster C, Boston MA, USA. 6 Persistent glaucoma secondary to periocular steroids. Akduman L, Conway M, Burchfield J, Kolker A, Black D, DelPriore L, Kaplan H, St. Louis, MO, USA 7 The use of itraconazole in ocular histoplasmosis Callanan D, Fish G, Dallas, TX, USA 8 Succesful treatment of macular hole secondary to sympathetic ophthalmia. Cano J, Diaz M, Navea A, Ruiz C, Castilla M. Barcelona, Spain. 9 HLA-DR2+ intermediate uveitis. Pulido J, Tang W, Han D, Mieler W. Milwaukee, WI, USA. 10 Vein occlusion in AIDS misdiagnosed as CMV retinitis. Park K, Marx J, Rao N. Los Angeles, CA, USA. 11 HIV-associated foveal hemorrhage. Crews K, Zimmerman P, Lohner S. Salt Lake City, UT, USA. 12 Cytomegalovirus papillitis in patients with AIDS. Patel S, Rutzen A, Marx J, Thach A, Chong L, Rao N, Los Angeles, CA, USA. 13 Recurrence rate of CMV retinitis following the ganciclovir implant and pars plans vitrectomy and silicone oil. Marx J, Thach A, Rao N, Chong L. Los Angeles, CA, USA. PMID:22827419

  8. Viisavabadus USA-ga läheneb vaidlustes / Ahto Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2008-01-01

    USA soovib Eesti kodanike viisanõudest vabastamiseks kõrgendatud turvameetmeid. Viisavabadust taotlev Tšehhi sõlmis USA-ga vastastikuse mõistmise memorandumi, EL-i nn. vanad liikmesriigid ja Euroopa Komisjon süüdistavad USA-ga kahepoolsete lepingute sõlmijaid Euroopa ühtsuse lõhestamises. Lisa: Eesti sõlmib lepingu ilmselt märtsi keskel

  9. Eesti ja USA juhtide kohtumiste peateema on NATO ja demokraatia / Vahur Koorits

    Index Scriptorium Estoniae

    Koorits, Vahur, 1981-

    2006-01-01

    USA presidendi George W. Bushi visiidi ajal toimuvatel USA ja Eesti riigijuhtide kohtumistel räägitakse NATO ja demokraatia tulevikust, samuti tulevad kõne alla missioonid Afganistanis ja Iraagis ning eestlaste viisavabadus USA-sse reisimisel. Lisa: Millest kavatsevad riigijuhid kohtumistel rääkida: Ansip, Ilves, Bush. Vt. samas: Bushi visiidi ajal vilksatab Eesti üheks õhtuks ameeriklaste teleekraanidel

  10. USA väed võivad hakata Iraagist lahkuma / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2005-01-01

    USA on Iraagis toimuvate valimiste eel saatnud sinna lisavägesid. Vägivalla tõttu võivad mõnes Iraagi piirkonnas valimised ära jääda. USA välisministri Colin Powelli sõnul võivad USA sõdurid juba sel aastal hakata järk-järgult Iraagist lahkuma, kui Iraagil endal õnnestub saada suurem roll turvalisuse tagamisel. Lisa: Kaotused Iraagis

  11. The energy situation in the Usa; Le contexte energetique des Etats-Unis

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    This analyses discusses the energy supplying security, the natural gas demand increase and its consequences, the climatic change in the long-dated, the long dated perspectives of the Usa energy policy, the law on the energy and the consequences for the nuclear activity, the financial incentives in favor of the construction of new nuclear power plants in the Usa and the good nuclear energy industry situation in the Usa. (A.L.B.)

  12. On New Economy Of USA:A Brief Survey

    Institute of Scientific and Technical Information of China (English)

    尹红心

    2008-01-01

    With the development of globalization,and of high technology,especially information technology(IT),together with the adiUStment of the USA government's policy,New Economy came into being in 1990s in the United States.As a new economic formation. New Economy is information\\knowledge economy in essence. New Economy can be divided into two distinctive periods marked off by the September 11 attacks.New Economy has its own characters and we should adopt an objective attitude towards it.

  13. Spent fuel management in the Power Engineering Ministry of USA

    International Nuclear Information System (INIS)

    There are presented the systematized data on the management with the spent fuel (SF), belonging to the USA Power Engineering Ministry, namely: 2300 t of SF of the two-purpose N reactor in Hanford; SF of the national and foreign research reactors in Savannah River (3400 fuel assemblies with uranium-aluminium fuel with aluminium can and 2000 fuel assemblies with zirconium-stainless steel can) and 265 t of SF of the Peach Bottom and Shipping-port NPPs and the TRIGA reactor in the INEEL laboratory

  14. Modelling real GDP per capita in the USA: cointegration test

    OpenAIRE

    Kitov, Ivan; Kitov, Oleg; Dolinskaya, Svetlana

    2007-01-01

    A two-component model for the evolution of real GDP per capita in the USA is presented and tested. The first component of the GDP growth rate represents an economic trend and is inversely proportional to the attained level of real GDP per capita itself, with the nominator being constant through time. The second component is responsible for fluctuations around the economic trend and is defined as a half of the growth rate of the number of 9-year-olds. This nonlinear relationship between the gr...

  15. The distribution of depleted uranium contamination in Colonie, NY, USA

    OpenAIRE

    Lloyd, N. S.; Chenery, S.R.N.; R. R. Parrish

    2009-01-01

    Uranium oxide particles were dispersed into the environment from a factory in Colonie (NY, USA) by prevailing winds during the 1960’s and ’70’s. Uranium concentrations and isotope ratios from bulk soil samples have been accurately measured using inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) without the need for analyte separation chemistry. The natural range of uranium concentrations in the Colonie soils has been estimated as 0.7 – 2.1 μg g-1, with a weighted geometric mea...

  16. Energy and Moisture Impact of EIFS Walls in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Desjarlais, Andre Omer [ORNL; Johnston, David [EIFS Industry Members Association (EIMA)

    2014-01-01

    ABSTRACT This paper summarizes a family of computer simulations that have been performed to assess the hygrothermal performance of exterior insulation finish systems and discusses the validation of the model prior to its use. This research deals with evaluation of the performance of a number of selected wall systems in all 8 IECC USA climate zones. The research produced a range of performances that are representative of generic EIFS wall systems, and not for a specific manufactured product. A comparison was performed between three different EIFS walls and a brick wall system.

  17. Homeland security in the USA: past, present, and future.

    Science.gov (United States)

    Kemp, Roger L

    2012-01-01

    This paper examines the evolving and dynamic field of homeland security in the USA. Included in this analysis is the evolution of the creation of the Department of Homeland Security, an overview of the National Warning System, a summary of citizen support groups, and how the field of homeland security has had an impact on the location and architecture of public buildings and facilities. Also included are website directories of citizen support groups and federal agencies related to the field of homeland security. PMID:22948103

  18. New trends in the economic sociology in the USA

    OpenAIRE

    Bolčić Silvano

    2004-01-01

    This review article is devoted to the presentation of recent trends in development of the economic sociology, in general, and in the USA, in particular. The return to the “great (European) traditions” in the economic sociology started in the 1980-ties, with M. Granovetter’s article, published in AJS 1985, on “social embeddedness” of economic actions. Relying on the most recent publications in this field, author presents the key principles of economic sociology (on economic action as a form of...

  19. Geochemical Precursors to Volcanic Activity at Mount St. Helens, USA

    Science.gov (United States)

    Berlo, Kim; Blundy, Jon; Turner, Simon; Cashman, Kathy; Hawkesworth, Chris; Black, Stuart

    2004-11-01

    The importance of the interplay between degassing and crystallization before and after the eruption of Mount St. Helens (Washington, USA) in 1980 is well established. Here, we show that degassing occurred over a period of decades to days before eruptions and that the manner of degassing, as deduced from geochemical signatures within the magma, was characteristic of the eruptive style. Trace element (lithium) and short-lived radioactive isotope (lead-210 and radium-226) data show that ascending magma stalled within the conduit, leading to the accumulation of volatiles and the formation of lead-210 excesses, which signals the presence of degassing magma at depth.

  20. SEGMENTING THE U.S.A. NON-TRAVEL MARKET

    Directory of Open Access Journals (Sweden)

    Wayne W. Smith

    2011-12-01

    Full Text Available Tourism marketers focus on understanding the many different segments that comprise their visitors. Understanding these segments’ motivations for travel is important in order to motivate repeat visitation and to attract like-minded consumers to visit. But how about those who do not travel? This surprisingly large percentage of the population is a lost opportunity for the industry. The research that follows, based upon a very significant USA-based sample of non-travelers, suggests that non-travelers can be effectively segmented and targeted. Understanding these segments will better allow vacation marketers to craft their product and their message, hopefully bringing more travelers to the mix.

  1. Overview of Botanical Status in EU, USA, and Thailand

    Directory of Open Access Journals (Sweden)

    Weena Jiratchariyakul

    2013-01-01

    Full Text Available The botanical status in EU, USA, and Thailand is different owing to the regulatory status, the progress of science, and the influence of culture and society. In the EU, botanicals are positioned as herbal medicinal products and food supplements, in the US they are regulated as dietary supplements but often used as traditional medicines, and in Thailand, they are regulated and used as traditional medicines. Information for some of the most popular botanicals from each country is included in this review.

  2. The Ethical Dilemma Of The Usa Government Wiretapping

    Directory of Open Access Journals (Sweden)

    Arwen Mullikin

    2010-11-01

    Full Text Available USA Government wiretapping activities is a very controversial issue. Undoubtedly this technology canassist law enforced authority to detect / identify unlawful or hostile activities; however, this task raisessevere privacy concerns. In this paper, we have discussed this complex information technology issue ofgovernmental wiretapping and how it effects both public and private liberties. Legislation has had amajor impact on the uses and the stigma of wiretapping for the war on terrorism. This paper alsoanalyzes the ethical and legal concerns inherent when discussing the benefits and concerns ofwiretapping. The analysis has concluded with the effects of wiretapping laws as they relate to futuregovernment actions in their fight against terrorists.

  3. Here comes the sun. Solar energy technology in the USA

    International Nuclear Information System (INIS)

    An overview is given of the energy policy in the USA with respect to solar energy technology and the marketing of solar energy applications. In particular, attention is paid to the Million Solar Roofs programme, small-scale and medium-scale photovoltaic (PV) systems (Residential PV and Utility Scale PV), solar thermal systems (Parabolic Trough, Power tower, and Solar Dish/Engine). Also examples of passive solar systems are given. Finally, a number of aspects with regard to market implementation, e.g. net-metering. 9 refs

  4. Inflation, GDP growth and population change in the USA

    OpenAIRE

    Ivan Kitov

    2006-01-01

    Inflation in the USA between 1960 and 2004 is studied in the framework of the revealed rigidity of the personal income distribution normalized to the total nominal GDP. Inflation is found to be a mechanism, which prevents changes in the relative incomes induced by economic growth and population changes - both in number and age structure. A model is developed linking CPI to GDP growth rate and relative change of the number of people of some specific age. The GDP growth rate is characterized by...

  5. Wirtschaftswachstum in den Volkswirtschaftlichen Gesamtrechnungen: Ein Vergleich Deutschland - USA

    OpenAIRE

    Wolfgang Nierhaus

    2001-01-01

    In den USA wird seit 1996 die Wachstumsrate des realen BIP auf der Basis eines "chain-type annual-weighted" Fisher-Index ermittelt, d.h. die Wachstumsrate des realen BIP ist zwar unabhängig vom Basisjahr, andererseits ist aber nicht mehr gewährleistet, dass das BIP gleich der Summe seiner Komponenten ist. Trotz dieses Nachteils könnte ein Systemwechsel in den deutschen Volkswirtschaftlichen Gesamtrechnungen dann angezeigt sein, wenn auch in Deutschland bei der Messung der Preisentwicklung im ...

  6. DOE Zero Energy Ready Home Case Study: Near Zero Maine Home II - Vassalboro, Maine

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2014-11-01

    This case study describes a DOE Zero Energy Ready home in Vassalboro, Maine, that scored HERS 35 without PV and HERS 11 with PV. This 1,200 ft2 home has 10.5-inch-thick double-walls with 3 layers of mineral wool batt insulation, an R-20 insulated slab, R-70 cellulose in the attic, extensive air sealing, a mini-split heat pump, an heat recovery ventilator, solar water heating, LED lighting, 3.9 kWh PV, and triple-pane windows.

  7. Mosaic of bathymetry derived from multispectral World View-2 satellite imagery of Ni'ihau Island, Territory of the Main Hawaiian Islands, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetric data derived from a multipectral World View-2 satellite image mosaiced to provide near complete coverage of nearshore terrain around the islands....

  8. Mosaic of gridded multibeam bathymetry and bathymetry derived from multispectral World View-2 satellite imagery of Ni'ihau Island, Territory of Main Hawaiian Islands, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded multibeam bathymetry is integrated with bathymetry derived from multpectral World View-2 satellite data. Gridded (5 m cell size) multibeam bathymetry...

  9. Rheologic evolution of low-grade metasedimentary rocks and granite across a large strike-slip fault zone: A case study of the Kellyland fault zone, Maine, USA

    Science.gov (United States)

    Sullivan, W. A.; Monz, M. E.

    2016-05-01

    We examine a large strike-slip fault zone that juxtaposes low-grade clastic metasedimentary rocks with coarse-grained granite near the brittle-ductile transition. The load-bearing matrixes in granite-derived ultramylonites and pelite and wacke metasedimentary intervals are texturally similar, and all deformed by diffusion-assisted granular flow. Granite underwent rapid strengthening as the pluton cooled followed by rapid weakening driven by brittle grain-size reduction and mixing that catalyzed ultramylonite formation. The textural and mineralogical similarity of pelitic intervals across the zone indicates they experienced little textural and reaction weakening. Wacke intervals record progressive textural and reaction weakening in an open system. Quartz recrystallized grain sizes in granite-derived ultramylonites record ∼2-times more differential stress than those in metasedimentary rocks in the interior of the zone. The relative weakness of metasedimentary rocks is correlated with fluid influx that likely enhanced diffusion and grain-boundary sliding in pelitic and wacke intervals and catalyzed textural and reaction weakening in wacke intervals. The lack of evidence for fluid and ionic communication with granitic rocks indicates that fluid movement was restricted to foliation-parallel pathways within single rock units. This localized fluid influx is the best explanation for the strength contrasts between texturally similar fault rocks deformed by similar mechanisms.

  10. Shale gas for Europe – main environmental and social considerations

    OpenAIRE

    KAVALOV Boyan; PELLETIER NATHANIEL

    2012-01-01

    The purpose of this study is to provide an overview of shale gas development in the USA and to assess the implications of findings with regard to the prospects for shale gas development in the EU by 2020-2030. Particular emphasis is placed on the environmental and social aspects of market-scale extraction of shale gas. Any purely technological, techno-economic and regulatory aspects of shale gas exploitation are beyond the scope of this study. Other European Commission services, such as DG fo...

  11. Weekend versus weekday transplant surgery and outcomes after kidney transplantation in the USA: a retrospective national database analysis

    Science.gov (United States)

    Martus, Peter; Feldman, Harold; Kramer, Holly

    2016-01-01

    Objective To determine whether kidney transplants performed during a weekend had worse outcomes than those performed during weekdays. Design Retrospective national database study. Setting United Network for Organ Sharing database of the USA. Participants 136 715 adult recipients of deceased donor single organ kidney transplants in the USA between 4/1994 and 9/2010. Main outcome measures The primary outcomes were patient survival and death-censored and overall allograft survival. Secondary outcomes included initial length of hospital stay after transplantation, delayed allograft function, acute rejection within the first year of transplant, and patient and allograft survival at 1 month and at 1 year after transplantation. Cox proportional hazards models were used to evaluate the impact of weekend kidney transplant surgery on primary and secondary outcomes, adjusting for multiple covariates. Results Among the 136 715 kidney recipients, 72.5% underwent transplantation during a regular weekday (Monday–Friday) and 27.5% during a weekend (Saturday–Sunday). No significant association was noted between weekend transplant status and patient survival, death-censored allograft survival or overall allograft survival in the adjusted analyses (HR 1.01 (95% CI 0.92 to 1.04), 1.012 (95% CI 0.99 to 1.034), 1.012 (95% CI 0.984 to 1.04), respectively). In addition, no significant association was noted between weekend transplant status and the secondary outcomes of patient and graft survival at 1 month and 1 year, delayed allograft function or acute rejection within the first year. Results remained consistent across all definitions of weekend status. Conclusions The outcomes for deceased donor kidney transplantation in the USA are not affected by the day of surgery. The operationalisation of deceased donor kidney transplantation may provide a model for other surgeries or emergency procedures that occur over the weekend, and may help reduce length of hospital stay and

  12. Hybrid downscaling of wind climates over the eastern USA

    International Nuclear Information System (INIS)

    Weibull distribution parameters (scale and shape) of wind speeds at 85 stations over the eastern USA are downscaled from distribution parameters of large-scale climate variables drawn from both global and regional models. A probabilistic statistical downscaling approach when applied in hybrid downscaling (combining dynamical and statistical downscaling), exhibits skill in reproducing the macro-scale variability in wind climates in independent data. However, use of predictors from a regional climate model (RCM) run at 50 km resolution does not substantially improve the downscaling results over those obtained when direct output from the parent atmosphere ocean general circulation model (AOGCM) run at approximately 200 km resolution is used for the predictors. The technique is applied to develop projections of mean and 90th percentile wind speeds based on output from six sets of RCM simulations. Projected differences in the mean and 90th percentile wind speeds over the eastern USA for 2041–2060 relative to 1981–1998 are of very modest magnitude (i.e. <5% of the value during 1981–1998), and are smaller than the inherent downscaling uncertainty. The implied near-term stability of wind climates is consistent with analysis of wind speeds directly simulated by RCMs. (paper)

  13. Religion and spirituality among bisexual Black men in the USA

    Science.gov (United States)

    JEFFRIES, WILLIAM L.; DODGE, BRIAN; SANDFORT, THEO G. M.

    2008-01-01

    Traditionally, religion has been a major source of institutional support and well-being for Black people in the USA. However, when juxtaposed against sexuality, religion's positive effect upon the lives of non-heterosexual individuals is questionable. Research suggests that non-heterosexuals often abandon structured religion for spirituality due to the homonegativity perpetuated through religious institutions. Although studies have examined religion and spirituality among gays and lesbians, few have examined their roles in the lives of bisexuals. In this study, we analyzed qualitative interviews from 28 bisexual Black men who resided in New York City. In addition to church attendance, participants expressed belonging to religious communities through activities such as music ministry. Despite rejection because of their bisexuality, some participants saw other religious individuals as being accepting of them. Others discussed the church as a place where non-heterosexuals interacted, often for meeting sexual partners. Participants evoked beliefs in God in coping with adverse life experiences; some linked faith to family and sexual responsibilities. Drawing upon relevant literature, we discuss the implications of religion and spirituality for the quality of life of bisexual Black men in the USA. PMID:18568870

  14. GIS learning tool for USA's tallest skyscrapers and their construction

    Science.gov (United States)

    Rajah Nagarajasetty, Kanaka Nethra

    Urban development in the twenty-first century takes many forms, but for many none quite so interesting as the skyscraper. With swelling cities and growing concerns about the environment, vertical living has become the preferred way of life for millions of people around the world. But just how these tall buildings are designed, constructed and operated remains a mystery to many--even to those who live in them. The motivation behind this application is to build an interactive and one-stop Geographic Information systems (GIS) learning tool that will help users learn about structural facts and geography of tallest skyscrapers around the metro cities of USA. For purpose of this application development, any building more than 700ft (213m) is considered as one of the tallest skyscrapers. The points displayed on USA map are the metro cities hosting these skyscrapers. When users click on cities, a brief description about the city along with a link to the top three skyscrapers is displayed. The links of the skyscrapers opens a HTML page that has a photo gallery, embedded video, facts, structural information etc., in a web browser. Map Objects Java Objects (MOJO), a set of Java API's provided by ESRI, is used to display a map of the United States of America and skyscrapers locations in the form of points. Along with MOJO, other technical languages used to develop this application are HTML5, CSS3, JavaScript and Java Swing.

  15. Pelvic Floor Muscle Training: Underutilization in the USA.

    Science.gov (United States)

    Lamin, Eliza; Parrillo, Lisa M; Newman, Diane K; Smith, Ariana L

    2016-02-01

    Pelvic floor disorders are highly prevalent in women of all ages and can greatly impair quality of life. Pelvic floor muscle training (PFMT) is a viable treatment option for several pelvic floor conditions including urinary incontinence and pelvic organ prolapse. PFMT is a program of therapy initiated by an experienced clinician (e.g., women's health or urology nurse practitioner (NP), physical therapist (PT)) that involves exercises for women with stress urinary incontinence (UI) and exercises combined with behavioral or conservative treatments (lifestyle changes, bladder training with urge suppression) for women with urgency or mixed UI. These exercise programs are more comprehensive than simple Kegel exercises. Despite evidence-based research indicating the efficacy and cost-effectiveness for treatment of urinary incontinence, PFMT is not commonly used as a first-line treatment in clinical practice in the USA (Abrams et al., 2012). This article will review PFMT for the treatment of UI and pelvic organ prolapse (POP) and theorize how this conservative therapy can be utilized more effectively in the USA. PMID:26757904

  16. USA, Russia and the Geopolitical Theatre in the South-Eastern Europe: The Place of Romania

    Directory of Open Access Journals (Sweden)

    Florin Pintescu

    2010-12-01

    Full Text Available Core issues addressed in this article are: the existing threats to address the interests of the US geopolitical and geostrategical, particularly in South-Eastern Europe; the resources available to the American State for the protection of those interests; main features (elements geopolitical of Romania; importance for Romania's Alliance with US. Only states or groups of states that may threaten the economic interests of the U.S. military are originated from Eurasia: China, Russia, the Organization of Shanghai cooperation, the European Union. The main opponent of the U.S. in South-Eastern Europe is Russia. Geostrategical interests of Russia remains fundamentally the attempt to divide alliance NATO (in particular by providing the economic benefits of Germany and France and isolate Eastern Europe; in this way, the US military presence in Europe would become problematic. Currently, the US has enough economic and military means in order to avoid this situation.Geopolitical and geostrategical problems of Romania are of two kinds: external and internal. Externally, Romania has some diplomatic disagreements with Ukraine. At the same time, Romania was not able to resolve in the manner of the former Federal Republic of Germany, a consequence of the Second World War: the unification with the Republic of Moldova, the State created artificially by former USSR after the Second World War. Internally, the main geopolitical problems of Romania are the following: underdevelopment and the absence of real economic competitiveness of industry and agriculture; the demographic decline, lowering the standard of living of population. In the absence of support of the USA for Romania, this country will increase the degree of economic dependence towards Russia.

  17. 77 FR 12909 - Eastern Maine Railway Company-Assignment of Trackage Rights Exemption-Montreal, Maine & Atlantic...

    Science.gov (United States)

    2012-03-02

    ... Surface Transportation Board Eastern Maine Railway Company--Assignment of Trackage Rights Exemption--Montreal, Maine & Atlantic Railway, Ltd. and Maine Northern Railway Company Pursuant to a written agreement, Montreal, Maine & Atlantic Railway, Ltd. (MMA) has agreed to assign its overhead trackage rights to...

  18. 76 FR 32265 - Maine Northern Railway Company-Trackage Rights Exemption-Montreal, Maine & Atlantic Railway, Ltd.

    Science.gov (United States)

    2011-06-03

    ... Surface Transportation Board Maine Northern Railway Company--Trackage Rights Exemption-- Montreal, Maine & Atlantic Railway, Ltd. Pursuant to a written trackage rights agreement, Montreal, Maine & Atlantic Railway, Ltd. (MMA) has agreed to grant overhead trackage rights to the Maine Northern Railway Company...

  19. 76 FR 32266 - Maine Northern Railway Company-Trackage Rights Exemption-Montreal, Maine & Atlantic Railway, Ltd.

    Science.gov (United States)

    2011-06-03

    ... Surface Transportation Board Maine Northern Railway Company--Trackage Rights Exemption-- Montreal, Maine & Atlantic Railway, Ltd. Pursuant to a written trackage rights agreement, Montreal, Maine & Atlantic Railway, Ltd. (MMA) has agreed to grant overhead trackage rights to the Maine Northern Railway Company...

  20. Safety Analysis Report for Packaging (SARP): USA/5790/BLF (ERDA-AL) and USA/5791/BLF (ERDA-AL)

    International Nuclear Information System (INIS)

    The Safety Analysis Report for Packaging (SARP) satisfies the request of the U. S. Energy Research and Development Administration for a formal safety analysis of the two insulated drum shipping containers identified as USA/5790/BLF ERDA-AL and USA/5791/BLF ERDA-AL. Discussions of structural integrity, thermal resistance, radiation shielding and radiological safety, nuclear criticality safety, and quality control are included. Much of the information was previously submitted to ERDA/OSD/ALO and the Department of Transportation (DOT) and provided the basis for obtaining special permits DOT-SP-5790 and DOT-SP-5791 as well as the Interim Certificates of Compliance until the SARP could be prepared. Complete physical and technical descriptions of the packages are presented. Each package consists of a modified DOT Specification 2R cylindrical steel inner container centered within an insulated steel drum. The contents may be any radioactive materials which satisfy the requirements established in this SARP. A shipment of Plutonium-238 in the form of a solid oxide is evaluated in this SARP as an example. The results of the nuclear criticality safety analysis show how much of the fissile isotopes may be shipped as Fissile Class I, II, or III for each container. Design and development considerations, the test and evaluations required to prove the ability of the containers to withstand normal transportation conditions, and the sequence of four hypothetical accident conditions (free drop, puncture, thermal, and water immersion) are discussed