WorldWideScience

Sample records for augusta maine usa

  1. Spatial pattern of groundwater arsenic occurrence and association with bedrock geology in greater augusta, maine

    Science.gov (United States)

    Yang, Q.; Jung, H.B.; Culbertson, C.W.; Marvinney, R.G.; Loiselle, M.C.; Locke, D.B.; Cheek, H.; Thibodeau, H.; Zheng, Yen

    2009-01-01

    In New England, groundwater arsenic occurrence has been linked to bedrock geology on regional scales. To ascertain and quantify this linkage at intermediate (100-101 km) scales, 790 groundwater samples from fractured bedrock aquifers in the greater Augusta, Maine area are analyzed, and 31% of the sampled wells have arsenic concentrations >10 ??g/L. The probability of [As] exceeding 10 ??g/L mapped by indicator kriging is highest in Silurian pelite-sandstone and pelite-limestone units (???40%). This probability differs significantly (p 10 ??g/L arsenic in groundwater. ?? 2009 American Chemical Society.

  2. Gridded bathymetry of Kohala, Hawaii, Main Hawaiian Islands, USA.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — 5-m grid of bathymetric data of Kohala coast of Hawaii, Main Hawaiian Islands, USA. The ASCII grids include multibeam bathymetry from the Reson 8101 multibeam sonar...

  3. 76 FR 53829 - Safety Zone; ESI Ironman 70.3 Augusta Triathlon, Savannah River, Augusta, GA

    Science.gov (United States)

    2011-08-30

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; ESI Ironman 70.3 Augusta Triathlon... during the ESI Ironman 70.3 Augusta Triathlon on Sunday, September 25, 2011. The temporary safety zone is... Guard did not receive necessary information regarding the ESI Ironman 70.3 Augusta Triathlon until...

  4. 77 FR 40544 - Safety Zone; ESI Ironman 70.3 Augusta Triathlon, Savannah River; Augusta, GA

    Science.gov (United States)

    2012-07-10

    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; ESI Ironman 70.3 Augusta Triathlon... during the ESI Ironman 70.3 Augusta Triathlon on Sunday, September 30, 2012. The temporary safety zone... Rule On Sunday, September 30, 2012, the ESI Ironman 70.3 Augusta Triathlon is scheduled to take...

  5. FLOODPLAIN, AUGUSTA COUNTY, USA AND INCORPORATED AREAS

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  6. Gridded bathymetry of Kaneohe Bay, Windward Side Oahu, Main Hawaiian Islands, USA.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — 4-m grid of bathymetric data of Kaneohe Bay, Windward Side Oahu, Main Hawaiian Islands, USA. These netCDF and ASCII grids include multibeam bathymetry from the Reson...

  7. Integrated geophysical investigations of Main Barton Springs, Austin, Texas, USA

    Science.gov (United States)

    Saribudak, By Mustafa; Hauwert, Nico M.

    2017-03-01

    Barton Springs is a major discharge site for the Barton Springs Segment of the Edwards Aquifer and is located in Zilker Park, Austin, Texas. Barton Springs actually consists of at least four springs. The Main Barton Springs discharges into the Barton Springs pool from the Barton Springs fault and several outlets along a fault, from a cave, several fissures, and gravel-filled solution cavities on the floor of the pool west of the fault. Surface geophysical surveys [resistivity imaging, induced polarization (IP), self-potential (SP), seismic refraction, and ground penetrating radar (GPR)] were performed across the Barton Springs fault and at the vicinity of the Main Barton Springs in south Zilker Park. The purpose of the surveys was two-fold: 1) locate the precise location of submerged conduits (caves, voids) carrying flow to Main Barton Springs; and 2) characterize the geophysical signatures of the fault crossing Barton Springs pool. Geophysical results indicate significant anomalies to the south of the Barton Springs pool. A majority of these anomalies indicate a fault-like pattern, in front of the south entrance to the swimming pool. In addition, resistivity and SP results, in particular, suggest the presence of a large conduit in the southern part of Barton Springs pool. The groundwater flow-path to the Main Barton Springs could follow the locations of those resistivity and SP anomalies along the newly discovered fault, instead of along the Barton Springs fault, as previously thought.

  8. Ascariasis in humans and pigs on small-scale farms, Maine, USA, 2010-2013.

    Science.gov (United States)

    Miller, Leigh Ann; Colby, Kate; Manning, Susan E; Hoenig, Donald; McEvoy, Elizabeth; Montgomery, Susan; Mathison, Blaine; de Almeida, Marcos; Bishop, Henry; Dasilva, Alexandre; Sears, Stephen

    2015-02-01

    Ascaris is a genus of parasitic nematodes that can cause infections in humans and pigs. During 2010-2013, we identified 14 cases of ascariasis in persons who had contact with pigs in Maine, USA. Ascaris spp. are important zoonotic pathogens, and prevention measures are needed, including health education, farming practice improvements, and personal and food hygiene.

  9. 76 FR 75508 - United States Navy Restricted Area, SUPSHIP Bath Maine Detachment Mobile at AUSTAL, USA, Mobile...

    Science.gov (United States)

    2011-12-02

    ... Maine Detachment Mobile at AUSTAL, USA, Mobile, AL; Restricted Area AGENCY: U.S. Army Corps of Engineers... parties for the restricted area around the AUSTAL, USA shipbuilding facility located in Mobile, Alabama... Gulf Coast) assumed the duties of administering new construction contracts at AUSTAL USA in...

  10. USA

    DEFF Research Database (Denmark)

    Nedergaard, Peter

    http://www.systime.dk/ungdomsuddannelser/almen-studieforberedelse/usa-en-grundbog-i-politik-og-okonomi.html......http://www.systime.dk/ungdomsuddannelser/almen-studieforberedelse/usa-en-grundbog-i-politik-og-okonomi.html...

  11. 76 FR 18497 - Television Broadcasting Services; Augusta, GA

    Science.gov (United States)

    2011-04-04

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Augusta, GA AGENCY: Federal Communications Commission. ACTION: Proposed rule. SUMMARY: The Commission has before it a petition for rulemaking filed...

  12. Wound healing activity of Abroma augusta in Wistar rats

    Institute of Scientific and Technical Information of China (English)

    Shanbhag T; Dattachaudhuri A; Shenoy S; Bairy KL

    2009-01-01

    Objective:The study was undertaken to evaluate the wound healing profile of alcoholic extract of Abroma au-gusta and its effect on dexamethasone suppressed wound healing in Wistar rats.Methods:An alcoholic extract of Abroma augusta was prepared.Three models were used -incision,excision and dead space wound models. Four groups of animals were used for each model.They were administered 2% gum acacia (orally),alcoholic extract of Abroma augusta (orally),dexamethasone (intramuscularly)and combination of Abroma augusta (o-rally)with dexamethasone (intramuscularly)respectively.The parameters studied included breaking strength of incision wound,period of epithelization and wound contraction rate in the excision wound,breaking strength,dry weight and hydroxyproline content of granulation tissue in dead space wound.Results:The breaking strength of incision wound of Abroma augusta treated group was significantly increased (P <0.001) while that of dexamethasone treated animals was significantly decreased (P <0.001)as compared to control. Coadministration of dexamethasone and Abroma augusta significantly reversed the dexamethasone suppressed wound healing in incision wound model (P <0.001).Animals treated with both dexamethasone and Abroma augusta also showed significant (P <0.004)increase in the breaking strength of granulation tissue in the dead space wound and a significant (P <0.011)reduction in the period of epithelization in the excision wound as compared to rats treated with dexamethasone alone.The rate of wound contraction was not significantly altered in any of the groups.Conclusion:The alcoholic extract of Abroma augusta was found to reverse dexametha-sone suppressed wound healing.

  13. Applicability of International Harvesting Equipment Productivity Studies in Maine, USA: A Literature Review

    Directory of Open Access Journals (Sweden)

    Patrick Hiesl

    2013-11-01

    Full Text Available Harvesting equipment productivity studies have been conducted in many countries around the world spanning over 25 years. These studies have shown that many factors influence individual machine productivity. These factors include stand and site conditions, equipment configuration, management objectives, and operator experience. Productivity can increase or decrease with slight changes in any of these factors. This literature review also highlights the variety of experimental designs and data collection methods encountered in a cross section of those studies. It further shows the variation in species composition, stand density, tree diameter, and harvest prescription. Although studies that include the influence of operator performance on harvest equipment productivity are limited, they were included in this review where appropriate and available. It is clear that productivity equations should be developed using population-level data with several operators. Some studies were conducted in stands similar to Maine, but they used harvesting equipment that is not commonly used in logging operations in this state. Therefore the applicability of existing studies to the logging industry in Maine, USA, is very limited. Our conclusion is that in order to accurately predict harvesting productivity it is necessary to develop regional harvesting productivity equations using harvesting equipment commonly used in Maine. Forest operations researchers in other regions will be able to use this summary to explore the difficulty of applying productivity information to regional logging operations.

  14. Determination of bioanalytical parameters for the standardization of Abroma augusta

    Institute of Scientific and Technical Information of China (English)

    Dinesh K Patel; S P Dhanabal

    2013-01-01

    Objective:To set the analytical parameters for simultaneous determination of different phytochemicals present in theAbroma augusta(A. augusta).Methods:Different phytochemical test including total phenol and total flavonoid content were carried out in the present investigation.Further, a rapid and simple high-performance thin-layer chromatographic(HPTLC) method was developed for the qualitative and quantitative analysis.Moreover antimicrobial study was also performed in the present investigation to know the presence of biological contamination. Results:Preliminary phytochemical analysis revealed the presence of glycoside, alkaloid, carbohydrate and steroid in theA. augusta.Total phenol and total flavonoid content were found to be0.29% and0.50% w/w respectively.All tested microorganism in theA. augusta extract were found to be under the limit.Chloroform: methanol: acetic acid:H2O(170:25:25:4) was used as a solvent system for the qualitative and quantitative analysis throughHPTLCMethod.HPTLC analysis revealed1.87% w/w of linoleic acid in theA. augusta extract.Conclusions:Results showed that the selected parameters in the present investigation would set the new standards for the qualitative and quantitative analysis ofA. augusta.

  15. Social-Ecological Scale Mismatches and the Collapse of the Sea Urchin Fishery in Maine, USA

    Directory of Open Access Journals (Sweden)

    Teresa R. Johnson

    2012-06-01

    Full Text Available Scale mismatches result in incomplete or ambiguous feedback that impairs the ability to learn and adapt and, ultimately, to sustain natural resources. Our aim is to examine the sea urchin fishery in Maine, USA to better understand the multiscale, social, and biophysical conditions that are important for the design of institutions that might be able to sustain the resource. During the late 1980s and 1990s, the Maine sea urchin fishery was a classic gold rush fishery. In the beginning, the fishery was characterized by an abundant resource with little to no harvesting activity, followed by a period of rapid increase in landings and effort that led to a subsequent and persistent decline in the sea urchin population and a significant reduction in effort. We conducted semistructured interviews with scientists and experienced fishermen to understand the multiscale, social, and biophysical conditions that influence fishermen's harvesting strategies, and the implications of this for the design of institutions for successful resource management. The current co-management system includes an advisory body made up of industry members and scientists it also includes limited entry, and additional input control mechanisms. Many of these measures are implemented at a very broad scale; however, we find that the ecological conditions relevant to the sustainable processes occur at the scale of individual fishing sites or ledges, which is a much finer scale than current management. Therefore, the co-management system maintains an open access system and leaves few incentives for the development of sustainable harvesting strategies among fishermen. The clear suggestion is that the appropriate management system would be one that directly addresses the fine scale ecological and social dynamics within this fishery and gives fishermen property rights over individual ledges (for example, leases. After having briefly reviewed experiences in Canada and Chile, we found that

  16. THE MAIN COMPONENTS OF THE CIVIC EDUCATION IN MODERN SCHOOL (USING THE EXAMPLE OF THE USA

    Directory of Open Access Journals (Sweden)

    Inna Stanislavovna Bessarabova

    2015-11-01

    Full Text Available The urgency of the topic is stipulated by the importance of the problem of civic education under modern conditions of forming of the constitutional state and civic society, which has the rights and freedoms of citizens as the highest value.The purpose of the research is to reveal and characterize the peculiarities of the process of civic education of schoolchildren in modern secondary school (using the example of the USA.The results of the research showed that civic education involves three basic components: civic knowledge, civic skills and civic position. Civic knowledge includes clear understanding of the government structure and the processes of law adoption. At this stage the main focus in the process of civic education is directed to the students’ knowledge and skills to analyze historical and political events in the country, to understand the directions of the state policy in the country. The main function of the civic knowledge is its stimulation of the civic activity.The essential part of civic education is the formation of the civic skills, which are dependent on many factors including home environment, active and responsible participation in political life of the society, general education. These skills are classified as interaction, control and influence.The next basic component of civic education – civic position – is connected with personal and social characteristics of a citizen, which are important for active participation under the conditions of constitutional democracy. Civic position is closely connected with conscious readiness of a person to take part in social activity, availability of the theoretical civic know-ledge and practical civic skills. Itshould be mentioned that civic knowledge, civic skills and civic position are interconnected.Practical implications of the results. The results of the research are applicable in the process of working out of the new technologies, methods and approaches in education to

  17. In vitro prevention of chick pancreatic lipase activity by Abroma augusta extract

    Institute of Scientific and Technical Information of China (English)

    Nidhi Gupta; Aditya Ganeshpurkar; Nishikant Jatav; Divya Bansal; Nazneen Dubey

    2012-01-01

    Objective: To investigate chick pancreatic lipase inhibitory activities of the Abroma augusta (A. augusta). Methods: A. augusta was first extracted with methanol and subjected to phytochemical screenings. Quantitative estimation of flavonoids, phenolics and alkaloids was done. Pancreatic lipase from chick pancreas was isolated and used as substrate for anti-lipase studies. Results:A. augusta extract effectively inhibited concentration dependent lipase activity, whereby extract at concentration 100 μg/mL inhibited 88.6% enzyme activity. Conclusions: From these results, it could be concluded that A. augusta can be used as a potential source anti-lipase agents.

  18. Chemical constituents of Gustavia Augusta L. (Lecythidaceae); Constituintes quimicos de Gustavia Augusta L. (Lecythidaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Afonso Duarte Leao de; Rocha, Arnaldo F. Imbiriba da; Pinheiro, Maria Lucia Belem; Andrade, Carlos Humberto de S.; Galotta, Ana Lucia de A. Queiroz; Santos, Maria do Perpetuo Socorro S. dos [Amazonas Univ., Manaus, AM (Brazil). Dept. de Quimica]. E-mail: afonsodlsouza@yahoo.com.br

    2001-08-01

    The Gustavia augusta is used in the folk medicine against leishmaniasis and showed anti-inflammatory action. The phyto chemical studies of the plant stem bark have led to the isolation of (22E)-stigmasta-7,22-dien-3{beta}-ol, 24{alpha}(S)-ethyl-5{alpha}-colesta-7, trans-22-dien-3-one, D-friedoolean-14-en-3{beta}-ol, D-friedoolean-14-en-3-one and D-friedoolean-14-en-3{alpha}-ol along with stigmasterol, {alpha}-amyrin, {beta}-amyrin, lupeol, 3{alpha}-hydroxy-lupeol and betulinic acid. The structures of these compounds were identified by IR, GC/M S, {sup 1} H and {sup 1} {sup 3} C NMR spectral analysis and comparison with literature data. (author)

  19. 77 FR 30216 - Approval and Promulgation of Air Quality Implementation Plans; Maine; Reasonably Available...

    Science.gov (United States)

    2012-05-22

    ... Floor of the Tyson Building, Augusta Mental Health Institute Complex, Augusta, ME 04333-0017. FOR... Environmental protection, Air pollution control, Carbon monoxide, Incorporation by reference, Intergovernmental... AGENCY 40 CFR Part 52 Approval and Promulgation of Air Quality Implementation Plans; Maine;...

  20. IMPACTS OF MARINE AEROSOLS ON SURFACE WATER CHEMISTRY AT BEAR BROOK WATERSHED, MAINE USA

    Science.gov (United States)

    The East Bear catchment at Bear Brook Watershed, Maine receives moderate (for the eastern U.S.) amounts of Cl- in wet and dry deposition. In 1989, Cl- in precipitation ranged from 2 to 55 eq/L. Dry, occult, and wet deposition plus evapotranspiration resulted in stream Cl- averagi...

  1. Plant-wide assessment summary: $1.6 million in savings identified in Augusta Newsprint assessment

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2003-08-01

    Augusta Newsprint and its partners conducted a systematic plant-wide assessment (PWA) to identify energy- and cost-saving opportunities at the company's plant in Augusta, Georgia. The assessment team identified $1.6 million in potential annual savings.

  2. 76 FR 2112 - Peach Orchard Road Groundwater Plume Site, Augusta, Richmond County, GA; Notice of Settlement

    Science.gov (United States)

    2011-01-12

    ... AGENCY Peach Orchard Road Groundwater Plume Site, Augusta, Richmond County, GA; Notice of Settlement... costs concerning the Peach Orchard Road Groundwater Plume Site located in Augusta, Richmond County... Site name Peach Orchard Road Groundwater Plume Superfund Site by one of the following methods:...

  3. Particle size distribution of main-channel-bed sediments along the upper Mississippi River, USA

    Science.gov (United States)

    Remo, Jonathan; Heine, Ruben A.; Ickes, Brian

    2016-01-01

    In this study, we compared pre-lock-and-dam (ca. 1925) with a modern longitudinal survey of main-channel-bed sediments along a 740-km segment of the upper Mississippi River (UMR) between Davenport, IA, and Cairo, IL. This comparison was undertaken to gain a better understanding of how bed sediments are distributed longitudinally and to assess change since the completion of the UMR lock and dam navigation system and Missouri River dams (i.e., mid-twentieth century). The comparison of the historic and modern longitudinal bed sediment surveys showed similar bed sediment sizes and distributions along the study segment with the majority (> 90%) of bed sediment samples having a median diameter (D50) of fine to coarse sand. The fine tail (≤ D10) of the sediment size distributions was very fine to medium sand, and the coarse tail (≥ D90) of sediment-size distribution was coarse sand to gravel. Coarsest sediments in both surveys were found within or immediately downstream of bedrock-floored reaches. Statistical analysis revealed that the particle-size distributions between the survey samples were statistically identical, suggesting no overall difference in main-channel-bed sediment-size distribution between 1925 and present. This was a surprising result given the magnitude of river engineering undertaken along the study segment over the past ~ 90 years. The absence of substantial differences in main-channel-bed-sediment size suggests that flow competencies within the highly engineered navigation channel today are similar to conditions within the less-engineered historic channel.

  4. Particle size distribution of main-channel-bed sediments along the upper Mississippi River, USA

    Science.gov (United States)

    Remo, Jonathan W. F.; Heine, Reuben A.; Ickes, Brian S.

    2016-07-01

    In this study, we compared pre-lock-and-dam (ca. 1925) with a modern longitudinal survey of main-channel-bed sediments along a 740-km segment of the upper Mississippi River (UMR) between Davenport, IA, and Cairo, IL. This comparison was undertaken to gain a better understanding of how bed sediments are distributed longitudinally and to assess change since the completion of the UMR lock and dam navigation system and Missouri River dams (i.e., mid-twentieth century). The comparison of the historic and modern longitudinal bed sediment surveys showed similar bed sediment sizes and distributions along the study segment with the majority (> 90%) of bed sediment samples having a median diameter (D50) of fine to coarse sand. The fine tail (≤ D10) of the sediment size distributions was very fine to medium sand, and the coarse tail (≥ D90) of sediment-size distribution was coarse sand to gravel. Coarsest sediments in both surveys were found within or immediately downstream of bedrock-floored reaches. Statistical analysis revealed that the particle-size distributions between the survey samples were statistically identical, suggesting no overall difference in main-channel-bed sediment-size distribution between 1925 and present. This was a surprising result given the magnitude of river engineering undertaken along the study segment over the past ~ 90 years. The absence of substantial differences in main-channel-bed-sediment size suggests that flow competencies within the highly engineered navigation channel today are similar to conditions within the less-engineered historic channel.

  5. Magic simulation of surface water acidification at, and first year results from the Bear Brook Watershed Manipulation, Maine, USA

    Energy Technology Data Exchange (ETDEWEB)

    Norton, S.A.; Wright, R.F.; Kahl, J.S.

    1992-01-01

    The catchments of East and West Bear Brooks, Maine, USA, with similar stream chemistries and hydrographs, have been hydrologically and chemically monitored for 3.5 years. These clear water streams are low in ANC (0-70 microeg/litre), with variations caused by changing concentrations of base cations, SO4, NO3, and Cl. After one year of treatment, the response of the stream chemistry and the response modelled by MAGIC are similar. Episodes of high discharge in the treated catchment are not characterized by lower ANC and pH, and higher Al than prior to the manipulation. Concentrations of NO3 have increased about 10 microeg/litre during the dormant season, presumably due to additional nitrification of N and NH4. Discharge-chemistry relationships indicate that changes in stream chemistry, except for NO3, are dominated by ion exchange reactions in the upper part of the soil profile.

  6. The effects of storms and storm-generated currents on sand beaches in Southern Maine, USA

    Science.gov (United States)

    Hill, H.W.; Kelley, J.T.; Belknap, D.F.; Dickson, S.M.

    2004-01-01

    Storms are one of the most important controls on the cycle of erosion and accretion on beaches. Current meters placed in shoreface locations of Saco Bay and Wells Embayment, ME, recorded bottom currents during the winter months of 2000 and 2001, while teams of volunteers profiled the topography of nearby beaches. Coupling offshore meteorological and beach profile data made it possible to determine the response of nine beaches in southern Maine to various oceanographic and meteorological conditions. The beaches selected for profiling ranged from pristine to completely developed and permitted further examination of the role of seawalls on the response of beaches to storms. Current meters documented three unique types of storms: frontal passages, southwest storms, and northeast storms. In general, the current meter results indicate that frontal passages and southwest storms were responsible for bringing sediment towards the shore, while northeast storms resulted in a net movement of sediment away from the beach. During the 1999-2000 winter, there were a greater percentage of frontal passages and southwest storms, while during the 2000-2001 winter, there were more northeast storms. The sediment that was transported landward during the 1999-2000 winter was reworked into the berm along moderately and highly developed beaches during the next summer. A northeast storm on March 5-6, 2001, resulted in currents in excess of 1 m s-1 and wave heights that reached six meters. The storm persisted over 10 high tides and caused coastal flooding and property damage. Topographic profiles made before and after the storm demonstrate that developed beaches experienced a loss of sediment volume during the storm, while sediment was redistributed along the profile on moderately developed and undeveloped beaches. Two months after the storm, the profiles along the developed beaches had not reached their pre-storm elevation. In comparison, the moderately developed and undeveloped beaches

  7. Religion and Cult in the ara Pacis Augustae

    Directory of Open Access Journals (Sweden)

    José A. Delgado Delgado

    2016-11-01

    Full Text Available The ara Pacis Augustae, in all its magnificence as a work of art and all its powerful political implications as a creation of the imperial power, was essentially an altar, i.e. an official place of cult subject to certain religious rules and having a specific ceremonial calendar. Accordingly, this research topic has come about and been developed to present, discuss and try to provide a response to the problems that the ara Pacis poses as a place of cult. The debate is organized and is part of the broader context of the nature of the arae in the Roman cultic practice and is predicated on the analysis of the textual tradition of the ara Pacis and the archaeological evidence itself. As a result, we present the process of ‘foundation’ of the ara Pacis Augustae to its full extent and complexity, both in its own ritual aspects themselves as well as in its physical representation as a monument.

  8. The MAGIC simulation of surface water acidification at, and first year results from, the Bear Brook Watershed Manipulation, Maine, USA.

    Science.gov (United States)

    Norton, S A; Wright, R F; Kahl, J S; Scofield, J P

    1992-01-01

    The catchments of East and West Bear Brooks, Maine, USA, have been hydrologically and chemically monitored for 3.5 years. Stream chemistries and hydrographs are similar. These clear water streams are low in ANC (0-70 microeq litre(-1)), with variations caused by changing concentrations of base cations, SO4, NO3 and Cl. The latter range between 90-120, 0-40 and 65-75 microeq litre(-1), respectively. The West Bear catchment is being treated with six applications per year of dry (NH4)2SO4 at 1800 eq ha(-1) year(-1). After one year of treatment, the response of the stream chemistry and the response modelled by MAGIC are similar. Retentions of NH4 and SO4 are nearly 100% and greater than 80%, respectively. The additional flux of SO4 is compensated principally by an increased Ca concentration. Episodes of high discharge in the treated catchment are now characterized by lower ANC and pH, and higher Al than prior to the manipulation. Concentrations of NO3 have increased about 10 microeq litre(-1) during the dormant season, presumably due to additional nitrification of N from NH4. Discharge-chemistry relationships indicate that changes in stream chemistry, except for NO3, are dominated by ion exchange reactions in the upper part of the soil profile.

  9. Antimicrobial and cytotoxic activities of Abroma augusta Lnn. leaves extract

    Institute of Scientific and Technical Information of China (English)

    FK Saikot; Alam Khan; MF Hasan

    2012-01-01

    Objective: To evaluate the antimicrobial and cytotoxic activity of acetone extract of leaves ofAbroma augusta. Methods: Disc diffusion method was used to demonstrate antibacterial and antifungal activities. Cytotoxicity was determined against brine shrimp nauplii. In addition, minimum inhibitory concentration (MIC) was determined using serial dilution technique to determine antibacterial potency. Results: The extract showed significant antibacterial activities against three gram-positive (Bacillus subtilis, Bacillus megaterium and Staphylococcus aureus) and four gram-negative (Escherichia coli, Shigella dysenteriae, Shigella sonnei and Salmonella typhi) bacteria. The antifungal activity was found strong against five fungi (Aspergillus flavus, Aspergillus niger, Candida albicans, Rhizopus oryzae and Aspergillus fumigatus). In cytotoxicity determination, LC50 of the extract against brine shrimp nauplii was 7.06μg/ml. Conclusions: The Abroma leaves extract may be consider as a potent antimicrobial and cytotoxic agent for further advance research.

  10. Three-dimensional numerical simulations on wind- and tide-induced currents: The case of Augusta Harbour (Italy)

    Science.gov (United States)

    De Marchis, Mauro; Freni, Gabriele; Napoli, Enrico

    2014-11-01

    The hydrodynamic circulation in the coastal area of the Augusta Bay (Italy), located in the eastern part of Sicily, is analysed. Due to the heavy contamination generated by the several chemical and petrochemical industries active in the zone, the harbour was declared a Contaminated Site of National Interest. To mitigate the risks connected with the industrial activities located near the harbour, it is important to analyse the hydrodynamic circulation in the coastal area. To perform such analysis, a parallel 3D numerical model is used to solve the Reynolds-averaged momentum and mass balance, employing the k-ε turbulence model for the Reynolds stresses. The numerical model is parallelized using the programing technology - Message Passing Interface (MPI) and applying the domain decomposition procedure. The Augusta Bay circulation is mainly due to the relative contribution of the wind force acting over the free surface and the tidal motion through the mouths. Due to the geometric complexity of the domain and the presence of several piers along the coast, a curvilinear boundary-fitted computational grid was used, where cells corresponding to land areas or to wharfs were excluded from the computation. Comparisons between numerical results and field measurements were performed. Three different simulations were performed to selectively isolate the effect of each force, wind and tide, acting in the considered domain. The current in the basin was successfully estimated on the basis of the numerical results, demonstrating the specific role of wind and tidal oscillation in the hydrodynamic circulation inside the harbour.

  11. Edificios con forjados postesados mediante tendones no adherentes. Edificio Mapfre-Vía Augusta, en Barcelona-España

    Directory of Open Access Journals (Sweden)

    Llombart Jaques, José Antonio

    1994-08-01

    Full Text Available The technique of unbonded tendons applied to post-tensioned flat-slabs of buildings of certain importance has not been very frequent in Spain to date; in fact, it was used on very few occasions. This article gives the basic characteristics of the post-tensioned floors comparing them with the conventional solutions of reinforced concrete floors. The second part of the article brings a description of the main aspects of the design and construction of the Mapfre-Vía Augusta building in Barcelona. This recently raised building has the floor construction with slabs post-tensioned by unbonded tendons.

    La técnica del postesado no adherente, aplicada a losas de forjado de edificios de cierta entidad, ha sido hasta el momento poco común en España, habiéndose utilizado solamente en contadas ocasiones. Se indican, en primer lugar, las características fundamentales de los forjados postesados y se establecen comparaciones con soluciones convencionales de forjados de hormigón armado. En la segunda parte del artículo se describen los principales aspectos de proyecto y construcción de la estructura del Edificio Mapfre-Vía Augusta, en Barcelona, de reciente construcción, cuyos forjados están constituidos por losas postesadas mediante tendones no adherentes.

  12. Marcadores da paisagem e intervenção cadastral no território próximo da cidade de Bracara Augusta (Hispania Citerior Tarraconensis

    Directory of Open Access Journals (Sweden)

    Carvalho, Helena Paula

    2012-12-01

    Full Text Available This paper focuses the organization of the rural landscape around the Roman town of Bracara Augusta and the identification of a Roman cadastre, perfectly adapted to the relief and to the main hydrographical network of the region. This cadastre is organized in modules of 20 by 20 actus with a predominant orientation of 16º NNW, what may be inferred by the clear intersection of some important axes. We have also detected two cippi with a cross engraved on their upper face, separated by 20 actus, probably connected with limits or termini.Este trabajo tiene como objetivo presentar algunos de los resultados del estudio sobre el poblamiento y la organizacion del paisaje rural en torno a la ciudad romana de Bracara Augusta. La existencia de un cadastro romano con una orientación dominante de 16º NNO y una modulación de 20x20 actus, se confirma gracias a la documentación de algunos elementos de delimitación, de los que podemos destacar dos cipos con una distancia entre sí de 20 actus. [pt] Este artigo propõe-se apresentar os resultados do estudo do povoamento e da organização da paisagem em torno da cidade romana de Bracara Augusta. Este objectivo orienta-se, mais especificamente, para os dados relativos à identificação de um cadastro romano perfeitamente adaptado às formas estruturantes do relevo e da rede hidrográfica. Este cadastro possui uma orientação de cerca de 16º NNO com uma modulação de 20x20 actus, e encontra-se confirmado por alguns elementos demarcatórios, nomeadamente dois cipos que possuem entre si 20 actus de distância.

  13. Urbanismo e arquitectura de Bracara Augusta : balanço dos resultados

    OpenAIRE

    Martins, Manuela; Delgado, Manuela; Alarcão, Jorge de

    1994-01-01

    Balanço dos conhecirncntos relativos ao urbanismo e arquitectura de Bracara Augusta, com base nos resultados das escavações realizadas desde 1976. Câmara Municipal do Porto Fundação Calouste Gulbenkian e Junta Nacional de Investigação CiÊntífica e Tecnológica

  14. Broadening Educational Horizons: The National Science Foundation GK-12 Teaching Fellowship Program at the University of Maine, Orono, ME, USA.

    Science.gov (United States)

    Wilson, K. R.; Kelley, J. T.

    2005-12-01

    The future of meaningful scientific research in the United States depends heavily upon the quality of the science and mathematics education received by students in our grade K-12 education system. The National Science Foundation's GK-12 Teaching Fellowship Program provides opportunities for scientific enrichment for students and their teachers at the K-12 level. Currently in its fifth year at the University of Maine, Orono, the program is one of over 100 such programs in the country. Last year, the program was honored by the New England Board of Higher Education with a Regional Award for Excellence in Project Achievement. The program has three broad goals: to enrich the scientific education of students by providing equipment, role models, and expertise that they may not otherwise be exposed; to provide professional development for teachers through curriculum enrichment and participation at scientific conferences; and to improve the teaching and communication skills of fellows. Fellows represent a broad spectrum of research interests at the University of Maine, including Biology, Chemistry, Engineering, Forestry, Geological Sciences, and Marine Science. This past year, 13 graduate students and 1 undergraduate student worked with 52 teachers and 2300 students in 26 schools across the state of Maine. The benefits of this program are tangible and substantial. New awareness of the innovative ways that K-12 and University education systems can work together to promote hands-on science and the scientific method, is one of the major contributions of the NSF GK-12 Teaching Fellowship Program.

  15. The Penobscot River, Maine, USA: a Basin-Scale Approach to Balancing Power Generation and Ecosystem Restoration

    Directory of Open Access Journals (Sweden)

    Jeffrey J. Opperman

    2011-09-01

    Full Text Available Although hydropower is a source of low-carbon energy, without careful consideration and management, dams have the potential to degrade river ecosystems and the goods and services they provide to society. Today, a broad range of hydropower interests and stakeholders are seeking approaches to hydropower development and operation that are more environmentally and socially sustainable. The Penobscot River Restoration Project ('the Project' illustrates that basin-scale approaches can provide a broader set of solutions for balancing energy and riverine environmental resources than can be achieved at the scale of individual projects. The Penobscot basin is the largest in Maine and historically supported culturally and economically significant populations of migratory fish. These migratory fish populations declined dramatically following the construction of a series of hydropower dams on the main stem river and major tributaries in the early 20th century. The Project, negotiated between a power company (PPL Corporation and a coalition including the Penobscot Indian Nation, resource agencies, and nongovernmental conservation organizations, features the removal of two main stem dams on the lower Penobscot and improved fish passage at the dams that remain. Because of various capacity and/or operational changes, power production will be increased at the remaining dams and total hydropower energy production from the basin will be maintained or increase slightly. The Project is expected to expand considerably the proportion of the basin accessible to migratory fish and contribute to significant increases in fish populations. The Project illustrates that a basin-scale approach can potentially yield more comprehensive solutions for sustainable hydropower than can be achieved at the project scale, and we recommend that such large-scale planning processes can improve the sustainability of both regulatory licensing of existing dams as well as the planning of

  16. 2015 NOAA NGS Ortho-rectified Mean High Water Color Mosaic of Augusta to Newcastle, Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  17. Paleotsunamis Evidence In The Augusta Bay (Eastern Sicily, Italy)

    Science.gov (United States)

    Smedile, A.; de Martini, P.; Barbano, M. S.; Pantosti, D.; Gerardi, F.; Del Carlo, P.; Bellucci, L. G.; Gasperini, L.; Sagnotti, L.; Polonia, A.; Pirrotta, C.

    2008-12-01

    The Augusta Bay, in Eastern Sicily (Italy), was repeatedly hit by tsunami waves related to large historical earthquakes (e.g. 1908, 1693, 1169). The area is characterized by coastal lowlands or lagoons, and by a relatively wide continental shelf with a thick late-Holocene record that has been investigated through the acquisition of a tight grid of CHIRP-sonar profiles. Well targeted sediment samples have been collected both offshore and inland. The integrated interpretation of the geophysical and geological data has been carried out in order to recognize, date and correlate key-layers in the sediment column that may be directly or indirectly related to tsunami events. A total of 26 cores were collected inland at a maximum distance of 530 m from the present coastline. The clay and silt dominated stratigraphy is intercalated by at least 5 high-energy or anomalous depositional layers, repeatedly found in several cores. These layers are made of coarse to fine sand with sharp basal contacts and present a bioclastic component made of microfauna (foraminifera) and shell fragments both suggestive of a marine provenance. Chronological constraints on the age of these deposits is based on AMS radiocarbon datings and on the attribution of a tephra layer to the 122 BC Etna eruption (thanks to petro- chemical and morphoscopic analyses). Integrating these data, the inland sequence spans the last 4100 yrs and the two uppermost high-energy events could be related to the AD 1169 and 1693 historical tsunamis. The offshore record was studied from a 6.7 m-long piston-core collected at 70 m water depth. The homogeneous sequence of dark gray mud is interrupted at -3 m by the same Etna tephra deposit found inland. Through the analysis of tephrostratigraphy, radiocarbon datings, high resolution paleomagnetic analysis and radioactive tracers, the entire core sequence has been dated back to the last 4500 yrs. Moreover, the quantitative micropaleontological analysis on the benthic

  18. Limestone fluidized bed treatment of acid-impacted water at the Craig Brook National Fish Hatchery, Maine, USA

    Science.gov (United States)

    Sibrell, P.L.; Watten, B.J.; Haines, T.A.; Spaulding, B.W.

    2006-01-01

    Decades of atmospheric acid deposition have resulted in widespread lake and river acidification in the northeastern U.S. Biological effects of acidification include increased mortality of sensitive aquatic species such as the endangered Atlantic salmon (Salmo salar). The purpose of this paper is to describe the development of a limestone-based fluidized bed system for the treatment of acid-impacted waters. The treatment system was tested at the Craig Brook National Fish Hatchery in East Orland, Maine over a period of 3 years. The product water from the treatment system was diluted with hatchery water to prepare water supplies with three different levels of alkalinity for testing of fish health and survival. Based on positive results from a prototype system used in the first year of the study, a larger demonstration system was used in the second and third years with the objective of decreasing operating costs. Carbon dioxide was used to accelerate limestone dissolution, and was the major factor in system performance, as evidenced by the model result: Alk = 72.84 ?? P(CO2)1/2; R2 = 0.975. No significant acidic incursions were noted for the control water over the course of the study. Had these incursions occurred, survivability in the untreated water would likely have been much more severely impacted. Treated water consistently provided elevated alkalinity and pH above that of the hatchery source water. ?? 2005 Elsevier B.V. All rights reserved.

  19. Flow and sorption controls of groundwater arsenic in individual boreholes from bedrock aquifers in central Maine, USA

    Science.gov (United States)

    Yang, Qiang; Culbertson, Charles W.; Nielsen, Martha G.; Schalk, Charles W.; Johnson, Carole D.; Marvinney, Robert G.; Stute, Martin; Zheng, Yan

    2014-01-01

    To understand the hydrogeochemical processes regulating well water arsenic (As) evolution in fractured bedrock aquifers, three domestic wells with [As] up to 478 µg/L are investigated in central Maine. Geophysical logging reveals that fractures near the borehole bottom contribute 70–100% of flow. Borehole and fracture water samples from various depths show significant proportions of As (up to 69%) and Fe (93–99%) in particulates (>0.45 µm). These particulates and those settled after a 16-day batch experiment contain 560–13,000 mg/kg of As and 14–35% weight/weight of Fe. As/Fe ratios (2.5–20 mmole/mole) and As partitioning ratios (adsorbed/dissolved [As], 20,000–100,000 L/kg) suggest that As is sorbed onto amorphous hydrous ferric oxides. Newly drilled cores also show enrichment of As (up to 1,300 mg/kg) sorbed onto secondary iron minerals on the fracture surfaces. Pumping at high flow rates induces large decreases in particulate As and Fe, a moderate increase in dissolved [As] and As(III)/As ratio, while little change in major ion chemistry. The δD and δ18O are similar for the borehole and fracture waters, suggesting a same source of recharge from atmospheric precipitation. Results support a conceptual model invoking flow and sorption controls on groundwater [As] in fractured bedrock aquifers whereby oxygen infiltration promotes oxidation of As-bearing sulfides at shallower depths in the oxic portion of the flow path releasing As and Fe; followed by Fe oxidation to form Fe oxyhydroxide particulates, which are transported in fractures and sorb As along the flow path until intercepted by boreholes. In the anoxic portions of the flow path, reductive dissolution of As-sorbed iron particulates could re-mobilize As. For exposure assessment, we recommend sampling of groundwater without filtration to obtain total As concentration in groundwater. PMID:24842411

  20. Flow and sorption controls of groundwater arsenic in individual boreholes from bedrock aquifers in central Maine, USA.

    Science.gov (United States)

    Yang, Qiang; Culbertson, Charles W; Nielsen, Martha G; Schalk, Charles W; Johnson, Carole D; Marvinney, Robert G; Stute, Martin; Zheng, Yan

    2015-02-01

    To understand the hydrogeochemical processes regulating well water arsenic (As) evolution in fractured bedrock aquifers, three domestic wells with [As] up to 478 μg/L are investigated in central Maine. Geophysical logging reveals that fractures near the borehole bottom contribute 70-100% of flow. Borehole and fracture water samples from various depths show significant proportions of As (up to 69%) and Fe (93-99%) in particulates (>0.45 μm). These particulates and those settled after a 16-day batch experiment contain 560-13,000 mg/kg of As and 14-35% weight/weight of Fe. As/Fe ratios (2.5-20 mmol/mol) and As partitioning ratios (adsorbed/dissolved [As], 20,000-100,000 L/kg) suggest that As is sorbed onto amorphous hydrous ferric oxides. Newly drilled cores also show enrichment of As (up to 1300 mg/kg) sorbed onto secondary iron minerals on the fracture surfaces. Pumping at high flow rates induces large decreases in particulate As and Fe, a moderate increase in dissolved [As] and As(III)/As ratio, while little change in major ion chemistry. The δD and δ(18)O are similar for the borehole and fracture waters, suggesting a same source of recharge from atmospheric precipitation. Results support a conceptual model invoking flow and sorption controls on groundwater [As] in fractured bedrock aquifers whereby oxygen infiltration promotes the oxidation of As-bearing sulfides at shallower depths in the oxic portion of the flow path releasing As and Fe; followed by Fe oxidation to form Fe oxyhydroxide particulates, which are transported in fractures and sorb As along the flow path until intercepted by boreholes. In the anoxic portions of the flow path, reductive dissolution of As-sorbed iron particulates could re-mobilize As. For exposure assessment, we recommend sampling of groundwater without filtration to obtain total As concentration in groundwater.

  1. Bedload entrainment in low-gradient paraglacial coastal rivers of Maine, U.S.A.: Implications for habitat restoration

    Science.gov (United States)

    Snyder, Noah P.; Castele, Michael R.; Wright, Jed R.

    2009-02-01

    The rivers of coastal Maine flow through mainstem lakes and long low-gradient reaches that break the continuum of bedload transport expected in nonparaglacial landscapes. Stream erosion of glacial deposits supplies coarse sediment to these systems. The land use history includes intensive timber harvest and associated dam construction, which may have altered the frequency of substrate-mobilizing events. These watersheds are vital habitat for the last remaining wild anadromous Atlantic salmon in the United States. Future adjustments in channel morphology and habitat quality (via natural stream processes or restoration projects) depend on erosion, transport, and deposition of coarse sediment. These factors motivate our study of competence at four sites in the Sheepscot and Narraguagus watersheds. Three of the four sites behaved roughly similarly, with particle entrainment during intervals that include winter ice and spring flood conditions, and relatively minor bed mobilization during moderate floods in the summer and fall (with a recurrence interval of 2-3 years). The fourth site, on the Sheepscot River mainstem, exhibits more vigorous entrainment of marked particles and more complex three-dimensional channel morphology. This contrast is partially due to local geomorphic conditions that favor high shear stresses (particularly relatively steep gradient), but also likely to nourishment of the bedload saltation system by recruitment from an eroding glacial deposit upstream. Our results suggest that the frequency and magnitude of bedload transport are reach specific, depending on factors including local channel geometry, upstream sediment supply and transport, and formation of anchor ice. This presents a challenge for stream practitioners in this region: different reaches may require contrasting management strategies. Our results underscore the importance of understanding channel processes at a given site and assessing conditions upstream and downstream as a prerequisite

  2. A late Holocene paleo-productivity record in the western Gulf of Maine, USA, inferred from growth histories of the long-lived ocean quahog ( Arctica islandica)

    Science.gov (United States)

    Wanamaker, Alan D.; Kreutz, Karl J.; Schöne, Bernd R.; Maasch, Kirk A.; Pershing, Andrew J.; Borns, Harold W.; Introne, Douglas S.; Feindel, Scott

    2009-02-01

    To investigate environmental variability during the late Holocene in the western Gulf of Maine, USA, we collected a 142-year-old living bivalve ( Arctica islandica) in 2004, and three fossil A. islandica shells of the Medieval Warm Period (MWP) and late MWP / Little Ice Age (LIA) period (corrected 14CAMS = 1030 ± 78 ad; 1320 ± 45 ad; 1357 ± 40 ad) in 1996. We compared the growth record of the modern shell with continuous plankton recorder (CPR) time-series (1961-2003) from the Gulf of Maine. A significant correlation ( r 2 = 0.55; p < 0.0001) exists between the standardized annual growth index (SGI) of the modern shell and the relative abundance of zooplankton species Calanus finmarchicus. We therefore propose that SGI data from A. islandica is a valid proxy for paleo-productivity of at least one major zooplankton taxa. SGIs from these shells reveal significant periods of 2-6 years (NAO-like) based on wavelet analysis, multitaper method (MTM) analysis and singular spectrum analysis (SSA) during the late Holocene. Based on established physical oceanographic observation in the Gulf of Maine, we suggest that slope water variability coupled with North Atlantic Oscillation (NAO) dynamics is primarily responsible for the observed SGI variability.

  3. Flow and sorption controls of groundwater arsenic in individual boreholes from bedrock aquifers in central Maine, USA

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Qiang [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9 W, Palisades, NY 10964 (United States); School of Earth and Environmental Sciences, Queens College and Graduate Center, City University of New York, 65-30 Kissena Blvd., Flushing, NY 11367 (United States); Culbertson, Charles W.; Nielsen, Martha G.; Schalk, Charles W. [U.S. Geological Survey, Maine Water Science Center, 196 Whitten Road, Augusta, ME 04330 (United States); Johnson, Carole D. [U.S. Geological Survey, Branch of Geophysics, 11 Sherman Place, Unit 5015, University of Connecticut, Storrs, CT 06269 (United States); Marvinney, Robert G. [Maine Geological Survey, 93 State House Station, Augusta, ME 04333 (United States); Stute, Martin [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9 W, Palisades, NY 10964 (United States); Zheng, Yan, E-mail: yan.zheng@qc.cuny.edu [Lamont-Doherty Earth Observatory of Columbia University, 61 Route 9 W, Palisades, NY 10964 (United States); School of Earth and Environmental Sciences, Queens College and Graduate Center, City University of New York, 65-30 Kissena Blvd., Flushing, NY 11367 (United States)

    2015-02-01

    To understand the hydrogeochemical processes regulating well water arsenic (As) evolution in fractured bedrock aquifers, three domestic wells with [As] up to 478 μg/L are investigated in central Maine. Geophysical logging reveals that fractures near the borehole bottom contribute 70–100% of flow. Borehole and fracture water samples from various depths show significant proportions of As (up to 69%) and Fe (93–99%) in particulates (> 0.45 μm). These particulates and those settled after a 16-day batch experiment contain 560–13,000 mg/kg of As and 14–35% weight/weight of Fe. As/Fe ratios (2.5–20 mmol/mol) and As partitioning ratios (adsorbed/dissolved [As], 20,000–100,000 L/kg) suggest that As is sorbed onto amorphous hydrous ferric oxides. Newly drilled cores also show enrichment of As (up to 1300 mg/kg) sorbed onto secondary iron minerals on the fracture surfaces. Pumping at high flow rates induces large decreases in particulate As and Fe, a moderate increase in dissolved [As] and As(III)/As ratio, while little change in major ion chemistry. The δD and δ{sup 18}O are similar for the borehole and fracture waters, suggesting a same source of recharge from atmospheric precipitation. Results support a conceptual model invoking flow and sorption controls on groundwater [As] in fractured bedrock aquifers whereby oxygen infiltration promotes the oxidation of As-bearing sulfides at shallower depths in the oxic portion of the flow path releasing As and Fe; followed by Fe oxidation to form Fe oxyhydroxide particulates, which are transported in fractures and sorb As along the flow path until intercepted by boreholes. In the anoxic portions of the flow path, reductive dissolution of As-sorbed iron particulates could re-mobilize As. For exposure assessment, we recommend sampling of groundwater without filtration to obtain total As concentration in groundwater. - Highlights: • Most Fe and some As exist as particulates in the tested borehole and fracture water.

  4. Fluxes and the mass balance of mercury in Augusta Bay (Sicily, southern Italy)

    Science.gov (United States)

    Salvagio Manta, Daniela; Bonsignore, Maria; Oliveri, Elvira; Barra, Marco; Tranchida, Giorgio; Giaramita, Luigi; Mazzola, Salvatore; Sprovieri, Mario

    2016-11-01

    The flux (Φ) of mercury (Hg) at the sediment-seawater interface was investigated in Augusta Bay (southern Italy) where uncontrolled industrial discharge from one of the most important chlor-alkali plant in Europe has caused significant negative effects on the environment. Hg fluxes were measured by the deployment of in-situ benthic chamber. The obtained value of 1.3 kmol y-1 clearly emphasizes the role of the sediments as source of Hg for the overlying water column. Moreover, Hg concentrations in the outflowing bottom waters were measured to estimate the export of this pollutant from Augusta Bay to the open sea. The calculated value of 0.54 kmol y-1, corresponding to ∼4% of the anthropogenic input of Hg from coastal point/diffuse sources to the Mediterranean Sea (12.5 kmol y-1; Rajar et al., 2007; UNEP-MAP, 2001), assigns this area a crucial role in the Hg inventory of the entire Mediterranean basin. Finally, a consistent and robust mass balance for Hg in Augusta Bay was provided by combining the obtained data with Hg fluxes at seawater-atmosphere interface.

  5. FIELD SURVEY, Androscoggin, MAINE USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  6. Floodplain, Androscoggin County, MAINE, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This Floodplain Mapping Submission includes a revised flood hazard dataset. STARR restudied all flooding sources with greator than 1 sq. mi. drainage area and not...

  7. Spatial and non-spatial risk factors associated with cage-level distribution of infectious salmon anaemia at three Atlantic salmon, Salmo salar L., farms in Maine, USA.

    Science.gov (United States)

    Gustafson, L; Ellis, S; Robinson, T; Marenghi, F; Merrill, P; Hawkins, L; Giray, C; Wagner, B

    2007-02-01

    The distribution of infectious salmon anaemia (ISA) was examined among 80 cages from three Atlantic salmon grow-out farms in Maine, USA that were stocked with smolts from a single hatchery. Cage-level disease was broadly defined as one or more moribund fish testing positive for infectious salmon anaemia virus (ISAV) by RT-PCR and a second confirmatory test (IFAT, culture or genotype sequence). Spatio-temporal and cage-level risks were explored using logistic regression and survival analysis. Non-spatial risk factors associated with ISA, or shortened survival time to disease, included increased predation, trucking company choice for smolt transfers, a finely-sedimented benthic substrate, and smaller average size of smolts at stocking. Univariable analysis identified the time-dependent spatial factor 'adjacency to newly infected cages' to be predictive of new infection in neighbouring cages 11-12 weeks later. However, none of the spatial factors, or their lags retained relevance in multiple-variable models. The results suggest a diffuse distribution of virus exposure throughout infected sites, with host-susceptibility factors probably influencing disease manifestation in individual cages. The narrow focus of the current study may limit application of the findings to other sites and year-classes. However, these data support the relevance of husbandry efforts to optimize fish health in regions affected by ISAV.

  8. The effect of fire on mercury cycling in the soils of forested watersheds: Acadia National Park, Maine, U.S.A

    Science.gov (United States)

    Amirbahman, A.; Ruck, P.L.; Fernandez, I.J.; Haines, T.A.; Kahl, J.S.

    2004-01-01

    This study compares mercury (Hg) and methylmercury (MeHg) distribution in the soils of two forested stream watersheds at Acadia National Park, Maine, U.S.A. Cadillac Brook watershed, which burned in 1947, has thin soils and predominantly deciduous vegetation. It was compared to the unburned Hadlock Brook watershed, with thicker soil and predominantly coniferous vegetation. Soils in both watersheds were primarily well drained. The fire had a significant impact on the Cadillac watershed, by raising the soil pH, altering the vegetation, and reducing carbon and Hg pools. Total Hg content was significantly higher (P metabolism due to more rapid nutrient cycling and higher soil pH in the deciduous forest. In this research, we have shown that the amount of MeHg is not a function of the total pool of Hg in the watershed. Indeed, MeHg was inversely proportional to total Hg, suggesting that landscape factors such as soil pH, vegetation type, or land use history (e.g., fire) may be the determining factors for susceptibility to high Hg in biota. ?? 2004 Kluwer Academic Publisher. Printed in the Netherlands.

  9. Taraxerol, a pentacyclic triterpene from Abroma augusta leaf, attenuates acute inflammation via inhibition of NF-κB signaling.

    Science.gov (United States)

    Khanra, Ritu; Dewanjee, Saikat; Dua, Tarun K; Bhattacharjee, Niloy

    2017-04-01

    Abroma augusta L. (Malvaceae) leaf is traditionally used to treat inflammatory disorders. In our laboratory, we have scientifically validated the anti-inflammatory effect of A. augusta leaf extract. In this study, it has been aimed to evaluate in vivo anti-inflammatory effect of taraxerol isolated from the methanol extract of A. augusta leaf. It was further intended to find out the probable mechanism of anti-inflammatory effect of taraxerol. The anti-inflammatory effect of taraxerol (5 and 10mg/kg, i.p.) was measured employing carrageenan-induced paw edema model of acute inflammation. The carrageenan injection resulted significant edema formation in the right paw when compared with un-injected left paw. However, taraxerol (10mg/kg) treatment could significantly (pinflammation via inhibition of NF-κB signaling.

  10. Estudio sobre la metrología de la ceca romana de Augusta Emerita

    Directory of Open Access Journals (Sweden)

    Cebrián Sánchez, Miguel Ángel

    2006-12-01

    Full Text Available Metrology analysis of the Roman currency in Augusta Emerita has allowed to distinguish two different metrological patterns. The former is a Roman imperial; the latter is a Hispanic one, this being used until the end of the Augustan reign. From B.C. 2 on, and throughout the Tiberian reign, coinage is only carried out following the imperial pattern. This happens at a time of high coinage production in Augusta Emerita, which might probably explain the city’s urban development and embellishment heyday.Se estudia la metrología en la ceca romana –imperial y provincial- de Augusta Emerita. Dividimos el trabajo metrológico en dos grandes apartados, el primero analiza los pesos de las doce emisiones de la Mérida romana y el segundo pretende hacer una comparación con las otras cecas hispanas que, por su emisiones, están más próximas a las emeritenses. A esos dos apartados se añade una pequeña sección dedicada a la metalografía. A través de todo ello se demuestra que hubo dos sistemas metrológicos conviviendo, el republicano y el augústeo, emitiendose en Emerita y que el periodo de mayor auge de las emisiones incluye la etapa final del reinado de Augusto, post 2 a.C., y todo el reinado de Tiberio, lo que podría muy bien señalar el momento de apogeo y embellecimiento de la ciudad.

  11. In Memoriam doctora Augusta Noemí Ochoa López (1937-2015

    Directory of Open Access Journals (Sweden)

    Gabriela Rouillon

    2015-10-01

    Full Text Available La Doctora Augusta Noemí Ochoa López, nació un martes 4 de mayo de 1937 en Cañete, Lima. Empezó los estudios de la carrera de biología en la Universidad Nacional Mayor de San Marcos, en 1953, también llevo cursos de la carrera de Educación. Obtuvo su grado de Bachiller en Biología en el año 1966 con la Tesis “Observaciones sobre el Desove de la Anchoveta, Engraulis ringens J., en la zona del Callao”.

  12. Sediment transport modelling based on grain size trend analysis in Augusta Harbour (Sicily)

    Science.gov (United States)

    Barbera, Giuseppe; Feo, Roberto; Freni, Gabriele

    2015-12-01

    To support marine civil engineer in pollutant studies, sediment management or dredging operations, is useful to know how the sediments move in accumulation basin. This paper investigates the dynamic of the sediment path using a two-dimensional numeric model: the Grain Size Trend Analysis (GSTA). The GSTA was applied using GiSedTrend plugin, under GIS software. The case study is the Augusta Harbour, which is one of the most polluted Italian harbours. It is the marine part of the Site of National Interest (SNI) of Priolo Gargallo (Siracusa, Italy) and it can be hydrodynamically considered as a lagoon. Two scenarios were obtained by using different geostatistical criteria.

  13. 77 FR 24385 - Approval and Promulgation of Air Quality Implementation Plans; Maine; Regional Haze

    Science.gov (United States)

    2012-04-24

    ... Control, Department of Environmental Protection, First Floor of the Tyson Building, Augusta Mental Health... energy and non-air quality environmental impacts; any pollution control equipment in use at the source... members of Credo Action stating ``As a Maine resident, I urge you to greatly reduce haze pollution...

  14. Interspecific hybridization between Tigridia pavonia and T. augusta through ovary slice culture.

    Science.gov (United States)

    Piña-Escutia, J-L; Vázquez-García, L-M; Arzate-Fernández, A-M

    2013-01-16

    Tigridia pavonia is the most popular species in the Tigridia genus, and is currently marketed in Europe, Asia, and Australia as a landscape plant. Although it is native to Mexico, there are no breeding programs for it. In this study, we attempted to increase its flower color spectrum and growth habit by interspecific hybridization with T. augusta. Interspecific hybrids between T. pavonia and T. augusta were successfully obtained for the first time using the cut-style pollination and ovary slice culture techniques. On the contrary, no hybrids were obtained from a reciprocal cross. At three, four, and five days after pollination (DAP) ovaries were sliced and cultured on Murashige and Skoog medium without growth regulators and ammonium nitrate, but were supplemented with 6% sucrose, 50 mg/L yeast extract, and 0.25% Gelrite. After 80 days of culture initiation, the germination of only 10 embryos was observed in ovary slices cultured at three DAP. After transfer to identical fresh medium, six hybrid embryos developed into seedlings. All obtained hybrid seedlings were transplanted successfully to soil, and grew normally. The progenies investigated were identified as true hybrids based on randomly amplified polymorphic DNA analysis.

  15. Portuguese nursing: history of the life and activism of Maria Augusta Sousa

    Directory of Open Access Journals (Sweden)

    Deybson Borba de Almeida

    2016-06-01

    Full Text Available Abstract OBJECTIVE To analyze the history of the life and activism of Portuguese nurse Maria Augusta Sousa. METHOD Sousa's life story was obtained by means of semi-structured interview swith Sousa as the oral source of data. NVivo qualitative research software was used for data analysis. Content analysis focused on thematic analysis based on the theoretical and philosophical ideas of Michel Foucault, in particular, power and techniques of the self. RESULTS Alienation and political participation were revealed as pertinent issues. In techniques of production of activist subjects, the following were highlighted: the importance of the review of formal education; actions of involvement with the world, society and the profession; and finally, techniques of the self, techniques of constitution of activist subjects, professional identity and way of being. CONCLUSION The constitution of the nurse Maria Augusta Sousa as an activist came about through questioning of how to be, education in the context of her family, and political engagement in Catholic Youth. This impacted her trajectory of contributions to Portuguese nursing, as expressed in the following achievements: the integration of nursing training into higher education; the creation of the Regulation of Nurses Professional Practice; and implementation of the Order of Nurses.

  16. [Evaluation of mercury exposure in populations living near the industrial Augusta Bay (Sicily Region, Southern Italy)].

    Science.gov (United States)

    Bonsignore, Maria; Andolfi, Nunzia; Quinci, Enza Maria; Madeddu, Anselmo; Tisano, Francesco; Ingallinella, Vincenzo; Castorina, Maria; Sprovieri, Mario

    2016-01-01

    OBIETTIVI: valutare e quantificare l'esposizione umana al mercurio (Hg) ed esplorare i fattori chiave che influenzano la contaminazione nelle popolazioni residenti in prossimità della Rada di Augusta, un'area a elevato rischio ambientale a causa degli effetti degli sversamenti incontrollati di Hg da parte di uno dei più grandi impianti cloro-soda d'Europa. DISEGNO: un campione di residenti nei comuni di Augusta, Priolo e Melilli (Sicilia orientale) è stato selezionato per lo studio di biomonitoraggio umano. Un questionario dettagliato è stato somministrato a ogni partecipante per raccogliere informazioni anagrafiche sulle abitudini di vita e alimentari. I livelli di Hg in sangue e capelli, usati come traccianti di esposizione a metilmercurio, sono stati messi in relazione al consumo di pesce locale. Il contenuto di Hg nelle urine è stato utilizzato per esplorare eventuali esposizioni atmosferiche a Hg inorganico. Una regressione lineare multivariata è stata applicata con l'obiettivo di esplorare i fattori che influenzano l'esposizione umana al Hg. L'approccio tossicocinetico è stato impiegato al fine di calcolare la dose settimanale provvisoria tollerabile ( provisional tolerable weekly intake, PTWI) e di predire le concentrazioni di Hg attese nel sangue degli individui con una dieta alimentare basata esclusivamente su pesce locale.

  17. Twenty-year inter-annual trends and seasonal variations in precipitation and stream water chemistry at the Bear Brook Watershed in Maine, USA.

    Science.gov (United States)

    Navrátil, Tomas; Norton, Stephen A; Fernandez, Ivan J; Nelson, Sarah J

    2010-12-01

    Mean annual concentration of SO4(-2) in wet-only deposition has decreased between 1988 and 2006 at the paired watershed study at Bear Brook Watershed in Maine, USA (BBWM) due to substantially decreased emissions of SO(2). Emissions of NO(x) have not changed substantially, but deposition has declined slightly at BBWM. Base cations, NH4+, and Cl(-) concentrations were largely unchanged, with small irregular changes of <1 μeq L(-1) per year from 1988 to 2006. Precipitation chemistry, hydrology, vegetation, and temperature drive seasonal stream chemistry. Low flow periods were typical in June-October, with relatively greater contributions of deeper flow solutions with higher pH; higher concentrations of acid-neutralizing capacity, Si, and non-marine Na; and low concentrations of inorganic Al. High flow periods during November-May were typically dominated by solutions following shallow flow paths, which were characterized by lower pH and higher Al and DOC concentrations. Biological activity strongly controlled NO3- and K(+). They were depressed during the growing season and elevated in the fall. Since 1987, East Bear Brook (EB), the reference stream, has been slowly responding to reduced but still elevated acid deposition. Calcium and Mg have declined fairly steadily and faster than SO4(-2), with consequent acidification (lower pH and higher inorganic Al). Eighteen years of experimental treatment with (NH(4))(2)SO(4) enhanced acidification of West Bear Brook's (WB) watershed. Despite the manipulation, NH4+ concentration remained below detection limits at WB, while leaching of NO3- increased. The seasonal pattern for NO3- concentrations in WB, however, remained similar to EB. Mean monthly concentrations of SO4(-2) have increased in WB since 1989, initially only during periods of high flow, but gradually also during base flow. Increases in mean monthly concentrations of Ca(2+), Mg(2+), and K(+) due to the manipulation occurred from 1989 until about 1995, during the

  18. Under Augustus sign: the role of Astronomy in the foundation of Augusta Praetoria Salassorum

    CERN Document Server

    Bertarione, Stella Vittoria

    2013-01-01

    Augusta Praetoria Salassorum, modern Aosta, was founded around 25 BC to celebrate the victory of Augustus army on the Salassi. Aosta is a city of the founder under many respects; for instance, one of the two twin temples of the forum was devoted to Augustus, and a huge triumphal arc to the ruler still welcomes the town visitors. Recently, a sculpted block has been uncovered, still in its original position, on a corner of one of the town towers. The block carries reliefs, such as a plough and a spade, which are clearly related to the town foundation ritual. As a consequence, we carried out an archaeoastronomical analysis of the original urban plan taking into account the complex natural horizon of the Alps in which Aosta valley is nested. The results show that the town was very likely oriented in such a way as to pinpoint Augustus associations with the cosmic signs of renewal: the winter solstice and the Capricorn.

  19. Rotation Period Determination for 254 Augusta, 465 Alekto 477 Italia, 515 Athalia, and 1061 Paeonia

    Science.gov (United States)

    Pilcher, Frederick

    2015-04-01

    Synodic rotation periods and amplitudes have been found for 254 Augusta 5.8949 ± 0.0001 hours, 0.75 to 0.58 magnitudes; 465 Alekto, 10.936 ± 0.001 hours, 0.14 ± 0.02 magnitudes with 3 maxima and minima per cycle; 477 Italia 19.413 ± 0.001 hours, 0.20 to 0.15 magnitudes with 3 very unequal maxima and minima per cycle; 515 Athalia 10.636 ± 0.001 hours, 0.21 ± 0.02 magnitudes; and 1061 Paeonia, 7.9971 ± 0.0001 hours, 1.00 ± 0.05 magnitudes.

  20. Noé en Mérida (Augusta Emérita

    Directory of Open Access Journals (Sweden)

    Arce, Javier

    2000-12-01

    Full Text Available For a long time, a relief, preserved in the Museo Nacional de Arte Romano in Mérida (Badajoz, Spain has been considered to be a representation of the oriental god Mithras Saxigenus and, therefore, as another witness of the oriental cults in the ancient capital of Lusitânia. Although some authors interpreted it differently, as a funeral banquet with a portrait of the dead person, nobody has yet proposed the Christian interpretation presented here: the image of Noah emerging from the Ark, shown on the front of a sarcophagus lid, and the representation of a celestial banquet celebrating the salvation of the dead. The piece is dated to the last quarter of the 3rd century AD and thus is the first archaeological evidence of Christianity in the colonia Augusta EmeritaSe estudia un relieve conservado en el Museo Nacional de Arte Romano de Mérida (Badajoz, España que durante mucho tiempo ha sido considerado como una representación de Mitra saxígeno y, por tanto, un documento más entre los testimonios de cultos orientales en la capital de la Lusitania. A pesar de que algunos autores dieron una interpretación diferente, esto es, que se trataba de un banquete funerario con la representación del difunto, ninguno ha propuesto la identificación con una escena cristiana que aquí se propone, representada en el frente de una tapa de sarcófago, con la imagen de Noé saliendo del arca y, a continuación, una representación del banquete celestial en el que participan los justos. La pieza se fecha en el último cuarto del siglo III d.C. y se convierte así en el primer testimonio arqueológico de la presencia de cristianos en la colonia Augusta Emerita.

  1. Abroma augusta Linn bark extract-mediated green synthesis of gold nanoparticles and its application in catalytic reduction

    Science.gov (United States)

    Das, Subhajit; Bag, Braja Gopal; Basu, Ranadhir

    2014-11-01

    The bark extract of Abroma augusta Linn is rich in medicinally important phytochemicals including antioxidants and polyphenols. First one step green synthesis of gold nanoparticles (AuNPs) has been described utilizing the bark extract of Abroma augusta L. and chloroauric acid under very mild reaction conditions. The phytochemicals present in the bark extract acted both as a reducing as well as a stabilizing agent, and no additional stabilizing and capping agents were needed. Detailed characterizations of the stabilized AuNPs were carried out by surface plasmon resonance spectroscopy, high resolution transmission electron microscopy, and X-ray diffraction studies. The catalytic activity of the freshly synthesized gold nanoparticles has been demonstrated for the sodium borohydride reduction of 4-nitrophenol to 4-aminophenol, and the kinetics of the reduction reaction have been studied spectrophotometrically.

  2. Tsunami vulnerability and damage for buildings analyzed by means of two methods (PTVA-3 and SCHEMA) in the area of Augusta and Siracusa, eastern Sicily, Italy

    Science.gov (United States)

    Pagnoni, Gianluca; Tinti, Stefano

    2015-04-01

    aim of this work is to compare the vulnerability and damage analyses carried out by means of the PTVA-3 and the SCHEMA methods on the same data set, that is the urban and port areas of Siracusa and Augusta in order to highlight similarities and discrepancies. In this preliminary analysis the coastal inundation was not derived from tsunami simulations, but was assumed to be constant along the coast (bathtub hypothesis) and was taken to be 5 m and 10 m respectively for Siracusa and Augusta. The main outcome of the compared analysis is that the two methods do not provide completely overlapping vulnerability and damage maps, though they use equivalent 5-degree scales. In general the PTVA-3 method tends to overestimate the damage, although there are several counterexamples where PTVA-3 foresees less damage than SCHEMA. The differences we found in the assessment opens the question of how to treat uncertainties in the vulnerability and damage analyses, which is a problem often overlooked, but of crucial importance for the application and for civil authorities.

  3. 2015 NOAA NGS Ortho-rectified Mean Low Low Water Color Mosaic of Augusta to Newcastle, Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  4. 2015 NOAA NGS Ortho-rectified Mean High Water Near-Infrared Mosaic of Augusta to Newcastle, Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  5. 2015 NOAA NGS Ortho-rectified Mean Low Low Water Near-Infrared Mosaic of Augusta to Newcastle, Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  6. Health-hazard evaluation report HETA 83-335-1618, Kendall Company, Augusta, Georgia. [Ethylene oxide

    Energy Technology Data Exchange (ETDEWEB)

    Seligman, P.; Gorman, R.

    1985-08-01

    Environmental and breathing-zone samples were analyzed for ethylene oxide at the Kendall Company, Augusta, Georgia in August, 1983 and July and August, 1984. The evaluation was requested confidentially to investigate employee complaints of eye irritation and neurologic symptoms and concern over an excessive number of miscarriages. Physicians at the Medical College of Georgia had reported cases of peripheral neuropathy and cataracts related to ethylene-oxide exposure. Twenty-one employees were interviewed. Company medical records were reviewed. Ethylene-oxide concentrations ranged from nondetectable to 0.83 part per million (ppm). The OSHA standard for ethylene oxide is 1.00 ppm. Grab samples taken during sterilizer down/loading contained 0.3 to 25.0ppm ethylene oxide. Medical records confirmed three cases of neuropathy and four of cataracts. Headache, eye irritation, and fatigue were the most prominent symptoms reported. Many of these symptoms were resolved when ethylene oxide was removed from the alcohol wipes. Five of six miscarriages were not occupationally related. The authors conclude that cases of peripheral neuropathy and cataracts among ethylene-oxide sterilizer operators can be related to past exposures, which were higher. Recommendations include using engineering controls to reduce ethylene-oxide exposure further and complying with OSHA recommendations in monitoring employees exposed to action-level concentrations of 0.5ppm ethylene oxide.

  7. Using model analyses and surface-atmosphere exchange measurements from the Howland AmeriFlux Site in Maine, USA, to improve understanding of forest ecosystem C cycling

    Energy Technology Data Exchange (ETDEWEB)

    Hollinger, David Y.; Davidson, Eric A.; Richardson, Andrew D.; Dail, D. B.; Scott, N.

    2013-03-25

    Summary of research carried out under Interagency Agreement DE-AI02-07ER64355 with the USDA Forest Service at the Howland Forest AmeriFlux site in central Maine. Includes a list of publications resulting in part or whole from this support.

  8. Petrography and mineral chemistry of the composite Deboullie Pluton, northern Maine, USA: implications for the genesis of Cu-Mo mineralization

    Science.gov (United States)

    Loferski, P.J.; Ayuso, R.A.

    1995-01-01

    Biotite and apatite mineral chemistry, particularly halogen abundances and ratios, are used to investigate the relation of the two contrasting parts of the Deboullie composite pluton (syenite-granodiorite) located in northern Maine. Biotite mineral chemistry helps to classify the weakly developed porphyry-style mineralization (Cu-Mo) associated with syenitic rocks of the Deboullie pluton. Biotite and apatite occur within the matrix of the rocks and within small multiphase inclusions hosted by clinopyroxene. The inclusions are interpreted to be crystallized melt inclusions rather than solid inclusions, that were trapped by clinopyroxene during growth. The multiphase inclusions consist of K-feldspar + quartz + biotite + apatite + magnetite. On a regional scale, biotite compositions from granitic plutons in Maine do not vary in a systematic manner. -from Authors

  9. Associated terrestrial and marine fossils in the late-glacial Presumpscot Formation, southern Maine, USA, and the marine reservoir effect on radiocarbon ages

    Science.gov (United States)

    Thompson, W.B.; Griggs, C.B.; Miller, N.G.; Nelson, R.E.; Weddle, T.K.; Kilian, T.M.

    2011-01-01

    Excavations in the late-glacial Presumpscot Formation at Portland, Maine, uncovered tree remains and other terrestrial organics associated with marine invertebrate shells in a landslide deposit. Buds of Populus balsamifera (balsam poplar) occurred with twigs of Picea glauca (white spruce) in the Presumpscot clay. Tree rings in Picea logs indicate that the trees all died during winter dormancy in the same year. Ring widths show patterns of variation indicating responses to environmental changes. Fossil mosses and insects represent a variety of species and wet to dry microsites. The late-glacial environment at the site was similar to that of today's Maine coast. Radiocarbon ages of 14 tree samples are 11,907??31 to 11,650??5014C yr BP. Wiggle matching of dated tree-ring segments to radiocarbon calibration data sets dates the landslide occurrence at ca. 13,520+95/??20calyr BP. Ages of shells juxtaposed with the logs are 12,850??6514C yr BP (Mytilus edulis) and 12,800??5514C yr BP (Balanus sp.), indicating a marine reservoir age of about 1000yr. Using this value to correct previously published radiocarbon ages reduces the discrepancy between the Maine deglaciation chronology and the varve-based chronology elsewhere in New England. ?? 2011 University of Washington.

  10. Dating slate belts using 40Ar/39Ar geochronology and zircon ages from crosscutting plutons: A case study from east-central Maine, USA

    Science.gov (United States)

    Ghanem, Hind; Kunk, Michael J.; Ludman, Allan; Bish, David L.; Wintsch, Robert P.

    2016-12-01

    We report the ages of cleavage development in a normally intractable lower greenschist facies slate belt, the Central Maine-Aroostook-Matapedia belt in east-central Maine. We have attacked this problem by identifying the minimum ages of muscovite in a regional Acadian cleavage (S1) and in a local ductile fault zone cleavage (S2) using 40Ar/39Ar geochronology and the ages of crosscutting plutons. Our success stems from the regional low-grade metamorphism of the rocks in which each crystallization event preserves a40Ar/39Ar crystallization age and not a cooling age. Evidence for recrystallization via a pressure solution mechanism comes from truncations of detrital, authigenic, and in some rocks S1 muscovite and chlorite grains by new cleavage-forming muscovite and chlorite grains. Low-blank furnace age spectra from meta-arkosic and slaty rocks climb from moderate temperature Devonian age-steps dominated by cleavage-forming muscovite to Ordovician age-steps dominated by a detrital muscovite component. S1- and S2-cleaved rocks were hornfelsed by granitoids of ∼407 and 377 Ma, respectively. The combination of these minimum ages with the maximum metamorphic crystallization ages establishes narrow constraints on the timing of these two cleavage-forming events, ∼410 Ma (S1) and ∼380 Ma (S2). These two events coincide in time with a change in the plate convergence kinematics from the arrival of the Avalon terrane (Acadian orogeny), to a right-lateral transpression arrival of the Meguma terrane in the Neoacadian orogeny.

  11. Aborto, abandono, y la muerte de Augusta García Platas en Ayacucho, Perú, 1946

    OpenAIRE

    Raúl Necochea López

    2016-01-01

    Resumen Augusta García Platas murió tras un aborto clandestino en Ayacucho en 1946. Este ensayo, basado en materiales del Archivo Histórico de Ayacucho, da cuenta del proceso criminal que se abrió para determinar los responsables de su muerte. A pesar de que sindicaron a ciertos individuos como culpables directos de provocar el aborto, las autoridades judiciales consideraban que la causa de fondo de la muerte de la joven había sido el abandono por parte de quienes debían velar por su salud fí...

  12. Spatial and diurnal distribution of invertebrate and fish fauna of a Zostera marina bed and nearby unvegetated sediments in Damariscotta River, Maine (USA)

    Science.gov (United States)

    Mattila, Johanna; Chaplin, Glen; Eilers, Michele R.; Heck, Kenneth L.; O'Neal, Jonathan P.; Valentine, John F.

    1999-06-01

    Fish, epibenthos and macroinfauna were collected in a Zostera marina bed and nearby unvegetated sediments in the estuary of the Damariscotta River, on the mid-coast of Maine. Samples of epibenthic fauna and fish were collected at low tides both during day and night, and samples of infauna at low tides during the day. The mean density of Zostera shoots in the study area was 335 m -2. Abundance and species number of fish were greater at night than during the day and greater in eelgrass beds ( Z. marina) than in unvegetated habitats. Daytime fish collections were dominated by Atlantic silversides ( Medinia medinia), while juvenile winter flounder ( Pseudopleuronectes americanus) dominated night collections. Also Zostera-associated epifaunal abundances and number of species were significantly higher at night than during the day. Mysis stenolepis, Idotea balthica and Littorina obtusata were dominant species in the epifauna samples. Of the total of 37 invertebrate species encountered, only five occurred both in the infaunal and epifaunal samples. Nineteen different taxa were collected from the benthic core samples. The most abundant invertebrate infaunal taxa were sipunculids, the polychaete Nereis virens, and oligochaetes. Infaunal invertebrate abundances and species diversity were significantly higher in eelgrass beds than in unvegetated sediments. The abundance and number of species of benthic invertebrates were also positively correlated to seagrass biomass. Community diversity values ( H') were relatively low but fit well in the general pattern of decreasing diversity towards northern latitudes.

  13. Parameterization of the InVEST Crop Pollination Model to spatially predict abundance of wild blueberry (Vaccinium angustifolium Aiton) native bee pollinators in Maine, USA

    Science.gov (United States)

    Groff, Shannon C.; Loftin, Cynthia S.; Drummond, Frank; Bushmann, Sara; McGill, Brian J.

    2016-01-01

    Non-native honeybees historically have been managed for crop pollination, however, recent population declines draw attention to pollination services provided by native bees. We applied the InVEST Crop Pollination model, developed to predict native bee abundance from habitat resources, in Maine's wild blueberry crop landscape. We evaluated model performance with parameters informed by four approaches: 1) expert opinion; 2) sensitivity analysis; 3) sensitivity analysis informed model optimization; and, 4) simulated annealing (uninformed) model optimization. Uninformed optimization improved model performance by 29% compared to expert opinion-informed model, while sensitivity-analysis informed optimization improved model performance by 54%. This suggests that expert opinion may not result in the best parameter values for the InVEST model. The proportion of deciduous/mixed forest within 2000 m of a blueberry field also reliably predicted native bee abundance in blueberry fields, however, the InVEST model provides an efficient tool to estimate bee abundance beyond the field perimeter.

  14. Characterization of concrete from Roman theatre and amphitheater in Emerita Augusta (Mérida, Spain)

    Science.gov (United States)

    Mota-Lopez, Maria Isabel; Fort, Rafael; Alvarez de Buergo, Monica; Pizzo, Antonio; Maderuelo-Sanz, Ruben; Meneses-Rodríguez, Juan Miguel

    2016-04-01

    The restoration of historical buildings is very important for the history and culture of the cities and their population. It requires an advanced knowledge of the building materials used for the construction of these structures. Previously to any intervention in historical buildings, it is necessary a historic-scientific study of the original material. Historic mortars or concretes can reveal us different composition and the dependence on the geographical location and the time period of its construction. Historical concretes are complex systems that contain aerial or hydraulic binders or a blend of them, with aggregates, not always crystalline, and others elements that interact with the binder. The use of different techniques for microstructural characterization of materials, like optical microscopy, X-ray diffractometry or petrophysical analysis, allows the determination of the composition and some properties of these concretes. However, each technique has its own limits and, in many cases, several characterization techniques must be used to obtain coherent and reliable results. The present study focuses on the compositional characterization of Roman concrete from Roman buildings for public spectacles of Emerita Augusta, Mérida, Spain. An advanced knowledge of the Roman concrete composition is required to get a reliable restoration and preservation of these ancient monuments. Various samples of concrete were extracted from different zones from this archaeological site. The concrete was studied through mineralogical analysis (petrographic microscope and XRD) and petrophysical properties determination (bulk and real density, open porosity, mercury porosimetry intrusion, compressive strength and Ultrasound propagation velocity). The results obtained allow us to know the original composition of the concrete and the provenance of the aggregates used in it. Acknowledgements: Community of Madrid for financing Geomateriales2 program (P2013/MIT2914), to the funding

  15. Anthropogenic and natural lead isotopes in Fe-hydroxides and Fe-sulphates in a watershed associated with arsenic-enriched groundwater, Maine, USA

    Science.gov (United States)

    Ayuso, Robert A.; Foley, Nora K.

    2008-01-01

    A survey of the natural and anthropogenic sources of lead contributing to secondary minerals in sulphidic schists associated with arsenic-enriched groundwater in Coastal Maine shows that the most likely source is natural Pb, particularly from coexisting sulphide minerals. The secondary minerals also reflect notable contributions from anthropogenic Pb. The Pb isotopes establish pathways by which Pb, and by inference As, could have been transported from As-bearing minerals (arsenian pyrite, arsenopyrite, lollingite, orpiment, arsenic oxide and others), via sulphide oxidation or carbonation reactions into multiple generations of secondary minerals (goethite, hematite, jarosite, natrojarosite and others). Lead isotopic compositions of the sulphides and secondary minerals determined by thermal ionization mass spectrometry (n=53) range widely. Lead and As contents of the sulphides and secondary minerals overlap, and are generally positively correlated. Pyrite, the dominant sulphide in sulphidic schists associated with As-enriched groundwater in Coastal Maine, has values of 206Pb/204Pb from 18.186 to 18.391, 207Pb/204Pb from 15.617 to 15.657, 208Pb/204Pb from 38.052 to 38.210, 206Pb/207Pb from c. 1.1625 to 1.1760 and 208Pb/207Pb from c. 2.4276 to 2.4394. Mixtures of Fe-hydroxide and oxide minerals (predominantly goethite and hematite) and secondary Fe-sulphate minerals (jarosite, natrojarosite, rozenite and melanterite) in the sulphidic schists have overlapping but generally higher values of 206Pb/204Pb from 18.495 to 19.747 (one sample at 21.495), 207Pb/204Pb from 15.595 to 15.722 (one sample at 15.839), 208Pb/204Pb from 38.186 to 39.162,206Pb/207Pb from c.1.1860 to 1.2575 (one sample at 1.3855) and 208Pb/207Pb from c. 2.4441 to 2.4865 than the sulphides. Sulphides from Zn-Pb metal mines are somewhat less radiogenic than sulphides from the schists. Other sulphides (mostly pyrite) associated with pegmatites and granitic rocks are heterogeneous and more

  16. More than a century of bathymetric observations and present-day shallow sediment characterization in Belfast Bay, Maine, USA: implications for pockmark field longevity

    Science.gov (United States)

    Brothers, Laura L.; Kelley, Joseph T.; Belknap, Daniel F.; Barnhardt, Walter A.; Andrews, Brian D.; Maynard, Melissa Landon

    2011-01-01

    Mechanisms and timescales responsible for pockmark formation and maintenance remain uncertain, especially in areas lacking extensive thermogenic fluid deposits (e.g., previously glaciated estuaries). This study characterizes seafloor activity in the Belfast Bay, Maine nearshore pockmark field using (1) three swath bathymetry datasets collected between 1999 and 2008, complemented by analyses of shallow box-core samples for radionuclide activity and undrained shear strength, and (2) historical bathymetric data (report and smooth sheets from 1872, 1947, 1948). In addition, because repeat swath bathymetry surveys are an emerging data source, we present a selected literature review of recent studies using such datasets for seafloor change analysis. This study is the first to apply the method to a pockmark field, and characterizes macro-scale (>5 m) evolution of tens of square kilometers of highly irregular seafloor. Presence/absence analysis yielded no change in pockmark frequency or distribution over a 9-year period (1999–2008). In that time pockmarks did not detectably enlarge, truncate, elongate, or combine. Historical data indicate that pockmark chains already existed in the 19th century. Despite the lack of macroscopic changes in the field, near-bed undrained shear-strength values of less than 7 kPa and scattered downcore 137Cs signatures indicate a highly disturbed setting. Integrating these findings with independent geophysical and geochemical observations made in the pockmark field, it can be concluded that (1) large-scale sediment resuspension and dispersion related to pockmark formation and failure do not occur frequently within this field, and (2) pockmarks can persevere in a dynamic estuarine setting that exhibits minimal modern fluid venting. Although pockmarks are conventionally thought to be long-lived features maintained by a combination of fluid venting and minimal sediment accumulation, this suggests that other mechanisms may be equally active in

  17. Construction of the Vinalhaven Intrusive Complex, Maine, USA: the Plutonic Record of Evolving Magma Chambers Affected by Multiple Episodes of Replenishment, Rejuvenation, Crystal Accumulation and Eruption

    Science.gov (United States)

    Wiebe, R. A.; Hawkins, D. P.

    2004-12-01

    Increasingly, the plutonic roots of volcanic systems can be shown to contain temporal records of events inferred from the study of volcanic rocks. The Vinalhaven intrusive complex preserves evidence for multiple episodes of silicic and mafic replenishments, rejuvenation of granite, and probable eruptive events over a nominal time-span of 1.7 Ma (Hawkins and Wiebe, this volume). The complex is about 12 km in diameter and consists mainly of cg granite, a thick section of arcuate, inward-dipping gabbro-diorite sheets in the southeastern half of the complex, and a circular core of fg granite. Field relations demonstrate that the base of the intrusion is along the southeastern margin of the complex, and the top is along the northwestern margin where it intrudes coeval volcanic rocks. Aphyric basaltic and granitic dikes fed this essentially bimodal intrusion. When basaltic dikes intersected a silicic chamber, basalt spread across a floor of silicic crystal mush to form gabbro-diorite sheets in granite. Several extensive layers of angular blocks of country rock occur within the mafic rocks. Granitic dikes and the fg granitic core of the complex have sharp to gradational contacts with cg granite, and, locally, both granites are intimately mixed and commingled. These relations indicate that new silicic injections mixed into partly crystallized resident magma. Several irregular bodies of porphyry (0.2 to 0.5 km in average dimension) intrude cg granite with sharp, gradational, or commingled contacts. The porphyry has 5 to 40% corroded phenocrysts, identical in composition to crystals in the granite, and a variably quenched matrix. Some of these bodies formed when late injections of basalt remelted largely solid portions of cg granite. New silicic input may have contributed to other porphyry bodies. The matrix probably quenched because of a sudden decrease in pressure, possibly due to eruption of magma from the chamber. The cg granite and inter-layered mafic rocks preserve a

  18. Programas de investigación en el Museo Nacional de Arte Romano: proyectos Foros de Augusta Emerita y Lusitania Romana

    Directory of Open Access Journals (Sweden)

    Nogales Basarrate, Trinidad

    2006-02-01

    Full Text Available This paper, taking as its starting point deficient position Museums find themselves in the course of their research activity, analyses two projects developed by the National Museum of Roman Art (MNAR. Both of these reflect two of the priority research avenues. First, the Foros de Augusta Emerita project is based on one of the Museum´s most important archaeological excavation and the corresponding exhibition discourse, and the results have aroused the interest of the international research community due to the evident link with Rome. Secondly, the Roman Lusitania programme aims to enlarge the scope from Augusta Emerita out in the colony´s sphere of influence.Este artículo, partiendo de la situación deficiente en que los Museos ejercitan su labor investigadora, analiza dos proyectos desarrollados desde el Museo Nacional de Arte Romano (MNAR. Ambos son reflejo de dos de sus líneas prioritarias de investigación. Por un lado, el proyecto Foros de Augusta Emerita se sustenta en uno de los trabajos de intervención arqueológica y discurso expositivo más importantes del MNAR, cuyos resultados han movido el interés de la comunidad científica internacional por sus evidentes conexiones con Roma. Por otra parte, el programa Lusitania Romana pretende ampliar las líneas científicas desde Augusta Emerita en relación con su territorio de influencia.

  19. Roman money boxes in pottery. A discovery in a grave from Augusta Emerita (Mérida, Badajoz

    Directory of Open Access Journals (Sweden)

    Ana María BEJARANO OSORIO

    2016-12-01

    Full Text Available In this work, a funerary deposit found in a female burial in Augusta Emerita (Mérida, Badajoz is analyzed. The location of this cremation has occurred during a recent excavation in one of the most important funerary areas of the city, in the southern area bordering the ancient Roman colony.Besides the interest offered by the tomb itself, it is important the appearance of an unusual funerary deposit. Therefore, we first pressent an overview that allows us to assess the continued use of all this funerary area. Our work has also focused on the detailed study of the funeral grave itself. We discuss a money box that was part of the deposit. Since it is a rara avis in the Spanish ceramic utensils, apropos of this finding, a typological and functional reflection of such parts in the Roman Empire is done.

  20. Aborto, abandono, y la muerte de Augusta García Platas en Ayacucho, Perú, 1946

    Directory of Open Access Journals (Sweden)

    Raúl Necochea López

    Full Text Available Resumen Augusta García Platas murió tras un aborto clandestino en Ayacucho en 1946. Este ensayo, basado en materiales del Archivo Histórico de Ayacucho, da cuenta del proceso criminal que se abrió para determinar los responsables de su muerte. A pesar de que sindicaron a ciertos individuos como culpables directos de provocar el aborto, las autoridades judiciales consideraban que la causa de fondo de la muerte de la joven había sido el abandono por parte de quienes debían velar por su salud física y moral. Este caso nos brinda la oportunidad de esclarecer las estrategias que los implicados usaban para defenderse de acusaciones criminales. Además, nos ayuda a entender las diversas deficiencias del Poder Judicial peruano de mediados del siglo XX.

  1. In quodam libro Graeco: The Use and Citation of Greek Sources by the ‘Authors’ of the Historia Augusta

    Directory of Open Access Journals (Sweden)

    Gregor Pobežin

    2010-07-01

    Full Text Available The enigmatic collection of imperial vitae ranging from the emperor Hadrian to Carinus, spanning a period of some 170 years, has long been subject to detailed scrutiny. Dubbed Historia Augusta by Isaac Casaubon in 1603, this historical document has been recognised to be anything but historical, and therefore hardly deserves to be treated by historians as a viable document – or at least this appears to be the position held by mainstream scholars on the subject. While there are still historians who maintain that the vitae were forged by several different authors, if not exactly six as purported in the work itself, the widespread thesis is that this ‘mockumentary’ was produced by one person only, but there is little agreement on the question when. However, there remain issues which, after careful examination, admonish us that even the well-accepted one-author theory is anything but airtight, one of them being the issue of the sources, their collection and implementation in the actual narrative. Several cited documents, such as letters, senatorial decrees etc., have been proved as forgeries, but the author(s went out of their way to cloak them in a veil of fake certainty; one such instance is the cited report on the inauguration of Marcus Claudius Tacitus. On the other hand, there are several completely vague references to some Greek book – quidam liber Graecus, which must arouse the reader’s suspicion. While this article does nothing to contest the one-author theory, it raises questions: Why, so late in the work, this change of approach in citing sources? Why not furnish the cited ‘documents’ with fabricated names?

  2. Contributions of non-destructive testing for determining the provenance of the granites used in the Roman Amphitheatre from Emerita Augusta, Badajoz, Spain.

    Science.gov (United States)

    Mota, M. Isabel; Alvarez de Buergo, Monica; Fort, Rafael; Pizzo, Antonio

    2015-04-01

    The Archaeological Ensemble of Emérita Augusta (Mérida, Badajoz, Spain) was listed a World Heritage Site in 1993 by UNESCO. One of the monuments that belongs to this Archaeological Ensemble is the Roman amphitheatre, mainly built with granite from quarries located near the city. Every urban centre in the Roman Empire, in addition to many rural sites, had one or more local quarries from which they extracted the bulk of their stone. In Mérida, there are a group of documented quarries located near the ancient city. In this work the authors have been investigating five of these documented outcrops which, due the distance from the monument or the existence of ancient Roman routes of communication with the city, can be the possible original quarries. The provenance of these materials with which the monument is built is of significant interest in terms of the restoration and conservation and from a historical point of view of the monument. Nowadays, there are many examples of identification of the original quarries that use destructive procedures and techniques which are based on the physical, petrographical, geochemical, magnetic or mechanical properties that are a function of the mineralogical and textural characteristics of the rock. In this work, the combined use of two non-destructive and on-site techniques, ultrasonic velocity and surface hardness determined with a Schmidt hammer rebound tester, allows to determine first, the quality and degree of decay in the granites, usually affecting the material surface and consisting of a decline in surface cohesion, and second, it can discriminate possible provenance areas of the rock used in the building. These two techniques are very useful for this purpose for several reasons. Their combined use allows the selection of the most representative blocks and ashlars for sampling. This reduces sampling to a minimum showing representative results for the whole building, especially in the case of performing ageing tests in the

  3. Augusta Emérita. La investigación arqueológica en una ciudad de época romana

    Directory of Open Access Journals (Sweden)

    Mateos Cruz, Pedro

    2001-12-01

    Full Text Available This article is an ample summary of the recent archaeological results developed in the last years in the roman colony of Augusta Emerita (modern Mérida, Spain. Recent systematic research has change many old views and statements about the urbanistic development of the roman colony as a result of the new scientific proyects undetaken recently, that offer a new undestanding of the evolution of Mérida during the Roman period.En este artículo se plantea la evolución del conocimiento de la ciudad romana de Emerita Augusta a partir de las investigaciones desarrolladas por historiadores y arqueólogos en los últimos años. Con ellas se han puesto en duda argumentos cerrados secularmente, sugiriendo, al menos, una imagen ciudadana distinta a la supuesta hasta ahora, con una fisonomía urbana resultado de variados proyectos, y con procesos y ciclos que, aunque en ocasiones no acertamos a situar o valorar correctamente, ayudan a entender cómo se conformó el devenir y la evolución de Mérida en época antigua.

  4. Assessment of mercury exposure in human populations: A status report from Augusta Bay (southern Italy).

    Science.gov (United States)

    Bonsignore, Maria; Andolfi, Nunzia; Barra, Marco; Madeddu, Anselmo; Tisano, Francesco; Ingallinella, Vincenzo; Castorina, Maria; Sprovieri, Mario

    2016-10-01

    Here we investigate mercury concentrations in the blood (HgB), urine (HgU) and human hair (HgH) of 224 individuals from a coastal area (Eastern Sicily, SE Italy) strongly affected by Hg contamination from one of the largest chlor-alkali plants in Europe. The factors affecting the distribution of Hg and the extent of the exposure of individuals have been explored with a multidisciplinary approach. Multiple regression analyses, together with evidence of high levels of HgB (exceeding the HBMI recommended levels in 50% of cases) and HgH (exceeding the EPA reference dose in 70% of cases), primarily suggest that the consumption of local fish is the main source of Hg for humans. no. significant exposure to inorganic mercury was identified. Toxicokinetic calculations produced a provisional tolerable weekly intake (PTWI) level that, in most cases, exceeds international recommendations, particularly for residents in the studied area.

  5. Chemotaxonomic significance of flavonoids, coumarins and triterpenes of Augusta longifolia (Spreng. Rehder, Rubiaceae-Ixoroideae, with new insights about its systematic position within the family Significância quimiotaxômica de flavonoides, cumarinas e triterpenos de Augusta longifolia (Spreng. Rehder, Rubiaceae-Ixoroideae, com novos entendimentos sobre a posição sistemática dentro da família

    Directory of Open Access Journals (Sweden)

    Rafael Choze

    2010-07-01

    Full Text Available Augusta has traditionally been placed in the tribe Rondeletieae, subfamily Cinchonoideae. However, recent molecular phylogenies positioned it near to Wendlandia (Ixoroideae, but locate A. longifolia near to the clade Ixoroidinae II. The study of A. longifolia afforded two coumarins, five flavonoids, three triterpenoids and one benzoic acid derivative. These metabolites reinforce the separation of Augusta as a monospecific genus, and Lindenia as a genus of three species, closely related to Wendlandia.Augusta tem sido tradicionalmente colocada na tribo Rondeletieae, Cinchonoideae subfamília. No entanto, recentes filogenias moleculares posicionou-a perto de Wendlandia, porém localizando A. longifolia perto do clado Ixoroidinae II. O estudo de A. longifolia resultou em duas cumarinas, cinco flavonoides, três triterpenoides e um derivado do ácido benzóico. Estes metabolitos reforçam a separação da Augusta como um gênero monoespecífico, e Lindenia como um gênero de três espécies, intimamente relacionada com Wendlandia.

  6. Main Memory

    OpenAIRE

    Boncz, Peter; Liu, Lei; Özsu, Tamer, M.

    2008-01-01

    Primary storage, presently known as main memory, is the largest memory directly accessible to the CPU in the prevalent Von Neumann model and stores both data and instructions (program code). The CPU continuously reads instructions stored there and executes them. It is also called Random Access Memory (RAM), to indicate that load/store instructions can access data at any location at the same cost, is usually implemented using DRAM chips, which are connected to the CPU and other peripherals (di...

  7. MAIN CONTENTS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    The Key to Agricultural Science and Technology Innovation should be placed on the FiveMajor Changes Based on analysis and forecasting on grain consumption influencing factors, production influencing factors and import influencing factors, the supply and demand of main sorts of grain in China is forecas- ted respectively, including paddy, wheat, corn and soybean. In 2020, grain consumption quantity, grain production quantity and grain import quantity of China is 693 million tons, 644 million tons and 49 million tons respectively. For grain security in future, new stratagem on food security should be im- plemented, grain import circumstance and global grain security. Father mechanism should be im- proved, and early warning and regulation on grain production capacity should be paid attention to sys- temically.

  8. Assessment of sediment contamination in Casco Bay, Maine, USA

    Energy Technology Data Exchange (ETDEWEB)

    Wade, Terry L. [Geochemical and Environmental Research Group, Texas A and M University, 833 Graham Road, College Station, TX 77845 (United States); Sweet, Stephen T. [Geochemical and Environmental Research Group, Texas A and M University, 833 Graham Road, College Station, TX 77845 (United States)], E-mail: sweet@gerg.tamu.edu; Klein, Andrew G. [Geography Department, Texas A and M University, 814B Eller O and M Building, College Station, TX 77843 (United States)

    2008-04-15

    The current status of contaminant concentrations in Casco Bay, decadal trends of these contaminants and changes in their geographical distribution are assessed using sediment samples collected approximately 10 years apart. In general, regulated contaminants appeared to be decreasing in concentration. Total PAH and dioxins/furans concentrations did not significantly change over this period. Total organochlorine pesticides, 4,4-DDE, 4,4-DDD, total DDT, PCB, tributyltin and total butyltin decreased in concentration. Trace element concentrations in sediments decreased at the majority of the sampling sites for chromium, nickel, and selenium while arsenic, cadmium, copper, lead, mercury, silver, and zinc remained relatively constant. None of the contaminants measured has increased by more than a factor of 2. Selected sites located in the Inner Bay, where concentrations are higher and new inputs were more likely, showed increased concentrations of contaminants. Most contaminants were not found at concentrations expected to adversely affect sediment biota based on ERL/ERM guidelines. - Sediment studies indicate decadal decreases for many chemical contaminants in Casco Bay.

  9. « Ni bas-bleu, ni pot-au-feu » : la conception de « la » femme selon Augusta Moll-Weiss (France, tournant des XIXe-XXe siècles

    Directory of Open Access Journals (Sweden)

    Sandrine Roll

    2009-12-01

    Full Text Available Cet article analyse les idées et l’œuvre de la directrice de l’École des mères, Augusta Moll-Weiss. Dans le contexte du tournant des XIXe-XXe siècles où l’éloge de la ménagère est un thème récurrent des discours moralisateurs émanant des ouvriers ou des bourgeois, Augusta Moll-Weiss met en place un projet de cours ménagers. Son œuvre offre une approche singulière de ce que des activités reconnues comme typiquement féminines peuvent offrir aux femmes. Loin de former uniquement des « fées du logis », les cours professés à l’École des mères donnent aussi aux élèves la possibilité de se préparer à une carrière professionnelle. Augusta Moll-Weiss imagine alors pléthore de débouchés qui placent les activités « du souci des autres » dans la sphère du travail social. Son engagement en faveur de l’enseignement ménager s’accompagne d’une réflexion sur de nouveaux modèles domestiques susceptibles d’accompagner l’entrée des femmes sur le marché du travail. La rationalisation et le partage sexué des tâches domestiques ainsi que la question du temps partiel sont au cœur de son projet. Aux marges de la philanthropie et du féminisme, Augusta Moll-Weiss s’engage donc dans une stratégie de reconnaissance du rôle des femmes dans l’espace civique. Après avoir présenté l’œuvre scolaire de cette femme, cet article s’intéresse à sa vision de la « Ménagère nouvelle » et à son approche du féminisme.This article explores the ideas and works of the Augusta Moll-Weiss, head of the École des mères. The latter started housewifery lessons at the turn of the 19th century at a moment when public discourse among both working and upper-class reformers sang the praises of the housewife. Her work offered a new approach to these typically feminine activities. Far from training only “angels of the home”, the lessons given at the Mothers’ School also offered students the possibility of

  10. Det sorte USA

    DEFF Research Database (Denmark)

    Brøndal, Jørn

    Bogen gennemgår det sorte USAs historie fra 1776 til 2016, idet grundtemaet er spændingsforholdet mellem USAs grundlæggelsesidealer og den racemæssige praksis, et spændingsforhold som Gunnar Myrdal kaldte "det amerikanske dilemma." Bogen, der er opbygget som politisk, social og racemæssig historie...

  11. Glemmer USA Afghanistan nu?

    DEFF Research Database (Denmark)

    Jakobsen, Peter Viggo

    2015-01-01

    Hvis Obamas efterfølger kan skrue den rigtige strategiske fortælling sammen så vil USA ikke forlade Afghanistan med udgangen af 2016.......Hvis Obamas efterfølger kan skrue den rigtige strategiske fortælling sammen så vil USA ikke forlade Afghanistan med udgangen af 2016....

  12. School Psychology Research and Scholarship: USA Status, International Explorations.

    Science.gov (United States)

    Strein, William; Cramer, Katurah; Lawser, Matthew

    2003-01-01

    Addresses questions regarding research in school psychology by coding all of the articles published from 1994-1998 in the main USA school psychology journals and in "School Psychology International." Assessment-related topics and research on clinical/personality issues dominated the USA literature, while clinical/personality and professional…

  13. USA Hire Testing Platform

    Data.gov (United States)

    Office of Personnel Management — The USA Hire Testing Platform delivers tests used in hiring for positions in the Federal Government. To safeguard the integrity of the hiring processes and ensure...

  14. Loeng USA Sisejulgeolekuministeeriumi kantslerilt

    Index Scriptorium Estoniae

    2005-01-01

    13. okt. pidas USA Sisejulgeolekuministeeriumi teaduse ja tehnoloogia kantsler dr Charles McQueary Tartu Ülikooli Tehnoloogiainstituudis loengu "Uue põlvkonna ettevõtlust suunavad ja julgeolekut edendavad tehnoloogiad"

  15. USA kunstidessant Venemaale

    Index Scriptorium Estoniae

    2007-01-01

    USA kunstnike näitus "Kolm sajandit ameerika kunsti" Moskvas Pushkini muuseumis. Eksponeeritakse Mark Rothko, Jean-Michel Basguiat', Roy Lichtensteini, Robert Rauschenbergi, Georgia O'Keefe'i, Willem de Kooningi töid

  16. La vie au bord de l'eau en moyenne vallée du Guadiana sous le Haut-Empire : occupation du sol et mesure du fleuve sur le territoire d'Augusta Emerita (Mérida, Espagne)

    OpenAIRE

    Gorges, Jean-Gérard

    2007-01-01

    International audience; El Guadiana es uno de los grandes ríos de la Península Ibérica, pero durante mucho tiempo representó un verdadero peligro, en particular en su curso medio, a causa de irregularidades frecuentes y crecidas violentas, origen de numerosas divagaciones de su cauce. Sin embargo, es en una de sus márgenes, frente a un importante vado, que se estableció la colonia de Augusta Emerita, hoy Mérida, capital de la provincia de Lusitania después de su fundación en el 16 aC., y más ...

  17. Baltimaade kunsti turnee USAs

    Index Scriptorium Estoniae

    1998-01-01

    5. nov.-st USA Lõuna-Carolina osariigis Wellington B. Grey galeriis ja Jenkins Fine Art Center's 13 eesti, läti ja leedu kunstniku näitus, mis hakkab kolme aasta jooksul ringlema Ameerikas. Eksponeeritud fotokunst, video, installatsioon, joonistused. Kuraator Peeter Linnap ja Mari Laanemets peavad ettekande näituse avamisega samal ajal toimuval Fotohariduse Ühingu konverentsil

  18. USA-USSR protocol

    CERN Multimedia

    1970-01-01

    On 30 November the USA Atomic Energy Commission and the USSR State Committee for the Utilization of Atomic Energy signed, in Washington, a protocol 'on carrying out of joint projects in the field of high energy physics at the accelerators of the National Accelerator Laboratory (Batavia) and the Institute for High Energy Physics (Serpukhov)'. The protocol will be in force for five years and can be extended by mutual agreement.

  19. Tšarterkool USA-s / Johannes Kiersch

    Index Scriptorium Estoniae

    Kiersch, Johannes

    2001-01-01

    24.-27. mainì 01 toimub Tallinnas EFFE 2001 (European Forum of Freedom in Education) konverents "Haridus tänases kodanikuühiskonnas." Konverentsil esineb ka Witteni Waldorf-pedagoogika Instituudi õppejõud Johannes Kiersch. Lähemalt tema artiklist USA-s populaarsust võitvate tsharterkoolide kohta, mis on riigi- ja erakooli vahevorm

  20. A Brief Analysis of the Main Characters in The Rising of the Moon

    Institute of Scientific and Technical Information of China (English)

    YU Hongbing

    2016-01-01

    《月出》是由格雷戈里夫人于1907年写的一部爱国题材戏剧。它以爱尔兰独立于英国前的一段历史时期为背景。主要人物军士和衣衫褴褛的人之间的对话决定性地改变了戏剧的结局。本文通过分析主要人物军士和衣衫褴褛人的性格特点,意为读者研究《月出》时提供一个深层次的视角。%The Rising of the Moon is a patriotic play written by Lady Augusta Gregory in 1907. It accounts for a time in Irish history prior to independence from Britain. The main characters’ monologues have changed this play into a decisive result. This paper will analyze the features of the main characters in this play, the Sergeant and the Ragged Man. By analyzing the features of characters, this paper will provide a profound understanding for readers to study about the play.

  1. TTÜ ja TÜ osalevad USA armee miljoniprojektides

    Index Scriptorium Estoniae

    2016-01-01

    TTÜ ja TÜ liitusid USA-s tegutseva meditsiinitehnoloogia ettevõtete konsortsiumiga. Nii jõuavad juhtivate Eesti kõrgkoolide teadmised USA armeesse, kes konsortsiumi kaudu innovaatilisi tooteid ja teenuseid sisse ostab

  2. Euroopa teadis USA salavanglaist / Tõnis Erilaid

    Index Scriptorium Estoniae

    Erilaid, Tõnis, 1943-

    2005-01-01

    USA endise välisministri Colin Powelli sõnul pole see tema sõpradele Euroopas uudiseks, et USA on viinud vange riikidesse, kus tema seadused ei kehti. USA praeguse välisministri Condoleezza Rice'i sõnul on USA vange üle kuulanud väljaspool USA-d. USA Today kirjeldab Stare Kiejkuty küla Poolas, kus arvatavasti on olnud salavangla

  3. Pepeljajev eesti näitlejatega USA-s

    Index Scriptorium Estoniae

    2008-01-01

    Sasha Pepeljajevi tantsulavastust "Uksed" etendati USA rahvusvahelisel teatrifestivalil "Arts & Ideas". Vene-Eesti trupi Apparatus lavastus on pühendatud Daniil Harmsi 100. sünniaastapäevale ning põhineb tema töödel

  4. Dengue in Florida (USA

    Directory of Open Access Journals (Sweden)

    Jorge R. Rey

    2014-12-01

    Full Text Available Florida (USA, particularly the southern portion of the State, is in a precarious situation concerning arboviral diseases. The geographic location, climate, lifestyle, and the volume of travel and commerce are all conducive to arbovirus transmission. During the last decades, imported dengue cases have been regularly recorded in Florida, and the recent re-emergence of dengue as a major public health concern in the Americas has been accompanied by a steady increase in the number of imported cases. In 2009, there were 28 cases of locally transmitted dengue in Key West, and in 2010, 65 cases were reported. Local transmission was also reported in Martin County in 2013 (29 cases, and isolated locally transmitted cases were also reported from other counties in the last five years. Dengue control and prevention in the future will require close cooperation between mosquito control and public health agencies, citizens, community and government agencies, and medical professionals to reduce populations of the vectors and to condition citizens and visitors to take personal protection measures that minimize bites by infected mosquitoes.

  5. USA pelgab Hiina tehnoloogialuuret / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2005-01-01

    Hiina Ameerika-vastasest majandusluurest. USA luureameti andmetel on USA-s loodud üle kolme tuhande Hiina firma, kelle ülesandeks on tööstusliku või sõjalise tehnoloogia hankimine. Vt. samas: Hiina firmad ostavad üha suuremaid USA ettevõtteid

  6. Main results of the third international PIV Challenge

    NARCIS (Netherlands)

    Stanislas, M.; Okamoto, K.; Kähler, C.J.; Westerweel, J.; Scarano, F.

    2008-01-01

    This paper presents the main results of the third international PIV Challenge which took place in Pasadena (USA) on the 19th and 20th of September 2005. This workshop was linked to the PIV05 International Symposium held at the same place the same week. The present contribution states the objectives

  7. Turbine main engines

    CERN Document Server

    Main, John B; Herbert, C W; Bennett, A J S

    1965-01-01

    Turbine Main Engines deals with the principle of operation of turbine main engines. Topics covered include practical considerations that affect turbine design and efficiency; steam turbine rotors, blades, nozzles, and diaphragms; lubricating oil systems; and gas turbines for use with nuclear reactors. Gas turbines for naval boost propulsion, merchant ship propulsion, and naval main propulsion are also considered. This book is divided into three parts and begins with an overview of the basic mode of operation of the steam turbine engine and how it converts the pressure energy of the ingoing ste

  8. Maine Field Station

    Data.gov (United States)

    Federal Laboratory Consortium — In 2000 NOAA's National Marine Fisheries Service established the Maine Field Station in Orono, ME to have more direct involvement in the conservation of the living...

  9. 2004 Maine Lidar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This metadata document describes the collection and processing of Light Detection and Ranging (LIDAR) data over an area along the coast of Maine. Data was collected...

  10. FrogwatchUSA

    Science.gov (United States)

    Droege, S.

    2002-01-01

    full text: Frogs and toads are perhaps the most approachable and available of all our wildlife. In many, if not most places, they are abundant. In wetter parts of the East, almost anyone outside on a warm rainy night in spring will hear their dream-like calls, bellows, trills and snores. Even in the deserts of the Southwest, a nocturnal trip after a summer monsoon will yield toads moving across the roads toward a cacophonous orgy of mating and calling in the roadside ditches and desert pools. Birds share with frogs and toads this same sense of presence in our daily lives. But the difference is that birds are like the attractive neighbor who just never gives you the time of day, while frogs are more like the troglodyte who appears regularly to chat, philosophize, and have a beer. Uninvited, frogs appear in our water gardens, toads are on our stoops in the morning, we catch them when we are kids, raise their babies in the aquarium, and feel sorry when we find we have run them over with the lawnmower. When concerns about declining populations of amphibians reached the mass media, the Secretaries' office became involved. In addition to using traditional research mechanisms to investigate the problem, the Secretary also wanted to involve the public directly. The combination of high public appeal and the relative ease with which frog calls can be learned made a large-scale monitoring program for frogs and toads possible. What emerged was a program called Frogwatch USA, modeled after a successful Canadian program with a similar name. A web site was created (www.frogwatch.org) that presented potential frogwatchers with directions and a way to register their site online as well as enter their data. Observers chose where to count frogs depending on what they felt was important. For some it was their backyard, others chose vulnerable wetlands in their neighborhoods, or spots on local refuges and parks. Initially funded at $8,000 a year and then after two years increased to

  11. Borgerrettigheder i USA

    OpenAIRE

    Hansen, Mie; Sommer Olsen, Jaqueline; Andersen, Trine; Madsbøll Møller, Andrea

    2014-01-01

    This project focuses on the civil rights struggle of 1950s through the 1960s in America. The main data which has been used throughout our investigation are Frantz Fanon’s The Wretched on Earth, Eldridge Cleaver’s Soul on Ice, Malcolm X and Alex Haley’s The Autobiography of Malcolm X, Mark Kurlansky’s 1968 – Året, der rystede verden ,and finally David Howard-Pitney’s Martin Luther King Jr., Malcolm X, and the Civil Rights Struggle of the 1950s and 1960s. The main part of the project consist...

  12. The origins of migrations of Albanians in USA

    Directory of Open Access Journals (Sweden)

    Naim Seferi

    2016-07-01

    Full Text Available The Albanians started to migrate in the US at the end of XIX-th century and beginning of XX-th century. The reasons of emigration were the persecutions carried out by Ottoman Empire as well as the Balkan countries which tried to take advantage of the weakening of Ottoman Empire. Migrations were also common from the Balkan countries such as Romania, Bulgaria, and Greece to USA. The migrations of Albanians in the US started very early when they initially emigrated from Albania into various countries and from there they continued their way to USA. In the archives of the USA they were recorded as people of countries from where they were coming, based on the passports issued by the country they migrated to and the Albanians, who were under the occupation of Ottoman empire, would be registered as Ottomans due to their Ottoman documentations whereas the Albanians of Orthodox religion would be registered as Greek in the USA. Main purpose of this study is the analysis of the origins of emigration of Albanians in USA.

  13. Ladybugs of Maine

    Science.gov (United States)

    Color images are presented for the 57 species of Coccinellidae, commonly known as ladybugs, that are documented from Maine. Images are displayed in taxonomic order. Information on each species includes its genus-species name, length, and an actual-size silhouette beside a grid matched to the scale...

  14. Abstracts of Main Essays

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    On Engels'Dialectics of "Theoretical Thinking" Sun Zheng-yu The main significant contribution to Marxist dialectics of Engels is to formulate dialectics on the level of theoretical thinking. This contribution is expressed in three aspects: 1 ) generalizing thoroughly the historical evolution of the way of thinking embodied in science history, philosophy history and human history;

  15. Direct sale in USA

    OpenAIRE

    Koula, Alexandr

    2014-01-01

    This thesis deals with direct sales. The thesis discuss the connection between theoretical part of my personal experience as a door to door sales person in the US, describing a sales process, using a techniques of direct sales and communication skills in practice. It stresses the importance of understanding the basic concepts of personality and communication. The main objective of this work is a suggestion to improve the sales manual for increasing sales success of door to door sales persons ...

  16. Renovating the Main Building

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    CERN's "Main Building" is exactly that. The Organization's central hub, with hundreds of staff and visitors passing through its doors every day, will soon be getting a well-earned facelift. Refurbishment work will proceed in phases, starting with the Salle des Pas Perdus, the concourse between the Council Chamber and the Main Auditorium. By the end of August, informal seating areas will be installed, electronic display panels will provide practical information and improved sound insulation will enhance conditions in the auditoria and surrounding meeting rooms.   In light green the area that will undergo the facelift. Work will start in July. The ground floor is home to the entrance to Restaurant No. 1, the bank, the post office, the travel agent, the Users Office, the Staff Association, the notice boards etc. Step up to the first floor to access CERN's largest lecture theatre, the Council Chamber and its "Pas Perdus" lobby. Everyone who works at or visits CERN i...

  17. Eesti piloodid õpivad USA-s Black Hawkiga lendama

    Index Scriptorium Estoniae

    2011-01-01

    Eesti õhujõudude helikopteripiloodid Rene Kallis ja Martin Noorsalu jäävad pärast väljaõpet kolmeks aastaks USA-sse teenima Marylandi üksuse juurde ning käivad selle aja jooksul ka missioonil Afganistanis

  18. Lodging Update: Portland, Maine

    Directory of Open Access Journals (Sweden)

    Rachel J. Roginsky

    2013-01-01

    Full Text Available Each quarter, Pinnacle Advisory Group prepares an analysis of the New England lodging industry, which provides a regional summary and then focuses in depth on a particular market. These reviews look at recent and proposed supply changes, factors affecting demand and growth rates, and the effects of interactions between such supply and demand trends. In this issue, the authors summarize regional performance for 2012, offer projections for 2013, and spotlight the lodging market in Portland, Maine.

  19. USA presidendivalimistel eristus kolm kandidaati / Aadu Hiietamm

    Index Scriptorium Estoniae

    Hiietamm, Aadu, 1954-

    2008-01-01

    USA presidendivalimiste eelvalimistel jätkavad tihedat rebimist demokraatidest senaatorid Hillary Clinton ja Barack Obama, vabariiklastest tõusis esile senaator John McCain. Vt. samas: USA eelvalimiste kalender

  20. Eesti ja USA sõlmisid kokkuleppe

    Index Scriptorium Estoniae

    2017-01-01

    Kaitseminister Margus Tsahkna ja Ameerika Ühendriikide suursaadik Eestis James Melville allkirjastasid Eesti ja USA kaitsekoostöö kokkuleppe, mis hakkab reguleerima Eestis viibivate USA relvajõudude liikmete, nende pereliikmete ja lepinglaste õiguslikku staatust

  1. Impact of OPEC Policies over the Global Economy: Case of USA

    Directory of Open Access Journals (Sweden)

    Ameer Mahdi Nassrullah Mzwri

    2016-12-01

    Full Text Available This article is focused on how OPEC policies have historically shaped global economic outlook; with a case example of United States of America (USA. The main aim of this study is to reflect the role of USA in strengthening of global economy using OPEC’s policies as the frontline mechanism and demonstrate an understanding of the key challenges confronted by world economies (especially emerging countries by OPEC policies influenced by the super-power USA. This also mentions how USA has made efforts in reducing its overdependence on OPEC for oil, and how it aims to preserve and enhance national resources so as to gain oil independence. The study is directed using mixed methodologies to examine how the consequences of OPEC policies are helping shape world economies, especially of the USA since it does not have very good relations with the OPEC member states in particular.

  2. USA panustab keskkonda / Jeffrey Goldstein

    Index Scriptorium Estoniae

    Goldstein, Jeffrey

    2007-01-01

    USA uus energiapoliitika kava näeb ette bensiini tarbimise vähendamist järgneva 10 aasta jooksul 20%, mis omakorda vähendab ameeriklaste autodest eralduva süsihappegaasi heitmete kasvu ning vähendab sõltuvust naftast

  3. Megainvesteering USA terasekompaniilt / Andres Reimer

    Index Scriptorium Estoniae

    Reimer, Andres

    2000-01-01

    USA kompanii RUMA toob tänavu Muuga sadamasse ülisuure, ligi 2,2 miljardi kroonise välisinvesteeringu teraseterminali näol. Tabel: Välisinvesteeringute TOP 10. Ilmunud ka: Delovõje Vedomosti 29. märts lk. 4

  4. Sõda, mille USA on juba kaotanud / Mart Helme

    Index Scriptorium Estoniae

    Helme, Mart, 1949-

    2003-01-01

    USA pole suutnud Iraagi-vastase sõja vajalikkust põhjendada, arvavad paljud USA poliitikavaatlejad. Rängaks diplomaatiliseks eksimuseks peetakse USA kaitseministri Donald Rumsfeldi avaldust, et USA ei vaja kellegi abi sõjas

  5. 77 FR 6587 - Startek USA, Inc. Alexandria, LA; Startek USA, Inc., Collinsville, VA; Amended Certification...

    Science.gov (United States)

    2012-02-08

    ... Employment and Training Administration Startek USA, Inc. Alexandria, LA; Startek USA, Inc., Collinsville, VA..., applicable to workers of StarTek USA, Inc., Alexandria, Louisiana. The workers are engaged in the supply of..., Virginia location of StarTek USA, Inc. supplied call center services such as sales and technical...

  6. Uranium and radon in private bedrock well water in Maine: geospatial analysis at two scales

    Science.gov (United States)

    Yang, Qiang; Smitherman, Paul; Hess, C.T.; Culbertson, Charles W.; Marvinney, Robert G.; Zheng, Yan

    2014-01-01

    In greater Augusta of central Maine, 53 out of 1093 (4.8%) private bedrock well water samples from 1534 km2 contained [U] >30 μg/L, the U.S. Environmental Protection Agency’s (EPA) Maximum Contaminant Level (MCL) for drinking water; and 226 out of 786 (29%) samples from 1135 km2 showed [Rn] >4,000 pCi/L (148 Bq/L), the U.S. EPA’s Alternative MCL. Groundwater pH, calcite dissolution and redox condition are factors controlling the distribution of groundwater U but not Rn due to their divergent chemical and hydrological properties. Groundwater U is associated with incompatible elements (S, As, Mo, F, and Cs) in water samples within granitic intrusions. Elevated [U] and [Rn] are located within 5–10 km distance of granitic intrusions but do not show correlations with metamorphism at intermediate scales (100−101 km). This spatial association is confirmed by a high-density sampling (n = 331, 5–40 samples per km2) at local scales (≤10–1 km) and the statewide sampling (n = 5857, 1 sample per 16 km2) at regional scales (102–103 km). Wells located within 5 km of granitic intrusions are at risk of containing high levels of [U] and [Rn]. Approximately 48 800–63 900 and 324 000 people in Maine are estimated at risk of exposure to U (>30 μg/L) and Rn (>4000 pCi/L) in well water, respectively.

  7. Uranium and radon in private bedrock well water in Maine: geospatial analysis at two scales.

    Science.gov (United States)

    Yang, Qiang; Smitherman, Paul; Hess, C T; Culbertson, Charles W; Marvinney, Robert G; Smith, Andrew E; Zheng, Yan

    2014-04-15

    In greater Augusta of central Maine, 53 out of 1093 (4.8%) private bedrock well water samples from 1534 km(2) contained [U] >30 μg/L, the U.S. Environmental Protection Agency's (EPA) Maximum Contaminant Level (MCL) for drinking water; and 226 out of 786 (29%) samples from 1135 km(2) showed [Rn] >4,000 pCi/L (148 Bq/L), the U.S. EPA's Alternative MCL. Groundwater pH, calcite dissolution and redox condition are factors controlling the distribution of groundwater U but not Rn due to their divergent chemical and hydrological properties. Groundwater U is associated with incompatible elements (S, As, Mo, F, and Cs) in water samples within granitic intrusions. Elevated [U] and [Rn] are located within 5-10 km distance of granitic intrusions but do not show correlations with metamorphism at intermediate scales (10(0)-10(1) km). This spatial association is confirmed by a high-density sampling (n = 331, 5-40 samples per km(2)) at local scales (≤10(-1) km) and the statewide sampling (n = 5857, 1 sample per 16 km(2)) at regional scales (10(2)-10(3) km). Wells located within 5 km of granitic intrusions are at risk of containing high levels of [U] and [Rn]. Approximately 48 800-63 900 and 324 000 people in Maine are estimated at risk of exposure to U (>30 μg/L) and Rn (>4000 pCi/L) in well water, respectively.

  8. USA andis Gruusiale vastakaid signaale / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2008-01-01

    USA välisministri Condoleezza Riceþi saabumisest Thbilisisse, et avaldada Gruusiale toetust. USA poolt antud soovitustest Gruusia president Mihhail Saakashvilile mitte jõudu kasutada ega alluda Venemaa provokatsioonidele ning hoiatustest sõjalise konflikti tagajärgede eest. USA analüütikute arvamusi

  9. USA suursaadikuga Tallinna lahel / Katrin Kruss

    Index Scriptorium Estoniae

    Kruss, Katrin

    2007-01-01

    USA suursaadik Stanley Davis Phillips oma haridusteest, perekonnast, armastusest mere vastu, panusest isa Earl Phillipsi mööbliäri laiendamisse, golfiharrastusest, suursaadikute ettevalmistusest USA-s, suursaadiku residentsist Pirital ning uue saatkonnahoone otsingutest Tallinnas. Lisa: Stanley Davis Phillips

  10. USA kaitsetollide vastu / Joseph E. Stiglitz

    Index Scriptorium Estoniae

    Stiglitz, Joseph E.

    2002-01-01

    USA poolt tollide kehtestamine imporditavale terasele on põhjustanud protesti. Riigid, eriti Euroopas, mis on võimelised USA-le vastu hakkama, peavad seda tegema nüüd. Karmide abinõude tarvitusele võtmine on nii nende kui ka USA huvides

  11. Abstracts of Main Essays

    Institute of Scientific and Technical Information of China (English)

    Feng Zi-yi

    2011-01-01

    On Deepening the Research on the Law of the Social Horizontal Development Feng Zi-yi The further development of globalization makes it urgent to deepen the research on the law of social hori- zontal development. Historical development of human society has experienced periods of isolation, multi-cen- ter, and globalization, while the truly horizontal development began from modernity. This kind of development is driven mainly by the logic of capital. The transforming process of capital, from dominating the whole process of economic development toward all aspects of social life, and from dominating nations toward the whole world, is also the logical process of capital pursuing itself and the process of social horizontal and wholly development as well. Horizontal and vertical developments of the society are interacting always. Researching on the law of social horizontal development is important for us to adapt to the historical trend consciously, to grasp the logic of capital rationally and to choose the right road of development.

  12. Main Oxidizer Valve Design

    Science.gov (United States)

    Addona, Brad; Eddleman, David

    2015-01-01

    A developmental Main Oxidizer Valve (MOV) was designed by NASA-MSFC using additive manufacturing processes. The MOV is a pneumatically actuated poppet valve to control the flow of liquid oxygen to an engine's injector. A compression spring is used to return the valve to the closed state when pneumatic pressure is removed from the valve. The valve internal parts are cylindrical in shape, which lends itself to traditional lathe and milling operations. However, the valve body represents a complicated shape and contains the majority of the mass of the valve. Additive manufacturing techniques were used to produce a part that optimized mass and allowed for design features not practical with traditional machining processes.

  13. 77 FR 43023 - Approval and Promulgation of Air Quality Implementation Plans; Connecticut, Maine, Massachusetts...

    Science.gov (United States)

    2012-07-23

    ..., Department of Environmental Protection, First Floor of the Tyson Building, Augusta Mental Health Institute... international pollution abatement. EPA is proposing to conditionally approve the submittals from all four states... program, as well as (D)(ii), which relates to interstate and international pollution...

  14. 76 FR 73955 - Approval and Promulgation of Air Quality Implementation Plans; Maine; Regional Haze

    Science.gov (United States)

    2011-11-29

    ... Control, Department of Environmental Protection, First Floor of the Tyson Building, Augusta Mental Health... (CAIR) and the Cross-State Air Pollution Rule (CSAPR) to the regional haze requirements? A. Overview of... 2.5 can also cause serious health effects and mortality in humans and contributes to...

  15. 77 FR 63228 - Approval and Promulgation of Air Quality Implementation Plans; Connecticut, Maine, Massachusetts...

    Science.gov (United States)

    2012-10-16

    ..., Department of Environmental Protection, First Floor of the Tyson Building, Augusta Mental Health Institute... New Hampshire for section 110(a)(2)(D)(ii) related to interstate and international pollution abatement...)(ii), which relates to interstate and international pollution abatement. Notwithstanding...

  16. 10 aastat USA-Balti hartat

    Index Scriptorium Estoniae

    2008-01-01

    10 aasta möödumisest 16. jaanuaril 1998 Valges Majas toimunud tseremooniast kui Ameerika Ühendriikide, Leedu, Läti ja Eesti presidendid allkirjastasid USA-Balti partnerlusharta. Eesti, Läti, Leedu presidentide ühisavaldusest - "ajalooline poliitiline teetähis Balti-USA riikide suhtes", tähistamaks USA-Balti partnerlusharta 10. aastapäeva. President George W. Bushi õnnitlusest Eesti, Läti ja Leedu elanikele harta 10. aastapäeva puhul\\

  17. USA otsib Iraanist aktiivselt tuumainfot / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Iraan avaldas protesti USA luurelendude üle Iraani kohal. USA endine kaitseminister James Baker peab Iraani ja Põhja-Koreaga nende tuumaprogrammide hävitamiseks sõja alustamist suurimaks veaks. Kuigi Bushi meeskond rõhutab vajadust lahendada küsimus rahumeelselt, toovad Dick Cheney' ja Condoleezza Rice'i avaldused mitme USA kommentaatori arvates meelde Iraagi sõja eelse taktika

  18. Eesti on USA uus lemmik / Argo Ideon

    Index Scriptorium Estoniae

    Ideon, Argo, 1966-

    2007-01-01

    President Toomas Hendrik Ilvese visiidist Washingtoni, kohtumistest USA presidendi George W. Bushi, asepresident Dick Cheney, asevälisminister John Negroponte, kaitseminister Robert M. Gates'i, USA Kongressi esindajatekoja spiikri Nancy Pelosi ja kongresmenidega. Eestil õnnestus korraldada USA pealinnas kohtumised, mille järjekorras ootab hulk palju suuremaid riike. Vabariigi President töövisiidil Ameerika Ühendriikides 25.-26.06.2007

  19. Virginia Tech's Ashley White named to USA Today All-USA First Team

    OpenAIRE

    Crumbley, Liz

    2005-01-01

    Virginia Tech senior Ashley White, a University Honors student pursuing degrees in both materials science and engineering and music performance, has been named to USA Today's All-USA College Academic First Team.

  20. Forensic entomology and main challenges in Brazil.

    Science.gov (United States)

    Gomes, Leonardo; Von Zuben, Cláudio J

    2006-01-01

    Apart from an early case report from China (13th century), the first observations on insects and other arthropods as forensic indicators were documented in Germany and France during mass exhumations in the 1880s by Reinhard, who is considered a co-founder of the discipline. After the French publication of Mégnin's popular book on the applied aspects of forensic entomology, the concept quickly spread to Canada and United States. At that time, researchers recognized that the lack of systematic observations of insects of forensic importance jeopardized their use as indicators of postmortem interval. General advances in insect taxonomy and ecology helped to fill this gap over the following decades. After World Wars, few forensic entomology cases were reported in the scientific literature. From 1960s to the 1980s, Leclercq and Nuorteva were primarily responsible for maintaining the method in Central Europe, reporting isolated cases. Since then, basic research in the USA, Russia and Canada opened the way to the routine use of Entomology in forensic investigations. Identifications of insects associated with human cadavers are relatively few in the literature of the Neotropical region and have received little attention in Brazil. This article brings an overview of historic developments in this field, the recent studies and the main problems and challenges in South America and mainly in Brazil.

  1. BusinessUSA Resource Access API

    Data.gov (United States)

    General Services Administration — BusinessUSA connects businesses to government services and information. The API provides access to resource abstracts including programs, services, data, events, and...

  2. Plan of Study for the Tidal Power Study, Cobscook Bay, Maine, USA

    Science.gov (United States)

    1978-09-01

    affected by various rates of escalation. The higher the rate of escala - tion, the larger the B/C ratio. Although life-cycle costing was not accomplished...ar4 Mr. Silverman on 15 %c£ctc-n:.-r 1976, at which tim~e tha subject matter was tlrcusd. I w.ould 1l~c to .kn relt43ra:.3 son-4 of the key points A...changing times, energy situation (estimated annual savings of 2,700,000 BBLS of oil for the 500 MW project), escala - tion, views of other agencies, etc

  3. Combined impacts of global changes on biodiversity across the USA.

    Science.gov (United States)

    Bellard, C; Leclerc, C; Courchamp, F

    2015-07-07

    Most studies of the effects of global changes on biodiversity focus on a single threat, but multiple threats lead to species extinction. We lack spatially explicit assessments of the intensity of multiple threats and their impacts on biodiversity. Here, we used a novel metric of cumulative threats and impacts to assess the consequences of multiple threats on 196 endemic species across the USA. We predict that large areas with high cumulative impact scores for amphibians, birds, mammals, and reptiles will be concentrated in the eastern part of the USA by the 2050 s and 2080  . These high cumulative impact values are due mainly to the presence of invasive species, climate change, cropland and pasture areas; additionally, a significant proportion of endemic species are vulnerable to some of these threats where they occur. This analysis provides a useful means of identifying where conservation measures and monitoring programs that should consider multiple threats should be implemented in the future.

  4. Distant education of gifted children in the USA

    Directory of Open Access Journals (Sweden)

    Rogozhkina I. B.

    2012-06-01

    Full Text Available Distant teaching which helps to realize the main principles of contemporary education: «teaching throughout» and «lifelong teaching» becomes more and more indemand. The possibility to get education for the residents of remote districts, excess to contemporary data bases, scientific libraries and learning materials of high quality, possibility to study at a time convenient for a student and in a tempo acceptable to the one makes distant education one of the most effective form of work with gifted children. System of distant education in the USA which is one of the most sophisticated one involves a big variety of programs and courses for both ordinary and gifted students. The article analyzes the existing in the USA on-line programs for gifted children, reveals their advantages and disadvantages, discusses the distant forms of work applicable to teaching of gifted children in Russia.

  5. Berliini müür USA-s varisemas / Mehis Replik

    Index Scriptorium Estoniae

    Replik, Mehis

    1998-01-01

    USA-s on pankade liitumine lõppjärgus. Tabelid: Pankade Euromoney TOP 200, suurima turuväärtusega pangad juunis 1998, Ida- ja Kesk-Euroopa pankade võrdlus koguvarade alusel. Euroopa ühinevad pangad. Artiklis on käsitletud ka USA pangandusalaseid õigusakte läbi ajaloo

  6. China / USA - Climate at stake; Chine / USA - Le climat en jeu

    Energy Technology Data Exchange (ETDEWEB)

    Marechal, Jean-Paul

    2011-10-15

    Climate change is one of the major challenge that humanity will have to take up during the coming decades. The preparation in 2012 of the 'post-Kyoto' era, where all countries would take up their climate responsibilities, remains the hardest trial. However, all successive international summits did not lead to any constraining agreement between countries. The main reason is the rivalry and dependence relation which links China and the USA. It is now obvious that no major climate decision can be taken without the double determined commitment of these both giants, and so far it is not in their interest to lead by example. This book analyses the freeze of this situation in an historical perspective and identifies some paths of solution to this serious problem. (J.S.)

  7. Poola ootab USA maaväelasi

    Index Scriptorium Estoniae

    2014-01-01

    Poola kaitseministri Tomasz Siemoniaki sõnul saadab USA Poolasse maavägesid, et laeindada NATO kohalolekut ajal, mil pingeline olukord Ukrainas kestab, kirjutas Washington Post. Siemoniak ütles lehele, et sõjalised planeerijad juba töötavad vastava kava üksikasjade kallal. Ta lisas, et tõenäoliselt saadetakse USA sõdureid ka Baltimaadesse

  8. Etteheide: USA okupeerib Haitit / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Prantsusmaa ja Brasiilia on esitanud protesti, sest USA sõjalennukitele on antud eelisõigus Haiti pealinna Port-au-Prince'i lennujaama kasutamisel. Paljude kommentaatorite hinnangul on Prantsusmaa püüdnud haarata prominentset rolli Haiti abistamisel, kuid USA on tegutsenud kiiremini ja jõulisemalt. Kaart

  9. Teadlased : USA liitub Kyoto protokolliga / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    USA ja Austraalia on ainsad riigid, mis pole Kyoto protokollile alla kirjutanud. Princetoni ülikooli professori Michael Oppenheimeri arvates võib USA president George W. Bush oma seisukohti keskkonnaküsimustes muuta, sest teiseks ametiajaks valitud presidendid ei pea mõtlema uuele kampaaniale ning püüavad enne Valgest Majast lahkumist oma mainet maailma silmis parandada

  10. Bulgaaria valitsus tahab USA raketikilpi / Mihkel Niglas

    Index Scriptorium Estoniae

    Niglas, Mihkel

    2007-01-01

    Bulgaarias küsiti USA presidendilt George W. Bushilt, miks Poolasse ja Tšehhi kavandatav raketikilp ei hakka katma Bulgaariat. USA paigutab septembris Bulgaaria sõjabaasi üle 3000 sõduri. George W. Bush toetab Bulgaaria nõudmist Liibüale vabastada Bulgaaria meditsiiniõed

  11. Krossil on probleeme USA viisaga? / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2011-01-01

    Eesti Päevaleht esitas USA Eesti-saatkonnale järelepärimise seoses sellega, et Eerik-Niiles Krossi USA-viisa on tühistatud. Saatkonna pressi- ja kultuuriatašee James Landi vastusest. Eerik-Niiles Krossi kommentaare

  12. USA relvastab Saddami toetajaid / Triin Oppi

    Index Scriptorium Estoniae

    Oppi, Triin

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 12. juuni 2007, lk. 6. USA koostööst Iraagis endiste vastaste ehk Saddam Husseini toetanud sunniitidega, sest valitsusväed ja USA sõdurid pole suutnud lüüa Iraagi mässulisi ja Al-Qaedat. Kaart: Koostööpiirkonnad

  13. USA tankid jõudsid Tapale

    Index Scriptorium Estoniae

    2017-01-01

    Tapale saabus poolsada USA sõjamasinat, nende seas neli tanki Abrams M1A2 ja 15 jalaväe lahingumasinat Bradley. Tehnikat hakkab kasutama USA maaväe 4. jalaväediviisi 68. soomusrügemendi esimese pataljoni C-kompanii

  14. USA laenukriis peegeldub Põhjalas / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2007-01-01

    USA-s süvenev kinnisvaralaenukriis avaldab mõju ka tunduvalt riskantsematele Põhjamaade kinnisvaraturgudele. Siiski on Põhjalas kõrge riskiga hüpoteeklaenude osa võrreldes ülejäänud laenudega äärmiselt väike. Lisa: Kõige haavatavamad kinnisvaraturud; Mõjud mujal maailmas. Vt. samas: Põhjamaade börsid USAga samas taktis

  15. USA allveelaev uputas kalalaeva / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2001-01-01

    Hawaii lähistel õppustel kiiret pinnaletõusu harjutanud USA allveelaev USS Greeneville põrkas kokku Jaapani õppelaevaga Ehime Maru, õnnetuse tagajärjel hukkus tõenäoliselt 9 jaapanlast. Skeem: Õnnetused USA allveelaevadega

  16. USA raport hoiatab tuumaterroristide eest / Karin Volmer

    Index Scriptorium Estoniae

    Volmer, Karin

    2007-01-01

    USA-s tegutseva tuumaterrori vastase organisatsiooni Nuclear Threat Initiative (NTI) raport kinnitab maailma edusamme tuumamaterjali turvalisuses, kuid on ka palju ohuallikaid. Analüütikud kahtlevad Venemaa ja Pakistani armee usaldusväärsuses tuumamaterjali hoidmisel. Lisa: Tuumaterrori raport

  17. Ideaalne torm USA majanduses / Ken Goldstein ; interv. Neeme Raud

    Index Scriptorium Estoniae

    Goldstein, Ken

    2008-01-01

    USA majandusuuringute organisatsiooni The Conference Board analüütik USA majanduse olukorrast, mõjust maailmamajandusele, arenguvõimalustest ning uue presidendi vajalikest sammudest majanduses. Lisa: Enamuse arvates on USA valel teel

  18. USA National Phenology Network gridded products documentation

    Science.gov (United States)

    Crimmins, Theresa M.; Marsh, R. Lee; Switzer, Jeff R.; Crimmins, Michael A.; Gerst, Katharine L.; Rosemartin, Alyssa H.; Weltzin, Jake F.

    2017-02-23

    The goals of the USA National Phenology Network (USA-NPN, www.usanpn.org) are to advance science, inform decisions, and communicate and connect with the public regarding phenology and species’ responses to environmental variation and climate change. The USA-NPN seeks to facilitate informed ecosystem stewardship and management by providing phenological information freely and openly. One way the USA-NPN is endeavoring to accomplish these goals is by providing data and data products in a wide range of formats, including gridded real-time, short-term forecasted, and historical maps of phenological events, patterns and trends. This document describes the suite of gridded phenologically relevant data products produced and provided by the USA National Phenology Network, which can be accessed at www.usanpn.org/data/phenology_maps and also through web services at geoserver.usanpn.org/geoserver/wms?request=GetCapabilities.

  19. Riverbed-Sediment Mapping in the Edwards Dam Impoundment on the Kennebec River, Maine By Use of Geophysical Techniques

    Science.gov (United States)

    Dudley, Robert W.

    1999-01-01

    INTRODUCTION In July 1997, the Federal Energy Regulatory Commission (FERC) issued a Final Environmental Impact Statement recommending that the 162-year-old Edwards Dam on the Kennebec River in Augusta, Maine, be removed. The impoundment formed by Edwards Dam extends about 15 mi to the city of Waterville, near the confluence of the Sebasticook River with the Kennebec River. The impoundment has a surface area of 1,143 acres, a gross storage of approximately 740 million ft3, and a usable storage of about 184 million ft3 (Stone and Webster, 1995a). According to FERC, removal of the 917-ft-long, 24-ft-high timber crib and concrete structure would restore 15 mi of riverine habitat, improve passage of ocean-migrating fish species native to the Kennebec River, and result in substantial recreational enhancements (Federal Energy Regulatory Commission, 1997). Because the removal of Edwards Dam would change the hydraulic characteristics of the river in the present-day impoundment, the potential transport of erodible, fine-grained sediment currently in the impoundment is a concern. Of particular concern is the erosion and transport of this sediment to areas downstream from the dam, a process that could introduce possible bacterial and chemical contamination and could impede river navigation as a result of sediment deposition. In an effort to build upon available information on the composition of the riverbed, the U.S. Geological Survey (USGS), in cooperation with the Maine State Planning Office, classified riverbed sediment types and mapped their areal extents in the lower (southern) half of the Edwards Dam impoundment. This report describes the methods used to collect and analyze the data used to create a map of sediment types in the Edwards Dam impoundment. The map is included with this report. Data used to map riverbed sediment types were also used to estimate the volume of observed mud and mud-containing sediment in the study area.

  20. Modelling middle pliocene warm climates of the USA

    Science.gov (United States)

    Haywood, A.M.; Valdes, P.J.; Sellwood, B.W.; Kaplan, J.O.; Dowsett, H.J.

    2001-01-01

    The middle Pliocene warm period represents a unique time slice in which to model and understand climatic processes operating under a warm climatic regime. Palaeoclimatic model simulations, focussed on the United States of America (USA), for the middle Pliocene (ca 3 Ma) were generated using the USGS PRISM2 2?? ?? 2?? data set of boundary conditions and the UK Meteorological Office's HadAMS General Circulation Model (GCM). Model results suggest that conditions in the USA during the middle Pliocene can be characterised as annually warmer (by 2?? to 4??C), less seasonal, wetter (by a maximum of 4 to 8 mm/day) and with an absence of freezing winters over the central and southern Great Plains. A sensitivity experiment suggests that the main forcing mechanisms for surface temperature changes in near coastal areas are the imposed Pliocene sea surface temperatures (SST's). In interior regions, reduced Northern Hemisphere terrestrial ice, combined with less snow cover and a reduction in the elevation of the western cordillera of North America, generate atmospheric circulation changes and positive albedo feedbacks that raise surface temperatures. A complex set of climatic feedback mechanisms cause an enhancement of the hydrological cycle magnifying the moisture bearing westerly wind belt during the winter season (Dec., Jan., Feb.). Predictions produced by the model are in broad agreement with available geological evidence. However, the GCM appears to underestimate precipitation levels in the interior and central regions of the southern USA. Copyright: Palaeontological Association, 22 June 2001.

  1. Experience from Soybean Industry Development of Main Soybean Producing Countries

    Institute of Scientific and Technical Information of China (English)

    MA Zenglin; GUO Xiangyu

    2009-01-01

    Soybean output and trade are mainly operated in America, Brazil, Argentina and China in recent years, especially in America. For China, the import output is number one, and the export output is the forth. For this reason, the soybean industry of China got a huge lash, and the soybean farmers got a large loss, it influenced the building of new countryside construction in China. Both U.S.A's soybean output and trade amout are the number one in the world, this achievement should be contributed to U.S.A's advanced production ability and its favorable subsidy policies. Contrary to U.S.A's large subsidy and cheap loan, Brazil and Argentina raise their soybean output and trade amount by high production technology and "untying" policies, such as abolishing some unreasonable rules and tax. So if we want to develop Chinese soybean industry and make sure our soybean industry's safety, it's necessary for us to experience soybean industry development of other countries' and improve ours.

  2. Problems of NPP construction project standardization and operational safety increase in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Gudkov, Yu.V.

    1980-01-01

    Main causes of slackening paces of the USA nuclear power engineering development are considered using the experience of the USA NPP design, construction and operation. Data on increase in capital investments for the NPP construction and variation of their structure to enhancing waste of capital are given. Problems of improvement of operational safety of water-cooled and water-moderated reactors as well as NPP separate assemblies are considered. Ways for reducing periods of NPP design realization are described taking as an example the USA leading power, construction and reactor construction companies. It is shown that the optimization of existing methods for designing NPPs and nuclear reactor structures, systems for construction management and control as well as complex standartization of equipment, construction methods and operational procedures for NPPs are main factors.

  3. Main: FEB3 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available nt to sterilization and rinsing - One of the main components of biofilms is polysaccharides - Some pit-formi...s - Structures and functions of a variety of alginate lyases have been determined A biofilm is an aggregate ...of water pipes and dental plaque are examples of biofilms. One of the main components of biofilms is polysac

  4. The American Eider in Maine

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The American eider, Maine's only breeding sea duck, is known to have nested on 215 coastal islands of the State in 1976. In Maine, eiders seem to prefer to nest on...

  5. Maine Agricultural Foods. Project SEED.

    Science.gov (United States)

    Beaulieu, Peter; Ossenfort, Pat

    This paper describes an activity-based program that teaches students in grades 4-12 about the importance of Maine agriculture in their lives. Specifically, the goal is to increase student awareness of how the foods they eat are planted, harvested, and processed. The emphasis is on crops grown in Maine such as potatoes, broccoli, peas, blueberries,…

  6. LHV soovib USA-s kohtuvälist kokkulepet / Toivo Tänavsuu

    Index Scriptorium Estoniae

    Tänavsuu, Toivo

    2005-01-01

    Kohtuväline kokkulepe LHV ja USA väärtpaberituru järelevalveasutuse SEC vahel tähendaks külmutatud väärtpaberikontode avamist, ent tõenäoliselt ka seda, et LHV peab maksma trahvi. Kohtuistungil USA-s esindavad LHV töötajaid Kristjan Lepikut ja Oliver Peeki advokaadid. Lisa: Teisedki on "sundpuhkusel"

  7. Main Propulsion Test Article (MPTA)

    Science.gov (United States)

    Snoddy, Cynthia

    2010-01-01

    Scope: The Main Propulsion Test Article integrated the main propulsion subsystem with the clustered Space Shuttle Main Engines, the External Tank and associated GSE. The test program consisted of cryogenic tanking tests and short- and long duration static firings including gimbaling and throttling. The test program was conducted on the S1-C test stand (Position B-2) at the National Space Technology Laboratories (NSTL)/Stennis Space Center. 3 tanking tests and 20 hot fire tests conducted between December 21 1 1977 and December 17, 1980 Configuration: The main propulsion test article consisted of the three space shuttle main engines, flightweight external tank, flightweight aft fuselage, interface section and a boilerplate mid/fwd fuselage truss structure.

  8. USA tantsupress soovitab: Tiit Helimets! / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2007-01-01

    Eesti balletitantsijast Tiit Helimetsast, kes töötab alates 2005. aastast San Francisko balleti juhtsolistina. Lisatud nimekiri eesti tantsijatest välistruppides. USA tantsuajakirjas "Dance Magazine" ilmunud artiklist "25, keda vaadata"

  9. Ilves kritiseeris USA juhtidega Venemaad / Dagne Hanschmidt

    Index Scriptorium Estoniae

    Hanschmidt, Dagne

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 21. apr. lk. 4. President Toomas Hendrik Ilves kohtus töövisiidil Ameerika Ühendriikidesse USA asepresidendi Dick Cheney ja riigisekretär Condoleezza Rice'iga. Arutusel olid Euroopa Liidu suhted Venemaaga, Venemaa käitumine Gruusiaga, NATO viimase tippkohtumise tulemused. USA välisminister C. Rice avaldas Eesti presidendile tänu Eesti silmapaistva panuse eest Afganistanis. Kohtumisi kommenteerivad Riigikogu Euroopa Liidu asjade komisjoni esimees Marko Mihkelson ja Riigikogu väliskomisjoni esimees Sven Mikser. Vt. samas: Euroliit andis USA viisavabadusele rohelise tee. Euroopa Liidu sise- ja justiitsministrite kohtumisel kiideti heaks otsused, mis võimaldavad Eestil liituda USA viisavabadusprogrammiga. Vabariigi President töövisiidil Ameerika Ühendriikides 17.-23.04.2008

  10. Skandaal USAs : Obamat kujutati islamiterroristina / Aadu Hiietamm

    Index Scriptorium Estoniae

    Hiietamm, Aadu, 1954-

    2008-01-01

    The New Yorkeri esiküljel ilmus karikatuur, kus USA demokraatide presidendikandidaati Barack Obamat ja tema abikaasat Michelle'i kujutati islamiterroristidena, karikaturisti väitel joonistas ta selle Obama laimajate naeruvääristamiseks

  11. Endise USA vastuluuraja naasmine / Priit Pullerits

    Index Scriptorium Estoniae

    Pullerits, Priit, 1965-

    2008-01-01

    USA poliitikateaduste professorist Christopher L. Kukest, kes käesoleval õppeaastal töötab Fulbright Scholar programmi stipendiaadina Tartu Ülikoolis. Lisa: CV. Kommenteerib Tartu Ülikooli riigiteaduste instituudi doktorant Mihkel Solvak

  12. USA suursaadik : hirmud on alistanud lootuse / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2004-01-01

    Eestist lahkuv USA suursaadik Joseph de Thomas andis USA iseseisvuspäeva kõnes hinnangu Eesti toetusele Iraagis ja USA Iraagi-poliitikale. Parlamendiliige Eiki Berg USA suursaadiku kõnest. Vt. ka: Suursaadiku sõnum lk. 10

  13. USA tahab Iraagilt täispuutumatust / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2008-01-01

    USA ja Iraagi läbirääkimised USA vägede staatuse üle venivad, USA soovib oma sõduritele täielikku immuniteeti. Iraak olevat nõus nende USA üksuste immuniteediga, kes on sõjalistes rajatistes või missioonil, milles on varem kokku lepitud

  14. Quo vadis, USA dollar? : finantsturgude viimastest arengutest / Robert Liljequist

    Index Scriptorium Estoniae

    Liljequist, Robert

    2013-01-01

    Swedbank AB Soome strateegiajuht vastab küsimustele, mis puudutavad USA majandust alanud aastal, dollari n.-ö turvalise valuuta staatuse kaotamise ohtu, võlakirjade ostmise vähendamist ja selle mõju USA dollarile, Euroopa Keskpanga poliitika mõju euro ja USA dollari suhtele. Swebanki prognoos USA dollari kohta

  15. USA võtab hoogu maha / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2010-01-01

    Pärast riiklike soodustuste lõppu koduostjatele on USA-s vähenenud kinnisvara soetamine, jaemüüjate käive langes juunis võrreldes maiga 0,5%. USA keskpanga presidendi Ben Bernanke hinnangul on USA majandus ebatavaliselt ebamäärane

  16. Lahingustress ajab USA sõdurid jooma / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 15. märts 2007, lk. 10. USA kaitseministeeriumi siseuurimuse kohaselt kasvas alkoholi kuritarvitamine tegevteenistuses olevate USA sõjaväelaste seas aastatel 2002-2005 enam kui 30%. Alkoholi ja uimastite tarvitamisest Iraagis ja Afganistanis teenivate USA sõdurite hulgas. Vt. samas: USA relvajõududes puhkes uus homoskandaal

  17. USA Today: Accentuating the Positive: A Study of the Gannett Flagship Newspaper.

    Science.gov (United States)

    Wright, William F.

    To investigate whether "USA Today" emphasizes "good news" over "bad news," a study was conducted using 10 randomly selected adults in State College, Pennsylvania, over an 11-week period in 1985. Subjects were asked to rate 248 stories over 45 pages of main news columns in 10 issues on a scale ranging from 1 (very negative news) to 7 (very positive…

  18. Didactics Textbooks in Germany and the USA: A Comparative Study of Eclecticism, Selection and Integration

    Science.gov (United States)

    Zierer, Klaus

    2011-01-01

    This article presents the results of a comparison of didactics textbooks in two countries: on the one hand it examines a textbook in the tradition of German Didaktik, and, on the other hand, a textbook in the tradition of "Instructional Design" from the USA. The main research question is: How do authors write didactics textbooks? Is it possible to…

  19. Exploring temperamental differences in infants from the USA and the Netherlands

    NARCIS (Netherlands)

    Sung, J.; Beijers, R.; Gartstein, M.A.; Weerth, C. de; Putnam, S.

    2015-01-01

    This longitudinal study employed the Infant Behaviour Questionnaire-Revised in assessing temperamental differences between infants at 6 months (n=114 US, 184 Dutch) and 12 months (n=92 US, 172 Dutch) from the USA and the Netherlands. Main effects indicated that Dutch infants were rated higher on the

  20. USA suhtub karmilt salainfo kasutamisse / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Juhtumitest USA-s, kus mitteavalikke pressiteateid on kasutatud ebaseadusliku tulu teenimiseks. Anonüümsust palunud Wall Streeti analüütiku sõnul võib LHV-ga seotud skandaal võtta halvema pöörde juhul, kui selgub, et äriuudisteagentuuris Business Wire'is oli keegi, kes tegi eestlastega koostööd

  1. 1952 Kern County, USA Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — South of Bakersfield. Affected area: 414,000 square kilometers. Damage: $50 million. This was the main shock of the series of earthquakes that struck this area. It...

  2. Gulf of Maine intermediate water

    Energy Technology Data Exchange (ETDEWEB)

    Hopkins, T.S. (Brookhaven National Lab., Upton, NY); Garfield, N. III

    1979-01-01

    The thermohaline dynamics of the Gulf of Maine are analyzed from the two year, eight cruise, data set of Colton, Marak, Nickerson, and Stoddard (1968). Six water masses are described: the Maine Surface Water, Maine Intermediate Water, and the Maine Bottom Water as interior water masses; and the Scotian Shelf Water, the Slope Water, and the Georges Bank Water as exterior water masses. Particular attention is given to the formation and disposition of the Maine Intermediate Water. Salt balance, T-S volume, and T-S drift analyses are used to provide transport and mixing estimates for the year 1966. The Slope Water entered at depth through the Northeast Channel at a rate of 2600 km/sup 3//yr; while the Scotian Shelf Water entered the surface and intermediate layers, mostly during winter intrusions, at a rate of 5200 km/sup 3//yr. The surface and intermediate layers exported a total of 7900 km/sup 3//yr in a 3:5 ratio, respectively. The Maine Intermediate Water tends to collect over the Wilkinson Basin during the stratified season, to exit via the Great South Channel during early spring, and to exit via the Northeast Channel during spring and summer. Comparisons are made between the estimated winter heat loss of 280 Ly/d and the observed heat losses of 230 Ly/d (surface layers) and 360 Ly/d (surface and intermediate layers). A limit for the Scotian Shelf Water contribution is about -70 Ly/d. It is concluded that the Maine Intermediate Water is produced locally and that it is exported in significant quantities.

  3. Non-main Stream Plays Main Role in Shipbuilding Market

    Institute of Scientific and Technical Information of China (English)

    Qin Ping

    2009-01-01

    @@ Comparing with both the major shipyards and shipping companies that were facing an market decline and hard time,the non-mainstream ship types,non-mainstream ship manufacturers and non-mainstream ship owners,as main roles,made a wonderful show of living and developing in 2009.

  4. I-WARP: Individual Water mAin Renewal Planner

    Directory of Open Access Journals (Sweden)

    Y. Kleiner

    2010-05-01

    Full Text Available I-WARP is based upon a nonhomogeneous Poisson approach to model breakage rates in individual water mains. The structural deterioration of water mains and their subsequent failure are affected by many factors, both static (e.g., pipe material, pipe size, age (vintage, soil type and dynamic (e.g., climate, cathodic protection, pressure zone changes. I-WARP allows for the consideration of both static and dynamic factors in the statistical analysis of historical breakage patterns. This paper describes the mathematical approach and demonstrates its application with the help of a case study. The research project within which I-WARP was developed, was jointly funded by the National Research Council of Canada (NRC, and the Water Research foundation (formerly known as the American Water Works Association Research Foundation – AwwaRF and supported by water utilities from USA and Canada.

  5. Architectural Portfolio 2001: Main Winners.

    Science.gov (United States)

    American School & University, 2001

    2001-01-01

    Presents descriptions and photographs of the following two American School and University Architectural Portfolio main winners for 2001: Chesterton, Indiana's Chesterton High School and Lied Library at the University of Nevada, Las Vegas. Included are each project's vital statistics, the architectural firm involved, and a list of designers.(GR)

  6. The four main LHC experiments

    CERN Multimedia

    AC Team

    1999-01-01

    This diagram shows the locations of the four main experiments (ALICE, ATLAS, CMS and LHCb) that will take place at the LHC. Located between 50 m and 150 m underground, huge caverns have been excavated to house the giant detectors. The SPS, the final link in the pre-acceleration chain, and its connection tunnels to the LHC are also shown.

  7. "Riia ring, "luurepost ja tööjaotus USA esindustest Baltikumis 1920. aastatel / Eero Medijainen""

    Index Scriptorium Estoniae

    Medijainen, Eero, 1959-

    2012-01-01

    Diplomaatilisest taustast. USA esinduste rajamisest Baltikumi. Olukorrast USA saatkonnas 1922. aastal. USA sõjalisest vaatlejast "Balti provintsides" 1919-1922. Luurekeskusest ja Sergius Riisist. "Vene sektsiooni" formaliseeerumisest.

  8. Overview: Main Fundamentals for Steganography

    CERN Document Server

    AL-Ani, Zaidoon Kh; Zaidan, B B; Alanazi, Hamdan O

    2010-01-01

    The rapid development of multimedia and internet allows for wide distribution of digital media data. It becomes much easier to edit, modify and duplicate digital information .Besides that, digital documents are also easy to copy and distribute, therefore it will be faced by many threats. It is a big security and privacy issue, it become necessary to find appropriate protection because of the significance, accuracy and sensitivity of the information. Steganography considers one of the techniques which used to protect the important information. The main goals for this paper, to recognize the researchers for the main fundamentals of steganography. In this paper provides a general overview of the following subject areas: Steganography types, General Steganography system, Characterization of Steganography Systems and Classification of Steganography Techniques.

  9. USA eksperdid näevad Baltimaid NATOs / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2001-01-01

    USA maineka välispoliitikaga tegeleva eraorganisatsiooni Välissuhete Nõukogu (Council of Foreign Relations CFR) analüütikute seisukohad USA välispoliitikast Balti riikide NATO-ga ühinemise kohta

  10. USA pensionisüsteem vajab kiiret reformimist / Raivo Sormunen

    Index Scriptorium Estoniae

    Sormunen, Raivo, 1976-

    2005-01-01

    Ameerika Ühendriikide pensionisüsteem vajab reformimist, kuna alates 2017. aastast tuleb USA pensionikindlustussüsteemil maksta pensionideks välja rohkem raha kui maksudena laekub. Tabel: USA sotsiaalkindlustussüsteem arvudes

  11. "Disko ja tuumasõda" jõuab USA kinolevisse

    Index Scriptorium Estoniae

    Kilmi, Jaak, 1973-, režissöör. Disko ja tuumasõda (film)

    2010-01-01

    Jaak Kilmi ja Kiur Aarma dokumentaalfilm "Disko ja tuumasõda" hakkab alates 12. novembrist jooksma New Yorgi kinos Cinema Village. 26. novembrist saab filmi näha Los Angeleses. Filmi levitaja USA-s on Icarus Film

  12. Bush soovib rahajagamisega USA majandust turgutada / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2008-01-01

    USA presidendi George W. Bushi plaanist maksta igale maksumaksjale tagasi 800 ja peredele 1600 dollarit, et majandust tõusule juhtida. USA Keskpanga poliitikast ja maailma börside jätkuvast langusest. Kommenteerivad: Romet Tepper, Jaanus Pikkani

  13. Main Elements for Upscaling Recreation

    DEFF Research Database (Denmark)

    Zandersen, Marianne; Termansen, Mette

    2012-01-01

    This report provides information on the main elements used to scale up modelled local visitor flow data to regional level based on recreational de-mand models. These models are described in Report #1. This report also provides information on data sources such as spatial data (e.g. land cov......-er/land use information), demographic information. The report is accom-pagnied with a spatial database for the regional case of forest recreation in Northern Zealand, Denmark. The spatial database contains forest polygons; forest attribute; estimation of total annual number of visits per site; and es...

  14. The USA: Challenges of the Superpower

    Directory of Open Access Journals (Sweden)

    Dr. Ketevan Rostiashvili

    2012-01-01

    Full Text Available Since the collapse of the Soviet Union function and mission of the United States in the contemporary world system is one of the most debatable problems of academic litera-ture. This article is an attempt to analyze most recent socioeconomic and political tendencies of the USA for better understanding the scale of ongoing transformation of the society. As the level of integration of contemporary world is very high, transfor-mation of the USA provokes tectonic changes and transformation of the world system, its structure and nature. This study argues that, although the US primacy in the world is significantly challenged and shaken by external and internal factors, the USA still preserves its traditional function of economic, financial, military and political superpow-er, but in a quite different environment. The article predominantly uses materials drawn from the Central Intelligence Agency (CIA, The World Fact book 2012; U.S. Census Bureau, Statistical Abstract of the USA - 2012, the US Federal Budgets 2010-2012, and other valuable literature and sources.

  15. Gridded bathymetry of Penguin Bank, Hawaii, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry (5 m cell size) of Penguin Bank, Hawaii, USA. The netCDF grid and ArcGIS ASCII file include multibeam bathymetry from the Simrad EM3002d, and...

  16. Euroopa ja USA: liidus tulevikuks / Barack Obama

    Index Scriptorium Estoniae

    Obama, Barack, 1961-

    2010-01-01

    Ameerika Ühendriikide president kirjutab 19.-20. novembril Lissabonis toimuvast NATO tippkohtumisest, USA ja Euroopa vastastikusest vajalikkusest ning NATO-sisesest koostööst. Barack Obama leiab, et NATO ja Venemaa võiksid taaskäivitada oma suhted

  17. Fosfomycin Resistance in Escherichia coli, Pennsylvania, USA.

    Science.gov (United States)

    Alrowais, Hind; McElheny, Christi L; Spychala, Caressa N; Sastry, Sangeeta; Guo, Qinglan; Butt, Adeel A; Doi, Yohei

    2015-11-01

    Fosfomycin resistance in Escherichia coli is rare in the United States. An extended-spectrum β-lactamase-producing E. coli clinical strain identified in Pennsylvania, USA, showed high-level fosfomycin resistance caused by the fosA3 gene. The IncFII plasmid carrying this gene had a structure similar to those found in China, where fosfomycin resistance is commonly described.

  18. USA survestab Mubarakit lahkuma / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2011-01-01

    USA on teinud Egiptusele mitu ettepanekut, kõige tõenäolisemaks peetakse kava, mille kohaselt president Hosni Mubarak astuks tagasi kohe ja annaks võimu üle vahevalitsusele. Opositsioonijuhi ElBaradei ettepanekul peaks riiki hakkama juhtima presidendikogu

  19. Lahkuv USA saadik sai Maarjamaa Risti

    Index Scriptorium Estoniae

    2009-01-01

    USA suursaadik Stanley Davis Phillips tegi 8. jaanuaril 2009 Kadriorus lahkumisvisiidi president Toomas Hendrik Ilvesele. Suursaadiku teenete tunnustuseks andis president T. H. Ilves talle Maarjamaa Risti I klassi ordeni. Ilmunud ka: Eesti Elu 9. jaan. 2009, lk. 3, pealk.: President tänas Ameerika Ühendriikide suursaadikut

  20. USA: A Schema for Communicating Change.

    Science.gov (United States)

    Fabien, Miriam R.

    Professional communicators are often called upon to announce changes at places of business and to implement them in a timely fashion. One approach that works (and minimizes confusion) is to plan carefully to achieve three key objectives: Understanding, Support, and Action (USA). To promote understanding, those who have decided on the change should…

  1. Toomas Hendrik Ilves kritiseeris USA juhtidega Venemaad

    Index Scriptorium Estoniae

    2008-01-01

    President Toomas Hendrik Ilves arutas kohtumistel USA asepresidendi Dick Cheney ja riigisekretär Condoleezza Rice'iga Euroopa Liidu ja Gruusia suhteid Venemaaga. Vabariigi President töövisiidil Ameerika Ühendriikides 17.-23.04.2008

  2. 77 FR 55141 - Safety Zone, ESI Ironman 70.3 Augusta Triathlon, Savannah River; Augusta, GA

    Science.gov (United States)

    2012-09-07

    ... of the competition. Persons and vessels are prohibited from entering, transiting through, anchoring... finds that good cause exists for making this rule effective less than 30 days after publication in the... navigation areas and other limited access areas: 33 U.S.C. 1231; 46 U.S.C. Chapter 701, 3306, 3703; 50...

  3. Võidurelvastumise tagasitulek : USA kiiluvees Venemaa ja Hiina / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA eelarvekavas on ette nähtud kaitsekulutuste jätkuv suurenemine, suureneda võib ka relvajõudude isikkoosseis. Relvajõududele kulub USA-s ligi 4% SKT-st. Globaalselt liidetuna tõusid kõikide riikide kulutused relvajõududele 1990. aasta tasemele. Hiina ja Venemaa kaitsekulutustest. Lisad: Aasia riigid kasvatavad sõjalisi kulutusi; 25 riigil pole oma sõjaväge. Graafik: USA sõjalised kulutused

  4. USA suursaadik : toetame Eestit / Stanley Davis Phillips ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Phillips, Stanley Davis

    2007-01-01

    USA suursaadik Eestis Stanley Davis Phillips vastab küsimustele, mis puudutavad USA positsiooni Tõnismäe pronkssõduri suhtes, Eesti saatkonna piiramist Moskvas, USA ja Venemaa suhteid ning koostööd, sõda terrorismiga, USA kava paigutada Tšehhi ja Poolasse raketitõrjebaasid, Eesti presidendi Toomas Hendrik Ilvese visiiti USAsse. Lisa: Stanley Davis Phillips. Ilmunud ka: Postimees : na russkom jazõke 16. mai lk. 5

  5. Burden in the main caregiver

    Directory of Open Access Journals (Sweden)

    Fabiola Yonte Huete

    2010-09-01

    Full Text Available Objectives: The main objective is to determine the degree of burden in the main caregivers of dependent patients, to analyse the profile of informal caregivers and dependent patients. Their claims and help received with caring, the influence of mental deteriorate and duration of care giving regarding the burden of caregivers.Methods: Descriptive cross-sectional observational study amongst 50 caregivers and dependents. We used descriptive statistics and correlational studies. Results: 86 % of caregivers were women, middle aged, son/daughter of the dependent, married, with basic studies, no work outside the home, the average time in the role of caregiver was 16,96 hours a day and 2,1 free hours a day. 64 % of them received family support and 68 % wish to receive economic aid. It was found that for 38 % of the caregivers there was no burden at all, 34 % of them had a minimum burden and 28 % a greater burden.Conclusion: There are some caregivers with moderate or great burden. Our caregiver wishes to receive economic help. Our research shows that the decrease of mental health and the years of evolution do not have a significant statistically influence on caregivers. It is necessary prioritize the interventions and its recipients, provide solutions for caregivers with a greater burden, trying to keep away “caregiver syndrome”.

  6. Ilves kohtus esmaspäeval USA-s Barack Obamaga

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves kohtus 15. juunil 2009 Washingtonis USA presidendi Barack Obamaga ja vestles temaga nii majanduskriisist kui ka Eesti missioonist Afganistanis. Vabariigi President töövisiidil Ameerika Ühendriikides 9.-16.06.2009

  7. Energy Conferences and Symposia; (USA)

    Energy Technology Data Exchange (ETDEWEB)

    Osborne, J.H.; Simpson, W.F. Jr. (eds.)

    1991-01-01

    Energy Conferences and Symposia, a monthly publication, was instituted to keep scientists, engineers, managers, and related energy professionals abreast of meetings sponsored by the Department of Energy (DOE) and by other technical associations. Announcements cover conference, symposia, workshops, congresses, and other formal meetings pertaining to DOE programmatic interests. Complete meeting information, including title, sponsor, and contact, is presented in the main section, which is arranged alphabetically by subject area. Within a subject, citations are sorted by beginning data of the meeting. New listings are indicated by a bullet after the conference number and DOE-sponsored conferences are indicated by a star. Two indexes are provided for cross referencing conference information. The Chronological Index lists conference titles by dates and gives the subject area where complete information they may be found. The Location Index is alphabetically sorted by the city where the conference will be held.

  8. USA-reis nõuab biomeetrilist passi / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2004-01-01

    USA-s pikendati viisavabastusprogrammi biomeetrilise passi tähtaega 2005. aasta 26. oktoobrini. USA Eesti-saatkonna töötaja Christopher Smithi sõnul ei kehti viisavabadusprogrammi raames reisimise puhul passid, mida ei saa masinaga lugeda

  9. Tšehhid protestisid USA raketikilbi vastu / Igor Taro

    Index Scriptorium Estoniae

    Taro, Igor

    2007-01-01

    USA soovib rajada oma ballistiliste rakettide eest kaitsva süsteemi rajatisi Poola ja Tšehhi territooriumile, mille vastu on protestinud ka Venemaa. Tšehhi Trokaveci küla elanike korraldatud referendumist ja Prahas toimunud meeleavaldustest USA raketikilbi radarijaama vastu. Lisa: USA raketikilp

  10. USA tunnistab valge fosfori relvana kasutamist Iraagis / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    Kui varem USA eitas valge fosfori kasutamist Iraagis Falluja linnas, siis nüüd on ta eitamisest loobunud. USA välisministeeriumi pressiteate kohaselt ei kasutatud fosforit keemiarelvana. Sütitavate relvade kasutamine tsiviilisikute vastu on keelatud. Vt. samas: Ahto Lobjakas. Europarlamendis USA hukkamõist

  11. COMPARISON OF AGRICULTURAL INSURANCE DEVELOPMENT OF CROATIA, EU AND USA

    Directory of Open Access Journals (Sweden)

    Lovro Babić

    2014-12-01

    Full Text Available Based on the usage of multiple sources of literature in this paper, a review of the most important characteristics is made along with the comparison of functions related to agricultural insurance in Croatia. Larger part of this paper is about comparison of offers and the ways agricultural insurance is being subsided in developed countries of the EU and USA on one hand, and Croatia on the other. Also, a display of risk coverage is made, along with the subsidization of the country and the way insurance system functions in Spain (country with the most developed security in Europe, Portugal, Italy, Austria and France. Main characteristic of the agricultural insurance in Croatia is a weak offer from the insurance companies, but also a weak demand. Therefore, only four companies can insure crops and plantations in Croatia. Although risk is unavoidable, negative impacts can be reduced with well-timed reaction and responsible organisation.

  12. Airborne contact dermatitis: common causes in the USA.

    Science.gov (United States)

    Schloemer, Julie A; Zirwas, Matthew J; Burkhart, Craig G

    2015-03-01

    Airborne contact dermatitis (ABCD) is an inflammatory reaction involving the skin upon exposure to allergenic agents or irritants suspended in air. In allergic ABCD, the hypersensitivity is classified as a type IV reaction. Substances responsible for such reactions can be of plant or non-plant origin. Commonly reported plants include those of the Compositae family, which includes ragweed, goldenrod, and sunflowers. Establishing an accurate diagnosis is critical for preventing exposure and improving symptoms in patients. Obtaining a detailed history and performing a physical examination to determine the sites of involvement, as well as patch testing to establish the causative allergen, are the main methods of arriving at the correct diagnosis. Treatment often involves avoidance of the allergens or irritants when possible and may also include the application of topical barrier creams or systemic therapy in more severe cases. This article reviews the topic of ABCD and highlights its most common etiologies in the USA.

  13. Earliest Cucurbita from the Great Lakes, Northern USA

    Science.gov (United States)

    Monaghan, G. William; Lovis, William A.; Egan-Bruhy, Kathryn C.

    2006-03-01

    Directly dated Cucurbita from archaeological sites near Lake Huron expand the range and human usage of adventive, cultivated wild gourds or squash into the Great Lakes region, USA, by 4000 14C yr BP. The data also show that domesticated C. pepo squash was cultivated there by 3000 14C yr BP. Although milder Hypsithermal climate may have been a contributing factor, squash and gourds expanded northward during the mid-Holocene mainly by human agency and may be the first human-introduced adventive plant in temperate North America. Even after 3000 14C yr BP, when domesticated squash generally replaced wild varieties at northern sites, squash stands were probably informally managed rather than intensively cultivated.

  14. Ecosystem metabolism and nutrient dynamics in the main channel and backwaters of the Upper Mississippi River

    Science.gov (United States)

    Houser, Jeff N.; Bartsch, Lynn; Richardson, William B.; Rogala, James T.; Sullivan, John F.

    2015-01-01

    Photosynthesis and respiration are primary drivers of dissolved oxygen dynamics in rivers. We measured dissolved oxygen dynamics, aquatic ecosystem metabolism, algal abundance and nutrient concentrations at main channel and backwater sites on a reach of the Upper Mississippi River that borders the states of Wisconsin and Minnesota (U.S.A.). We asked (i) how ecosystem metabolism rates, dissolved oxygen dynamics and nutrient concentrations differed in the main channel and in backwaters, (ii) whether ecosystem metabolism relates to solar irradiance, nutrient concentration, algal abundance, temperature and river discharge and (iii) whether the relationships between ecosystem metabolism and these environmental factors differs between the main channel and backwaters.

  15. Aeropuerto intercontinental de Houston USA

    Directory of Open Access Journals (Sweden)

    Goleman & Rolfe, Arquitectos

    1970-09-01

    Full Text Available The main factors that tend to differentiate this intercontinental airport are the following. An extensive network of parking facilities near the flying stations. Maximum proximity of the airliners to the waiting passengers. An underground railway to transport passengers and luggage outside the runway area. Each of the two terminal buildings has exits in six different directions. It enjoys ample communications with the approach and motor roads leading into Houston. The possibility of further enlarging the airport at a later time without excessive cost. This ultramodern airport is designed to handle all types of intercontinental airliners and supersonic aircraft, and provides maximum comfort to passengers.Disponer de una red de aparcamientos cercanos a las estaciones de vuelo; acercamiento máximo de los aviones a los pasajeros; existencia de un tren subterráneo para el transporte de los viajeros y equipajes fuera del campo de aterrizaje; dotación, a cada uno de los dos edificios tei-minales, de salidas en seis direcciones; disfrute de amplias comunicaciones con las vías de accesos y las autopistas que irradian de la ciudad; y la posibilidad de efectuar una futura ampliación sin realizar gastos excesivos. Estos son los factores que contribuyen a diferenciar este Aeropuerto Intercontinental de otros Centros de Aviación Comercial. Este ultramoderno Aeropuerto está preparado para recibir toda clase de reactores y transportes supersónicos intercontinentales, ofreciendo toda clase de comodidades a sus usuarios.

  16. Dravet syndrome: the main issues.

    Science.gov (United States)

    Guerrini, Renzo

    2012-09-01

    Dravet syndrome (DS) is a severe form of infantile onset epilepsy characterized by multiple seizure types, prolonged convulsive seizures and frequent episodes of status epilepticus. Seizures precipitated by fever are a main characteristic. Affected children exhibit normal early development. Cognitive impairment, behavioral disturbances with hyperactivity and sometimes autistic traits occur after seizure onset. Seizures persist into adulthood but become less frequent. In about 85% of patients, a mutation of the SCN1A gene is present. DS fully illustrates the concept of epileptic encephalopathy. However, it is difficult to determine the causative role of the underlying sodium channel dysfunction and that of the consequent seizures in influencing cognitive outcome. An overwhelmingly high number of SCN1A mutations have been associated with DS. Intragenic or whole gene deletions, duplications and amplifications are additional rare molecular mechanisms. Most mutations are de novo, but familial mutations also occur. Somatic mosaic mutations should be considered when estimating the recurrence. MRI imaging is usually normal, and no neuropathologic signature of the condition seems to exist. In heterozygous Scn1a+/- mice, GABAergic interneurons exhibit substantially reduced sodium current density with reduced ability for sustained action potential firing. GABAergic output is reduced and excitability of downstream synaptic targets increased. Stiripentol was effective in combination with valproate and clobazam in two pivotal phase III trials. Phenytoin, carbamazepine, and lamotrigine can worsen seizures and should be avoided. Prospective studies will clarify to what extent earlier diagnosis and efforts at seizure control with the most appropriate drug combinations will reduce clinical deterioration.

  17. Main challenges of residential areas

    Directory of Open Access Journals (Sweden)

    Oana Luca

    2017-06-01

    Full Text Available The present article is a position paper aiming to initiate a professional debate related to the aspects related to the urban dysfunctions leading to the wear of the residential areas. The paper proposes a definition of the wear process, identify the main causes leading to its occurrence and propose a number of solutions to neutralise the dysfunctions. The three wearing phases of residential areas components are emphasized, exploring their lifecycle. In order to perform the study of urban wear, the status of the residential areas components can be established and monitored, and also the variables of the function that can mathematically model the specific wear process may be considered. The paper is considered a first step for the model adjustment, to be tested and validated in the following steps. Based on the mathematical method and model, there can be created, in a potential future research, the possibility of determining the precarity degree for residential areas/neighbourhoods and cities, by minimising the subjective component of the analyses preceding the decision for renovation or regeneration.

  18. The development of transcatheter aortic valve replacement in the USA.

    Science.gov (United States)

    Dvir, Danny; Barbash, Israel M; Ben-Dor, Itsik; Okubagzi, Petros; Satler, Lowell F; Waksman, Ron; Pichard, Augusto D

    2012-03-01

    The penetration rate of devices in general, and in transcatheter aortic valve replacement (TAVR) specifically, is significantly delayed in the United States of America (USA) compared with in Europe. This is mostly due to the mission statement of the regulatory agencies in the USA, which requires very rigorous clinical testing of a device prior to its approval. The USA had a major role in the development and evaluation of this technology and USA research has enabled clinicians inside and outside of the USA to conduct a concise scientifically based assessment of the performance of TAVR devices in terms of safety and efficacy. In the following review, we provide data on the development of TAVR in the USA, revealing the critical role the USA has played in this extraordinary process.

  19. Licensing the ACR-700 in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Langman, V.; Ion, R. [Atomic Energy of Canada Limited, Mississauga, Ontario (Canada); Reid, C. [Bechtel Power Corporation, San Fransisco, California (United States); Snell, V. [Atomic Energy of Canada Limited, Mississauga, Ontario (Canada)

    2003-07-01

    Atomic Energy of Canada Ltd. (AECL), via its 100% owned US subsidiary AECL Technologies Inc., is performing a pre-application review of the Advanced CANDU Reactor (ACR) with the US Nuclear Regulatory Commission (USNRC). Completion of this pre-application review by mid-2004, is in support of an application to the USNRC for Standard Design Certification that is targeted for the fall of 2004. The intent of the pre-application review is to deal up-front with potential issues associated with the CANDU reactor genealogy of the ACR that are different from the Light Water Reactor (LWR) and Boiling Water Reactor (BWR) regulatory framework in the USA. The focus of the paper will be to describe the pre-application review process currently underway with the NRC staff. In the context of the pre-application review this paper will provide an overview of the licensing approach being used to introduce the ACR-700 to the USA. (author)

  20. Big Bend National Park, TX, USA, Mexico

    Science.gov (United States)

    1991-01-01

    The Sierra del Carmen of Mexico, across the Rio Grande River from Big Bend National Park, TX, (28.5N, 104.0W) is centered in this photo. The Rio Grande River bisects the scene; Mexico to the east, USA to the west. The thousand ft. Boquillas limestone cliff on the Mexican side of the river changes colors from white to pink to lavender at sunset. This severely eroded sedimentary landscape was once an ancient seabed later overlaid with volcanic activity.

  1. Review of the USA National Phenology Network

    Science.gov (United States)

    Glynn, Pierre D.; Owen, Timothy W.

    2015-08-24

    In January 2014, leadership from the U.S. Geological Survey (USGS) Ecosystems Mission Area commissioned a review of the USA National Phenology Network (USA–NPN) Program. The Ecosystems Mission Area has a key stake in the USA–NPN, providing both supervision of its Director and most of the appropriated funds. The products and objectives of the program are relevant to six of the seven USGS Mission Areas as well as to at least four Department of the Interior (DOI) bureaus.

  2. USA asepresident vihastas Venemaad / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 15. mai lk. 9. Läänemere ja Musta mere piirkonna riikide tippkohtumisel Vilniuses esinenud USA asepresident Dick Cheney märkis, et Ameerikal ja Euroopal on raske näha Venemaad demokraatlike riikide seas, kuna reformivastased püüavad Venemaal hävitada möödunud kümnendi edusamme. Vt. samas: Eesti pakub abiks oma kogemusi

  3. Validating a Measure of Teacher Intentions to Integrate Technology in Education in Turkey, Spain and the USA

    Science.gov (United States)

    Perkmen, Serkan; Antonenko, Pavlo; Caracuel, Alfonso

    2016-01-01

    The main purpose of this study was to examine the validity of the Teacher Intentions to Integrate Technology in Education Scale using pre-service teacher samples from three countries on three continents--Turkey, Spain and the United States. Study participants were 550 pre-service teachers from three universities in Turkey, Spain and the USA (219,…

  4. Proceedings of the Japan-USA Collaborative Workshops on the History of Particle Theory in Japan, 1935-1960

    CERN Document Server

    Kawabe, Rokuo; Konuma, Michiji; Elementary particle theory in Japan, 1935-1960 : Japan-USA collaboration, second phase

    1988-01-01

    This volume consists mainly of papers presented at five "workshop", each of two or three days duration, held at various locations in Japan and the United States during 1984-5 by a USA-Japan collaboration for the study of the history of particle physics in Japan, together with some of the discussions and additional interviews.

  5. The System of Environmental Education in the USA

    Directory of Open Access Journals (Sweden)

    Fasolya Oleg

    2016-09-01

    Full Text Available The article deals with studying the peculiarities of environmental education system in the USA. It has been defined that US environmental policy includes governmental actions at the federal, state and local level. It has been identified that US environmental education is characterized by an extraordinary variety of forms, directions and methodological approaches, deep penetration of the ideas of environmental ethics in the content of all the disciplines, extensive involvement of communities and, in particular, public non-governmental organizations in the process of forming US citizens’ careful and responsible attitude to the environment. It has been stated that the system of US Environmental Education aims to provide a solution to such problems: to ensure citizens’ close contact with the environment; to contribute to the forming of environmentally friendly styles of behaviour and activities; to form a set of knowledge about the environment as a system of interconnected natural, economic and social factors; to involve students in solving local environmental problems. It has been found out that since 1970 Environmental Protection Agency has been operating in the USA. It has been mentioned that Environmental Protection Agency implements an environmental law by writing regulations and set national environmental standards. It has been indicated that Environmental Protection Agency has created the Office of Environmental Education so that national leadership may be provided and environmental literacy may be increased. It has been denoted that main goals of the the Office of Environmental Education include design and implementation of curricula and training programs for environmental education for both pupils and adults; organization of seminars, conferences and discussions on ugent environmental issues; cooperation with state education departments and other agencies. Consequently, recommendations that may be used by native educators to improve the

  6. Decommissioning of nuclear power plants in the US - a travel report; Avveckling av kaernkraftverk i USA - en reserapport

    Energy Technology Data Exchange (ETDEWEB)

    Efraimsson, H.; Lindhe, J.C.; Malmqvist, L.; Lund, I.; Welleman, E

    1999-03-01

    This report summarises information and impressions from a journey in north-east USA. The purpose of the journey was to study the on-going decommissioning of nuclear power plants - mainly how it is regulated by the competent authorities, but also how it is performed in practice. The journey included visits at the US Nuclear Regulatory Commission, the company Duke Engineering and Services, and the two nuclear power plants Haddam Neck and Maine Yankee

  7. USA relvastab araabia maid miljardite dollaritega / Kunnar Kukk

    Index Scriptorium Estoniae

    Kukk, Kunnar

    2007-01-01

    USA välisminister Condoleezza Rice ja kaitseminister Robert Gates tegid visiidi Saudi-Araabiasse. Arvatakse, et nad on pehmendamas katastroofi, mis järgneks USA vägede järk-järgulisele taandumisele Iraagist. USA kavatseb anda Pärsia riikidele sõjalist abi, et tuua Iraan kolmepoolsetele läbirääkimistele. Lisa: Kodusõda võib olla vältimatu

  8. The Characteristics of the Systems of Continuing Pedagogical Education in Great Britain, Canada and the USA

    Directory of Open Access Journals (Sweden)

    Mukan Nataliya

    2016-06-01

    Full Text Available In the article the systems of continuing pedagogical education in Great Britain, Canada and the USA have been characterized. The main objectives are defined as the theoretical analysis of scientific-pedagogical literature, which highlights different aspects of the problem under research; identification of the common and distinctive features of the systems of continuing pedagogical education in Great Britain, Canada, the USA. The legislative and normative framework of teachers’ CPD in Great Britain, Canada and the USA has been highlighted; the levels of the systems of continuing pedagogical education have been presented; the main functions of these systems have been determined; the key models, forms and methods of teachers’ CPD have been defined. Foreign and domestic scientists have studied the teachers’ CPD: teacher leadership (T. Bush, M. Clement, D. Jackson, D. Pavlou, R. Venderberghe, models, forms and methods of teachers’ CPD (L. Chance, A. Hollingsworth, D. Ross, E. Villegas-Reimers, non-formal teachers’ CPD (J. Scheerens. The research methodology comprises theoretical (logical, induction and deduction, comparison and compatibility, structural and systematic, analysis and synthesis and applied (observations, questioning and interviewing methods. The research results have been presented.

  9. Kriisis USA valis, Euroopa rõõmustas / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    Maailma reaktsioonidest Barack Obama valimisel USA uueks presidendiks. Vt. samas: Osariikide referendumid; Obama otsib kaastöötajaid; Katkeid maailma riigijuhtide õnnitlustest Barack Obama presidendiks valimise puhul

  10. USA erisaadik : USA investorid Eestis rahul / J. Frank Mermoud ; interv. Sirje Rank

    Index Scriptorium Estoniae

    Mermoud, J. Frank

    2004-01-01

    Ameerika Ühendriikide välisministri nõunik ja erisaadik majandusküsimustes kiidab Eesti edu, räägib USA investorite rahuolust Eesti majanduskeskkonnaga ja väljendab muret Euroopa Liidu kavade pärast maksude ühtlustamiseks

  11. Bark and Ambrosia Beetles Show Different Invasion Patterns in the USA.

    Directory of Open Access Journals (Sweden)

    Davide Rassati

    Full Text Available Non-native bark and ambrosia beetles represent a threat to forests worldwide. Their invasion patterns are, however, still unclear. Here we investigated first, if the spread of non-native bark and ambrosia beetles is a gradual or a discontinuous process; second, which are the main correlates of their community structure; third, whether those correlates correspond to those of native species. We used data on species distribution of non-native and native scolytines in the continental 48 USA states. These data were analyzed through a beta-diversity index, partitioned into species richness differences and species replacement, using Mantel correlograms and non-metric multidimensional scaling (NMDS ordination for identifying spatial patterns, and regression on distance matrices to test the association of climate (temperature, rainfall, forest (cover area, composition, geographical (distance, and human-related (import variables with β-diversity components. For both non-native bark and ambrosia beetles, β-diversity was mainly composed of species richness difference than species replacement. For non-native bark beetles, a discontinuous invasion process composed of long distance jumps or multiple introduction events was apparent. Species richness differences were primarily correlated with differences in import values while temperature was the main correlate of species replacement. For non-native ambrosia beetles, a more continuous invasion process was apparent, with the pool of non-native species arriving in the coastal areas that tended to be filtered as they spread to interior portions of the continental USA. Species richness differences were mainly correlated with differences in rainfall among states, while rainfall and temperature were the main correlates of species replacement. Our study suggests that the different ecology of bark and ambrosia beetles influences their invasion process in new environments. The lower dependency that bark beetles have

  12. Emergency braking systems for commercial vehicles in various markets shown for Europe and the USA; Marktspezifische Notbremssysteme im Nutzfahrzeug am Beispiel Europa und USA

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, Karsten; Hoffmann, Guido; Sandkuehler, Dirk [WABCO, Hannover (Germany)

    2008-07-01

    Today the main focus of driver assistance in commercial vehicles changes from pure comfort systems to safety related systems. Currently most development work is taking place for collision avoidance and collision mitigation systems, which is caused by various initiatives of the legislation organizations around the world. Since the world's markets have differing requirements, those systems are varying in their concept and design. In the following course a concept for autonomous braking in collision immanent situations and its different implementations are shown for systems in Europe and the USA. Especially the different integration into the vehicle electronic architecture and the brake control is described. (orig.)

  13. Main: 1GHR [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1GHR 大麦 Barley Hordeum vulgare l. Lichenase Ii Precursor Hordeum Vulgare 1,3-1,4-Be... T.P.J.Garrett J.N.Varghese, T.P.J.Garrett, P.M.Colman, L.Chen, P.J.Hoj, G.B.Fincher The Three-Dimensional S...cities Proc.Nat.Acad.Sci.Usa V. 91 2785 1994 EMBL; M13237; AAA32962.1; -.|PIR; A25455; A25455.|PDB; 1AQ0; X-...YGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAATPANARFYNQHLINHVGRGTPRHPGAIETYIFAMFNENQKDSGVEQNWGLFYPNMQHVYPINF barley_1GHR.jpg ...

  14. Läbikatsumine USA lennujaamades riivab siin tehtavast vähem / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2010-01-01

    USA sisejulgeoleku ministeeriumi privaatsuse ja andmekaitse juht Mary Ellen Callahan kinnitab, et USA-sse reisivate inimeste krediitkaardiandmeid kasutatakse vaid elektroonilise reisi autoriseerimise süsteemi jaoks ning andmeid säilitab USA rahandusministeerium. Ta on arvamusel, et USA-s on kehaskannerite kasutamisel reisija privaatsuse kaitse parem kui Euroopas

  15. The Industrial Organization of Congress in USA and Spain: A Comparative Institutional Analysis

    Directory of Open Access Journals (Sweden)

    Gonzalo Caballero Miguez

    2006-03-01

    Full Text Available The institutional and organizational details framing legislative processes are key aspects for understanding how Congresses work. From a new institutional economics perspective, this paper comparatively examines how the Spanish and USA Congresses are organized. The main purpose of the paper is to unveil the so-called “black box” factors operating in each case. The role played by property rights, hierarchy, individual deputies, leadership, transactions costs and committees will be researched. Whereas committees and decision-making rules based on a property rights system are key factors for understanding how the Congress performs in USA; in the Spanish case the most relevant explanatory factors are strong party leadership and the hierarchical rules by which political parties and parlamentary groups are organized.

  16. INTELLECTUAL INVESTMENT. THE PROSPECTS IN EDUCATION IN THE USA AND IN THE EU

    Directory of Open Access Journals (Sweden)

    LOREDANA-IOANA PRIBAC

    2010-01-01

    Full Text Available This paper approaches a few theoretical issues related to the investments in intellectual capital and those in human capital, these investments influencing education system and society. As a particular case, we have analysed the education prospects for the next ten years in the USA and in the European Union, the education system being one of the most important immaterial investments, with a decisive impact over the society we live in. The main conclusion is this: a tendency of increase in the number of individuals who will hold a higher education diploma, both in the USA and in the European Union. In other words, the decrease in the number of secondary school graduates and high school graduates is desired.

  17. Maine Students Learn to Appreciate Diversity.

    Science.gov (United States)

    Flood, Pamela S.

    1994-01-01

    The Maine studies program at a rural Maine middle school begins in the sixth grade and expands through the eighth grade. Students camp out, explore Maine's geography, and learn about themselves, their state's history, and the state's diverse populations. Two multischool programs, Exchanging Maine's Cultures and the Curriculum Integration…

  18. Short history of PACS. Part I: USA

    Energy Technology Data Exchange (ETDEWEB)

    Huang, H.K., E-mail: hkhuang@aol.com [Departments of Radiology and Biomedical Engineering, University of Southern California (United States); Hong Kong Polytechnic University (Hong Kong); Shanghai Institute of Technical Physics, Chinese Academy of Sciences (China)

    2011-05-15

    This historical review covers the PACS development in the USA during the past 28 years from 1982 to 2010. General historical remarks of PACS and international scene in three stages from infancy, puberty to adolescence are presented. Early PACS development was mostly financed by the federal government including the National Institutes of Health (NIH) and the U.S. Army Medical Research and Materiel Command. PACS evolution went through several stages. The earliest stages included the definition of large-scale PACS, establishment of the DICOM and other standards, the development of some early key PACS related technologies, and PACS implementation strategies. The later stages were in the concept of enterprise PACS, IHE (Integrating the Healthcare Enterprise) workflow profiles, and ePR with image distribution. The current most excited accomplishment is in the development of the new field in medical imaging informatics. This review goes through these stages and events in the USA during these 28 years, whenever an event involved participants from other countries, the contributors are cited.

  19. 77 FR 27082 - StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc., 1250 H Street, Greeley, CO...

    Science.gov (United States)

    2012-05-08

    ... Employment and Training Administration StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc... December 28, 2010, applicable to workers and former workers of StarTek USA, Inc., Greeley, Colorado. The...Tek USA, Inc. facilities in Greeley, Colorado (the ``west'' center at 244 Dundee Avenue and...

  20. FY2015 Analysis of the Teamwork USA Program. Memorandum

    Science.gov (United States)

    Howard, Mark

    2015-01-01

    The Department of Research and Evaluation (DRE) has completed an analysis of the performance of students who participated in the Teamwork USA Program, administered in FY2014 at three District schools. Teamwork USA hopes to improve student achievement at select Title I elementary schools via its Instrumental Music Program grant. This memorandum to…

  1. Continental Tire to Build New Tire Plant in USA

    Institute of Scientific and Technical Information of China (English)

    Yuan Ye

    2012-01-01

    According to Tire Comments of USA, Continental Tire earlier announced that in order to meet the increasing market demand on replacement tires of USA, German Tire Company had negotiated and reached an agreement on production capacity expansion with the South Carolina Government.

  2. USA üritab leida Teherani agente Iraagist / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2007-01-01

    USA süüdistab Iraani, et see abistab Iraagis mahdiste, mida juhib Muqtada al-Sadri. Autori sõnul on Iraani eliitüksuse Qudsi korpuse koostööd al-Sadriga aga sama vähe tõestatud kui omal ajal USA väidet Saddam Husseini ja al-Qaida vahel

  3. Valitsus vaeb USA viisavabadusenõudeid / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2008-01-01

    USA viisavabaduse aluseks oleva vastastikuse mõistmise memorandumi projekt on täna valitsuse istungi päevakorras. Tšehhi ja USA on juba sõlminud kahepoolse memorandumi, mõnedel hinnangutel on Tšehhi järele andnud kogu ameeriklaste nõudmiste paketile. Lisa: Andmekaitsjad pole viimase seisuga kursis

  4. USA kliimamuutuse vastu: Kopenhaagenis ja edaspidi / Michael C. Polt

    Index Scriptorium Estoniae

    Polt, Michael C., 1954-

    2009-01-01

    Käsitledes Kopenhaageni kliimakonverentsi, märgib USA Eesti-suursaadik, et USA on valmis paika panema eesmärgi vähendada kohalike seadustega kooskõlas 2020. aastaks kasvuhoonegaaside heitmete emissiooni tasemeni, mis oleks 17% väiksem 2005. aasta tasemest

  5. Oletus : USA luurevanglad on Poolas ja Rumeenias / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2005-01-01

    USA ajalehe Washington Post andmeil hoiab USA terrorismis kahtlustavaid Ida-Euroopa riikides. Poola ajalehe allikate väitel on üks neist riikidest Poola. Poola, Rumeenia, Bulgaaria tõrjuvad kahtlustusi, Tšehhi väitel on ameeriklaste palvele vange majutada ära öeldud

  6. Mexico/USA. Magtkamp om muren er i gang

    DEFF Research Database (Denmark)

    Gelardi, Maiken

    2017-01-01

    Trump skaber nervøsitet i Mexico. Men vil et svagere Mexico få uoverskuelige konsekvenser for USA?......Trump skaber nervøsitet i Mexico. Men vil et svagere Mexico få uoverskuelige konsekvenser for USA?...

  7. 78 FR 44531 - Corporation for Travel Promotion (dba Brand USA)

    Science.gov (United States)

    2013-07-24

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE International Trade Administration Corporation for Travel Promotion (dba Brand USA) AGENCY: International Trade... Promotion (dba Brand USA). The purpose of the Board is to guide the Corporation for Travel Promotion...

  8. 77 FR 38039 - Corporation for Travel Promotion (dba Brand USA)

    Science.gov (United States)

    2012-06-26

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF COMMERCE International Trade Administration Corporation for Travel Promotion (dba Brand USA) AGENCY: International Trade... membership on the Board of Directors of The Corporation for Travel Promotion (Board) (dba Brand USA)....

  9. 78 FR 53728 - Corporation for Travel Promotion (dba Brand USA)

    Science.gov (United States)

    2013-08-30

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE International Trade Administration Corporation for Travel Promotion (dba Brand USA) AGENCY: International Trade... Promotion (dba Brand USA). The purpose of the Board is to guide the Corporation for Travel Promotion...

  10. Ruslands betændte forhold til USA

    DEFF Research Database (Denmark)

    Skak, Mette

    2015-01-01

    Rusland udgør en anden stormagtsudfordring for USA. Rusland er en stormagt i forfald, som imidlertid har genopfundet sin gamle sovjetiske 'Manifest Destiny'.......Rusland udgør en anden stormagtsudfordring for USA. Rusland er en stormagt i forfald, som imidlertid har genopfundet sin gamle sovjetiske 'Manifest Destiny'....

  11. Siin ta siis ongi: USA õnnelikem inimene / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Uuringufirma Gallup ja tervise edendamisele pühendunud ettevõtte Healthways poolt läbiviidud uuringu käigus saadi teada, milline on statistiliselt USA kõige õnnelikum inimene. Ajaleht New York Times võttiski aluseks Gallupi andmed ja otsis üles statistilistelt näitajatelt kõige õnnelikuma USA inimese, kelleks osutus Alwin Wong

  12. Distribution, hosts and identification of Meloidogyne partityla in the USA

    Science.gov (United States)

    Pecan, Carya illinoensis, is an economically important nut crop and member of the Juglandaceae native to the southern USA. Discovered in South Africa in 1986, Meloidogyne partityla was first found infecting pecan in USA in 1996 and currently occurs in Texas, New Mexico, Georgia, Arizona, Oklahoma a...

  13. Basque Diaspora in the USA and Language Maintenance

    Science.gov (United States)

    Lasagabaster, David

    2008-01-01

    The Basques first immigrated on a large scale to the USA during the Gold Rush of 1848. After immigrating to the USA, they settled in pockets throughout the West, especially in California, Nevada and Idaho, and it is currently estimated that more than 35,000 Basque-Americans live in these three states. This represents one of the largest…

  14. USA ja EL vähendavad kaubandustõkkeid / Kertu Ruus

    Index Scriptorium Estoniae

    Ruus, Kertu, 1977-

    2005-01-01

    Tippkohtumisel Washingtonis arutasid Euroopa Komisjoni president Jose Manuel Barroso ja USA president George W. Bush, kuidas EL-i ja USA majandussuhteid vabamaks muuta. Diagramm: EL-i kaubavahetus USA-ga

  15. Ameerikat sõtta õhutanud Iraagi prominent kaotas USA soosingu / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Iraaklase Ahmed Chalabi tegevusest ja lubadustest USA Iraagi-vastase sõja alustamiseks. USA toetuse kahanemisest Chalabile ja süüdistustest, et ta andis salajast infot Iraanile USA vägede tegevuse kohta Iraagis

  16. USA politoloogid : Obama võit oleks ka Eesti oma / Laura Vetik

    Index Scriptorium Estoniae

    Vetik, Laura

    2008-01-01

    USA politoloogide sõnul oleks pingestunud Venemaa ja USA suhete taustal Eestile kasulikum, kui 56. USA presidendivalimised võidaks demokraat Barack Obama. Erinevate politoloogide hinnanguid. Vt. samas: Obama ja McCain loovad kabinette

  17. Vaiksed professionaalid USA erivägedes on tulevased liidrid / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    USA eriüksuste juhid kinnitavad esiterrorist Osama bin Ladeni peatset tabamist. Floridas Tampas asuvast USA Lähis-Ida operatsioonide peastaabist. Lisa: USA erioperatsioonide keskused. Vt. samas: Ameerika pikk ja väsitav sõda

  18. President Meri näitas USA-le vabaduse ilu / Daniel Fried ; interv. Kaarel Kaas

    Index Scriptorium Estoniae

    Fried, Daniel, 1952-

    2006-01-01

    USA abivälisminister Daniel Fried USA välispoliitika ühest eesmärgist - demokraatia levitamisest maailmas, demokraatia olukorrast Venemaal ning USA ja Venemaa vahelistest suhetest. Lisa: Daniel Fried

  19. 30 CFR 57.6160 - Main facilities.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Main facilities. 57.6160 Section 57.6160...-Underground Only § 57.6160 Main facilities. (a) Main facilities used to store explosive material underground... facilities will not prevent escape from the mine, or cause detonation of the contents of another...

  20. [Murder. Italy-USA comparative profiles].

    Science.gov (United States)

    Palermo, George B; Mastronardi, Vincenzo

    2012-01-01

    This paper, through illustrative cases of homicidal typologies, examines the generally accepted theories on the subject: 1) sociological ones by Lorenz to Sutherland and Cressey, by Berkowitz to Wolfgang and Ferracuti and others; 2) neurobiological ones, which include the involvement of the limbic, hippocampal and parietal lobes of the brain; 3) the psychological (psychodynamic) ones which are not disjoint from the types of individual criminal homicide and related aspects. In the discussion of the types of murders, family and extrafamilial murders are then taken into consideration, with the various meanings of revenge, challenge, other reasons linked to robbery, theft, settling scores leading to youth gangs and drive-by-shootings of marginalized adolescents, crimes related to drugs and to mental disorders. Infanticide and multiple murder, including mass murder and serial killer, conclude the work together with the statistics of murders and family murders in Italy compared to USA, specifically to the crime clock.

  1. Paragonimus kellicotti flukes in Missouri, USA.

    Science.gov (United States)

    Lane, Michael A; Marcos, Luis A; Onen, Nur F; Demertzis, Lee M; Hayes, Ericka V; Davila, Samuel Z; Nurutdinova, Diana R; Bailey, Thomas C; Weil, Gary J

    2012-08-01

    Paragonimiasis is an infection caused by lung flukes of the genus Paragonimus. In Asia, P. westermani infections are relatively common because of dietary practices. However, in North America, cases of paragonimiasis, which are caused by P. kellicotti flukes, are rare. Only 7 autochthonous cases of paragonimiasis were reported during 1968-2008. In 2009, we reported 3 new case-patients with paragonimiasis who had been seen at our medical center over an 18-month period. Six additional case-patients were identified in St. Louis, Missouri, USA, and treated at Washington University-affiliated health centers in 2009-2010. We report detailed descriptions of these case-patients, which includes unusual clinical manifestations. We also describe public health interventions that were undertaken to inform the general public and physicians about the disease and its mode of transmission.

  2. Review: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008 Buchbesprechung: Grigoleit, Grit: Integrationsvarianten. Die Hmong in den USA (2008

    Directory of Open Access Journals (Sweden)

    Hans-Bernd Zöllner

    2009-07-01

    Full Text Available Review of the monograph: Grigoleit, Grit (2008, Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 pages Besprechung der Monographie: Grigoleit, Grit (2008, Integrationsvarianten. Die Hmong in den USA, Passau: Verlag Karl Stutz, ISBN 978-3-88849-183-2, 250 Seiten

  3. Synthetic Pattern of Fish Diversity in Alabama, USA

    Directory of Open Access Journals (Sweden)

    Chen, X.

    2006-12-01

    Full Text Available The state of Alabama has a rich fish fauna. Analyzing the current distributional patterns of fish diversity by synthesizing information and integrating different spatial and temporal scales is important for understanding the underlying mechanisms of diversity and making strategies for fish conservation. Basing the study on long-term intensive samples (9,244 collections of fish species at 3,716 field stations across Alabama from 1845 to 1994, I analyzed the general pattern of fish diversity in Alabama at the county level. The results indicate that more than half the area of Alabama has high fish diversity, including fish species endemic to the USA. Most of the counties with the highest fish diversity are in southwestern Alabama. Nonnative fish species occurred mainly in the southernmost counties, such as Mobile and Baldwin. Twelve counties have the rare species which has only one occurence location in each country, with Lauderdale County having the most (10 rare species; the counties with the rare species are generally distributed at the four corner areas of the state boundaries, particularly on the northern and southern boundaries. A high positive correlation exists between species diversity and endemic species, but there is no significant correlation between species diversity and diversification. Both Power-law and logarithmic relationships exist between class of species diversity and its frequency; counties with higher fish diversity tend to have low human-population densities, and are located at or nearby the Alluvial-deltaic Plain and Gulf Coast floodplain.

  4. eLearning in the USA: The Standard? The Benchmark?

    Directory of Open Access Journals (Sweden)

    Rolf Schulmeister

    2007-07-01

    Full Text Available More than 3 million enrolments in online courses in the USA are reported by American sources. The essay investigates the role of online studies within the American educational system and tries to find out more about the exact meaning of these extremely high figures. The research discovers astonishing facts and relations: Public schools offer more online courses (82% than private schools, and 52% of all online courses are offered by 2-year colleges for the associate degrees (and only 8% for the bachelor. A majority of online courses fulfill the role as "remedial courses" that serve for "credit recovery" (U.S. department of Education.The quality of these courses is not very high. This applies to the use of media as well as to the didactic concept. The teaching staff mainly consists of hired part-time lecturers who are still at the very entrance level to an academic career.The essay wants to initiate a discussion about the question if the European study system is in danger to imitate the shortcomings and consequences of the American educational system, because the European system is approximating the American due to recent political decisions. Can we still pursue the aims that we proclaimed when starting with eLearning, if in future eLearning will have to be used to repair the consequences of the bachelor?

  5. Iowa valus hoop Hillary Clintonile segas USA presidendivalimistel kaarte / Liisi Poll

    Index Scriptorium Estoniae

    Poll, Liisi, 1980-

    2008-01-01

    USA presidendivalimiste eelvalimistel võitis demokraat Barack Obama. Presidendikandidaatide seisukohtadest. Tabel: USA presidendivalimised. Tulemused Iowas. Vt. samas: Tähtsaimaks osutusid majandus ja Iraagi sõda

  6. Medierne tager stilling : de amerikanske mediers rolle under USA's krige i det tyvende århundrede

    DEFF Research Database (Denmark)

    Pedersen, Carl George

    2005-01-01

    USA ; medier ; krige ; nyhedsformidling ; journalistik ; pressedækning ; krigsjournalistik ; historie......USA ; medier ; krige ; nyhedsformidling ; journalistik ; pressedækning ; krigsjournalistik ; historie...

  7. 76 FR 65710 - Decision and Order Amending Waivers Granted to Mitsubishi Electric & Electronics USA, Inc. From...

    Science.gov (United States)

    2011-10-24

    ... Electric & Electronics USA, Inc. From the Department of Energy Commercial Package Air Conditioner and Heat... Matter of: Mitsubishi Electric & Electronics USA, Inc. (Mitsubishi) (Case No. CAC-037). Background...

  8. MAIN FACTORS DRIVING SOCIAL PUBLIC SERVICES IN INTERNATIONAL CONTEXT

    Directory of Open Access Journals (Sweden)

    Mihaela, GHENTA

    2014-03-01

    Full Text Available Literature and the latest reports point out that not only in Europe, but all over the world there is a growing demand for social services. As social needs have diversified, the number of potential users of social services has increased and this has generated increased complexity of social services. This paper highlights some of the results of a study conducted by the author in the doctoral studies program. One of the aims of this study was to identify the main factors that cause the current configuration of social services at global level. The research analysed the demographic changes and the impact of the crisis in social services for Europe, the United States of America (USA and Japan based on statistical data provided by the national statistics institutes for the regions considered. The results highlight the necessity of continuous development and reconfiguration of social services in order to meet the social and economic demands and to ensure a better organisation of these type of services.

  9. Main results of the 4th International PIV Challenge

    Science.gov (United States)

    Kähler, Christian J.; Astarita, Tommaso; Vlachos, Pavlos P.; Sakakibara, Jun; Hain, Rainer; Discetti, Stefano; La Foy, Roderick; Cierpka, Christian

    2016-06-01

    In the last decade, worldwide PIV development efforts have resulted in significant improvements in terms of accuracy, resolution, dynamic range and extension to higher dimensions. To assess the achievements and to guide future development efforts, an International PIV Challenge was performed in Lisbon (Portugal) on July 5, 2014. Twenty leading participants, including the major system providers, i.e., Dantec (Denmark), LaVision (Germany), MicroVec (China), PIVTEC (Germany), TSI (USA), have analyzed 5 cases. The cases and analysis explore challenges specific to 2D microscopic PIV (case A), 2D time-resolved PIV (case B), 3D tomographic PIV (cases C and D) and stereoscopic PIV (case E). During the event, 2D macroscopic PIV images (case F) were provided to all 80 attendees of the workshop in Lisbon, with the aim to assess the impact of the user's experience on the evaluation result. This paper describes the cases and specific algorithms and evaluation parameters applied by the participants and reviews the main results. For future analysis and comparison, the full image database will be accessible at http://www.pivChallenge.org URL"/> .

  10. Hierarchy in industrial structure: The cases of China and the USA

    Science.gov (United States)

    Hu, Fei; Zhao, Shangmei; Bing, Tao; Chang, Yiming

    2017-03-01

    Although several studies have investigated the industrial structure from the perspective of network, the focus is mainly on the identification of key sectors, and little is known about the hierarchical structure, and its impact on economic performance. Using the World Input-Output Tables (WIOTs), this paper performs a comparative study of the hierarchy in industrial structures of China and the USA. Specifically, the hierarchy is generally confirmed in the networks of industrial structure, although in different levels for China and the USA: the level of hierarchy in industrial structure of the USA is much higher than that of China. To intuitively comprehend the evolution over time in a much visualized way, we also present the backbone network of industrial structure via minimum spanning tree (MST), leading to interesting insights about the origins of hierarchy. Further, the impact of the hierarchy in network on economic performance is also explored, and the result suggests that a hierarchy of a moderate range might be better for economic growth.

  11. Comparing forest fragmentation and its drivers in China and the USA with Globcover v2.2

    Science.gov (United States)

    Li, M.; Mao, L.; Zhou, C.; Vogelmann, J.E.; Zhu, Z.

    2010-01-01

    Forest loss and fragmentation are of major concern to the international community, in large part because they impact so many important environmental processes. The main objective of this study was to assess the differences in forest fragmentation patterns and drivers between China and the conterminous United States (USA). Using the latest 300-m resolution global land cover product, Globcover v2.2, a comparative analysis of forest fragmentation patterns and drivers was made. The fragmentation patterns were characterized by using a forest fragmentation model built on the sliding window analysis technique in association with landscape indices. Results showed that China's forests were substantially more fragmented than those of the USA. This was evidenced by a large difference in the amount of interior forest area share, with China having 48% interior forest versus the 66% for the USA. China's forest fragmentation was primarily attributed to anthropogenic disturbances, driven particularly by agricultural expansion from an increasing and large population, as well as poor forest management practices. In contrast, USA forests were principally fragmented by natural land cover types. However, USA urban sprawl contributed more to forest fragmentation than in China. This is closely tied to the USA's economy, lifestyle and institutional processes. Fragmentation maps were generated from this study, which provide valuable insights and implications regarding habitat planning for rare and endangered species. Such maps enable development of strategic plans for sustainable forest management by identifying areas with high amounts of human-induced fragmentation, which improve risk assessments and enable better targeting for protection and remediation efforts. Because forest fragmentation is a long-term, complex process that is highly related to political, institutional, economic and philosophical arenas, both nations need to take effective and comprehensive measures to mitigate the

  12. Ameerika suursaadik Aldona Sofia Wos : toon kättpidi USA suurfirmad Eestisse / Aldona Zofia Wos ; interv. Airi Ilisson

    Index Scriptorium Estoniae

    Wos, Aldona Zofia

    2005-01-01

    USA suursaadik Eestis vastab küsimustele, mis on seotud Londonis USA riigidepartemangu korraldatud konverentsiga, kus Balti riikide juhid rääkisid USA ettevõtete esindajatele, miks tuleks investeerida Balti riikidesse. USA tehtud investeeringutest Eestisse, Eesti ettevõtjate võimalustest USA-s. Lisa: Tõhus rahapüüdja

  13. About the treaty of complete nuclear test ban: the USA between unilateralism and multilateralism; A propos du traite sur l'interdiction complete des essais nucleaires: les Etats-Unis entre l'unilateralisme et le multilateralisme

    Energy Technology Data Exchange (ETDEWEB)

    Sur, S. [Universite Pantheon-Assas, 75 - Paris (France); Centre Thucydide, Analyse et Recherche en Relations Internationales, 75 - Paris (France)

    2000-07-01

    This article analyses the possible reasons that have led the US Senate to reject the treaty of comprehensive nuclear test ban. Even if this decision did not retained the attention of the international public opinion, it appears as surprising because the USA have worked a lot for the elaboration of this treaty and were considered as the main beneficiaries of it. Three interpretations are proposed by the author: some purely internal disputes inside Clinton's administration, a real will of the USA to abandon the arms control policy, or an intermediate attitude which allows the USA to act on different levels and to get rid of common rules. (J.S.)

  14. Developing and Implementing Climate Change Adaptation Options in Forest Ecosystems: A Case Study in Southwestern Oregon, USA

    OpenAIRE

    Jessica E. Halofsky; Peterson, David L.; Kerry L. Metlen; M. Gwyneth Myer; V. Alaric Sample

    2016-01-01

    Climate change will likely have significant effects on forest ecosystems worldwide. In Mediterranean regions, such as that in southwestern Oregon, USA, changes will likely be driven mainly by wildfire and drought. To minimize the negative effects of climate change, resource managers require tools and information to assess climate change vulnerabilities and to develop and implement adaptation actions. We developed an approach to facilitate development and implementation of climate change adapt...

  15. 78 FR 34701 - Maine Disaster #ME-00037

    Science.gov (United States)

    2013-06-10

    ... ADMINISTRATION Maine Disaster ME-00037 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of Maine dated 05/30/2013. Incident: Commercial and Residential Building Complex Fire. Incident Period: 05/03/2013. Effective Date:...

  16. 78 FR 34701 - Maine Disaster #ME-00036

    Science.gov (United States)

    2013-06-10

    ... ADMINISTRATION Maine Disaster ME-00036 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a notice of an Administrative declaration of a disaster for the State of Maine dated 05/30/2013. Incident: Apartment Complex Fire. Incident Period: 04/29/2013. Effective Date: 05/30/2013. Physical...

  17. Maine's Employability Skills Program

    Science.gov (United States)

    McMahon, John M.; Wolffe, Karen E.; Wolfe, Judy; Brooker, Carrie

    2013-01-01

    This Practice Report describes the development and implementation of the "Maine Employability Skills Program," a model employment program developed by the Maine Division for the Blind and Visually Impaired (DBVI). The program was designed to support the efforts of the chronically unemployed or underemployed. These consumers were either…

  18. Riigikogu maine ja armastus / Aune Past

    Index Scriptorium Estoniae

    Past, Aune, 1954-

    2007-01-01

    Autor arutleb Riigikogu maine üle, toetudes TÜ ajakirjanduse ja kommunikatsiooni osakonna 2007. aastal tehtud uuringu tulemustele. Riigikogu liikmete maine paraneks, kui neil endil oleks selge, mis eesmärgil Toompeale mindi ja sellest siis ka rahvale kõneldaks

  19. A BWR licensing experience in the USA

    Energy Technology Data Exchange (ETDEWEB)

    Powers, J.; Ogura, C. [Toshiba America Nuclear Energy, Charlotte, North Carolina (United States); Arai, K. [Toshiba Corporation, Yokohama, Kanagawa (Japan); Thomas, S.; Mookhoek, B., E-mail: jim.powers@toshiba.com [Nuclear Innovation North America, Lake Jackson, Texas (United States)

    2015-09-15

    The US-Advanced Boiling Water Reactor (A BWR), certified by the United States Nuclear Regulatory Commission (US NRC), is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (STP3-4) Combined License Application (Cola). Nuclear Innovation North America (Nina) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The STP3-4 project has finished the US NRC technical review of the Cola through the final meeting of the Advisory Committee on Reactor Safeguards (ACRS), and the Final Safety Evaluation Report (FSER) is scheduled to be issued by the US NRC in the middle of 2015. The next steps are to support the Mandatory Hearing process, and voting by the NRC commissioners on the motion to grant the Combined License, which is scheduled beginning of 2016 according to US NRC schedule as of March 30, 2015. This paper summarizes the history and progress of the US-A BWR licensing, including the experiences of the Licensee, Nina, and Toshiba as the Epc team worked through the Code of Federal Regulations Title 10 (10-Cfr) Part 52 process, and provides some perspectives on how the related licensing material would also be of value within a 10-Cfr Part 50, two-step process to minimize schedule and financial risks which could arise from ongoing technical developments and regulatory reviews. (Author)

  20. Professional Training of Economists in the USA

    Directory of Open Access Journals (Sweden)

    Rudnitska Kateryna

    2014-12-01

    Full Text Available The article deals with the peculiarities of American professional undergraduate and graduate training in economics. The analysis of documents, scientific and educational literature demonstrates the diversity of the US training courses and combinations of disciplines in economics. It has been defined that leading position of the USA in the world and its impact on the economic life of other countries has predetermined the development of the internationalization of economic education at the undergraduate and graduate level: by offering courses in International Economics as well as introductory programs for international Internships for students and teachers. The program of study in economics provides various forms of learning, number of major, minor and elective courses. It has been determined that economics majors include variety of courses, ranging from those which are intensely mathematical like Principles of Economics, Microeconomic, Macroeconomics and Econometrics, to more philosophical courses like History of Economic Thought. Moreover, courses in Survey Design, Political Science and Computer Science are also highly recommended and essential for future success. In order to achieve the objectives in economists' training in high school a system of new methods, means and approaches (“Chalk and Talk”, “Proficiency Approach”, “Peaconomics”, “Writing Intensive” are used to stimulate and motivate students to cognitive functions. The educational process and control by teachers through traditional and innovative techniques provides effective feedback.

  1. News and Features Updates from USA.gov

    Data.gov (United States)

    General Services Administration — Stay on top of important government news and information with the USA.gov Updates: News and Features RSS feed. We'll update this feed when we add news and featured...

  2. Film teeb USA valmistumise Iraagi okupatsiooniks maatasa / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Dokumentaalfilm "Lõppu ei ole näha" ("No End in Sight") : autor ja režissöör professor Charles Ferguson : Ameerika Ühendriigid 2007. Lisa: USA vead Iraagis. Vt. samas: Sunniidid lahkusid Iraagi valitsusest

  3. CIA salalennud varjutasid USA-Saksa kohtumist / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Saksa välisministri Frank-Walter Steinmeieri visiidist Washingtoni. Vahetult enne välisministri visiiti selgus, et USA Luure Keskagentuuri salalennukid terrorismisõjas vahistatutega võisid maanduda ka Saksamaal

  4. USA kuulas pealt Chiraci kõnesid / Riina Tallo

    Index Scriptorium Estoniae

    Tallo, Riina

    2004-01-01

    Prantsusmaal ilmuva Henri Vernet' ja Thomas Cantaloube'i raamatu väitel kuulas USA Iraagi kriisi kulmineerudes regulaarselt pealt Prantsusmaa presidendi Jacques Chiraci ja tema kaastöötajate telefonikõnesid Elysee' lossis.

  5. Reson 8101 Backscatter imagery of Penguin Bank, Molokai, Hawaii, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Backscatter imagery extracted from gridded bathymetry of Penguin Bank, Molokai, Hawaii, USA. These data provide almost complete coverage between 0 and 100 meters....

  6. USA andis Venemaale vastulöögi / Argo Ideon

    Index Scriptorium Estoniae

    Ideon, Argo, 1966-

    2011-01-01

    USA välisministeerium teatas, et ühendriigid peatavad teatud kohustuste täitmise Venemaa suhtes Euroopa tavarelvade leppe (CFE) raames, sest Venemaa ei ole viimase nelja aasta jooksul lepet täitnud. Euroopa tavarelvade lepe

  7. Biochar in the USA. Starting new methods for green energy

    Energy Technology Data Exchange (ETDEWEB)

    Meehan, Chris

    2012-07-01

    Companies in the USA develop pyrolysis and gasification systems to generate electricity from biomass and sell the by-product. Up to now it is interesting for agriculture and livestock producers. (orig.)

  8. USA paisutas mullu maailma sõjalisi kulutusi

    Index Scriptorium Estoniae

    2007-01-01

    Stockholmi rahvusvahelise rahu-uuringute instituudi (SIPRI) raporti kohaselt on kasvasid riikide kulutused relvajõududele aastaga 3,5%, viimase 10 aastaga 37%. USA relvajõududele kulus 396 miljardit

  9. Ocean Biogeographic Information System (OBIS) - USA Dataset Collection

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — OBIS-USA provides aggregated, interoperable biogeographic data collected primarily from U.S. waters and oceanic regions--the Arctic, the Atlantic and Pacific...

  10. Wikileaks Soomes: USA huvitus Venest ja iseloomustas poliitikuid / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Ajalehes Helsingin Sanomat avaldatud ülevaadetest USA diplomaatide memodest, mis lekkisid Wikileaksi kaudu ja mis puudutavad Soome välispoliitikat, kokkupuuteid Venemaaga, hinnanguid Soome tipp-poliiitikutele

  11. Eesti ja USA kaitsekoostöö saab uue aluspaberi

    Index Scriptorium Estoniae

    2017-01-01

    Valitsus kiitis eilsel istungil heaks Eesti ja Ameerika Ühendriikide valitsuse kaitsekoostöö kokkuleppe ning volitas kaitseminister Margus Tsahknat allkirjastama selle USA suursaadikuga Eestis. Leppe peab ratifitseerima ka riigikogu

  12. Ocean Biogeographic Information System (OBIS) - USA Dataset Collection

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — OBIS-USA provides aggregated, interoperable biogeographic data collected primarily from U.S. waters and oceanic regions--the Arctic, the Atlantic and Pacific oceans,...

  13. USA politsei valusad küsimused / Eve Tisler

    Index Scriptorium Estoniae

    Tisler, Eve

    2015-01-01

    Ameerika Ühendriikide õiguskaitseorganite viimase aja suurimad probleemid on seotud süüdistustega, et USA politsei kasutab oma töös liigset jõudu ja teeb seda eelkõige mustanahaliste inimestega suheldes

  14. USA valitsus sõdib New Yorgi suurlehega / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    New York Timesi tembeldamine USA ebapatriootlikemaks ajaleheks, sest see uuris Bushi administratsiooni salajasi jälgimisprogramme, on tekitanud küsimuse, kas tegu pole poliitilise aktsiooniga õõnestada lehe usaldusväärsust

  15. USA ärgitab Saddami eksiili saatma / Sten A Hankewitz

    Index Scriptorium Estoniae

    Hankewitz, Sten A., 1979-

    2003-01-01

    USA kaitseminister Donald Rumsfeld, välisminister Colin Powell ja riikliku julgeoleku nõunik Condoleezza Rice toetavad ideed saata Iraagi president Saddam Hussein eksiili. Iraagi erisaadik lükkas selle võimaluse tagasi

  16. Ämari baas sobib USA-le ja brittidele

    Index Scriptorium Estoniae

    2013-01-01

    Eelmisel nädalal Eestit külastanud USA ja Ühendkuningriigi sõjalised esindajad NATO juures kindralleitnandid David R. Hogg ja Christopher Harper kinnitasid, et on valmis oma lennukeid Ämari baasist opereerima

  17. Terroriekspert kujutab USA valitsust fanaatilise grupina / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    USA terroriekspert Richard Clarke maalib oma mälestustekogus "Against All Enemies" Bushi administratsioonist pildi kui kohe ametisse astumise järel fanaatiliselt Iraagi-vastaseid samme sepitsema hakanud grupist. Lisa: Neli presidenti terrori-raamatus

  18. Gridded bathymetry of Barbers Point, Oahu Hawaii, USA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gridded bathymetry (1m) of Barbers Point ship grounding site, Oahu, Hawaii, USA. The data include multibeam bathymetry from the Reson 8101 multibeam sonar collected...

  19. USA Kongressi raport kritiseerib orkaan Katrinale reageerimist / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 14. veebr. lk. 7. USA Kongressi raport kritiseerib kõikide võimutasandite tegutsemist orkaan Katrina põhjustatud katastroofi ajal. Lisa: Kõigi läbikukkumine

  20. USA järelevalve e-side üle maailmas tugevneb / Tõnis Arnover

    Index Scriptorium Estoniae

    Arnover, Tõnis, 1952-

    2007-01-01

    USA Kongress võttis vastu seaduse, mis annab eriteenistustele suurema tegutsemisvabaduse rahvusvahelise e-side jälgimisel ning nõuab USA-d külastavate viisavabade riikide ärimeestelt eelinfot oma tegevuse kohta. Lisa: USA-s heakskiidetud terrorismivastased abinõud

  1. USA salajane riigiametnike komisjon võib panna ka oma kodanikud tapanimekirja / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Jeemenis USA droonirünnakus hukkunud Anwar al-Awlaki, keda USA valitsusesindajad nimetasid al-Qaida talendiotsijaks ja värvatute motiveerijaks, oli väidetavalt esimene USA kodanik, kes oli pandud USA vastu võitlevate terroristide nn. tapanimekirja

  2. Iraagis on surma saanud juba 2000 USA sõjaväelast / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    USA-s suri 2000. sõjaväelane Iraagis saadud haavadesse. Kui USA juhitud välismaiste relvajõudude esindaja Bagdadis kutsus meediat seda arvu mitte üle tähtsustama, siis USA meedia seevastu pidas seda just oluliseks märgiks. Diagrammid: Iraagi sõja inimkaotused

  3. USA kindral ei soovita sõjalist kohalolekut Iraagis niipea vähendada / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2007-01-01

    USA vägede juhataja Iraagis David Petraeus ja suursaadik Iraagis Ryan Cocker käsitlesid USA Esindajatekoja relvajõudude ja väliskomitee ühisistungil olukorda Iraagis ja USA sõjalist kohalolekut. Nad soovisid Kongressilt USA vägede säilitamist enam-vähem praegusel tasemel kuni 2008. aasta suveni

  4. Clinton: USA kaotab infosõjas Hiina, Venemaa ja Al Jazeeraga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    USA välisministri Hillary Clintoni hinnangul on USA propaganda nõrgenenud ning USA mõjuvõim väheneb pidevalt. H. Clintoni vastusest Senati väliskomisjonis senaator Richard Lugari küsimusele USA pingutustest diplomaatilise kommunikatsiooni vallas

  5. 78 FR 14400 - Southern USA Resources, Inc., Order of Suspension of Trading

    Science.gov (United States)

    2013-03-05

    ... COMMISSION Southern USA Resources, Inc., Order of Suspension of Trading March 1, 2013. It appears to the... securities of Southern USA Resources, Inc. (``Southern USA'') because of questions regarding the accuracy of... company's outstanding shares. Southern USA's securities are quoted on the OTC Link, operated by...

  6. Evaluation and comparison of present R and D for the production of syngas from biomass in the USA and Finland - Kaasutusalkoholit

    Energy Technology Data Exchange (ETDEWEB)

    Hannula, I. (VTT Technical Research Centre of Finland, Espoo (Finland)), e-mail: ilkka.hannula@vtt.fi

    2011-11-15

    The main objective of this project is to assess the current status of syngas technology in the USA and to identify novel process configurations that have the potential to increase overall efficiency of biomass based syngas technology. The project involves genuine international co-operation in a significant field of Finnish energy technology. (orig.)

  7. Pesticides et toxicité chez l'abeille - USA

    OpenAIRE

    Johnson, Reed M.; Marion D Ellis; Mullin, Christopher A.; Frazier, Maryann

    2010-01-01

    International audience; Until 1985 discussions of pesticides and honey bee toxicity in the USA were focused on pesticides applied to crops and the unintentional exposure of foraging bees to them. The recent introduction of arthropod pests of honey bees, Acarapis woodi (1984), Varroa destructor (1987), and Aethina tumida (1997), to the USA have resulted in the intentional introduction of pesticides into beehives to suppress these pests. Both the unintentional and the intentional exposure of ho...

  8. Main aspects of geothermal energy in Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Hiriart, G.; Gutierrez-Negrin, L.C.A. [Comision Federal de Electridad, Morelia (Mexico)

    2003-12-01

    With an installed geothermal electric capacity of 853 MW{sub e}, Mexico is currently the third largest producer of geothermal power worldwide, after the USA and the Philippines. There are four geothermal fields now under exploitation: Cerro Prieto, Los Azufres, Los Humeros and Las Tres Virgenes. Cerro Prieto is the second largest field in the world, with 720 MW{sub e} and 138 production wells in operation; sedimentary (sandstone) rocks host its geothermal fluids. Los Azufres (88 MW{sub e}), Los Humeros (35 MW{sub e}) and Las Tres Virgenes (10 MW{sub e}) are volcanic fields, with fluids hosted by volcanic (andesites) and intrusive (granodiorite) rocks. Four additional units, 25 MW{sub e} each, are under construction in Los Azufres and due to go into operation in April 2003. One small (300 kW) binary-cycle unit is operating in Maguarichi, a small village in an isolated area with no link to the national grid. The geothermal power installed in Mexico represents 2% of the total installed electric capacity, but the electricity generated from geothermal accounts for almost 3% of the national total. (author)

  9. Lihtrahvast "solvanud" Obama sai elitisti maine / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2008-01-01

    USA demokraatide presidendikandidaat Barack Obama ütles San Franciscos toimunud rahakogumisüritusel, et väikelinnade inimesed on majandusraskuste tõttu kibestunud ning klammerduvad seetõttu relvade ja religiooni külge

  10. Bush võitleb tugeva presidendi maine nimel / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 13. juuni 2007, lk. 5. USA president George W. Bush pidi sekkuma immigratsioonireformi debatti. Vt. samas: Malta ja Rootsi nõuavad sisserändajate jagamist

  11. USA Is Concerned to the Oil of Middle East

    Energy Technology Data Exchange (ETDEWEB)

    Hong, S.M. [Korea Institute of the Mideast Economies, Seoul (Korea)

    2002-02-01

    USA has increased its power on the international oil market since Gulf War. As USA secures the hegemony in Middle East region, USA has helped the return of Majors, which had been lost after 1970s, and Saudi Arabia, the biggest oil producing country, positively follows USA. A new change of the international oil market has been actualized by forming a long-term alliance between USA and Saudi Arabia, a major component of the change, and it is characterized by a kind of geopolitical substance. After 30 years since the ruling power of US oil companies in the international oil market was damaged and actually removed, finally, the ruling axis of the international oil market is to completely return to the original position. The hegemony of USA has been reconfirmed. In the powerful politics and the economical cooperation for the interests related to the international oil, the basic intervene of Saudi Arabia will be proved as thee most powerful force among the effective and long-term systems, which they established in the past.

  12. Hillshades for the main 8 Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These hillshade datasets were derived from USGS 7.5' DEM Quads for the main 8 Hawaiian Islands. Individual DEM quads were first converted to a common datum, and...

  13. Libraries in Maine: MedlinePlus

    Science.gov (United States)

    ... 602-2386 http://www.une.edu/library/ Lewiston Bates College Ladd Library 48 Campus Avenue Lewiston, ME 04240-6087 207-786-6471 http://abacus.bates.edu/Library/ Central Maine Medical Center Gerrish-True ...

  14. Alcid Nesting Habitat on the Maine Coast

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Maine supports an extensive seabird population because of the abundance of relatively inaccessible rocky coastal islands which are ideal nesting grounds for many...

  15. Distributed PV Adoption in Maine Through 2021

    Energy Technology Data Exchange (ETDEWEB)

    Gagnon, Pieter; Sigrin, Ben

    2015-11-06

    NREL has used its dSolar (distributed solar) model to generate low-medium-high estimates of distributed PV adoption in Maine through 2021. This presentation gives a high-level overview of the model and modeling results.

  16. Superconducting magnets for the LHC main lattice

    CERN Document Server

    Rossi, L

    2004-01-01

    The main lattice of the Large Hadron Collider (LHC) will employ about 1600 main magnets and more than 4000 corrector magnets. All superconducting and working in pressurized superfluid helium bath, these impressive line of magnets will fill more than 20 km of the underground tunnel. With almost 70 main dipoles already delivered and 10 main quadrupoles almost completed, we passed the 5% of the production and now all manufacturers have fully entered into series production. In this paper the most critical issues encountered in the ramping up in such a real large scale fabrication will be addressed: uniformity of the coil size and of prestress, special welding technique, tolerances on curvature (dipoles) or straightness (quadrupoles) and of the cold mass extremities, harmonic content and, most important, the integrated field uniformity among magnets. The actual limits and the solution for improvements will be discussed. Finally a realistic schedule based on actual achievements is presented.

  17. Mercury in bird eggs from coastal Maine

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Maine's coastal islands and beaches provide important nesting habitat for piping plover (Charadrius melodus), least tern (Sterna antillarum), common tern (Sterna...

  18. Station Management Plan Maine Coastal Refuges

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This management plan outlines how four Maine refuges and twelve islands and one peninsula should be managed over the next three to five years. Plan results are...

  19. Main Development Targets for CNOOC in 2000

    Institute of Scientific and Technical Information of China (English)

    1996-01-01

    @@ In order to obtain stable reserves and create scope economic management, the China National Offshore Oil Corporation (CNOOC) officially put forward the main development target and main sci-tech sector target of the Ninth Five-Year Plan in July, 1995. These targets aim to make CNOOC as an international group corporation,including exploration and development of oil and gas,refining, petrochemicals, chemical fertilizer, power generation, unitizing sales network of up and down stream.

  20. Molecular clusters of the main group elements

    CERN Document Server

    Driess, Matthias

    2008-01-01

    ""To summarize, Molecular Clusters of the Main Group Elements is certainly not a popular science book, nor is it a textbook; it is a very good, up-to-date collection of articles for the specialist. Als Fazit bleibt: Molecular Clusters of the Main Group Elements ist sicher kein populissenschaftliches Werk, auch kein Lehrbuch, aber eine gelungene, hoch aktuelle Zusammenstellung fen interessierten Fachmann."" -Michael Ruck, TU Dresden, Angewandte Chemie, 2004 - 116/36 + International Edition 2004 - 43/36

  1. Modeling landslide recurrence in Seattle, Washington, USA

    Science.gov (United States)

    Salciarini, Diana; Godt, Jonathan W.; Savage, William Z.; Baum, Rex L.; Conversini, Pietro

    2008-01-01

    To manage the hazard associated with shallow landslides, decision makers need an understanding of where and when landslides may occur. A variety of approaches have been used to estimate the hazard from shallow, rainfall-triggered landslides, such as empirical rainfall threshold methods or probabilistic methods based on historical records. The wide availability of Geographic Information Systems (GIS) and digital topographic data has led to the development of analytic methods for landslide hazard estimation that couple steady-state hydrological models with slope stability calculations. Because these methods typically neglect the transient effects of infiltration on slope stability, results cannot be linked with historical or forecasted rainfall sequences. Estimates of the frequency of conditions likely to cause landslides are critical for quantitative risk and hazard assessments. We present results to demonstrate how a transient infiltration model coupled with an infinite slope stability calculation may be used to assess shallow landslide frequency in the City of Seattle, Washington, USA. A module called CRF (Critical RainFall) for estimating deterministic rainfall thresholds has been integrated in the TRIGRS (Transient Rainfall Infiltration and Grid-based Slope-Stability) model that combines a transient, one-dimensional analytic solution for pore-pressure response to rainfall infiltration with an infinite slope stability calculation. Input data for the extended model include topographic slope, colluvial thickness, initial water-table depth, material properties, and rainfall durations. This approach is combined with a statistical treatment of rainfall using a GEV (General Extreme Value) probabilistic distribution to produce maps showing the shallow landslide recurrence induced, on a spatially distributed basis, as a function of rainfall duration and hillslope characteristics.

  2. Main building fire drill safely concluded

    CERN Document Server

    CERN Bulletin

    2015-01-01

    Last week, a simulated fire in the stairwell of the Main Building put CERN’s emergency response procedures to the test.   Firefighters descend the stairwell in the Main Building as the simulated fire rises.   At 2 p.m. on 22 September, alarms sounded around CERN’s Main Building as an evacuation exercise got underway. A simulated fire in the  stairwell, complete with very realistic smoke, led to the evacuation of one of the busiest places at CERN. The Main Building complex includes the Carlson Wagonlit travel agency, the post office, UBS, Uniqa, the Users Office, the Staff Association and the Novae restaurant as well as the Main Auditorium, the Council Chamber and the Charpak meeting room. It was impressive to see how quickly the smoke propagated in the staircase as well as into the corridors, and equally impressive to see how smoothly, quickly and efficiently the evacuation proceeded. The...

  3. Main Coast Winds - Final Scientific Report

    Energy Technology Data Exchange (ETDEWEB)

    Jason Huckaby; Harley Lee

    2006-03-15

    The Maine Coast Wind Project was developed to investigate the cost-effectiveness of small, distributed wind systems on coastal sites in Maine. The restructuring of Maine's electric grid to support net metering allowed for the installation of small wind installations across the state (up to 100kW). The study performed adds insight to the difficulties of developing cost-effective distributed systems in coastal environments. The technical hurdles encountered with the chosen wind turbine, combined with the lower than expected wind speeds, did not provide a cost-effective return to make a distributed wind program economically feasible. While the turbine was accepted within the community, the low availability has been a negative.

  4. Assessing the potential clinical impact of reciprocal drug approval legislation on access to novel therapeutics in the USA: a cohort study

    Science.gov (United States)

    Larochelle, Matthieu; Downing, Nicholas S; Ross, Joseph S; David, Frank S

    2017-01-01

    Objective To quantify the potential effect of reciprocal approval legislation on access to clinically impactful therapeutics in the USA. Design A cohort study. Setting New therapeutics approved by the Food and Drug Administration (FDA), European Medicines Agency (EMA) and/or Health Canada between 2000 and 2010. Main outcome measures Characteristics of new therapeutics approved by the EMA and/or Health Canada before the FDA, including mechanistic novelty, likely clinical impact, size of the affected population and FDA review outcome. Results From 2001 to 2010, 282 drugs were approved in the USA, Europe or Canada, including 172 (61%) first approved in the USA, 24 (9%) never approved in the USA, and 86 (30%) approved in the USA after Europe and/or Canada. Of the 110 new drugs approved in Europe and/or Canada before the USA, 37 (34%) had a novel mechanisms of action compared with drugs already approved by the FDA, but only 10 (9%) were for conditions lacking alternate available therapies in the USA at the time of ex-US approval—of which the majority (9/10; 90%) were indicated for rare diseases. 12 of the 37 agents with novel mechanisms of action approved first in Europe and/or Canada (32%) had their initial FDA submissions rejected for safety reasons—including 2 drugs that were ultimately withdrawn from the market in Europe due to safety concerns. Conclusions If enacted, reciprocal approval legislation would most likely benefit only a small number of US patients receiving treatment for rare diseases, and the benefit may be somewhat mitigated by an increased exposure to harms. PMID:28179418

  5. The double main sequence of Omega Centauri

    CERN Document Server

    Bedin, L R

    2004-01-01

    Recent, high precision photometry of Omega Centauri, the biggest Galactic globular cluster, has been obtained with Hubble Space Telescope. The color magnitude diagram reveals an unexpected bifurcation of colors in the main sequence (MS). The newly found double MS, the multiple turnoffs and subgiant branches, and other sequences discovered in the past along the red giant branch of this cluster add up to a fascinating but frustrating puzzle. Among the possible explanations for the blue main sequence an anomalous overabundance of helium is suggested. The hypothesis will be tested with a set of FLAMES@VLT data we have recently obtained (ESO DDT program), and with forthcoming ACS@HST images.

  6. [Risk factors of main cancer sites].

    Science.gov (United States)

    Uleckiene, Saule; Didziapetriene, Janina; Griciūte, Liudvika Laima; Urbeliene, Janina; Kasiulevicius, Vytautas; Sapoka, Virginijus

    2008-01-01

    Cancer prevention is a system of various measures devoted to avoid this disease. Primary cancer prevention means the identification, avoidance, or destruction of known risk factors. The main risk factors are smoking, diet, alcohol consumption, occupational factors, environmental pollution, electromagnetic radiation, infection, medicines, reproductive hormones, and lack of physical activity. Approximately one-third of cancers can be avoided by implementing various preventive measures. The aim of this article was to acquaint medical students, family doctors with risk factors of main cancer sites (lung, breast, colorectal, and prostate).

  7. 78 FR 42556 - Maine Yankee Atomic Power Company; Maine Yankee Atomic Power Plant Issuance of Environmental...

    Science.gov (United States)

    2013-07-16

    ... COMMISSION Maine Yankee Atomic Power Company; Maine Yankee Atomic Power Plant Issuance of Environmental..., 2011, with various implementation dates for each of the rule changes. Maine Yankee Atomic Power Company... ADAMS, which provides text and image files of NRC's public documents. If you do not have access to...

  8. Evidence-Based Redesign of the COMLEX-USA Series.

    Science.gov (United States)

    Gimpel, John R; Horber, Dorothy; Sandella, Jeanne M; Knebl, Janice A; Thornburg, John E

    2017-04-01

    To ensure that the Comprehensive Osteopathic Medical Licensing Examination-USA (COMLEX-USA) reflects the evolving practice of osteopathic medicine, the National Board of Osteopathic Medical Examiners has developed new content and format specifications for an enhanced, competency-based examination program to be implemented with COMLEX-USA Level 3 in 2018. This article summarizes the evidence-based design processes that served as the foundation for blueprint development and the evidence supporting its validity. An overview is provided of the blueprint's 2 dimensions: Competency Domains and Clinical Presentations. The authors focus on the evidence that supports interpretation of test scores for the primary and intended purpose of COMLEX-USA, which is osteopathic physician licensure. Important secondary uses and the educational and catalytic effect of assessments are also described. This article concludes with the National Board of Osteopathic Medical Examiners' plans to ensure that the COMLEX-USA series remains current and meets the needs of its stakeholders-the patients who seek care from osteopathic physicians.

  9. Evolving plans for the USA National Phenology Network

    Science.gov (United States)

    Betancourt, Julio L.; Schwartz, Mark D.; Breshears, David D.; Brewer, Carol A.; Frazer, Gary; Gross, John E.; Mazer, Susan J.; Reed, Bradley C.; Wilson, Bruce E.

    2007-01-01

    Phenology is the study of periodic plant and animal life cycle events, how these are influenced by seasonal and interannual variations in climate, and how they modulate the abundance, diversity, and interactions of organisms. The USA National Phenology Network (USA-NPN) is currently being organized to engage federal agencies, environmental networks and field stations, educational institutions, and citizen scientists. The first USA-NPN planning workshop was held August 2005, in Tucson, Ariz. (Betancourt et al. [2005]; http://www.uwm.edu/Dept/Geography/npn/; by 1 June 2007, also see http://www.usanpn.org). With sponsorship from the U.S. National Science Foundation, the U.S. Geological Survey (USGS), the U.S. Fish and Wildlife Service, and NASA, the second USA-NPN planning workshop was held at the University of Wisconsin-Milwaukee on 10–12 October 2006 to (1) develop lists of target species and observation protocols; (2) identify existing networks that could comprise the backbone of nationwide observations by 2008; (3) develop opportunities for education, citizen science, and outreach beginning in spring 2007; (4) design strategies for implementing the remote sensing component of USA-NPN; and (5) draft a data management and cyberinfrastructure plan.

  10. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, AUGUSTA COUNTY, VIRGINIA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...

  11. Fray Félix de Augusta y el Diccionario Mapuche

    Directory of Open Access Journals (Sweden)

    Andrés Gallardo

    Full Text Available El problema verdaderamente arduo aparece cuando el lexicógrafo, el autor de diccionarios, enfrenta una lengua estandarizada, que cuenta on tradición escrita, congramáticas, con diccionarios, con literatura vigente, a una lengua no escrita, no codificada de modo explícito y que sólo vive en la vibración efímera de los enunciados de sus hablantes y cuya permanencia consiste sólo en ese modo de carportarse quellaman cultura tradicional. Ahí el problema es diferente.

  12. Severe Weather Guide - Mediterranean Ports. 4. Augusta Bay

    Science.gov (United States)

    1988-03-01

    Destroyer (DDG 993) 31A1 Amphibious Command Ship LANT (2) 31B1 Amphibious Cargo Ship LANT 31G1 Amphibious Transport Ship LANT 31H1 Amphibious...GERMANY ISTITUTO UNIVERSITARIO NAVALE FACILTA DI SCIENZE NAUTICHE ISTITUTO DI METEOROLOGIA E OCEANOGRAFIA, 80133 NAPOLI - VIA AMM, ACTON, 38 ITALY

  13. Main Strategies for Autonomous Robotic Controller Design

    OpenAIRE

    Paterega, I.

    2011-01-01

    This review gives an overall introduction to the artificial evolution mechanism. It presents the main strategies for robotic controller design. It gives a review of the pertinent literature, focusing on approaches that use neural networks, evolutionary computing, and fuzzy logic. Various applications of artificial evolution in robotics are surveyed and classified.

  14. Water Hammer in Pumped Sewer Mains

    DEFF Research Database (Denmark)

    Larsen, Torben

    This publication is intended for engineers seeking an introduction to the problem of water hammer in pumped pressure mains. This is a subject of increasing interest because of the development of larger and more integrated sewer systems. Consideration of water hammer is essential for structural...

  15. Main facts 1995; Faits marquants 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations.

  16. Kommunikatsioon ja maaelu maine / Ants Laansalu

    Index Scriptorium Estoniae

    Laansalu, Ants, 1938-2011

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 156-159. Autori hinnangul mõjutas meedias EL-i põllumajanduspoliitika kohta loodud negatiivne maine oluliselt Eesti põllumajanduspoliitika kujundamist riigi tasandil kuni 2000. a. ja ettevõtlus tasandil kuni 2003. a.

  17. 76 FR 59177 - Maine Disaster #ME-00029

    Science.gov (United States)

    2011-09-23

    ... ADMINISTRATION Maine Disaster ME-00029 AGENCY: U.S. Small Business Administration. ACTION: Notice. SUMMARY: This is a Notice of the Presidential declaration of a major ] disaster for Public Assistance Only for the... Kingsport Road, Fort Worth, TX 76155. FOR FURTHER INFORMATION CONTACT: A. Escobar, Office of...

  18. 1.An Examination of Malaysia’s Structural Breaks Vis-À-Vis Japan and the USA

    Directory of Open Access Journals (Sweden)

    Md. Wahid Murad

    2012-12-01

    Full Text Available This paper primarily examines whether Malaysia has had experienced any structural breaks in comparison with its main two trading partners, namely the USA and Japan in 1970s, 1980s, 1990s and 2000s. It also discusses the implications of such structural breaks to Malaysia’s economic globalization at the international level. Using some econometric and statistical tools such as the ADF test, transformed lag equation, Chow Breakpoint test, and CUSUM test, the study reveals that only at 1% level of significance income ratio of Japan and Malaysia has had experienced structural breaks in terms ofGDP during the periods 1980s, 1990s, and 2000s. In respect of GNI, the study reveals that only at 5% level of significance their income ratio has had experienced structural breaks during these periods. The study further reveals that income ratio of the USA and Malaysia does not have any structural break both in respect of GNI and GDP.

  19. Rotor dynamic analysis of main coolant pump

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chong Won; Seo, Jeong Hwan; Kim, Choong Hwan; Shin, Jae Chul; Wang, Lei Tian [Korea Advanced Institute of Science and Technology, Taejon (Korea)

    1999-03-01

    A rotor dynamic analysis program DARBS/MCP, for the main coolant pump of the integral reactor, has been developed. The dynamic analysis model of the main coolant pump includes a vertical shaft, three grooved radial journal bearings and gaps that represent the structure-fluid interaction effects between the rotor and the lubricant fluid. The electromagnetic force from the motor and the hydro-dynamic force induced by impeller are the major sources of vibration that may affect the rotor system stability. DARBS/MCP is a software that is developed to effectively analyze the dynamics of MCP rotor systems effectively by applying powerful numerical algorithms such as FEM with modal truncation and {lambda}-matrix method for harmonic analysis. Main design control parameters, that have much influence to the dynamic stability, have been found by Taguchi's sensitivity analysis method. Design suggestions to improve the stability of MCP rotor system have been documented. The dynamic bearing parameters of the journal bearings used for main coolant pump have been determined by directly solving the Reynolds equation using FDM method. Fluid-structure interaction effect that occurs at the small gaps between the rotor and the stator were modeled as equivalent seals, the electromagnetic force effect was regarded as a linear negative radial spring and the impeller was modeled as a rigid disk with hydrodynamic and static radial force. Although there exist critical speeds in the range of operational speeds for type I and II rotor systems, the amplitude of vibration appears to be less than the vibration limit set by the API standards. Further more, it has been verified that the main design parameters such as the clearance and length of journal bearings, and the static radial force of impeller should be properly adjusted, in order to the improve dynamic stability of the rotor system. (author). 39 refs., 81 figs., 17 tabs.

  20. A geochemical atlas of North Carolina, USA

    Science.gov (United States)

    Reid, J.C.

    1993-01-01

    A geochemical atlas of North Carolina, U.S.A., was prepared using National Uranium Resource Evaluation (NURE) stream-sediment data. Before termination of the NURE program, sampling of nearly the entire state (48,666 square miles of land area) was completed and geochemical analyses were obtained. The NURE data are applicable to mineral exploration, agriculture, waste disposal siting issues, health, and environmental studies. Applications in state government include resource surveys to assist mineral exploration by identifying geochemical anomalies and areas of mineralization. Agriculture seeks to identify areas with favorable (or unfavorable) conditions for plant growth, disease, and crop productivity. Trace elements such as cobalt, copper, chromium, iron, manganese, zinc, and molybdenum must be present within narrow ranges in soils for optimum growth and productivity. Trace elements as a contributing factor to disease are of concern to health professionals. Industry can use pH and conductivity data for water samples to site facilities which require specific water quality. The North Carolina NURE database consists of stream-sediment samples, groundwater samples, and stream-water analyses. The statewide database consists of 6,744 stream-sediment sites, 5,778 groundwater sample sites, and 295 stream-water sites. Neutron activation analyses were provided for U, Br, Cl, F, Mn, Na, Al, V, Dy in groundwater and stream water, and for U, Th, Hf, Ce, Fe, Mn, Na, Sc, Ti, V, Al, Dy, Eu, La, Sm, Yb, and Lu in stream sediments. Supplemental analyses by other techniques were reported on U (extractable), Ag, As, Ba, Be, Ca, Co, Cr, Cu, K, Li, Mg, Mo, Nb, Ni, P, Pb, Se, Sn, Sr, W, Y, and Zn for 4,619 stream-sediment samples. A small subset of 334 stream samples was analyzed for gold. The goal of the atlas was to make available the statewide NURE data with minimal interpretation to enable prospective users to modify and manipulate the data for their end use. The atlas provides only

  1. THE MAIN PRINCIPLES OF TOTAL QUALITY MANAGEMENT

    Directory of Open Access Journals (Sweden)

    Andrei DIAMANDESCU

    2016-06-01

    Full Text Available Nowadays the industry is one of the main economic sectors, with a major contribution to achieving and maintaining a high rate of economic growth. The processing industry operation to high economic performance requires changes in structural terms, the re-engineering of processes and management. In this regard, one of the main actions taken at the level of companies in the manufacturing industry is the implementation of quality systems. Practicing quality management system not only allows businesses to react to changes taking place in business, but also to inflict them by the controlling of the future. This paper aims to analyze the principles of Total Quality Management – TQM and will highlight the advantages that organizations could obtain by applying each principle separately in the process of management.

  2. Spiropyran main-chain conjugated polymers.

    Science.gov (United States)

    Sommer, Michael; Komber, Hartmut

    2013-01-11

    The first main-chain conjugated copolymers based on alternating spiropyran (SP) and 9,9-dioctylfluorene (F8) units synthesized via Suzuki polycondensation (SPC) are presented. The reaction conditions of SPC are optimized to obtain materials of type P(para-SP-F8) with appreciably high molecular weights up to M(w) ≈ 100 kg mol(-1). (13)C NMR is used to identify the random orientation of the non-symmetric SP unit in P(p-SP-F8). Ultrasound-induced isomerization of P(p-SP-F8) to the corresponding merocyanine form P(p-MC-F8) yields a deep-red solution. This isomerization reaction is followed by (1)H NMR in solution using sonication, whereby the color increasingly changes to deep red. The possibility to incorporate multiple SP units into main-chain polymers significantly broadens existing SP-based polymeric architectures.

  3. Early history of the Fermilab Main Ring

    Energy Technology Data Exchange (ETDEWEB)

    Malamud, E.; /Fermilab

    1983-10-01

    This note is written in response to a request from Phil Livdahl for corrections, and additions to a TM he is writing on Staffing Levels at Fermilab during Initial Construction Years and to a note that Hank Hinterberger is preparing on milestones. In my spare time over the past few years I have taken the original files of the Main Ring Section, my own notes from that period, and various other collections of relevant paper, and arranged them in a set of 44 large loose leaf binders in chronological order. I call this set of volumes the 'Main Ring Chronological Archives'. In response to Phil's request I have recently skimmed through these records of the period and extracted a small subset of documents which relate to the specific questions that Phil is addressing: staffing. administration, and milestones.

  4. The geomagnetic main field and the geodynamo

    Science.gov (United States)

    Bloxham, Jeremy; Roberts, Paul H.

    1991-01-01

    Information available on the geomagnetic main field and the geodynamo is presented. Attention is given to the process of mapping the magnetic field, the last version of International Geomagnetic Reference Field Model, and maps of the magnetic field at the core-mantle boundary and their interpretation. Particular consideration is given to the existing geodynamo theories, with special relation given to the Braginsky and Meytlis theory of core turbulence in which the turbulence differs fundamentally from classical turbulence of Kolmogorov type.

  5. SLC5A8-Mediated Switching of STAT3 from a Pro-Oncogenic Signal into a Pro-Apoptotic Signal in Breast Cancer

    Science.gov (United States)

    2011-06-01

    and Gibson G.R. (2004). Microbial–gut interactions in health and disease. Prebiotics . Best Pract. Res. Clin. Gastroenterol. 18: 287–298. 28. Gopal...of Georgia, Georgia Health Sciences University, Augusta, GA - 30912 Abstract Slc5a8 and Stat3 expression is induced in early onset of mammary gland...Department of Biochemistry and Molecular Biology, Georgia Health Sciences University, Medical College of Georgia, Augusta, GA 30912, USA Breast cancer is

  6. Use of energy piles in the Main Tower high-rise building, Frankfurt/Main; Einsatz von Energiepfaehlen am Beispiel des Main Tower im Frankfurt am Main

    Energy Technology Data Exchange (ETDEWEB)

    Hude, N. von der [Bilfinger und Berger Bauaktiengesellschaft, Mannheim (Germany). Service Center Technik; Kapp, C. [NEK Umwelttechnik AG, Zuerich (Switzerland)

    1998-03-01

    The ``Main Tower``, with a height of 198 m, is one of Europe`s highest and most innovative office buildings. The building has a pile foundation which is at the same time a component of the energy supply concept: The piles are equipped with heat exchanger tubes, so that the soil can be utilized for heat supply down to a depth of 50 m. There are several interfaces between foundation work and technical facilities. The number of cogeneration units required for supply of the building could be reduced accordingly. (orig.) [Deutsch] Im Bankenviertel der Innenstadt von Frankfurt am Main entsteht eines der hoechsten und modernsten Buerogebaeude Europas. Der 198 m hohe Neubau des Main Tower zeichnet sich dadurch aus, dass durch die Nutzung des Energiepotentials im Untergrund ein innovatives Energiekonzept verwirklicht wird. Das Hochhaus ist auf Grossbohrpfaehlen gegruendet. Sie dienen der Lastabtragung und sind, wie die Pfaehle der ueberschnittenen Bohrpfahlwand zur Baugrubensicherung, Bestandteil des Energiekonzeptes. Die Pfaehle wurden mit Waermetauscherrohren ausgestattet, um den Boden unterhalb des Hochhauses bis in eine Tiefe von 50 m unter Gelaendeoberkante zur umweltfreundlichen Energiegewinnung zu nutzen. Daraus ergeben sich eine Vielzahl von Schnittstellen zwischen Gruendungsarbeiten und technischer Gebaeudeausruestung. Dem Bauherrn wurde es ermoeglicht, die Zahl der erforderlichen Blockheizkraftwerke zur Versorgung des Gebaeudes nennenswert zu reduzieren. (orig.)

  7. Isolated systems with wind power. Main report

    Energy Technology Data Exchange (ETDEWEB)

    Lundsager, P.; Bindner, H.; Clausen, N.E.; Frandsen, S.; Hansen, L.H.; Hansen, J.C.

    2001-06-01

    The overall objective of this research project is to study the development of methods and guidelines rather than 'universal solutions' for the use of wind energy in isolated communities. The main specific objective of the project is to develop and present a more unified and generally applicable approach for assessing the technical and economical feasibility of isolated power supply systems with wind energy. As a part of the project the following tasks were carried out: Review of literature, field measurements in Egypt, development of an inventory of small isolated systems, overview of end-user demands, analysis of findings and development of proposed guidelines. The project is reported in one main report and four topical reports, all of them issued as Risoe reports. This is the Main Report Risoe-R-1256, summing up the activities and findings of the project and outlining an Implementation Strategy for Isolated Systems with Wind Power, applicable for international organisations such as donor agencies and development banks. (au)

  8. Nitrogen chronology of massive main sequence stars

    CERN Document Server

    Köhler, K; Brott, I; Langer, N; de Koter, A

    2012-01-01

    Rotational mixing in massive main sequence stars is predicted to monotonically increase their surface nitrogen abundance with time. We use this effect to design a method for constraining the age and the inclination angle of massive main sequence stars, given their observed luminosity, effective temperature, projected rotational velocity and surface nitrogen abundance. This method relies on stellar evolution models for different metallicities, masses and rotation rates. We use the population synthesis code STARMAKER to show the range of applicability of our method. We apply this method to 79 early B-type main sequence stars near the LMC clusters NGC 2004 and N 11 and the SMC clusters NGC 330 and NGC 346. From all stars within the sample, 17 were found to be suitable for an age analysis. For ten of them, which are rapidly rotating stars without a strong nitrogen enhancement, it has been previously concluded that they did not evolve as rotationally mixed single stars. This is confirmed by our analysis, which fla...

  9. Carbonate system biogeochemistry in a subterranean estuary - Waquoit Bay, USA

    Science.gov (United States)

    Liu, Qian; Charette, Matthew A.; Breier, Crystaline F.; Henderson, Paul B.; McCorkle, Daniel C.; Martin, William; Dai, Minhan

    2017-04-01

    Quantifying carbon fluxes associated with submarine groundwater discharge (SGD) remains challenging due to the complex biogeochemistry of the carbonate system in the subterranean estuary (STE). Here we conducted time series measurements of total alkalinity (TAlk) and dissolved inorganic carbon (DIC) in a well-studied coastal aquifer (Waquoit Bay, Massachusetts, USA). Groundwater samples were collected monthly from May 2009 to June 2010 across the freshwater-saltwater mixing zone of the Waquoit Bay (WB) STE. The concentrations of both TAlk and DIC in zero-salinity groundwater were variable, but were lower than those in the bay water (S ∼ 28). DIC underwent slightly non-conservative mixing between low and intermediate salinities while there was an apparent additional DIC source at high salinity (>20) in all seasons. TAlk concentrations exhibited even stronger variations, with evidence of both production and consumption in high salinity zones, and consistent TAlk consumption at intermediate salinity in summer and fall (June-December, 2009). The increases in DIC and TAlk at high salinity were attributed to aerobic respiration and denitrification in WB sediments during bay water recharge of the STE. We infer that the loss of TAlk at intermediate salinity reflects H+ production as reduced compounds (e.g. Fe2+) are oxidized within the STE. In terms of impacts on surface water inorganic carbon budgets, the SGD-derived DIC flux was mainly controlled by seasonal changes in SGD while a combination of TAlk concentration variability and SGD drove the TAlk flux. SGD-derived DIC, aqueous CO2, and H+ fluxes to the bay were ∼40-50% higher in summer vs. in winter, a result of enhanced marine groundwater flux and significant TAlk removal (proton addition) during periods of high seawater intrusion. Furthermore, the SGD-derived DIC flux was consistently greater than TAlk flux regardless of season, indicating that SGD serves to reduce the CO2 buffering capacity of surface water. Our

  10. National Assessment of Tree City USA Participation According to Geography and Socioeconomic Characteristics

    Science.gov (United States)

    Tree City USA is a national program that recognizes municipal commitment to community forestry. In return for meeting program requirements, Tree City USA participants expect social, economic, and/or environmental benefits. Understandingthe geographic distribution and socioeconomi...

  11. USA rahatrükkimine tõstab ka Eestis hindu / Adele Pao

    Index Scriptorium Estoniae

    Pao, Adele

    2010-01-01

    USA Keskpanga otsus majanduse turgutamiseks lisaraha trükkida annab analüütikute hinnangul Eestis tunda eelkõige hinnatõusuna. USA keskpanga otsuse mõjust Saksamaa, Brasiilia, Hiina ja arenevate riikide majandusele

  12. USA kongresmen Chandler - sõber, kes aitas Eestil tunnustust leida / Eric A. Johnson, Oliver Prits

    Index Scriptorium Estoniae

    Johnson, Eric A.

    2008-01-01

    Advokaadi ja USA kongressi liikme Walter M. Chandleri (1867-1935) tegevusest Balti riikide de jure tunnustamiseks. Lisatud: USA valitsuse avaldus Balti riikide tunnustamisest ; väike elulugu : Jeesuse advokaat

  13. Child Health USA 2013: Postpartum Visit and Well-Baby Care

    Science.gov (United States)

    ... HRSA MCHB CHUSA Downloads Viewers & Players Child Health USA 2013 An illustrated collection of current and historical ... found in the print version of Child Health USA 2013 . Suggested Citation: U.S. Department of Health and ...

  14. 77 FR 70825 - Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC

    Science.gov (United States)

    2012-11-27

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC... November 5, 2012, Siegfried (USA) LLC, 33 Industrial Park Road, Pennsville, New Jersey 08070,...

  15. 78 FR 32458 - Manufacturer of Controlled Substances; Notice of Application; Siegfried USA, LLC

    Science.gov (United States)

    2013-05-30

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried USA, LLC... April 18, 2013, Siegfried USA, LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070,...

  16. Dalai-laama saab hoolimata Hiina vihahoost USA medali / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2007-01-01

    Dalai-laama saab Kongressi kuldmedali USA presidendilt George W. Bushilt, kes esimese võimul oleva USA presidendina ilmub dalai-laamaga avalikkuse ette. Hiina on teravalt reageerinud dalai-laama austamisele

  17. Alar Laneman siirdub USA-sse kaitseatašeeks / Holger Roonemaa

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2007-01-01

    Brigaadikindral Alar Lanemanist võib saada Eesti kaitseatašee USA-s. Endise kaitseministri Jürgen Ligi sõnul oli A. Laneman osaline mitmetes juhtimisvigades ning neist ühe puhul kestab senini kriminaalasi

  18. 78 FR 5500 - Manufacturer of Controlled Substances, Notice of Application; Siegfried (USA)

    Science.gov (United States)

    2013-01-25

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances, Notice of Application; Siegfried (USA... 19, 2012, Siegfried (USA), 33 Industrial Park Road, Pennsville, New Jersey 08070, made application...

  19. 78 FR 46613 - Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC

    Science.gov (United States)

    2013-08-01

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF JUSTICE Drug Enforcement Administration Manufacturer of Controlled Substances; Notice of Application; Siegfried (USA), LLC... 10, 2013, Siegfried (USA), LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070,...

  20. USA finantskriis tabas Eestit eriti halval ajal / Lemmi Kann, Kaisa Tahlfeld

    Index Scriptorium Estoniae

    Kann, Lemmi

    2008-01-01

    USA-s puhkenud finantskriis ja Euroopa jahenev majanduskliima takistab Eesti majanduse taastumist. Küsimustele vastab Eesti Panga asepresident Andres Sutt. Kommenteerivad Aare Järvan ja Rain Tamm. Diagramm: Dow Jonesi ja OMXT indeksite muutus

  1. "Disko ja tuumasõda" jõuab USA-sse

    Index Scriptorium Estoniae

    2010-01-01

    Jaak Kilmi ja Kiur Aarma dokumentaalfilm "Disko ja tuumasõda" hakkab alates 12. novembrist jooksma New Yorgi kinos Cinema Village. 26. novembrist saab filmi näha Los Angeleses. Filmi levitaja USA-s on Icarus Film

  2. USA paneb välisabi kaitsma oma huve maailmas / Markus Larsson

    Index Scriptorium Estoniae

    Larsson, Markus

    2003-01-01

    USA valitsuse raporti kohaselt tuleb riigi välisabiprogramme hakata kohandama nii, et need oleksid suunatud USA rahvuslike huvide kaitsele ning vabaduse ja julgeoleku laiendamisele kogu maailmas. USAID juhataja Andrew Natsiose seisukohti

  3. 75 FR 11937 - Ternium USA, Inc.; Shreveport, LA; Notice of Termination of Investigation

    Science.gov (United States)

    2010-03-12

    ... From the Federal Register Online via the Government Publishing Office ] DEPARTMENT OF LABOR Employment and Training Administration Ternium USA, Inc.; Shreveport, LA; Notice of Termination of..., USA, Inc., Shreveport, Louisiana. The petitioner has requested that the petition be...

  4. The main determinants affecting economic growth

    Directory of Open Access Journals (Sweden)

    Florin Teodor BOLDEANU

    2015-12-01

    Full Text Available Growth theories highlight the evolution and trends in economic thought that shaped the way economic growth is perceived. From the early works of Adam Smith and Malthus to the present day researchers have tried to find the most important determinates that influence growth by formulating new and improved theories and models. In this article we try to offer our point of view in the evolution of the main factors that have an impact on economic growth. There is still not a consensus on the key determinants of growth and an all-encompassing model that includes all the influences has not yet been elaborated.

  5. Impact of Main Macroeconomic Indicators on Happiness

    Directory of Open Access Journals (Sweden)

    Yavuz Agan

    2016-01-01

    Full Text Available The relationship between economic welfare and happiness has been compounded by different conceptualizations and statistical approaches. Economic conditions influence the welfare and social well-being of the society. While the literature indicates a positive relationship between income levels and life satisfaction, it indicates negative relationships between inflation, unemployment and life satisfaction. In this paper we analyze the relationship between main macroeconomic variables of unemployment, inflation, per capita GDP and life satisfaction using data from 57 countries. We make use of the standard regression analysis and conclude that our method is sufficient to examine the relations and the stated macro variables are significantly affecting life satisfaction towards expected directions.

  6. Space Shuttle Main Engine Public Test Firing

    Science.gov (United States)

    2000-01-01

    A new NASA Space Shuttle Main Engine (SSME) roars to the approval of more than 2,000 people who came to John C. Stennis Space Center in Hancock County, Miss., on July 25 for a flight-certification test of the SSME Block II configuration. The engine, a new and significantly upgraded shuttle engine, was delivered to NASA's Kennedy Space Center in Florida for use on future shuttle missions. Spectators were able to experience the 'shake, rattle and roar' of the engine, which ran for 520 seconds - the length of time it takes a shuttle to reach orbit.

  7. Space shuttle main engine hardware simulation

    Science.gov (United States)

    Vick, H. G.; Hampton, P. W.

    1985-01-01

    The Huntsville Simulation Laboratory (HSL) provides a simulation facility to test and verify the space shuttle main engine (SSME) avionics and software system using a maximum complement of flight type hardware. The HSL permits evaluations and analyses of the SSME avionics hardware, software, control system, and mathematical models. The laboratory has performed a wide spectrum of tests and verified operational procedures to ensure system component compatibility under all operating conditions. It is a test bed for integration of hardware/software/hydraulics. The HSL is and has been an invaluable tool in the design and development of the SSME.

  8. Isolated systems with wind power. Main report

    DEFF Research Database (Denmark)

    Lundsager, P.; Bindner, Henrik W.; Clausen, Niels-Erik;

    2001-01-01

    approach for assessing the technical and economical feasibility of isolated power supply systems with wind energy. As a part of the project the following tasks were carried out: Review of literature, fieldmeasurements in Egypt, development of an inventory of small isolated systems, overview of end......The overall objective of this research project is to study the development of methods and guidelines rather than "universal solutions" for the use of wind energy in isolated communities. The main specific objective of the project is to develop and present amore unified and generally applicable...... for Isolated Systems with Wind Power, applicable for international organisations such as donoragencies and development banks....

  9. Musculoskeletal disorders in main battle tank personnel

    DEFF Research Database (Denmark)

    Nissen, Lars Ravnborg; Guldager, Bernadette; Gyntelberg, Finn

    2009-01-01

    PURPOSE: To compare the prevalence of musculoskeletal disorders of personnel in the main battle tank (MBT) units in the Danish army with those of personnel in other types of army units, and to investigate associations between job function in the tank, military rank, and musculoskeletal problems......, and ankle. RESULTS AND CONCLUSIONS: There were only 4 women in the MBT group; as a consequence, female personnel were excluded from the study. The participation rate was 58.0% (n = 184) in the MBT group and 56.3% (n = 333) in the reference group. The pattern of musculoskeletal disorders among personnel...

  10. Period Determination of Six Main Belt Asteroids

    Science.gov (United States)

    Ferrero, Andrea

    2014-07-01

    Observations of six main-belt asteroids (MBA) produced lightcurve parameters of: 487 Venetia, P = 13.34 ± 0.01 h, A = 0.20 mag; 684 Hildburg, P = 15.89 ± 0.01 h, A = 0.22 mag; 772 Tanete, P = 8.629 ± 0.001 h, A = 0.18 mag.; 1181 Lilith, P = 15.04 ± 0.01 h, A = 0.11 mag.; 1246 Chaka, P = 25.44 ± 0.01 h, A = 0.25 mag.; and 2834 Christy Carol, P = 12.79 ± 0.01 h, A = 0.39 mag.

  11. Main Ocular Manifestations in Rheumatoid Arthritis

    Directory of Open Access Journals (Sweden)

    Sandra Saray Quignon Santana

    2009-12-01

    Full Text Available Rheumatoid arthritis is considered an autoimmune disease in which articular and extra articular manifestations are produced and contribute to alter the functional capacity of the individual. This study consists on performing a bibliographical review showing the main ocular manifestations in patients with rheumatoid arthritis. It is our purpose to give you our experiences to the students as well as the internal medicine, ophthalmology and rheumatologist residents about this topic. The ophthalmological consultation of sick patients contributes to the prevention of ocular illnesses which are characteristic of the base disease and improve the ocular health.

  12. Electrochemistry of Main-Group Phthalocyanines.

    Science.gov (United States)

    1981-07-30

    to follow a linear relationship with the function r/(ze) (radius/charge). This reltionshlp may be used to facilitate the design of photocatalysts with...ze) and a function of central metal ion has been published. We have recently completed a study of the electrochemistry of main- us n i. Figure I for...SiV 54 0.074 -540 CIA 111 67.5 0.044 915 -655 1570Experimental Secfio* CiGat el 76 0.040 865 -735 1600Clintl! 94 0.032 830 -715 1545The r.-:m grUp

  13. Impact of Main Macroeconomic Indicators on Happiness

    Directory of Open Access Journals (Sweden)

    Yavuz Agan

    2009-10-01

    Full Text Available The relationship between economic welfare and happiness has been compounded by different conceptualizations and statistical approaches. Economic conditions influence the welfare and social well-being of the society. While the literature indicates a positive relationship between income levels and life satisfaction, it indicates negative relationships between inflation, unemployment and life satisfaction. In this paper we analyze the relationship between main macroeconomic variables of unemployment, inflation, per capita GDP and life satisfaction using data from 57 countries. We make use of the standard regression analysis and conclude that our method is sufficient to examine the relations and the stated macro variables are significantly affecting life satisfaction towards expected directions

  14. A gap clearing kicker for Main Injector

    CERN Document Server

    Kourbanis, I; Biggs, J; Brown, B; Capista, D; Jensen, C C; Krafczyk, G E; Morris, D K; Scott, D; Seiya, K; Ward, S R; Wu, G; Yang, M -J

    2012-01-01

    Fermilab Main Injector has been operating at high Beam Power levels since 2008 when multi-batch slip stacking became operational. In order to maintain and increase the beam power levels the localized beam loss due to beam left over in the injection kicker gap during slip stacking needs to be addressed. A set of gap clearing kickers that kick any beam left in the injection gap to the beam abort have been built. The kickers were installed in the summer of 2009 and became operational in November of 2010. The kicker performance and its effect on the beam losses will be described.

  15. Engage the Public in Phenology Monitoring: Lessons Learned from the USA National Phenology Network

    Science.gov (United States)

    Crimmins, T. M.; Lebuhn, G.; Miller-Rushing, A. J.

    2009-12-01

    The USA National Phenology Network (USA-NPN) is a recently established network that brings together citizen scientists, government agencies, non-profit groups, educators and students of all ages to monitor the impacts of climate change on plants and animals in the United States. Though a handful of observers participated in the USA-NPN monitoring program in 2008, 2009 was the first truly operational year for the program. With a goal of 100,000 observers for this nationwide effort, we are working to engage participants both directly and through established organizations and agencies. The first year of operational monitoring and program advertisement has yielded many insights that are shaping how we move forward. In this presentation, we will highlight some of our most prominent “lessons learned” from our experience engaging participants, mainly through partnerships with organizations and agencies. One successful partnership that the USA-NPN established in 2009 was with the Great Sunflower Project, a citizen science effort focused on tracking bee activity. By piggy-backing on this established program, we were able to invite tens of thousands of self-selected individuals to learn about plant phenology and to contribute to the program. A benefit to the Great Sunflower Project was that monitoring phenology of their sunflowers gave observers something to do while waiting for the plant to attract bees. Observers’ experiences, data, and comments from the 2009 season are yielding insights into how this partnership can be strengthened and USA-NPN and GSP goals can more effectively be met. A second partnership initiated in 2009 was with the US National Park Service (NPS). Partnering with federal and state agencies offers great opportunities for data collection and education. In return, agencies stand to gain information that can directly influence management decisions. However, such efforts necessitate careful planning and execution. Together the USA-NPN and NPS drafted

  16. Causes of sinks near Tucson, Arizona, USA

    Science.gov (United States)

    Hoffmann, John P.; Pool, Donald R.; Konieczki, A. D.; Carpenter, Michael C.

    Land subsidence in the form of sinks has occurred on and near farmlands near Tucson, Pima County, Arizona, USA. The sinks occur in alluvial deposits along the flood plain of the Santa Cruz River, and have made farmlands dangerous and unsuitable for farming. More than 1700 sinks are confined to the flood plain of the Santa Cruz River and are grouped along two north-northwestward-trending bands that are approximately parallel to the river and other flood-plain drainages. An estimated 17,000m3 of sediment have been removed in the formation of the sinks. Thirteen trenches were dug to depths of 4-6m to characterize near-surface sediments in sink and nonsink areas. Sediments below about 2m included a large percentage of dispersive clays in sink areas. Sediments in nonsink areas contain a large component of medium- to coarse-grained, moderately to well sorted sand that probably fills a paleochannel. Electromagnetic surveys support the association of silts and clays in sink areas that are highly electrically conductive relative to sand in nonsink areas. Sinks probably are caused by the near-surface process of subsurface erosion of dispersive sediments along pre-existing cracks in predominantly silt and clay sediments. The pre-existing cracks probably result from desiccation or tension that developed during periods of water-table decline and channel incision during the past 100 years or in earlier periods. Résumé Des effondrements en forme d'entonnoir se sont produits sur et près d'exploitations agricoles de Pima (Arizona). Ces entonnoirs apparaissent dans les alluvions le long de la plaine d'inondation de la rivière Santa Cruz ; ils ont rendu ces terrains dangereux et inexploitables pour l'agriculture. Plus de 1700 entonnoirs existent dans la plaine d'inondation de la rivière Santa Cruz et sont groupés en deux bandes orientées nord-nord-ouest, approximativement parallèles à la rivière et aux autres chenaux de la plaine d'inondation. Un volume de sédiments estim

  17. USA on Iraagis ülbe ja rumal? / Tõnis Erilaid

    Index Scriptorium Estoniae

    Erilaid, Tõnis, 1943-

    2006-01-01

    USA välisministeeriumi ühe büroo avaliku diplomaatia direktor Alberto Fernandez tunnistas väidetavalt Al-Jazeera telekanalis esinedes, et ameeriklased olid Iraagis ülbed ja rumalad ning nüüd on vaja kõigi sealsete esindajatega läbirääkimisi pidada

  18. Bin Laden sekkus USA valimisvõitlusesse / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Terroripealik Osama bin Laden pöördus 29. oktoobril meedia vahendusel ameeriklaste poole ning märkis, et kui USA soovib vältida uusi 11. septembri laadseid rünnakuid, peab ta lõpetama moslemite julgeoleku ohustamise

  19. USA kapitalivoog jõuab Eestisse / Roland Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Roland

    2012-01-01

    Autor leiab, et on soodne hetk hakata arendama rohkem start-up ettevõtteid, kuna USA Föderaalreserv on aasta jooksul juurde trükkinud 600 miljardit dollarit ning Eesti Arengufondil ja riskikapitalifondidel nagu ASI on vajalik investeerimisraha olemas

  20. USA folkloristid tutvustavad Eestis afroameerika rahvamuusikat / Andres Roost

    Index Scriptorium Estoniae

    Roost, Andres

    2008-01-01

    9. veebruaril tutvustavad USA folkloristid Anna Lomax Wood ja Todd Dunham Harvey Eesti Kirjandusmuuseumi saalis Tartus John A. Lomaxi (1867-1948) ja Alan Lomaxi (1915-2002) kogutud afroameerika folkloori, näidatakse dokumentaalfilmi "Land Where the Blues Began"

  1. Monitoring Drosophila suzukii Matsumura in Oregon, USA sweet cherry orchards.

    Science.gov (United States)

    Drosophila suzukii rapidly became a significant cherry pest in the western United States after it was observed damaging cherries in 2009 in California. It has caused significant damage to ripening cherries in all major USA cherry production districts leading to increased management costs and reduced...

  2. Integration of GCAM-USA into GLIMPSE: Update and demonstration

    Science.gov (United States)

    The purpose of this presentation is to (i) discuss changes made to the GCAM-USA model to more fully support long-term, coordinated environmental-climate-energy planning within the U.S., and (ii) demonstrate the graphical user interface that has been constructed to construct model...

  3. Rethinking Postgraduate Geography Education in the USA: Issues and Concerns

    Science.gov (United States)

    Foote, Kenneth; Bednarz, Sarah; Monk, Janice; Solem, Michael; Stoltman, Joseph

    2012-01-01

    Postgraduate geography education in the USA is growing and changing. In recent years, the number of postgraduate programs has increased at both the doctoral and master's levels. Interest in improving and reforming doctoral education has increased dramatically both inside and outside geography, and geography has been involved in these reforms.…

  4. USA riigipeaks pürgijad saavad tuleristsed / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 28. dets. lk. 8. 2008. aasta 3. jaanuaril saavad alguse Iowa osariigis toimuval USA kohalike vabariiklaste ja demokraatide nõupidamisel viis kuud kestvad presidendikandidaatide eelvalimised. Lisa: Demokraatide seas on kaks selget liidrit, vabariiklaste seas on shansse viiel mehel. Vt. samas: Vabariiklaste must hobune

  5. Exploring Air-Climate-Energy Impacts with GCAM-USA

    Science.gov (United States)

    The Global Climate Assessment Model (GCAM) is a global integrated assessment model used for exploring future scenarios and examining strategies that address air pollution, climate change and energy (ACE) goals. My research focuseson integration of impact factors in GCAM-USA and a...

  6. Homeschooling in the USA: Past, Present and Future

    Science.gov (United States)

    Gaither, Milton

    2009-01-01

    This article first examines why the homeschooling movement in the USA emerged in the 1970s, noting the impact of political radicalism both right and left, feminism, suburbanization, and public school bureaucratization and secularization. It then describes how the movement, constituted of left- and right-wing elements, collaborated in the early…

  7. USA meedia kritiseerib Obama välispoliitikat / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2009-01-01

    ÜRO peaassambleel võeti vastu Ameerika Ühendriikide presidendi juhtimisel resolutsioon, kus kinnitatakse taas tahet muuta maailm tuumarelvavabaks, kuid USA ajakirjanikud ja poliitikud leiavad, et president ei ole maailmapoliitikas eriti midagi saavutanud. 25. septembril toimunud G20 tippkohtumisel otsustati, et globaalset majandust puudutavates küsimustes võetakse G8-lt juhiroll üle

  8. Euroopa tootjad ei ole rahul USA survega / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2006-01-01

    Seoses USA survega Euroopa turgude avanemiseks ning probleemidega Brasiilia toidukaupade ekspordi osas, kutsub üleeuroopalise põllumajandustootjate liit COPA ja põllumajandustööandjate organisatsioonide liit COGECA Euroopa valitsusjuhte üles lõpetama järeleandmiste tegemise

  9. Titanium Technology in the USA-an Overview

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The state of Ti research, development and industry is reviewed in this article. The fifty-year anniversary of Ti technology commercialization in the USA provides an opportunity for a historical perspective. Incorporation of "information-age" tools into alloy development, processing, and production invigorates the technology. Consolidation, diversification and globalization have been transforming the Ti industry in the recent years.

  10. USA kriitikud pärjasid Clint Eastwoodi / A. F.

    Index Scriptorium Estoniae

    A. F.

    2006-01-01

    USA rahvuslik filmikriitikute ühing (National Society of Film Critics) valis aasta parimaks filmiks Clint Eastwoodi "Kirjad Iwo Jimalt" ("Letters from Iwo Jima"), parimaks režissööriks Martin Scorsese ja parimaks võõrkeelseks filmiks Pedro Almodovari "Tagasitulek" ("Volver"). Sõnumis on ekslikult Iowa pro Iwa ja Almadovar pro Almodovar

  11. The Current Landscape of the School Librarianship Curricula in USA

    Science.gov (United States)

    Yi, Kwan; Turner, Ralph

    2014-01-01

    The current landscape of the School Librarianship educational programs and curricula of master's degrees in the USA has been explored. The master's programs are currently offered in the following four venues: (1) programs that are American Library Association (ALA) accredited but not American Association of School Librarians (AASL) recognized,…

  12. 75 FR 24369 - Law Day, U.S.A., 2010

    Science.gov (United States)

    2010-05-05

    ...#0;#0; ] Proclamation 8511 of April 29, 2010 Law Day, U.S.A., 2010 By the President of the United States of America A Proclamation For over two centuries, our Nation has adhered to the rule of law as the foundation for a safe, free, and just society. President Eisenhower, seeking to formally recognize...

  13. USA300 Methicillin-resistant Staphylococcus aureus in Cuba

    Directory of Open Access Journals (Sweden)

    Hopman Joost

    2012-01-01

    Full Text Available Abstract Background Methicillin-resistant Staphylococcus aureus is an increasing problem in the Caribbean. We investigated the molecular epidemiology of MRSA isolates on Cuba. Findings The predominant clone was of the spa type t149, followed by community-associated MRSA USA300. Conclusions We report the first molecular typing results of MRSA isolates from Cuba.

  14. Sourcing USA Summit Engages Global Cotton Industry Leaders

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    From November 9-12,the"6th Biennial Sourcing USA Summit,"organized by Cotton Council International and Cotton Incorporated and with the support of the U.S.cotton industry and USDA, took place at Terranea in Rancho Palos Verdes,

  15. President Ilves töövisiidil USAs

    Index Scriptorium Estoniae

    2009-01-01

    President Toomas Hendrik Ilves alustas töövisiiti USA läänerannikul, teadus- ja kõrgtehnoloogia keskuses Silicon Valley's. Riigipea kohtus ka San Francisco linnapea Gavin Newsom'iga ja Stanfordi Ülikooli rektori John L. Hennessy'ga. Vabariigi President töövisiidil Ameerika Ühendriikides 9.-16.06.2009

  16. San Juan Basin, USA; coalbed methane development and production

    Energy Technology Data Exchange (ETDEWEB)

    Gluskoter, H. [US Geological Survey, Reston, VA (USA)

    2002-07-01

    Twenty one slides/overheads outline the talk on production of coalbed methane from sedimentary basins in the USA. Figures are given for production and reserves for the year 2000. The San Juan basin's geologic structure, containing resources of the Cretaceous coal age, primarily in the Fruitland Formation, is described. 4 refs.

  17. Protecting nature : organizations and networks in Europe and the USA.

    NARCIS (Netherlands)

    Koppen, van C.S.A.; Markham, W.T.

    2007-01-01

    This book offers a comparative analysis of organizations and networks involved in nature protection in France, Germany, Italy, the Netherlands, Norway, Poland, Sweden, the UK and the USA. It traces their development from their origins, more than a century ago, to the present day. Throughout this per

  18. Vaccinia virus infections in martial arts gym, Maryland, USA, 2008.

    Science.gov (United States)

    Hughes, Christine M; Blythe, David; Li, Yu; Reddy, Ramani; Jordan, Carol; Edwards, Cindy; Adams, Celia; Conners, Holly; Rasa, Catherine; Wilby, Sue; Russell, Jamaal; Russo, Kelly S; Somsel, Patricia; Wiedbrauk, Danny L; Dougherty, Cindy; Allen, Christopher; Frace, Mike; Emerson, Ginny; Olson, Victoria A; Smith, Scott K; Braden, Zachary; Abel, Jason; Davidson, Whitni; Reynolds, Mary; Damon, Inger K

    2011-04-01

    Vaccinia virus is an orthopoxvirus used in the live vaccine against smallpox. Vaccinia virus infections can be transmissible and can cause severe complications in those with weakened immune systems. We report on a cluster of 4 cases of vaccinia virus infection in Maryland, USA, likely acquired at a martial arts gym.

  19. Bush lubas Bagdadi rohkem USA sõdureid / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 28. juuli lk. 10. Iraagi peaministri Nuri Kamal al-Maliki USA visiidist, mille käigus ilmnesid kahe riigi vahelised erimeelsused, kokku lepiti lisajõudude saatmises Bagdadi. Lisa: Bagdadi julgeolek

  20. Julma USA sõdurit ootab elu vanglas / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2011-01-01

    USA sõjavägi hakkab mõistma kohut veebel Calvin Gibbsi üle, keda peetakse afgaani tsiviilisikuid tapnud ja ohvrite laipu rüvetanud jõugu eestvedajaks. Calvin Gibbs eitab kõiki talle esitatud süüdistusi

  1. USA kiidetud noise-rock Eestis / Annika Haas

    Index Scriptorium Estoniae

    Haas, Annika

    2008-01-01

    Müra-rock'i viljelevast USA duost Magik Markers (ansambel osaleb režissöör Veiko Õunapuu uue mängufilmi "Püha Tõnu kiusamine" võtetel ja annab kaks kontserti - 13. nov. Tallinnas klubis Tapper ja 15. nov. Tartus klubis Trehv)

  2. USA sepitseb uusi plaane Iraani mahasurumiseks / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Kommenteerides ÜRO ja Iraani tuumakõneluste ummikseisust väljumise võimalusi, tunnistas USA välisministeeriumi poliitikanõunik Nicholas Burns, et diplomaatia abil on keeruline veenda Iraani loobuma tuumatehnoloogia väljatöötamisest

  3. Kas maailm vajab USA-vastast allianssi? / Mihhail Gorbatshov

    Index Scriptorium Estoniae

    Gorbatšov, Mihhail, 1931-

    2007-01-01

    Kasvanud on Brasiilia, Venemaa, India ja Hiina majanduslik võimsus ja poliitiline tähtsus, neid riike ei saa enam kohelda maailmaasjades alandavalt, ütleb autor. USA püüdlustest võtta endale maailma liidriroll ja rakendada seda peamiselt sõjaliste vahenditega

  4. Plagiarism Litigation Trends in the USA and Australia

    Science.gov (United States)

    Mawdsley, Ralph D.; Cumming, J. Joy

    2008-01-01

    In this article we explore the increasing complexity of plagiarism litigation in the USA and Australia. Plagiarism has always been a serious academic issue and academic staff and students have wrestled with its definition and appropriate penalties for some time. However, the advent of the Internet and more freely accessible information resources,…

  5. USA ajakirjaniku teos paljastab CIA nõrkusi / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 30. juuli 2007, lk. 6. New York Timesi ajakirjanik Tim Weiner annab oma äsjailmunud raamatus "Legacy of ashes: the history of the USA" põhjaliku ülevaate CIA ajaloost. Lisa: CIA läbikukkumiste jada

  6. 76 FR 25527 - Law Day, U.S.A., 2011

    Science.gov (United States)

    2011-05-05

    ...#0;#0; ] Proclamation 8665 of April 29, 2011 Law Day, U.S.A., 2011 By the President of the United States of America A Proclamation At the core of our Nation's values is our faith in the ideals of equality and justice under law. It is a belief embedded in our most cherished documents, and honored...

  7. USA sõdib terrorismi vastu sobimatul moel / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2008-01-01

    Mõttekoja Rand Corporation analüüsi kohaselt ei piisa USA-l islamiekstremistidega võitlemisel vaid vägede suurendamisest, panustada tuleb kohalike võimude tõhustamisse, nende paremasse koolitamisse ja infovahetusse. Lisa: Guantanamo kuuik kohtu all

  8. Kuhu USAs investeerida, kui võidab...? / Mati Feldmann

    Index Scriptorium Estoniae

    Feldmann, Mati, 1961-

    2008-01-01

    Autor analüüsib investorite investeerimisvõimalusi sõltuvalt sellest, kas USA presidendivalimised võidab Barack Obama või John McCain. Vt. samas: Investoritel oleks mõttekas investeerida sõltuvalt võitjast

  9. USAs on kõik veel lahtine / Kertu Ruus

    Index Scriptorium Estoniae

    Ruus, Kertu, 1977-

    2008-01-01

    USA presidendivalimiste praeguses etapis võistlevad omavahel demokraatidest senaatorid Hillary Clinton ja Barack Obama, vabariiklastest tõusis esile senaator John McCain. Vt. samas: Katre Pilvinski. Politoloog: Eestil on kõvasti McCaini ja Clintoniga vedanud

  10. Opsigtsvækkende nyt om derivater fra USA

    DEFF Research Database (Denmark)

    Thinggaard, Frank

    1997-01-01

    Der er opsigsvækkende nyt fra USA om den regnskabsmæssige behandling af derivater som terminskontrakter, futures, optioner, swaps m.v. Glem alt om historiske anskaffelsespriser. For derivater er der kun ét mål, som kan bruges: markedsværdier (fair-values). Glem alt om snakken om 'off-balance-sheet...

  11. Õhuvägi loobus USA pakutud lennukitest

    Index Scriptorium Estoniae

    2016-01-01

    Eesti õhuvägi loobus USA poolt kingituseks pakutud kahest sõjaväe transportlennukist Sherpa C-23B+. Põhjalikuma analüüsi tulemusel on kaalumisel alternatiivsed variandid ja Sherpasid õhuvägi praeguse seisuga kasutusse ei võta, ütles kaitseväe peastaabi pressiesindaja

  12. Comparing Teacher Dispositions in China and the USA

    Science.gov (United States)

    Shao, Kun; Tamashiro, Roy

    2013-01-01

    In studies conducted in the USA, teacher dispositional factors such as enthusiasm, professional esteem and learning motivation often emerge as the most significant variables affecting student learning and achievement from the primary grades through higher education. Do these factors play as significant a role in student learning and achievement in…

  13. Knemidocoptic Mange in Wild Golden Eagles, California, USA

    Centers for Disease Control (CDC) Podcasts

    2014-09-21

    Dr. Mike Miller reads an abridged version of the article, Knemidocoptic Mange in Wild Golden Eagles, California, USA .  Created: 9/21/2014 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 10/15/2014.

  14. Trichinella surveillance in black bears (Ursus americanus) from Oregon, USA.

    Science.gov (United States)

    Mortenson, J A; Kent, M L; Fowler, D R; Chomel, B B; Immell, D A

    2014-01-01

    We used serology and muscle digestion to test black bears (Ursus americanus) from western Oregon, USA, for Trichinella. Results indicate black bears in Oregon are not part of a sylvatic cycle for Trichinella, and risk of human exposure to Trichinella larvae from eating black bear meat from Oregon appears low.

  15. Status and migration of irrigation in the USA

    Science.gov (United States)

    Irrigated agriculture produces 49% of crop market value on 18% of cropped lands in the USA. Irrigation is essential to the most highly productive, intensely managed, and internationally competitive sectors of our agricultural economy, which play a key role in meeting growing global food, fiber, and ...

  16. Miks USA ründab Iraani? / Gwynne Dyer

    Index Scriptorium Estoniae

    Dyer, Gwynne

    2006-01-01

    Ilmunud ka: Molodjozh Estonii 6. märts lk. 12. 20. märtsil avab Iraan uue börsi, kus kõik maad saavad osta ja müüa naftat ja gaasi mitte ainult dollarite, vaid ka eurode eest, selle mõju USA finantspositsioonile

  17. Järelkajad Eesti presidendi visiidist USA-sse

    Index Scriptorium Estoniae

    2006-01-01

    Töövisiit Ameerika Ühendriikidesse 17.-21.01.2006. Ülevaade president Arnold Rüütli USA-vsiidist, kohtumisest San Francisco ja Sunnyvale'i linnapeadega, investor Steve Jürvetsoniga, kohalike väliseestlastega, külaskäigust Silicon Valley tehnoloogiaettevõtetesse, California Ülikooli biotehnoloogia uurimiskeskusesse

  18. Duck Hunters’ Perceptions of Risk for Avian Influenza, Georgia, USA

    OpenAIRE

    Dishman, Hope; Stallknecht, David; Cole, Dana

    2010-01-01

    To determine duck hunters’ risk for highly pathogenic avian influenza, we surveyed duck hunters in Georgia, USA, during 2007–2008, about their knowledge, attitudes, and practices. We found they engage in several practices that could expose them to the virus. Exposures and awareness were highest for those who had hunted >10 years.

  19. Duck hunters' perceptions of risk for avian influenza, Georgia, USA.

    Science.gov (United States)

    Dishman, Hope; Stallknecht, David; Cole, Dana

    2010-08-01

    To determine duck hunters'risk for highly pathogenic avian influenza, we surveyed duck hunters in Georgia, USA, during 2007-2008, about their knowledge, attitudes, and practices. We found they engage in several practices that could expose them to the virus. Exposures and awareness were highest for those who had hunted >10 years.

  20. Napier ootab USA aktsiatelt 30% tõusu / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2010-01-01

    Prantsusmaa suurpanga Credit Agricole üksuse CLSA strateegi Russell Napieri arvates on USA aktsiad karjuvalt madalalt hinnatud võrrreldes aktsiate dividendide ja ettevõtete kasumitega. Investeerimisel on tema soosingus kõrge dividenditootlusega aktsiad. Tema arvates hakkavad võlakirja tootlused järjekindlalt tõusma

  1. Experiencing Second-Wave Feminism in the USA

    Science.gov (United States)

    Biklen, Sari; Marshall, Catherine; Pollard, Diane

    2008-01-01

    How has feminism mattered in the lives of particular academic feminists? Three scholars in education whose careers developed during the era of second-wave feminism describe how their personal and political stances were affected by theories, methodological advances, the milieus of academia as well as legal, and political events in the USA. The…

  2. USA sõdurid tulevad Paidesse ja Türile

    Index Scriptorium Estoniae

    2015-01-01

    USA laseb Eestisse toodud Strykeri soomukitel läbi kuue riigi Saksamaale kodubaasi sõita. 1700-kilomeetrise retke eesmärk on näidata nii eurooplastele kui ka Venemaale, et NATO suudab sõjatehnikat kiiresti ja lihtsalt üle riigipiiride liigutada. Peatutakse ka Paides ja Türil

  3. MAIN TOPICS,ABSTRACTS & KEY WORDS

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    Design and implementation of a power control system for electron beam welder HE Shaojia, LI Jianling, MO Jinhai, LI Haibiao (School of Mechanical & Electrical Engineering, Guilin University of Electronic Technology, Guilin 541004, China). ppl-5, 12 Abstract: Stability of output voltage of high-voltage accelerating stabilized power supply for electron beam welder (EBW) is a prerequisite to ensure the electron beam welding quality. The common power supplies have the disadvantages of circuit complexity and bulkiness. A novel control system of higholtage accelerating stabilized power supply for EBW was designed. Its main circuit is based on pulse-width modulation (PWM) buckboost converter topology. Compared with common EBW power supplies, this new power supply requires a much lower voltage grade transformer because of the converter's effect for rising voltage, so its volume is smaller and the circuit is simpler. The sys- tem main circuit characteristics and its working process were analyzed. The system circuit's small-signal mathematical model was created, and lag-lead correction compensation control was em- ployed in the system to achieve static and dynamic performance requirements. The results displayed that this unit had the characteristics of fast response, high reliability, high control precision and anti-interference capability.

  4. Main areas of the national economy modernization

    Directory of Open Access Journals (Sweden)

    Valeriy Anatolyevich Tsvetkov

    2011-06-01

    Full Text Available This paper shows the concept of modernization, its main areas related to the commodity sector and transport infrastructure are identified, it is proposed to consider the application in relation to the modernization of modernization of the commodity sector. The author connects the need to modernize the Russian economy with the task of doubling GDP, correcting structural imbalances, reducing the technological gap with the developed world, overcoming social polarization in income, fighting inflation and smoothing the growth of inter-regional contrasts. The aim of modernizing the Russian economy is to achieve high competitiveness of the national economy, which would put the Russian Federation in terms of living standards among the most developed countries, and would provide a decent position in the world. The fact that "breakthrough" sectors of the sixth technological structure cannot be the starting point of modernization is substantiated. The concept of national competitiveness is reviewed. The lack of a complete model of modernization in the world is highlighted. Two main areas in relation to the modernization of the Russian Federation are identified: modernization of the commodity sector, which should represent applied modernization based on the comparative advantages of the Russian economy; with respect to functionally interrelated industries (fuel and energy complex and the oil-gas and upgrading of transport infrastructure, which is so effective because of unique transit facilities and prospects of Russia.

  5. Debris disks in main sequence binary systems

    CERN Document Server

    Trilling, D E; Stapelfeldt, K R; Rieke, G H; Su, K Y L; Gray, R O; Corbally, C J; Bryden, G; Chen, C H; Boden, A; Beichman, C A

    2006-01-01

    We observed 69 A3-F8 main sequence binary star systems using the Multiband Imaging Photometer for Spitzer onboard the Spitzer Space Telescope. We find emission significantly in excess of predicted photospheric flux levels for 9(+4/-3)% and 40(+7/-6)% of these systems at 24 and 70 microns, respectively. Twenty two systems total have excess emission, including four systems that show excess emission at both wavelengths. A very large fraction (nearly 60%) of observed binary systems with small (<3 AU) separations have excess thermal mission. We interpret the observed infrared excesses as thermal emission from dust produced by collisions in planetesimal belts. The incidence of debris disks around main sequence A3-F8 binaries is marginally higher than that for single old AFGK stars. Whatever combination of nature (birth conditions of binary systems) and nurture (interactions between the two stars) drives the evolution of debris disks in binary systems, it is clear that planetesimal formation is not inhibited to a...

  6. USA ärritab Poolat ideega ehitada raketikilp hoopis Leetu / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2008-01-01

    Kuigi USA ja Poola vahel jätkuvad läbirääkimised raketikilbi üle, on rahvusvahelisse meediasse imbunud oletus, et USA võib raketikilbi paigutada hoopis Leetu. Poola asevälisministri Witold Waszczykowski hinnangul kasutab USA Leedut survestusvahendina. Nii Leedu välisministeerium kui ka USA-poolne kõneluste juht John Rood kinnitavad, et raketikilbiküsimust on riigid omavahel arutanud

  7. Afganistan ja USA tülitsevad vangide ja oopiumi pärast / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2005-01-01

    USA presidendi George W. Bushiga kohtumise järel nõudis Afganistani president Hamid Karzai USA käes olevate Afganistani vangide väljaandmist, ta oli nördinud teadete üle, kuidas vange on koheldud. Karzai nõudis kontrolli Afganistanis viibivate USA sõdurite üle ja relvastatud reidide lõpetamist afgaanide kodudesse. Lisa: USA ründab Afganistani narkoäri

  8. Eesti saab tõenäoliselt USA-lt pooletoobise viisavabaduse / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2008-01-01

    Algasid läbirääkimised USA-ga viisavabaduse saavutamiseks. USA eksperdid tulevad hindama Eesti riigipiiri pidavust, koostatakse vastastikuse arusaamise memorandum. Tõenäoliselt hakkab Eesti puhul kehtima teistsugune süsteem kui on praegu 27 riigil, kellel on USA-ga viisavabadus ja kellest 15 on EL-i nn vanad riigid. USA sisejulgeoleku ministeeriumi asekantsleri Richard Barthi seisukohti. Vt. samas: Eesti näide võib tekitada vastuolulist reaktsiooni

  9. USA saatkonna ründe eest 11 inimest trellide taga / Küllike Rooväli

    Index Scriptorium Estoniae

    Rooväli, Küllike, 1969-

    2003-01-01

    Kaitsepolitsei uurijad peavad linnakohtule esitama taotlused, et pikendada USA saatkonna ees vandaalitsenute arestimajas pidamist. Vt. samas: lühiinterv. USA suursaatkonna avalike suhete juhi Thomas Hodgesiga

  10. Contrasting Policies towards (Mainly) Christian Education in Different Contexts

    Science.gov (United States)

    Watson, Keith

    2010-01-01

    During the past 10 to 15 years there has been a renewed interest in the place of religion, religious education and religious schools in different parts of the world. This began in the USA and Europe with the development of private Christian schools. It was later followed by the resurgence of religious schools in the former parts of the Soviet…

  11. S&P: meie kohus oli USA riigireitingut alandada / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2011-01-01

    Standard & Poor´s langetas USA reitingut tasemelt AAA tasemeni AA+. Agentuuri esindaja sõnul oli reitingu alandamine nende kohustus, sest nende arvates oli USA senine reiting liiga kõrge. Hiina nõuab, et USA hakkaks oma võlaprobleemiga tegelema. AAA reiting on nüüd vaid 15 riigil või territooriumil maailmas

  12. USA saadik loodab võita eestlaste poolehoiu / Joseph M. DeThomas

    Index Scriptorium Estoniae

    DeThomas, Joseph M.

    2003-01-01

    USA suursaadik Eestis Joseph DeThomas vastab on-line intervjuus Eesti Päevalehe lugejate küsimustele Iraagi ründamise, USA ja Euroopa vahelise lõhe, USA Eesti saatkonna võimaliku ümberkolimise kohta

  13. USA välisminister kaitses CIA salaaktsioone vangidega / Aadu Hiietamm

    Index Scriptorium Estoniae

    Hiietamm, Aadu, 1954-

    2005-01-01

    USA välisminister Condoleezza Rice kaitses Berliinis USA Luure Keskagentuuri (CIA) salaaktsioone. Välisminister teatas, et USA ei piina vange ning kinnipeetavate välisriikidesse toimetamise eesmärk on vältida terrorirünnakuid ja päästa inimelusid

  14. 75 FR 8920 - Grant of Authority for Subzone Status; Danisco USA, Inc., Sweeteners Division (Xylitol, Xylose...

    Science.gov (United States)

    2010-02-26

    ... Foreign-Trade Zones Board Grant of Authority for Subzone Status; Danisco USA, Inc., Sweeteners Division... manufacturing facility of Danisco USA, Inc., Sweeteners Division, located in Thomson, Illinois, (FTZ Docket 4... facility of Danisco USA, Inc., Sweeteners Division, located in Thomson, Illinois (Subzone 271A),...

  15. 75 FR 15987 - Education and Sharing Day, U.S.A., 2010

    Science.gov (United States)

    2010-03-30

    ... these values in their own lives and communities. Each year, Education and Sharing Day, U.S.A., reminds... Proclamation 8486--Education and Sharing Day, U.S.A., 2010 #0; #0; #0; Presidential Documents #0; #0; #0;#0...-- #0;The President ] Proclamation 8486 of March 25, 2010 Education and Sharing Day, U.S.A., 2010 By...

  16. 78 FR 48767 - Combi USA, Inc., Receipt of Petition for Decision of Inconsequential Noncompliance

    Science.gov (United States)

    2013-08-09

    ... National Highway Traffic Safety Administration Combi USA, Inc., Receipt of Petition for Decision of... petition. SUMMARY: Combi USA, Inc., (Combi),\\1\\ has determined that certain model child restraint systems...\\ Combi USA, Inc., is a U.S. company that manufactures child restraint systems. Pursuant to 49...

  17. 78 FR 64020 - Manufacturer of Controlled Substances; Notice of Registration; Siegfried USA, LLC

    Science.gov (United States)

    2013-10-25

    ... Enforcement Administration Manufacturer of Controlled Substances; Notice of Registration; Siegfried USA, LLC..., Siegfried USA, LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070, made application by letter to... Siegfried USA, LLC., to manufacture the listed basic class of controlled substance is consistent with...

  18. 78 FR 24206 - Agency Information Collection Activities; Information Collection; USA Spending

    Science.gov (United States)

    2013-04-24

    ... ADMINISTRATION Agency Information Collection Activities; Information Collection; USA Spending AGENCY: Interagency... requirement regarding USA Spending. DATES: Submit comments on or before June 24, 2013. ADDRESSES: Submit comments identified by Information Collection 3090- 00xx, USA Spending, by any of the following...

  19. 78 FR 64020 - Manufacturer of Controlled Substances, Notice of Registration, Siegfried USA, LLC

    Science.gov (United States)

    2013-10-25

    ... Enforcement Administration Manufacturer of Controlled Substances, Notice of Registration, Siegfried USA, LLC..., page 18338, Siegfried (USA), LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070, applied for... August 6, 2013, Siegfried (USA), LLC., subsequently withdrew this request for drug code Opium, raw...

  20. 78 FR 30333 - Manufacturer of Controlled Substances; Notice of Registration; Siegfried (Usa), Llc.

    Science.gov (United States)

    2013-05-22

    ... Enforcement Administration Manufacturer of Controlled Substances; Notice of Registration; Siegfried (Usa), Llc... 70825, Siegfried (USA), LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070, made application by... determined that the registration of Siegfried (USA), LLC., to manufacture the listed basic classes...

  1. USA moos määrib Eesti naabritest mõjukamaks / Raimo Poom

    Index Scriptorium Estoniae

    Poom, Raimo

    2007-01-01

    Sel sügisel on toimunud mitu Eesti ja USA poliitikute kohtumist. Peaminister Andrus Ansipi ja kaitseminister Jaak Aaviksoo USA-visiitide korraldamisega kursis olevad ametnikud ei nõustu, et kohtumiste taga oleks olnud USA lobitöö Iraagi missiooni pikendamiseks

  2. EL taotleb USA-lt viisavabaduse võrdsust / Ahto Lobjakas, Anneli Ammas

    Index Scriptorium Estoniae

    Lobjakas, Ahto, 1970-

    2004-01-01

    Euroopa Komisjon soovib, et USA kiirendaks EL-i uute liikmesriikide kaasamist oma viisavabastusprogrammi. USA peab illegaalseid tööotsijaid üheks peamiseks tõkkeks viisavabaduse saavutamise teel. Kriteeriumidest, millele peavad USA-ga viisavabadust taotlevad riigid vastama

  3. Blair üritab muuta USA Euroopa-meelsemaks / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    USA presidendi George W. Bushi ja Suurbritannia peaministri Tony Blairi kohtumine Valges Majas. Blairi parteikaaslase Helen Jacksoni kriitika Blairi USA-poliitika kohta. Suurbritannia endise välisministri Robin Cooki sõnul on USA ja Euroopa poliitilised väärtushinnangud pigem lahknemas kui ühtimas

  4. Eesti-USA suhetes loevad väärtused / Vello Andres Pettai

    Index Scriptorium Estoniae

    Pettai, Vello, 1968-

    2006-01-01

    Ilmunud ka: Järva Teataja 30. nov. lk. 6 lüh. Tartu Ülikooli võrdleva poliitika professor vastab Postimees Online'i lugejate küsimustele, mis puudutavad USA presidendi visiiti Eestisse, viisavabadust USA-ga, USA presidendi võimu, NATO-t, välispoliitikat, riikidevahelisi suhteid, ajakirjandusvabadust, inimõigusi ja demokraatiat

  5. Valge Maja hämab USA vägede tulevikust Iraagis / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    Kuigi USA president George W. Bush on kõnelenud ja USA vägede ülemjuhataja Iraagis George Casey esitanud konkreetse plaani USA vägede väljatoomisest Iraagist, pole Valge Maja konkreetset plaani ametlikult kinnitanud. Lisa: Sõjatandrilt lahkumine

  6. ÜRO asesekretäri kriitika USA suunal ajas viimase marru / Liise Lehtsalu

    Index Scriptorium Estoniae

    Lehtsalu, Liise

    2006-01-01

    ÜRO asesekretär Malloch Brown kritiseeris oma kõnes USA tahtmatust teavitada ameeriklasi ÜRO osast USA välispoliitikas. USA ÜRO-suursaadiku John Boltoni reageering Browni märkustele. Lisa: Rikaste ja vaeste riikide vastuolud

  7. USA : rünnak võib olla parim kaitse / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2006-01-01

    USA uues rahvusliku julgeoleku strateegias rõhutatakse, et tuumaambitsioonidega Iraak kujutab USA jaoks suurimat strateegilist väljakutset ning märgitakse, et teatud juhtudel on ohtude ennetamiseks vajalik jõu kasutamine. Vt. samas: Ameeriklaste toetus Iraagi sõjale väheneb. Lisa: Pessimistlik USA

  8. Tšehhi võimud tahavad endale USA raketikilpi / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister

    2006-01-01

    USA rajab 2011. aastaks raketirünnakute tõrje süsteemi. Raketikilbi Euroopa-keskuse asukohale kandideerivad Tšehhi ja Poola, samas on suur osa tshehhe USA baasi rajamise vastu. Skeem: USA tähesõdade programm. Lisa: Peaminister vaid nime poolest

  9. USA saadik : Lihula sammas oli solvav / Aldona Zofia Wos ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Wos, Aldona Zofia

    2005-01-01

    USA suursaadik Eestis vastab küsimustele, mis puudutavad Eesti-USA suhteid, eestlaste võimalust saada kunagi sõita USA-sse ilma viisata, Lihula mälestusmärgi mahavõtmist, valimisi ja jätkuvat vägivalda Iraagis, HI-viiruse levikut

  10. 77 FR 30027 - Manufacturer of Controlled Substances; Notice of Registration; Siegfried (USA)

    Science.gov (United States)

    2012-05-21

    ... Enforcement Administration Manufacturer of Controlled Substances; Notice of Registration; Siegfried (USA) By..., Siegfried (USA), 33 Industrial Park Road, Pennsville, New Jersey 08070, made application by renewal to the... (USA), to manufacture the listed basic classes of controlled substances is consistent with the...

  11. 78 FR 64015 - Importer of Controlled Substances, Notice of Registration, Siegfried (USA), LLC

    Science.gov (United States)

    2013-10-25

    ... Enforcement Administration Importer of Controlled Substances, Notice of Registration, Siegfried (USA), LLC By..., Siegfried USA, LLC., 33 Industrial Park Road, Pennsville, New Jersey 08070, made application by letter to... that the registration of Siegfried USA, LLC., to import the basic classes of controlled substances...

  12. 76 FR 62785 - Nordica USA, Provisional Acceptance of a Settlement Agreement and Order

    Science.gov (United States)

    2011-10-11

    ... COMMISSION Nordica USA, Provisional Acceptance of a Settlement Agreement and Order AGENCY: Consumer Product... Agreement with Nordica USA, containing a civil penalty of $214,000.00. DATES: Any interested person may ask... Agreement 1. In accordance with 16 CFR 1118.20, Nordica USA (``Nordica'') and staff of the United...

  13. 78 FR 4400 - Eni USA Gas Marketing LLC; Application for Blanket Authorization To Export Previously Imported...

    Science.gov (United States)

    2013-01-22

    ... USA Gas Marketing LLC; Application for Blanket Authorization To Export Previously Imported Liquefied... and order (Order No. 2923) that granted Eni USA Gas Marketing authority to export a cumulative total... Application, Eni USA Gas Marketing requests blanket authorization to export LNG from the Cameron Terminal...

  14. PS main supply: motor-generator set.

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    In picture 04 the motor is on the right in the background and the main view is of the generator. The peak power in each PS cycle drawn from the generator, up to 96 MW, is taken from the rotational kinetic energy of the rotor (a heavy-weight of 80 tons), which makes the rotational speed drop by only a few percent. The motor replenishes the average power of 2 to 4 MW. Photo 05: The motor-generator set is serviced every year and, in particular, bearings and slip-rings are carefully checked. To the left is the motor with its slip-rings visible. It has been detached from the axle and moved to the side, so that the rotor can be removed from the huge generator, looming at the right.

  15. Siberian snakes for the Fermilab Main Injector

    Energy Technology Data Exchange (ETDEWEB)

    Anferov, V.A.; Baiod, R.; Courant, E.D. [and others

    1993-04-01

    Appropriate Siberian snakes were designed to maintain the proton beam polarization during acceleration in the Fermilab Main Injector from 8 to 150 GeV. Various snake designs were investigated to find one fitting into the 14 m straight section spaces with the required spin rotation axis and the minimum orbit excursion. The authors studied both cold and warm discrete magnet snakes as well as warm snakes with helical magnets. For the warm discrete magnet snake, obtaining small orbit excursions required a nearly longitudinal snake axis, while axes near {+-}45{degrees} are needed when using two snakes in a ring. The authors found acceptable snakes either by using superconducting magnets or by using warm magnets with a helical dipole field.

  16. Main injector particle production experiment at Fermilab

    Indian Academy of Sciences (India)

    Sonam Mahajan; Ashok Kumar; Rajendran Raja

    2012-11-01

    The main injector particle production (MIPP) experiment at Fermilab uses particle beams of charged pions, kaons, proton and antiproton with beam momenta of 5–90 GeV/c to measure particle production cross-sections of various nuclei including liquid hydrogen, MINOS target and thin targets of beryllium, carbon, bismuth and uranium. The physics motivation to perform such cross-section measurements is described here. Recent results on the analysis of NuMI target and forward neutron cross-sections are presented here. Preliminary cross-section measurements for 58 GeV/c proton on liquid hydrogen target are also presented. A new method is described to correct for low multiplicity inefficiencies in the trigger using KNO scaling.

  17. Water Hammer in Pumped Sewer Mains

    DEFF Research Database (Denmark)

    Larsen, Torben

    This publication is intended for students and engineers seeking an introduction to the problem of water transients in pumped sewer and water mains. This is a subject of increasing interest because of the development of larger and more integrated systems. Consideration of transients is essential...... for the structural design of pipelines and for the planning of the proper function of the systems. The text is written by Torben Larsen, who is a professor of environmental hydraulics at the Department of Civil Engineering, Aalborg University. Torben Larsen has many years of experience with computer simulations...... of transients in pumped pipeline systems. This present publication can be understood as the second and revised edition of the pamphlet ”Transients in pumped sewer mains” (2006) which was published as a technical report by The EVA committee under The Danish Water Pollution Committee (The Danish Society...

  18. Eccentricity distribution in the main asteroid belt

    CERN Document Server

    Malhotra, Renu

    2016-01-01

    The observationally complete sample of the main belt asteroids now spans more than two orders of magnitude in size and numbers more than 64,000 (excluding collisional family members). We undertook an analysis of asteroids' eccentricities and their interpretation with simple physical models. We find that Plummer's (1916) conclusion that the asteroids' eccentricities follow a Rayleigh distribution holds for the osculating eccentricities of large asteroids, but the proper eccentricities deviate from a Rayleigh distribution: there is a deficit of eccentricities smaller than $\\sim0.1$ and an excess of larger eccentricities. We further find that the proper eccentricities do not depend significantly on asteroid size but have strong dependence on heliocentric distance: the outer asteroid belt follows a Rayleigh distribution, but the inner belt is strikingly different. Eccentricities in the inner belt can be modeled as a vector sum of a primordial eccentricity vector of random orientation and magnitude drawn from a Ra...

  19. Natural syntax : English interrogative main clauses

    Directory of Open Access Journals (Sweden)

    Janez Oresnik

    2007-12-01

    Full Text Available Natural Syntax is a developing deductive theory, a branch of Naturalness Theory. The naturalnessjudgements are couched in naturalness scales, whichfollow from the basic parameters (or «axioms» listed at the beginning of the paper. The predictions of the theory are calculated in deductions, whose chief components are apair of naturalness scales and the rules governing the alignment of corresponding naturalness values. Parallel and chiastic alignments are distinguished, in complementary distribution. Chiastic alignment is mandatory in deductions limited to unnatural environments. The paper deals with English interrogative main clauses. Within these, only the interrogatives containing wh-words exclusively insitu constitute an extremely unnatural environment and require chiastic alignment. Otherwiseparallel alignment is used. Earlier publications on Natural Syntax: Kavcic 2005a,b, Oresnik 1999, 2000a,b, 200la-f   2002, 2003a-c, 2002/03, 2004. This list cites only works written in English.

  20. Heat piles: the `MAIN TOWER` in Frankfurt on the Main; Einsatz von Energiepfaehlen am Beispiel des MAIN TOWER in Frankfurt am Main

    Energy Technology Data Exchange (ETDEWEB)

    Kapp, C. [NEK Umwelttechnik AG, Zuerich (Switzerland); Hude, N. von der [Bilfinger und Berger Bauaktiengesellschaft, Mannheim (Germany). Service Center Technik

    1997-12-01

    In the inner-city banking quarter of Frankfurt on the Main, one of the highest and most modern office buildings of Europe has been being erected since the summer of 1996. The intersecting rows of drill-foundation piles required to secure the deep excavation and the load-bearing piles were designed as heat piles. Thereby the harnessing of shallow geothermal energy was integrated into the overall HVAC concept, realizing a highly innovative project. Although the erection of heat piles had only been decided on when planning for a conventional energy system was completed, the decision permitted to dispense with some of the usual components in the control station. As executed simulations show, integration of the piles into the overall concept of the building is not easy because the piles are exclusively used to provide cooling energy. But the project demonstrates that heat piles can nowadays be used also on a large scale. (orig.) [Deutsch] Im Bankenviertel in der Innenstadt von Frankfurt am Main entsteht seit dem Sommer 1996 eines der hoechsten und modernsten Buerogebaeude Europas. Die zur Sicherung der tiefen Baugrube erforderlichen Pfaehle der ueberschnittenen Bohrpfahlwand sowie diejenigen zum Lastabtrag wurden als Energiepfaehle ausgebildet. Damit wurde die Nutzung der untiefen Geothermie in das Gesamtkonzept der Haustechnik integriert und so ein innovatives Energiekonzept umgesetzt. Obwohl der Einsatz der Energiepfaehle erst dann beschlossen worden ist, als bereits eine konventionelle Energieversorgung vorgesehen und planerisch umgesetzt worden war, konnte dank der Energiepfaehle auf einige herkoemmliche Komponenten in der Energiezentrale verzichtet werden. Aufgrund der durchgefuehrten Simulationsberechnungen gestaltet sich die Einbindung ins Gesamtgebaeudekonzept nicht einfach, da die Energiepfaehle lediglich zu Kuehlzwecken verwendet werden. Trotzdem zeigt dieses Beispiel, dass heute Energiepfahlsysteme auch in grossem Massstab eingesetzt werden koennen. (orig.)

  1. Eccentricity distribution in the main asteroid belt

    Science.gov (United States)

    Malhotra, Renu; Wang, Xianyu

    2017-03-01

    The observationally complete sample of the main belt asteroids now spans more than two orders of magnitude in size and numbers more than 64 000 (excluding collisional family members). We undertook an analysis of asteroids' eccentricities and their interpretation with simple physical models. We find that a century old conclusion that the asteroids' eccentricities follow a Rayleigh distribution holds for the osculating eccentricities of large asteroids, but the proper eccentricities deviate from a Rayleigh distribution; there is a deficit of eccentricities smaller than ∼0.1 and an excess of larger eccentricities. We further find that the proper eccentricities do not depend significantly on asteroid size but have strong dependence on heliocentric distance; the outer asteroid belt follows a Rayleigh distribution, but the inner belt is strikingly different. Eccentricities in the inner belt can be modelled as a vector sum of a primordial eccentricity vector of random orientation and magnitude drawn from a Rayleigh distribution of parameter ∼0.06, and an excitation of random phase and magnitude ∼0.13. These results imply that when a late dynamical excitation of the asteroids occurred, it was independent of asteroid size and was stronger in the inner belt than in the outer belt. We discuss implications for the primordial asteroid belt and suggest that the observationally complete sample size of main belt asteroids is large enough that more sophisticated model-fitting of the eccentricities is warranted and could serve to test alternative theoretical models of the dynamical excitation history of asteroids and its links to the migration history of the giant planets.

  2. Remotely triggered earthquakes following moderate main shocks

    Science.gov (United States)

    Hough, S.E.

    2007-01-01

    Since 1992, remotely triggered earthquakes have been identified following large (M > 7) earthquakes in California as well as in other regions. These events, which occur at much greater distances than classic aftershocks, occur predominantly in active geothermal or volcanic regions, leading to theories that the earthquakes are triggered when passing seismic waves cause disruptions in magmatic or other fluid systems. In this paper, I focus on observations of remotely triggered earthquakes following moderate main shocks in diverse tectonic settings. I summarize evidence that remotely triggered earthquakes occur commonly in mid-continent and collisional zones. This evidence is derived from analysis of both historic earthquake sequences and from instrumentally recorded M5-6 earthquakes in eastern Canada. The latter analysis suggests that, while remotely triggered earthquakes do not occur pervasively following moderate earthquakes in eastern North America, a low level of triggering often does occur at distances beyond conventional aftershock zones. The inferred triggered events occur at the distances at which SmS waves are known to significantly increase ground motions. A similar result was found for 28 recent M5.3-7.1 earthquakes in California. In California, seismicity is found to increase on average to a distance of at least 200 km following moderate main shocks. This supports the conclusion that, even at distances of ???100 km, dynamic stress changes control the occurrence of triggered events. There are two explanations that can account for the occurrence of remotely triggered earthquakes in intraplate settings: (1) they occur at local zones of weakness, or (2) they occur in zones of local stress concentration. ?? 2007 The Geological Society of America.

  3. Measuring and decomposing output gap: A production function approach of the USA and EU-27 countries

    Directory of Open Access Journals (Sweden)

    Domicián Máté

    2012-11-01

    Full Text Available The ICT-based techno-economic paradigm shift was sharpened by income inequalities in all over the world. The economic performance of USA and Europe were seemed to more different thanks to global economic events. The main purpose of this study is to estimate various macroeconomic variables such as GDP and labour for the period of 1993-2013. In order to indicate economic growth an alternative growth accounting method was used to decompose impacts of physical capital accumulation, technological changes and labour. Analysing the time series data of various OECD countries we could conclude that a large part of the variations in the output gap stem from the cyclical variations of total labour input and the total factor productivity (TFP. Hence, our results were reflected the relevance of technological progress.

  4. Is it time for elective left main percutaneous coronary intervention to become 'main stream'?

    Institute of Scientific and Technical Information of China (English)

    Joshua Cohen; Andrew D.Michaels

    2006-01-01

    @@ Left main (LM) stenting is considered by many to be one of the last frontiers of interventional cardiology. Beginning with the VA cooperative study published in 1976 demonstrating a mortality benefit for patients undergoing coronary artery bypass grafting (CABG), i the standard of care for treatment of left main coronary artery disease has been surgical.The most recent 2005 update of the ACC/AHA/SCAI Practice Guidelines on PCI 2 again notes that "CABG using IMA grafting is the 'gold standard' for treatment of unprotected left main disease and has proven benefit on long-term outcomes."

  5. Maine Environmental Vulnerability Index (EVI) Atlas, Maine - 2007, maps in portable document format (NODC Accession 0036827)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This four volume set of Environmental Vulnerability Index Maps depicts environmental resources along the coast of Maine most at risk from oil spilled into the marine...

  6. Flood of April 2007 in Southern Maine

    Science.gov (United States)

    Lombard, Pamela J.

    2009-01-01

    Up to 8.5 inches of rain fell from April 15 through 18, 2007, in southern Maine. The rain - in combination with up to an inch of water from snowmelt - resulted in extensive flooding. York County, Maine, was declared a presidential disaster area following the event. The U.S. Geological Survey, in cooperation with the Federal Emergency Management Agency (FEMA), determined peak streamflows and recurrence intervals at 24 locations and peak water-surface elevations at 63 sites following the April 2007 flood. Peak streamflows were determined with data from continuous-record streamflow-gaging stations where available and through hydraulic models where station data were not available. The flood resulted in peak streamflows with recurrence intervals greater than 100 years throughout most of York County, and recurrence intervals up to 50 years in Cumberland County. Peak flows for selected recurrence intervals varied from less than 10 percent to greater than 100 percent different than those in the current FEMA flood-insurance studies due to additional data or newer regression equations. Water-surface elevations observed during the April 2007 flood were bracketed by elevation profiles in FEMA flood-insurance studies with the same recurrence intervals as the recurrence intervals bracketing the observed peak streamflows at seven sites, with higher elevation-profile recurrence intervals than streamflow recurrence intervals at six sites, and with lower elevation-profile recurrence intervals than streamflow recurrence intervals at one site. The April 2007 flood resulted in higher peak flows and water-surface elevations than the flood of May 2006 in coastal locations in York County, and lower peak flows and water-surface elevations than the May 2006 flood further from the coast and in Cumberland County. The Mousam River watershed with over 13 dams and reservoirs was severely impacted by both events. Analyses indicate that the April 2007 peak streamflows in the Mousam River watershed

  7. Evaluation and comparison of present R and D for the production of syngas from biomass in the USA and Finland

    Energy Technology Data Exchange (ETDEWEB)

    Hannula, I. (VTT Technical Research Centre of Finland, Espoo (Finland)), Email: ilkka.hannula@vtt.fi

    2010-10-15

    The most essential application of biomass gasification is the production of liquid fuels. Finnish knowhow and position in biomass gasification is strong although significant investments for the development of this technology have been made also elsewhere in the world. The main objective of this project is to produce a report about the current status of syngas technology in the USA and to identify such process configurations that have the potential to increase overall efficiency of biomass based syngas technology. The project involves genuine international co-operation in a significant field of Finnish energy technology. (orig.)

  8. Comparative attributes of effective health services managers and definitions of organizational effectiveness in Australia, the UK and the USA.

    Science.gov (United States)

    Boldy, D; Jain, S; Chen, G

    1996-02-01

    This paper explores and contrasts the perceptions of 855, mainly health services managers and 1452 students from three major English-speaking countries regarding the attributes needed for becoming effective managers in their country. Also addressed are country differences and similarities in the perceived relevance of particular indicators of organizational effectiveness. Despite Australia's British heritage, respondents from this country were found to be more similar to those from the USA, than those from the UK, in their views regarding the attributes of effective managers. Australian and American respondents rated 'nurturing' personality skills relatively highly, as they did 'classical' management skills. UK respondents rated 'classical' management skills as more important than 'political' skills.

  9. USA300 Methicillin-Resistant Staphylococcus aureus Bacteremia and the Risk of Severe Sepsis: Is USA300 MRSA Associated with More Severe Infections?

    Science.gov (United States)

    Kreisel, Kristen M.; Stine, O. Colin; Johnson, J. Kristie; Perencevich, Eli N.; Shardell, Michelle D.; Lesse, Alan J.; Gordin, Fred M.; Climo, Michael W.; Roghmann, Mary-Claire

    2011-01-01

    Objective USA300 methicillin-resistant Staphylococcus aureus (MRSA) is increasing as a cause of severe community-associated bacteremic infections. We assessed severe sepsis in response to infection in patients with USA300 MRSA compared to non-USA300 MRSA bacteremia. Methods A cohort study was conducted from 1997–2008 comparing sepsis in response to infection in 271 patients with MRSA bacteremia from four VA hospitals. Results Sixty-seven (25%) patients with MRSA bacteremia were USA300 MRSA; 204 (75%) were non-USA300 MRSA. The proportion of MRSA bacteremia caused by USA300 MRSA increased over time (χ2 p<0.0001). Adjusting for age and nosocomial infection, patients with USA300 MRSA bacteremia were more likely to have severe sepsis or septic shock in response to infection than patients with non-USA300 MRSA bacteremia (adjusted Relative Risk=1.82; 95% CI: 1.16–2.87; p=0.01). Conclusions This suggests that patients with USA300 MRSA are more likely to develop severe sepsis in response to their infection, which could be due to host or bacterial differences. PMID:21558047

  10. Nature and main kinds of psychopathological mechanisms

    Directory of Open Access Journals (Sweden)

    Panagiotis Oulis

    2010-12-01

    Full Text Available The paper deals with two central issues in the philosophy of neuroscience and psychiatry, namely those of the nature and the major kinds and types of psychopathological mechanisms. Contrary to a widespread view, I argue that mechanisms are not kinds of systems but kinds of processes unfolding in systems or between systems. More precisely, I argue that psychopathological mechanisms are sets of actions and interactions between brain-systems or circuits as well as between the latter and other systems in one's body and external environment, both physical and social, involved in human psychopathology. According to the kinds of properties of the interacting systems or their component-parts, psychopathological mechanisms may be physical, chemical, biological, psychological, social, or, typically, mixed ones. Furthermore, I focus on two main kinds of psychopathological mechanisms involved in the causation of mental disorders, namely the pathogenetic and pathophysiological ones, stressing the importance of their careful distinction for the integrative understanding of otherwise disparate and apparently incommensurable psychiatric research findings. I illustrate my analysis with an example drawn from contemporary research on the mechanisms of acute psychosis. Finally, I stress the relevance of psychopathological mechanisms to a more scientifi cally-grounded classifi cation of mental disorders.

  11. GAS MAIN SENSOR AND COMMUNICATIONS NETWORK SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Hagen Schempf, Ph.D.

    2003-02-27

    Automatika, Inc. was contracted by the Department of Energy (DOE) and with co-funding from the New York Gas Group (NYGAS), to develop an in-pipe natural gas prototype measurement and wireless communications system for assessing and monitoring distribution networks. A prototype system was built for low-pressure cast-iron mains and tested in a spider- and serial-network configuration in a live network in Long Island with the support of Keyspan Energy, Inc. The prototype unit combined sensors capable of monitoring pressure, flow, humidity, temperature and vibration, which were sampled and combined in data-packages in an in-pipe master-slave architecture to collect data from a distributed spider-arrangement, and in a master-repeater-slave configuration in serial or ladder-network arrangements. It was found that the system was capable of performing all data-sampling and collection as expected, yielding interesting results as to flow-dynamics and vibration-detection. Wireless in-pipe communications were shown to be feasible and valuable data was collected in order to determine how to improve on range and data-quality in the future.

  12. Primary Productivity in Meduxnekeag River, Maine, 2005

    Science.gov (United States)

    Goldstein, Robert M.; Schalk, Charles W.; Kempf, Joshua P.

    2009-01-01

    During August and September 2005, dissolved oxygen, temperature, pH, specific conductance, streamflow, and light intensity (LI) were determined continuously at six sites defining five reaches on Meduxnekeag River above and below Houlton, Maine. These data were collected as input for a dual-station whole-stream metabolism model to evaluate primary productivity in the river above and below Houlton. The river receives nutrients and organic matter from tributaries and the Houlton wastewater treatment plant (WWTP). Model output estimated gross and net primary productivity for each reach. Gross primary productivity (GPP) varied in each reach but was similar and positive among the reaches. GPP was correlated to LI in the four reaches above the WWTP but not in the reach below. Net primary productivity (NPP) decreased in each successive downstream reach and was negative in the lowest two reaches. NPP was weakly related to LI in the upper two reaches and either not correlated or negatively correlated in the lower three reaches. Relations among GPP, NPP, and LI indicate that the system is heterotrophic in the downstream reaches. The almost linear decrease in NPP (the increase in metabolism and respiration) indicates a cumulative effect of inputs of nutrients and organic matter from tributaries that drain agricultural land, the town of Houlton, and the discharges from the WWTP.

  13. Flood inundation map library, Fort Kent, Maine

    Science.gov (United States)

    Lombard, Pamela J.

    2012-01-01

    Severe flooding occurred in northern Maine from April 28 to May 1, 2008, and damage was extensive in the town of Fort Kent (Lombard, 2010). Aroostook County was declared a Federal disaster area on May 9, 2008. The extent of flooding on both the Fish and St. John Rivers during this event showed that the current Federal Emergency Management Agency (FEMA) Flood Insurance Study (FIS) and Flood Insurance Rate Map (FIRM) (Federal Emergency Management Agency, 1979) were out of date. The U.S. Geological Survey (USGS) conducted a study to develop a flood inundation map library showing the areas and depths for a range of flood stages from bankfull to the flood of record for Fort Kent to complement an updated FIS (Federal Emergency Management Agency, in press). Hydrologic analyses that support the maps include computer models with and without the levee and with various depths of backwater on the Fish River. This fact sheet describes the methods used to develop the maps and describes how the maps can be accessed.

  14. THE MAIN PROBLEM OF COUNTERACTION AGAINST CORRUPTION

    Directory of Open Access Journals (Sweden)

    Alexander Sergeevich Dilkov

    2015-01-01

    Full Text Available The article considers the problem of corruption. The experience of anti-corruption activities in various countries shows convincingly that to completely get rid of corruption is impossible, as any other social evil, with solid foundations in economic, social and political system of society. You can put a question only about how to reduce the scale of corruption to the socially acceptable level. Corruption infringes upon interests and constitutional rights of citizens, undermines the rule of law and democratic principles, suggests discrediting the activities of the state apparatus, distorts the principle of legality, hinders economic reforms and therefore requires detailed investigation with the scientific side to find the most effective ways of countering this phenomenon. Corruption can be done in different ways and methods. The conclusion that corruption is not only a form of criminal enrichment bureaucratic state apparatus, it has always been the main source of criminalization of social life, its degradation.Corruption is both a prerequisite and a consequence of the functioning of the shadow economy, strengthening property differentiation of the society, the fall of morals and degradation of the socio-political life.

  15. THINKING SKILL - THE MAIN LEARNING TOOL

    Directory of Open Access Journals (Sweden)

    Daniela Koteková

    2010-06-01

    Full Text Available The method of teaching with help of four elementary skills - reading, speaking, writing and listening is definitely inconceivable to teaching any foreign language. But automatic answers following the exercise and students passive memorising does not make speaking language and its learning very natural. This has forced me to find and create the way how to make learners think and realise the point and meaning of learning itself. My paper is about special skill I have tried to apply –thinking skill. I have chosen it to complement other four which teacher normally uses when teaching foreign language (reading, speaking, listening skills. At the same time I put thinking skill into a role to support and enhance learning process. To find and use some methods how to make students think, make their own opinion and also teach them to apply their own experience to learning process was the main goal of this survey. The methods I have applied were provoking students to think before they learn.

  16. Brand new hall in the main building

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The renovation of the UNIQA and post office premises is getting under way, with their reopening scheduled for the spring.   The renovation of the large hall in the main building (Building 500) has finally reached the home straight. As of this week, building contractors will get to work on the last part – the offices of UNIQA and La Poste. In the last week of November, the two concessions moved their offices across Route Scherrer to the same part of Building 510 where UBS was temporarily housed during the bank’s refurbishment. Their services were therefore unavailable for one day. The renovation work will last until the spring, with the new offices expected to open in May 2015. Between now and then, the windows and insulation will be completely refitted, with a view to reducing heat loss considerably, and, above all, the premises will be modernised to improve customer reception and service. For example, UNIQA’s new premises will feature a confidential area, guarantee...

  17. Survey for protozoan parasites in Eastern oysters (Crassostrea virginica) from the Gulf of Maine using PCR-based assays.

    Science.gov (United States)

    Marquis, Nicholas D; Record, Nicholas R; Robledo, José A Fernández

    2015-10-01

    Protozoan pathogens represent a serious threat to oyster aquaculture, since they can lead to significant production loses. Moreover, oysters can concentrate human pathogens through filter feeding, thus putting at risk raw oyster consumers' health. Using PCR-based assays in oysters (Crassostrea virginica) from Maine, we expand the Northeast range in the USA for the protozoans Perkinsus marinus, Perkinsus chesapeaki, and Haplosporidium nelsoni, and report for the first time the detection of the human pathogens Toxoplasma gondii and Cryptosporidium parvum. Oysters hosting both P. marinus and P. chesapeaki were more than three times as likely to be infected by a non-Perkinsus than those free of Perkinsus infections.

  18. Gas Main Sensor and Communications Network System

    Energy Technology Data Exchange (ETDEWEB)

    Hagen Schempf

    2006-05-31

    Automatika, Inc. was contracted by the Department of Energy (DOE) and with co-funding from the Northeast Gas Association (NGA), to develop an in-pipe natural gas prototype measurement and wireless communications system for assessing and monitoring distribution networks. This projected was completed in April 2006, and culminated in the installation of more than 2 dozen GasNet nodes in both low- and high-pressure cast-iron and steel mains owned by multiple utilities in the northeastern US. Utilities are currently logging data (off-line) and monitoring data in real time from single and multiple networked sensors over cellular networks and collecting data using wireless bluetooth PDA systems. The system was designed to be modular, using in-pipe sensor-wands capable of measuring, flow, pressure, temperature, water-content and vibration. Internal antennae allowed for the use of the pipe-internals as a waveguide for setting up a sensor network to collect data from multiple nodes simultaneously. Sensor nodes were designed to be installed with low- and no-blow techniques and tools. Using a multi-drop bus technique with a custom protocol, all electronics were designed to be buriable and allow for on-board data-collection (SD-card), wireless relaying and cellular network forwarding. Installation options afforded by the design included direct-burial and external polemounted variants. Power was provided by one or more batteries, direct AC-power (Class I Div.2) and solar-array. The utilities are currently in a data-collection phase and intend to use the collected (and processed) data to make capital improvement decisions, compare it to Stoner model predictions and evaluate the use of such a system for future expansion, technology-improvement and commercialization starting later in 2006.

  19. GAS MAIN SENSOR AND COMMUNICATIONS NETWORK SYSTEM

    Energy Technology Data Exchange (ETDEWEB)

    Hagen Schempf

    2004-09-30

    Automatika, Inc. was contracted by the Department of Energy (DOE) and with co-funding from the New York Gas Group (NYGAS), to develop an in-pipe natural gas prototype measurement and wireless communications system for assessing and monitoring distribution networks. In Phase II of this three-phase program, an improved prototype system was built for low-pressure cast-iron and high-pressure steel (including a no-blow installation system) mains and tested in a serial-network configuration in a live network in Long Island with the support of Keyspan Energy, Inc. The experiment was carried out in several open-hole excavations over a multi-day period. The prototype units (3 total) combined sensors capable of monitoring pressure, flow, humidity, temperature and vibration, which were sampled and combined in data-packages in an in-pipe master-repeater-slave configuration in serial or ladder-network arrangements. It was verified that the system was capable of performing all data-sampling, data-storage and collection as expected, yielding interesting results as to flow-dynamics and vibration-detection. Wireless in-pipe communications were shown to be feasible and the system was demonstrated to run off in-ground battery- and above-ground solar power. The remote datalogger access and storage-card features were demonstrated and used to log and post-process system data. Real-time data-display on an updated Phase-I GUI was used for in-field demonstration and troubleshooting.

  20. Hotel Intercontinental, en Frankfurt-Main (Alemania

    Directory of Open Access Journals (Sweden)

    Apel, Otto

    1966-09-01

    Full Text Available This building has basements, and 21 storeys above the ground. The basements are occupied with the usual services, and a garage, for clients, capable of holding 500 cars. The concierge’s office, the reception office, main hall, restaurant and services are on the ground floor. On the first floor there is a large ball room, where 600 people can assemble, as well as other reception halls. On each of the 2nd to 18th floors there are thirty rooms of one type, and eighteen of another. A luxury apartment occupies the 19th floor, and a restaurant for 200 people as well as a bar is on the top floor. This hotel, which is slab shaped, fits well with its environment and is very pleasantly proportioned.Consta de: planta de sótanos, planta baja y 20 plantas de altura. La planta de sótano contiene las distintas instalaciones; dependencias del personal, etcétera, y un garaje, reservado para los viajeros, capaz de albergar 500 coches. La planta baja comprende: la conserjería, recepción, hall, restaurantes, etc. En la planta primera existe una gran sala de baile para 600 personas, salas de reuniones, etc. Las plantas, de la 2.ª a la 18.ª contienen treinta habitaciones de un tipo y dieciocho de otro, en cada planta. En la planta 19.ª hay un apartamento de lujo. Y en la última planta se distribuyen: un restaurante para 200 personas, bar, etc. El bloque, dentro de su configuración paralelepipédica, es de forma armónica y está perfectamente encajado en el paisaje urbano circundante.

  1. MAIN PROBLEMS OF CONTROLLING OF THE QUALITY

    Directory of Open Access Journals (Sweden)

    Orlov A. I.

    2015-09-01

    Full Text Available Controlling of statistical methods to ensure product quality is the special case of controlling organizational and economic methods of management. Today, controlling in the practice of management of Russian companies is understood as "the system of information-analytical and methodological support to achieve their goals." The controller is developing a decision-making rules, the head takes decisions on the basis of these rules. We proved the concept of "controlling of methods". Innovation in management is based, in particular, on the use of new adequate organizational-economic (as well as economicmathematical and statistical methods. Controlling in this area - is the development and application procedures of compliance management used and newly developed (implemented organizationaleconomic methods for the task. Thus, the methodology for controlling is of great practical value in any field in which the actions (operations must be carried out in accordance with certain rules (regulations, standards, guidelines, as in any such area in which we need to use development and application procedures of compliance management used and the newly established (implemented rules for solution of tasks assigned to the organization. In this article, we select a area of controlling as controlling quality, and we discuss its main issues. This is about controlling of organizational-economic methods to ensure product quality, especially about the statistical methods based on probability theory and mathematical statistics. We consider the analysis and synthesis of plans of statistical quality control, optimization options plans of statistical control, truncated plans. Are discussed the differences control plans provider and the consumer, the allocation of units formless (liquid, gas products, the selection of a random sample of the statistical quality control of products, lower estimate of the required sample size. It is established, that is not always necessary

  2. Main points for 1991 family planning work.

    Science.gov (United States)

    1991-06-01

    The main points for 1991 Family Planning (FP) Work in China are discussed as follows: 1) strengthen leadership, 2) strengthen grass roots buildup, 3 intensify population plan management and improve the responsibility system, 4) strengthen publicity and promote population and FP education in rural areas, 5) strengthen and establish the legal system for FP management, 6) provide excellent contraceptive and birth control services, 7 perform inservice training conscientiously and technical secondary education earnestly, and 8) coordinate efforts among related departments. Leadership changes involve the 2 top leaders of the Communist Party Committees and governments at each level taking personal responsibility for the implementation of their local population plans and FP work. FP work must have a prominent place on all agendas. The FP service network needs to be accelerated in countries, townships, and villages and grass roots units strengthened in urban areas. Provinces, autonomous regions, and municipalities must work out their local population plans for 1991-95 and 1991-99 according to the national population target. Rational apportionment needs to be considered for prefectures and counties. The emphasis should be on timely and accurate feedback and statistical supervision. The 1990 national population census data should be used to inform everyone about the current population situation. Legal needs entail standardizing documentation and developing local laws and regulations within a comprehensive system. Improvements are needed in such areas as rules and regulations pertaining to the administration of charges for unplanned births, identification of disabled children and approval of the birth quota. Abortion and unplanned births are to be averted through prepregnancy management. The emphasis is on voluntary use of contraception by couples of childbearing age. Inservice training should improve the political, ideological, professional proficiency, and ability to

  3. Aqueous alteration on main-belt asteroids

    Science.gov (United States)

    Fornasier, S.; Lantz, C.; Barucci, M.; Lazzarin, M.

    2014-07-01

    The study of aqueous alteration is particularly important for unraveling the processes occurring during the earliest times in Solar System history, as it can give information both on the thermal processes and on the localization of water sources in the asteroid belt, and for the associated astrobiological implications. The aqueous alteration process produces the low temperature (< 320 K) chemical alteration of materials by liquid water which acts as a solvent and produces materials like phyllosilicates, sulphates, oxides, carbonates, and hydroxides. This means that liquid water was present in the primordial asteroids, produced by the melting of water ice by heating sources, very probably by ^{26}Al decay. Hydrated minerals have been found mainly on Mars surface, on primitive main-belt asteroids (C, G, B, F, and P-type, following the classification scheme by Tholen, 1984) and possibly also on few transneptunian objects. Reflectance spectroscopy of aqueous altered asteroids shows absorption features in the 0.6-0.9 and 2.5-3.5-micron regions, which are diagnostic of, or associated with, hydrated minerals. In this work, we investigate the aqueous alteration process on a large sample of 600 visible spectra of C-complex asteroids available in the literature. We analyzed all these spectra in a similar way to characterize the absorption-band parameters (band center, depth, and width) and spectral slope, and to look for possible correlations between the aqueous alteration process and the asteroids taxonomic classes, orbital elements, heliocentric distances, albedo, and sizes. We find that 4.6 % of P, 7.7 % of F, 9.8 % of B, 50.5 % of C, and 100 % of the G-type asteroids have absorption bands in the visible region due to hydrated silicates. Our analysis shows that the aqueous alteration sequence starts from the P-type objects, practically unaltered, and increases through the P → F → B → C → G asteroids, these last being widely aqueously altered, strengthening thus

  4. South Cascade (USA/North Cascades)

    Science.gov (United States)

    Bidlake, William R.

    2011-01-01

    The U.S. Geological Survey has closely monitored this temperate mountain glacier since the late 1950s. During 1958-2007, the glacier retreated about 0.7 km and shrank in area from 2.71 to 1.73 km2, although part of the area change was due to separation of contributing ice bodies from the main glacier. Maximum and average glacier thicknesses are about 170 and 80 m, respectively. Year-to-year variations of snow accumulation amounts on the glacier are largely attributable to the regional maritime climate and fluctuating climate conditions of the North Pacific Ocean. Long-term-average precipitation is about 4500 mm and most of that falls as snow during October through May. Average annual air temperature at 1,900 m altitude (the approximate ELA0) was estimated to be 1.6°C during 2000-2009. Mass balances are computed yearly by the direct glaciological method. Mass balances measured at selected locations are used in an interpolation and extrapolation procedure that computes the mass balance at each point in the glacier surface altitude grid. The resulting mass balance grid is averaged to obtain glacier mass balances. Additionally, the geodetic method has been applied to compute glacier net balances in 1970, 1975, 1977, 1979-80, and 1985-97. Winter snow accumulation on the glacier during 2007/08 and 2008/09 was larger than the long-term (1959-2009) average. The 2007/08 preliminary summer balance (-3510 mm w.e.) was slightly more negative than the long-term average and this yielded a preliminary 2007/08 net balance (-290 mm w.e.), which was less negative than the average for the period of record (-600 mm w.e.). Summer 2009 was uncommonly warm and the preliminary 2008/09 summer balance (-4980 mm w.e.) was more negative than any on record for the glacier. The 2008/09 glacier net balance (-1860 mm w.e.) was among the 10 most negative for the period of net balance record (1953-2009). Material presented here is preliminary in nature and presented prior to final review. These

  5. New directions for psychiatric rehabilitation in the USA.

    Science.gov (United States)

    Bond, G R; Drake, R E

    2016-11-21

    American researchers have led the world in developing, evaluating, and disseminating evidence-based psychiatric rehabilitation practices for people with serious mental illness. Paradoxically, however, the USA lags behind most industrialized nations in providing access to high-quality mental health and psychiatric services. This essay examines several evidence-based practices developed in the USA, the spread of these practices, the barriers to ensuring availability to people who could benefit from these services, and some promising directions for overcoming the barriers. Factors influencing the growth and sustainment of effective client-centred practices include the availability of adequate and stable funding, committed leadership, and the influence of vested interests. Two strategies for promoting the spread and sustainment of well-implemented evidence-based practices are the adoption of fidelity scales and learning communities.

  6. Nye mål for naturfagsundervisning i USA

    DEFF Research Database (Denmark)

    Evans, Robert Harry; Horst, Sebastian

    2012-01-01

    Analysen ser nærmere på den nye ramme for naturfagsundervisning i USA som udkom i 2011, og som i år bliver udmøntet i nye målbeskrivelser. Den nye ramme er opbygget ud fra tre dimensioner: praksisser inden for naturvidenskab og ingeniørarbejde, tværgående begreber og faglige kerneidéer. Rammen...

  7. Health protection in the USA: Right or privilege?

    OpenAIRE

    Vidojević, Jelena

    2011-01-01

    The paper deals with the system of health protection in the USA, its key features, problems it faces and attempts for improvement of its functioning. Corresponding to the manner in which (residual) social state is organized, the American health protection system is rather rudimental, characterized by high costs and inequality in approach to and quality of health protection. Accordingly, general health situation of the nation is comparatively poorer than in developed market economy countries. ...

  8. Homeland security in the USA: past, present, and future.

    Science.gov (United States)

    Kemp, Roger L

    2012-01-01

    This paper examines the evolving and dynamic field of homeland security in the USA. Included in this analysis is the evolution of the creation of the Department of Homeland Security, an overview of the National Warning System, a summary of citizen support groups, and how the field of homeland security has had an impact on the location and architecture of public buildings and facilities. Also included are website directories of citizen support groups and federal agencies related to the field of homeland security.

  9. Reintrodukce vlka obecného do USA

    OpenAIRE

    Myslivcová, Markéta

    2016-01-01

    This bachelors study Reintroduction of Grey wolf in the USA summarizes known facts about species Grey wolf (Canis lupus) in its first part. It describes problems in taxonomic system, lists wolf subspecies, describes its natural home range and habitat, morphology, social behavior and pack structure, ethology, reproduction and process of raising wolf pups, hunting techniques, eating habits, and wolf and human relationships. Wolves as top predators play a key role in natural ecosystem and a b...

  10. USA kahepaiksest mängust / Jüri Lina

    Index Scriptorium Estoniae

    Lina, Jüri, 1949-

    2000-01-01

    Sama artikkel on ilmunud ka Eesti 2000 : sõltumatu almanahh ühiskonna ja vaimuelu küsimustes nr. 4 ja nr. 6. Autori väitel on USA muu hulgas huvitatud maakera rahvastiku drastilisest vähendamisest, seepärast ongi pärast Teist maailmasõda kunstlikult lõkkele puhutud sadu sõjalisi konflikte. Lisatud Jüri Lina lühielulugu lk. 23

  11. Volatility spillover in Indonesia, USA, and Japan capital market

    OpenAIRE

    Mulyadi, Martin Surya

    2009-01-01

    Globalization and advanced information technology easing us for obtaining information from global stock markets. With that condition, volatility in domestic capital market could be affected by volatility from global stock markets. That concern will be answered in this research, about volatility spillover in Indonesia, USA, and Japan capital market. This research using daily return data from each country indices from January 2004 until December 2008 employing econometric model GARCH (1,1). ...

  12. Reasons For Culture Differences Between Sino——USA

    Institute of Scientific and Technical Information of China (English)

    Sun; Wen; Xu; Jing; Jing

    2014-01-01

    Culture is about survival of the human species.One key goal in the study of cultures is in assessing the survival and predictability of values across the history of humankind.As for China and USA,both countries have their own cultures.of course,they have a lot of difference between each other.Every culture has its own reason to exist in the world.

  13. USA toetab arvatust enam Ukraina opositsiooni / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2004-01-01

    Briti ajalehe The Guardian kommentaatori Ian Traynor'i sõnul on Ukraina sündmuste puhul tegemist viimase nelja aasta jooksul juba neljanda USA poolt korraldatud ja finantseeritud ettevõtmisega endises idablokis, kus soovitakse vanameelseid režiime võimult tõugata. Sarnase skeemi järgi on tema hinnangul toimunud valimistejärgsed rahutused Jugoslaavias, Gruusias ja Valgevenes

  14. Present Conditions and Problems of School counselors in the USA

    OpenAIRE

    山谷, 敬三郎

    2002-01-01

    I have been engaged as a public school counselor for the trust reseach division of the Ministry of Education since 1997. I have been conducting reseach concerning methods for child students backup service based on this experience. We/Japanese teachers and parents/encounte many dificult problems in instructing our pupils. Fortunately, I was able to participate in the school counselor training program conducted in the USA by the Japanese Association of Educational Psychology in the years 2000 a...

  15. From Caprio's lilacs to the USA National Phenology Network

    Science.gov (United States)

    Schwartz, Mark D.; Betancourt, Julio L.; Weltzin, Jake F.

    2012-01-01

    Continental-scale monitoring is vital for understanding and adapting to temporal changes in seasonal climate and associated phenological responses. The success of monitoring programs will depend on recruiting, retaining, and managing members of the public to routinely collect phenological observations according to standardized protocols. Here, we trace the development of infrastructure for phenological monitoring in the US, culminating in the USA National Phenology Network, a program that engages scientists and volunteers.

  16. Reforming dental workforce education and practice in the USA.

    Science.gov (United States)

    Davidson, P L; Nakazono, T T; Carreon, D C; Gutierrez, J J; Shahedi, S; Andersen, R M

    2011-05-01

    The USA dental education programmes are facing challenges similar to those confronting countries around the globe, particularly amongst the industrialised nations. The purpose of this study was to evaluate the educational programmes of 15 USA dental schools to determine their impact on improving workforce diversity and oral health care access. The study investigates the predictors of public service plans of dental school seniors in Pipeline and non-Pipeline Program dental schools. We analysed baseline and post-intervention data collected in the American Dental Education Association (ADEA) Annual Survey of Dental School Seniors and a set of contextual variables. Public service plans (dependent variable) was predicted by four types of independent variables: intervention, contextual, community-based dental education (CBDE), and student characteristics. Findings from the study show that access to a state or federally sponsored loan repayment program was the most significant predictor of public service plans and that increasing educational debt was the most significant barrier. In the short-term we may be able to sustain the USA loan repayment programs to motivate senior dental students to provide public service to address the oral health care access crisis. However, in the long-term, a new workforce development initiative will be required to transform dental education and practice, modelled after the well-respected licensure programmes for Physician Assistants and/or Advanced Practice Registered Nurses, to expand oral health care access, particularly amongst vulnerable population subgroups, such as low-income children and families.

  17. GIS tool to locate major Sikh temples in USA

    Science.gov (United States)

    Sharma, Saumya

    This tool is a GIS based interactive and graphical user interface tool, which locates the major Sikh temples of USA on a map. This tool is using Java programming language along with MOJO (Map Object Java Object) provided by ESRI that is the organization that provides the GIS software. It also includes some of the integration with Google's API's like Google Translator API. This application will tell users about the origin of Sikhism in India and USA, the major Sikh temples in each state of USA, location, name and detail information through their website. The primary purpose of this application is to make people aware about this religion and culture. This tool will also measure the distance between two temple points in a map and display the result in miles and kilometers. Also, there is an added support to convert each temple's website language from English to Punjabi or any other language using a language convertor tool so that people from different nationalities can understand their culture. By clicking on each point on a map, a new window will pop up showing the picture of the temple and a hyperlink that will redirect to the website of that particular temple .It will also contain links to their dance, music, history, and also a help menu to guide the users to use the software efficiently.

  18. Clinical outcomes of osteomyelitis patients infected with methicillin-resistant Staphylococcus aureus USA-300 strains.

    Science.gov (United States)

    Peyrani, P; Allen, M; Seligson, D; Roberts, C; Chen, A; Haque, N; Zervos, M; Wiemken, T; Harting, J; Christensen, D; Ramirez, R

    2012-03-01

    Methicillin-resistant Staphylococcus aureus (MRSA) USA-300 strains have emerged as an important cause of community-acquired infections. These strains have been recognized as an etiology of osteomyelitis but data on their incidence and outcomes are limited. We retrospectively studied the incidence and clinical outcomes of MRSA USA-300 osteomyelitis in patients at the University of Louisville Hospital and the Henry Ford Health System between January 2007 and March 2008. Pulsed-field gel electrophoresis was used to determine USA type. Clinical outcomes were defined as management success versus failure at 12 months. Chi-square tests, Fisher exact tests, and Mann-Whitney tests were used to compare patient characteristics on the basis of clinical outcomes and USA type. Of the 50 patients with MRSA osteomyelitis, 27 (54%) had the USA-300 strain. Clinical failure was identified in 22% (6/27) of the patients with MRSA USA-300 and in 30% (7/23) of the patients with MRSA non-USA-300 osteomyelitis (P = .509). Our results showed that MRSA USA-300 is a significant etiology of MRSA osteomyelitis. With current surgical and medical management, outcomes of patients with MRSA USA-300 osteomyelitis are similar to those of patients with MRSA non-USA-300 osteomyelitis.

  19. Vertical deformation of lacustrine shorelines along breached relay ramps, Catlow Valley fault, southeastern Oregon, USA

    Science.gov (United States)

    Hopkins, Michael C.; Dawers, Nancye H.

    2016-04-01

    Vertical deformation of pluvial lacustrine shorelines is attributed to slip along the Catlow Valley fault, a segmented Basin and Range style normal fault in southeastern Oregon, USA. The inner edges of shorelines are mapped along three breached relay ramps along the fault to examine the effect of fault linkage on the distribution of slip. Shoreline inner edges act as paleohorizontal datums so deviations in elevation from horizontal, outside of a 2 m error window, are taken to be indications of fault slip. The sites chosen represent a spectrum of linkage scenarios in that the throw on the linking fault compared to that on the main fault adjacent to the linking fault varies from site to site. Results show that the maturity of the linkage between segments (i.e. larger throw on the linking fault with respect to the main fault) does not control the spatial distribution of shoreline deformation. Patterns of shoreline deformation indicate that the outboard, linking, and/or smaller ramp faults have slipped since the shorelines formed. Observations indicate that displacement has not fully localized on the linking faults following complete linkage between segments.

  20. American Uveitis Society Meeting October 30, 1995 Marriott Marquis Hotel, Atlanta, GA, USA.

    Science.gov (United States)

    Meisler, D M; Chern, K C

    1996-01-01

    1 Retinal vascular occlusion and scleroderma. Tessler H, Flores-Guevara J, Goldstein D, Chicago, IL, USA. 2 MHC Class II antigen expression in ciliary body in spontaneous and experimental uveitis. Kalsow C, Zhavoronkova M, Dwyer A, Rochester, NY & Scottsville, NY, USA. 3 IL-10 in the vitreous of patients with intraocular lymphoma. Whitcup S, Solomon D, Nussenblatt R, Chan C-C, Bethesda, MD, USA 4 Iris juvenile xanthogranuloma studied by immunohistochemistry. Shields J, Shields C, Eagle R, DePotter P, Collins M, Philadelphia, PA, USA. 5 Outcomes analysis in with JRA-associated uveitis. Dana M-R, Merayo-Lloves J, Foster C, Boston MA, USA. 6 Persistent glaucoma secondary to periocular steroids. Akduman L, Conway M, Burchfield J, Kolker A, Black D, DelPriore L, Kaplan H, St. Louis, MO, USA 7 The use of itraconazole in ocular histoplasmosis Callanan D, Fish G, Dallas, TX, USA 8 Succesful treatment of macular hole secondary to sympathetic ophthalmia. Cano J, Diaz M, Navea A, Ruiz C, Castilla M. Barcelona, Spain. 9 HLA-DR2+ intermediate uveitis. Pulido J, Tang W, Han D, Mieler W. Milwaukee, WI, USA. 10 Vein occlusion in AIDS misdiagnosed as CMV retinitis. Park K, Marx J, Rao N. Los Angeles, CA, USA. 11 HIV-associated foveal hemorrhage. Crews K, Zimmerman P, Lohner S. Salt Lake City, UT, USA. 12 Cytomegalovirus papillitis in patients with AIDS. Patel S, Rutzen A, Marx J, Thach A, Chong L, Rao N, Los Angeles, CA, USA. 13 Recurrence rate of CMV retinitis following the ganciclovir implant and pars plans vitrectomy and silicone oil. Marx J, Thach A, Rao N, Chong L. Los Angeles, CA, USA.