WorldWideScience

Sample records for au-ge based candidate

  1. Au-Ge based Candidate Alloys for High-Temperature Lead-Free Solder Alternatives

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Hattel, Jesper Henri

    2009-01-01

    Au-Ge based candidate alloys have been proposed as an alternative to high-lead content solders that are currently being used for high-temperature applications. The influence of the low melting point metals namely In, Sb and Sn to the Au-Ge eutectic with respect to the microstructure and microhard...

  2. Development of Au-Ge based candidate alloys as an alternative to high-lead content solders

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Hattel, Jesper Henri

    2010-01-01

    , 150°C for up to 3 weeks and compared with aging at 200°C. After being subjected to high-temperature aging, the microstructure varied a lot in morphology in the case of both Au-Ge-Sb and Au-Ge-Sn candidate alloys while the microstructure remained relatively stable even after long-term thermal aging......-Ge-In and Au-Ge-Sn combinations was determined to be the classic solid solution strengthening. The Au-Ge-Sb combination was primarily strengthened by the refined (Ge) dispersed phase. The aging temperature had a significant influence on the microhardness in the case of the Au-Ge-Sn candidate alloy...

  3. Controlling Lateral Fano Interference Optical Force with Au-Ge2Sb2Te5 Hybrid Nanostructure

    DEFF Research Database (Denmark)

    Cao, Tun; Bao, Jiaxin; Mao, Libang;

    2016-01-01

    We numerically demonstrate that a pronounced dipole-quadrupole (DQ) Fano resonance (FR) induced lateral force can be exerted on a dielectric particle 80 nm in radius (R-sphere = 80 nm) that is placed 5 nm above an asymmetric bow-tie nanoantenna array based on Au/Ge2Sb2Te5 dual layers. The DQ-FR-i...

  4. Wetting and Soldering Behavior of Eutectic Au-Ge Alloy on Cu and Ni Substrates

    Science.gov (United States)

    Leinenbach, C.; Valenza, F.; Giuranno, D.; Elsener, H. R.; Jin, S.; Novakovic, R.

    2011-07-01

    Au-Ge-based alloys are interesting as novel high-temperature lead-free solders because of their low melting point, good thermal and electrical conductivity, and high corrosion resistance. In the present work, the wetting and soldering behavior of the eutectic Au-28Ge (at.%) alloy on Cu and Ni substrates have been investigated. Good wetting on both substrates with final contact angles of 13° to 14° was observed. In addition, solder joints with bond shear strength of 30 MPa to 35 MPa could be produced under controlled conditions. Cu substrates exhibit pronounced dissolution into the Au-Ge filler metal. On Ni substrates, the NiGe intermetallic compound was formed at the filler/substrate interface, which prevents dissolution of Ni into the solder. Using thin filler metal foils (25 μm), complete consumption of Ge in the reaction at the Ni interface was observed, leading to the formation of an almost pure Au layer in the soldering zone.

  5. A Corrosion Investigation of Solder Candidates for High-Temperature Applications

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Ambat, Rajan;

    2009-01-01

    The step soldering approach is being employed in the Multi-Chip module (MCM) technology. High lead containing alloys is one of the solders currently being used in this approach. Au-Sn and Au-Ge based candidate alloys have been proposed as alternative solders for this application. In this work, co...

  6. Generation of AuGe nanocomposites by co-sparking technique and their photoluminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Kala, Shubhra, E-mail: shubkala@gmail.com [National Physical Laboratory (India); Theissmann, Ralf; Kruis, Frank Einar [University of Duisburg-Essen, Institute for Nanostructures and Technology, Faculty of Engineering Science, and CENIDE (Center for Nanointegration Duisburg-Essen) (Germany)

    2013-09-15

    The feasibility of spark discharge technique for preparing metal-semiconductor nanocomposites is demonstrated. In the AuGe system, Au shows only 10{sup -3} atomic percent solid solubility in Ge, whereas 3.1 at.% Ge is soluble in Au. During the co-sparking, Au is used as anode material; the cathode is composed of Ge. The relative atomic percent of Au and Ge in the initially generated mixture can be changed by changing the charging current to the capacitor used to trigger the sparking. Depending upon the atomic ratio of Au and Ge in the initial mixture, AuGe agglomerates form AuGe composite nanoparticles on subsequent sintering, in which AuGe alloy nanoparticles are found dispersed in a Ge matrix. The size of the dispersed AuGe alloy nanoparticles depend on the relative atomic concentration of Au and Ge in the initial mixture as well as on the sintering temperature. AuGe alloy nanoparticles dispersed in the Ge matrix are observed to exhibit an intense photoluminescence between 550 and 600 nm.

  7. Structural and phonon transmission study of Ge-Au-Ge eutectically bonded interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Knowlton, W.B. [Univ. of California, Berkeley, CA (United States). Dept. of Materials Science and Mineral Engineering]|[Lawrence Berkeley Lab., CA (United States). Materials Sciences Div.

    1995-07-01

    This thesis presents a structural analysis and phonon transparency investigation of the Ge-Au-Ge eutectic bond interface. Interface development was intended to maximize the interfacial ballistic phonon transparency to enhance the detection of the dark matter candidate WIMPs. The process which was developed provides an interface which produces minimal stress, low amounts of impurities, and insures Ge lattice continuity through the interface. For initial Au thicknesses of greater than 1,000 {angstrom} Au per substrate side, eutectic epitaxial growth resulted in a Au dendritic structure with 95% cross sectional and 90% planar Au interfacial area coverages. In sections in which Ge bridged the interface, lattice continuity across the interface was apparent. Epitaxial solidification of the eutectic interface with initial Au thicknesses < 500 A per substrate side produced Au agglomerations thereby reducing the Au planar interfacial area coverage to as little as 30%. The mechanism for Au coalescence was attributed to lateral diffusion of Ge and Au in the liquid phase during solidification. Phonon transmission studies were performed on eutectic interfaces with initial Au thicknesses of 1,000 {angstrom}, 500 {angstrom}, and 300 {angstrom} per substrate side. Phonon imaging of eutectically bonded samples with initial Au thicknesses of 300 {angstrom}/side revealed reproducible interfacial percent phonon transmissions from 60% to 70%. Line scan phonon imaging verified the results. Phonon propagation TOF spectra distinctly showed the predominant phonon propagation mode was ballistic. This was substantiated by phonon focusing effects apparent in the phonon imaging data. The degree of interface transparency to phonons and resulting phonon propagation modes correlate with the structure of the interface following eutectic solidification. Structural studies of samples with initial Au thickness of 1,000 {angstrom}/side appear to correspond with the phonon transmission study.

  8. Existence of a stable compound in the Au-Ge alloy system

    NARCIS (Netherlands)

    Tasci, E.S.; Sluiter, M.H.F.; Pasturel, A.; Jakse, N.

    2010-01-01

    First-principles electronic structure calculations predict the existence of a crystalline compound in the Au-Ge system. The structure is found by matching the theoretically determined local atomic structure in the liquid state with that for experimentally known crystal structures in other alloys. Su

  9. Temperature-induced assembly of semiconductor nanocrystals into fractal architectures and thermoelectric power properties in Au/Ge bilayer films

    Energy Technology Data Exchange (ETDEWEB)

    Li Quanbao; Wang Jian; Jiao Zheng [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Wu Minghong, E-mail: mhwu@staff.shu.edu.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Shek, Chan-Hung; Lawrence Wu, C.M.; Lai, Joseph K.L. [Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong); Chen Zhiwen, E-mail: cnzwchen@yahoo.com.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong)

    2011-08-15

    Highlights: > Ge fractal architectures were achieved by temperature-induced assembly. > The appearance of fractal architectures influences the thermoelectric power. > But it has little effect on the resistivity. > The values of the superlocalization exponent were within 1.22 {<=} {xi} {<=} 1.29. > It was higher than expected for two-dimension fractal system. - Abstract: Fractal architectures of semiconductor nanocrystals were successfully achieved by temperature-induced assembly of semiconductor nanocrystals in gold/germanium (Au/Ge) bilayer films. New assessment strategies of fractal architectures are of fundamental importance in the development of micro/nano-devices. Temperature-dependent properties including resistivity and thermoelectric power (TEP) of Au/Ge bilayer films with self-similar fractal patterns were investigated in detail. Experimental results indicated that the microstructure of Au film plays an important role in the characteristics of Au/Ge bilayer films after annealing and the crystallization processes of amorphous Ge accompany by fractal formation of Ge nanocrystals via temperature-induced assembly. The appearance of fractal architectures has significantly influence on the TEP but little effect on the resistivity of the annealed bilayer film. By analysis of the data, we found that the values of superlocalization exponent are within 1.22 {<=} {xi} {<=} 1.29, which are higher than expected for two-dimension fractal systems. The results provided possible evidence for the superlocalization on fractal architectures in Au/Ge bilayer films. The TEP measurements are considered a more effective method than the conductivity for investigating superlocalization in a percolating system.

  10. Magnetic, Electrical and Surface Morphological Characterization of AuGe/Ni/Au Ohmic Contact Metallization on GaAs/AlGaAs Multilayer Structures

    Directory of Open Access Journals (Sweden)

    T.S. Abhilash

    2011-01-01

    Full Text Available A process issue arising from the use of ferromagnetic Nickel in the AuGe/Ni/Au Ohmic contact metallization is studied in the context of magnetic field sensors and HEMT devices made using GaAs/AlGaAs multilayer structures with the two dimensional electron gas layer. The dependence of magnetization, contact resistance, adhesion, surface roughness and current distribution of alloyed Ohmic contacts on parameters such as Ni layer thickness, anneal temperature and Au-Ge alloy composition are discussed. The magnetization measurements provided some new and interesting insights into changes occurring in the metallization layers prior to alloying.

  11. Carrier transport property of Au/Ge/SiO2/p-Si structure%Au/Ge/SiO2/p-Si结构中的电流输运特性

    Institute of Scientific and Technical Information of China (English)

    陈彦; 马书懿

    2006-01-01

    用射频磁控溅射双靶交替淀积的方法在p-Si(100)衬底上制备了Ge/SiO2薄膜,利用Au/Ge/SiO2/p-Si结构的I-V特性曲线研究了该结构的电流输运机制.分析表明,在较低的正向偏压和反向偏压下,电流输运机制分别为Schottky发射和欧姆输运电流;而在较高的正向偏压下,Frenkel-Poole发射和空间电荷限制电流两种机制共同作用.

  12. M3(Au,Ge)19 and M(3.25)(Au,Ge)18 (M = Ca, Yb): distinctive phase separations driven by configurational disorder in cubic YCd6-type derivatives.

    Science.gov (United States)

    Lin, Qisheng; Corbett, John D

    2010-05-17

    Exploratory syntheses in the M-Au-Ge (M = Ca, Yb) systems have led to the discovery of two cleanly separated non-stoichiometric phases M(3)Au(approximately 14.4)Ge(approximately 4.6) (I) and M(3.25)Au(approximately 12.7)Ge(approximately 5.3) (II). Single crystal X-ray studies reveal that both (space group Im3) feature body-centered-cubic packing of five-shell multiply endohedral clusters that resemble those in the parent YCd(6) (= Y(3)Cd(18)) and are akin to approximate phases in other quasicrystal systems. However, differences resulting from various disorders in these are distinctive. The innermost cluster in the M(3)Au(approximately 14.4)Ge(approximately 4.6) phase (I) remains a disordered tetrahedron, as in the YCd(6) parent. In contrast, its counterpart in the electron-richer M(3.25)Au(approximately 12.7)Ge(approximately 5.3) phase (II) is a "rattling" M atom. The structural differentiations between I and II exhibit strong correlations between lattice parameters, cluster sizes, particular site occupancies, and valence electron counts.

  13. Fuzzy Logic Based Trusted Candidate Selection for Stable Multipath Routing

    Directory of Open Access Journals (Sweden)

    Sujata V. Mallapur

    2015-05-01

    Full Text Available In mobile ad hoc networks (MANETs, providing reliable and stable communication paths between wireless devices is critical. This paper presents a fuzzy logic stablebackbone-based multipath routing protocol (FLSBMRP for MANET that provides a high-quality path for communication between nodes. The proposed protocol has two main phases. The first phase is the selection of candidate nodes using a fuzzy logic technique. The second phase is the construction of a routing backbone that establishes multiple paths between nodes through the candidate nodes, thus forming a routing backbone. If any candidate node in the path fails due to a lack of bandwidth, residual energy or link quality, an alternate path through another candidate node is selected for communication before the route breaks, because a candidate node failure may lead to a broken link between the nodes. Simulation results demonstrate that the proposed protocol performs better in terms of the packet delivery ratio, overhead, delay and packet drop ratio than the major existing ad hoc routing protocols.

  14. Speeding disease gene discovery by sequence based candidate prioritization

    Directory of Open Access Journals (Sweden)

    Porteous David J

    2005-03-01

    Full Text Available Abstract Background Regions of interest identified through genetic linkage studies regularly exceed 30 centimorgans in size and can contain hundreds of genes. Traditionally this number is reduced by matching functional annotation to knowledge of the disease or phenotype in question. However, here we show that disease genes share patterns of sequence-based features that can provide a good basis for automatic prioritization of candidates by machine learning. Results We examined a variety of sequence-based features and found that for many of them there are significant differences between the sets of genes known to be involved in human hereditary disease and those not known to be involved in disease. We have created an automatic classifier called PROSPECTR based on those features using the alternating decision tree algorithm which ranks genes in the order of likelihood of involvement in disease. On average, PROSPECTR enriches lists for disease genes two-fold 77% of the time, five-fold 37% of the time and twenty-fold 11% of the time. Conclusion PROSPECTR is a simple and effective way to identify genes involved in Mendelian and oligogenic disorders. It performs markedly better than the single existing sequence-based classifier on novel data. PROSPECTR could save investigators looking at large regions of interest time and effort by prioritizing positional candidate genes for mutation detection and case-control association studies.

  15. A computer vision based candidate for functional balance test.

    Science.gov (United States)

    Nalci, Alican; Khodamoradi, Alireza; Balkan, Ozgur; Nahab, Fatta; Garudadri, Harinath

    2015-08-01

    Balance in humans is a motor skill based on complex multimodal sensing, processing and control. Ability to maintain balance in activities of daily living (ADL) is compromised due to aging, diseases, injuries and environmental factors. Center for Disease Control and Prevention (CDC) estimate of the costs of falls among older adults was $34 billion in 2013 and is expected to reach $54.9 billion in 2020. In this paper, we present a brief review of balance impairments followed by subjective and objective tools currently used in clinical settings for human balance assessment. We propose a novel computer vision (CV) based approach as a candidate for functional balance test. The test will take less than a minute to administer and expected to be objective, repeatable and highly discriminative in quantifying ability to maintain posture and balance. We present an informal study with preliminary data from 10 healthy volunteers, and compare performance with a balance assessment system called BTrackS Balance Assessment Board. Our results show high degree of correlation with BTrackS. The proposed system promises to be a good candidate for objective functional balance tests and warrants further investigations to assess validity in clinical settings, including acute care, long term care and assisted living care facilities. Our long term goals include non-intrusive approaches to assess balance competence during ADL in independent living environments.

  16. Trinocular stereo vision method based on mesh candidates

    Science.gov (United States)

    Liu, Bin; Xu, Gang; Li, Haibin

    2010-10-01

    One of the most interesting goals of machine vision is 3D structure recovery of the scenes. This recovery has many applications, such as object recognition, reverse engineering, automatic cartography, autonomous robot navigation, etc. To meet the demand of measuring the complex prototypes in reverse engineering, a trinocular stereo vision method based on mesh candidates was proposed. After calibration of the cameras, the joint field of view can be defined in the world coordinate system. Mesh grid is established along the coordinate axes, and the mesh nodes are considered as potential depth data of the object surface. By similarity measure of the correspondence pairs which are projected from a certain group of candidates, the depth data can be obtained readily. With mesh nodes optimization, the interval between the neighboring nodes in depth direction could be designed reasonably. The potential ambiguity can be eliminated efficiently in correspondence matching with the constraint of a third camera. The cameras can be treated as two independent pairs, left-right and left-centre. Due to multiple peaks of the correlation values, the binocular method may not satisfy the accuracy of the measurement. Another image pair is involved if the confidence coefficient is less than the preset threshold. The depth is determined by the highest sum of correlation of both camera pairs. The measurement system was simulated using 3DS MAX and Matlab software for reconstructing the surface of the object. The experimental result proved that the trinocular vision system has good performance in depth measurement.

  17. Candidate antibody-based therapeutics against HIV-1.

    Science.gov (United States)

    Gong, Rui; Chen, Weizao; Dimitrov, Dimiter S

    2012-06-01

    Antibody-based therapeutics have been successfully used for the treatment of various diseases and as research tools. Several well characterized, broadly neutralizing monoclonal antibodies (bnmAbs) targeting HIV-1 envelope glycoproteins or related host cell surface proteins show sterilizing protection of animals, but they are not effective when used for therapy of an established infection in humans. Recently, a number of novel bnmAbs, engineered antibody domains (eAds), and multifunctional fusion proteins have been reported which exhibit exceptionally potent and broad neutralizing activity against a wide range of HIV-1 isolates from diverse genetic subtypes. eAds could be more effective in vivo than conventional full-size antibodies generated by the human immune system. Because of their small size (12∼15 kD), they can better access sterically restricted epitopes and penetrate densely packed tissue where HIV-1 replicates than the larger full-size antibodies. HIV-1 possesses a number of mechanisms to escape neutralization by full-size antibodies but could be less likely to develop resistance to eAds. Here, we review the in vitro and in vivo antiviral efficacies of existing HIV-1 bnmAbs, summarize the development of eAds and multispecific fusion proteins as novel types of HIV-1 inhibitors, and discuss possible strategies to generate more potent antibody-based candidate therapeutics against HIV-1, including some that could be used to eradicate the virus.

  18. Monoclonal antibody-based candidate therapeutics against HIV type 1.

    Science.gov (United States)

    Chen, Weizao; Dimitrov, Dimiter S

    2012-05-01

    Treatment of HIV-1 infection has been highly successful with small molecule drugs. However, resistance still develops. In addition, long-term use can lead to toxicity with unpredictable effects on health. Finally, current drugs do not lead to HIV-1 eradication. The presence of the virus leads to chronic inflammation, which can result in increased morbidity and mortality after prolonged periods of infection. Monoclonal antibodies (mAbs) have been highly successful during the past two decades for therapy of many diseases, primarily cancers and immune disorders. They are relatively safe, especially human mAbs that have evolved in humans at high concentrations to fight diseases and long-term use may not lead to toxicities. Several broadly neutralizing mAbs (bnmAbs) against HIV-1 can protect animals but are not effective when used for therapy of an established infection. We have hypothesized that HIV-1 has evolved strategies to effectively escape neutralization by full-size antibodies in natural infections but not by smaller antibody fragments. Therefore, a promising direction of research is to discover and exploit antibody fragments as potential candidate therapeutics against HIV-1. Here we review several bnmAbs and engineered antibody domains (eAds), their in vitro and in vivo antiviral efficacy, mechanisms used by HIV-1 to escape them, and strategies that could be effective to develop more powerful mAb-based HIV-1 therapeutics.

  19. Candidate Smoke Region Segmentation of Fire Video Based on Rough Set Theory

    OpenAIRE

    Yaqin Zhao

    2015-01-01

    Candidate smoke region segmentation is the key link of smoke video detection; an effective and prompt method of candidate smoke region segmentation plays a significant role in a smoke recognition system. However, the interference of heavy fog and smoke-color moving objects greatly degrades the recognition accuracy. In this paper, a novel method of candidate smoke region segmentation based on rough set theory is presented. First, Kalman filtering is used to update video background in order to ...

  20. Utility-based Recommendation of Candidate Coalitions in Virtual Creativity Teams

    NARCIS (Netherlands)

    Sie, Rory; Bitter-Rijpkema, Marlies; Sloep, Peter

    2010-01-01

    Sie, R. L. L., Bitter-Rijpkema, M. E., & Sloep, P. B. (2010, 28-30 September). Utility-based Recommendation of Candidate Coalitions in Virtual Creativity Teams. Presentation at the first Workshop on Recommender Systems in Technology Enhanced Learning (RecSysTEL 2010), Barcelona, Spain.

  1. A three-dimensional measurement method based on mesh candidates assisted with structured light

    Science.gov (United States)

    Xu, Gang; Zhang, Wenming; Li, Haibin; Liu, Bin

    2009-07-01

    Rendering three-dimensional information of a scene from optical measurement is very important for a wide variety of applications such as robot navigation, rapid prototyping, medical imaging, industrial inspection, etc. In this paper, a new 3D measurement method based on mesh candidate with structured light illuminating is proposed. The vision sensor consists of two CCD cameras and a DLP projector. The measurement system combines the technology of binocular stereo vision and structured light, so as to simplify the process of acquiring depth information using mesh candidates. The measurement method is based on mesh candidates which represent the potential depth in the three dimensional scene. First the mesh grid was created along the direction of axes in world coordinate system, and the nodes were considered as depth candidates on the surface of object. Then each group of the mesh nodes varying along z axis were mapped to the captured image planes of both cameras. At last, according to the similarity measure of the corresponding pixel pairs, the depth of the object surface can be obtained. The matching process is between the pixels in both camera planes corresponding to the spatial mesh candidates. Aided by the structured light pattern, the accuracy of measurement system improved. Appending the periodic sawtooth pattern on the scene by structured light made measurement easier, while the computational cost did not increased since the projector had no need to be calibrated. The 3DS MAX and Matlab software were used to simulate measurement system and reconstruct the surface of the object. After the positioned cameras have been calibrated using Matlab calibration toolbox, the projector is used to project structured light pattern on the scene. Indicated by experimental results, the mesh-candidate-based method is obviously superior in computation and accuracy. Compared with traditional methods based on image matching, our method has several advantages: (1) the complex

  2. A Simulation for Content-based and Utility-based Recommendation of Candidate Coalitions in Virtual Creativity Teams

    NARCIS (Netherlands)

    Sie, Rory; Bitter-Rijpkema, Marlies; Sloep, Peter

    2010-01-01

    Sie, R. L. L., Bitter-Rijpkema, M. E., Sloep, P. B. (2010). A Simulation for Content-based and Utility-based Recommendation of Candidate Coalitions in Virtual Creativity Teams. 1st Workshop on Recommender Systems for Technology Enhanced Learning (RecSysTEL 2010). September, 29 -30, 2010, Barcelona,

  3. Using Bayesian Networks for Candidate Generation in Consistency-based Diagnosis

    Science.gov (United States)

    Narasimhan, Sriram; Mengshoel, Ole

    2008-01-01

    Consistency-based diagnosis relies heavily on the assumption that discrepancies between model predictions and sensor observations can be detected accurately. When sources of uncertainty like sensor noise and model abstraction exist robust schemes have to be designed to make a binary decision on whether predictions are consistent with observations. This risks the occurrence of false alarms and missed alarms when an erroneous decision is made. Moreover when multiple sensors (with differing sensing properties) are available the degree of match between predictions and observations can be used to guide the search for fault candidates. In this paper we propose a novel approach to handle this problem using Bayesian networks. In the consistency- based diagnosis formulation, automatically generated Bayesian networks are used to encode a probabilistic measure of fit between predictions and observations. A Bayesian network inference algorithm is used to compute most probable fault candidates.

  4. Intelligent computing budget allocation for on-road tra jectory planning based on candidate curves

    Institute of Scientific and Technical Information of China (English)

    Xiao-xin FU; Yong-heng JIANG; De-xian HUANG; Jing-chun WANG; Kai-sheng HUANG

    2016-01-01

    In this paper, on-road trajectory planning is solved by introducing intelligent computing budget allocation (ICBA) into a candidate-curve-based planning algorithm, namely, ordinal-optimization-based differential evolution (OODE). The proposed algorithm is named IOODE with‘I’ representing ICBA. OODE plans the trajectory in two parts: trajectory curve and acceleration profi le. The best trajectory curve is picked from a set of candidate curves, where each curve is evaluated by solving a subproblem with the differential evolution (DE) algorithm. The more iterations DE performs, the more accurate the evaluation will become. Thus, we intelligently allocate the iterations to individual curves so as to reduce the total number of iterations performed. Meanwhile, the selected best curve is ensured to be one of the truly top curves with a high enough probability. Simulation results show that IOODE is 20% faster than OODE while maintaining the same performance in terms of solution quality. The computing budget allocation framework presented in this paper can also be used to enhance the efficiency of other candidate-curve-based planning methods.

  5. Candidate pathway based analysis for cleft lip with or without cleft palate.

    Science.gov (United States)

    Zhang, Tian-Xiao; Beaty, Terri H; Ruczinski, Ingo

    2012-01-06

    The objective of this research was to identify potential biological pathways associated with non-syndromic cleft lip with or without cleft palate (NSCL/P), and to explore the potential biological mechanisms underlying these associated pathways on risk of NSCL/P. This project was based on the dataset of a previously published genome-wide association (GWA) study on NSCL/P (Beaty et al. 2010). Case-parent trios used here originated from an international consortium (The Gene, Environment Association Studies consortium, GENEVA) formed in 2007. A total of 5,742 individuals from 1,908 CL/P case-parents trios (1,591 complete trios and 317 incomplete trios where one parent was missing) were collected and genotyped using the Illumina Human610-Quad array. Candidate pathways were selected using a list of 356 genes that may be related to oral clefts. In total, 42 candidate pathways, which included 1,564 genes and 40,208 SNPs were tested. Using a pathway-based analysis approach proposed by Wang et al (2007), we conducted a permutation-based test to assess the statistical significance of the nominal p-values of 42 candidate pathways. The analysis revealed several pathways yielding nominally significant p-values. However, controlling for the family wise error rate, none of these pathways could retain statistical significance. Nominal p-values of these pathways were concentrated at the lower tail of the distribution, with more than expected low p-values. A permutation based test for examining this type of distribution pattern yielded an overall p-value of 0.029. Thus, while this pathway-based analysis did not yield a clear significant result for any particular pathway, we conclude that one or more of the genes and pathways considered here likely do play a role in oral clefting.

  6. Candidate Smoke Region Segmentation of Fire Video Based on Rough Set Theory

    Directory of Open Access Journals (Sweden)

    Yaqin Zhao

    2015-01-01

    Full Text Available Candidate smoke region segmentation is the key link of smoke video detection; an effective and prompt method of candidate smoke region segmentation plays a significant role in a smoke recognition system. However, the interference of heavy fog and smoke-color moving objects greatly degrades the recognition accuracy. In this paper, a novel method of candidate smoke region segmentation based on rough set theory is presented. First, Kalman filtering is used to update video background in order to exclude the interference of static smoke-color objects, such as blue sky. Second, in RGB color space smoke regions are segmented by defining the upper approximation, lower approximation, and roughness of smoke-color distribution. Finally, in HSV color space small smoke regions are merged by the definition of equivalence relation so as to distinguish smoke images from heavy fog images in terms of V component value variety from center to edge of smoke region. The experimental results on smoke region segmentation demonstrated the effectiveness and usefulness of the proposed scheme.

  7. Network Based Integrated Analysis of Phenotype-Genotype Data for Prioritization of Candidate Symptom Genes

    Directory of Open Access Journals (Sweden)

    Xing Li

    2014-01-01

    Full Text Available Background. Symptoms and signs (symptoms in brief are the essential clinical manifestations for individualized diagnosis and treatment in traditional Chinese medicine (TCM. To gain insights into the molecular mechanism of symptoms, we develop a computational approach to identify the candidate genes of symptoms. Methods. This paper presents a network-based approach for the integrated analysis of multiple phenotype-genotype data sources and the prediction of the prioritizing genes for the associated symptoms. The method first calculates the similarities between symptoms and diseases based on the symptom-disease relationships retrieved from the PubMed bibliographic database. Then the disease-gene associations and protein-protein interactions are utilized to construct a phenotype-genotype network. The PRINCE algorithm is finally used to rank the potential genes for the associated symptoms. Results. The proposed method gets reliable gene rank list with AUC (area under curve 0.616 in classification. Some novel genes like CALCA, ESR1, and MTHFR were predicted to be associated with headache symptoms, which are not recorded in the benchmark data set, but have been reported in recent published literatures. Conclusions. Our study demonstrated that by integrating phenotype-genotype relationships into a complex network framework it provides an effective approach to identify candidate genes of symptoms.

  8. ReCGiP, a database of reproduction candidate genes in pigs based on bibliomics

    Directory of Open Access Journals (Sweden)

    Yang Lun

    2010-08-01

    Full Text Available Abstract Background Reproduction in pigs is one of the most economically important traits. To improve the reproductive performances, numerous studies have focused on the identification of candidate genes. However, it is hard for one to read all literatures thoroughly to get information. So we have developed a database providing candidate genes for reproductive researches in pig by mining and processing existing biological literatures in human and pigs, named as ReCGiP. Description Based on text-mining and comparative genomics, ReCGiP presents diverse information of reproduction-relevant genes in human and pig. The genes were sorted by the degree of relevance with the reproduction topics and were visualized in a gene's co-occurrence network where two genes were connected if they were co-cited in a PubMed abstract. The 'hub' genes which had more 'neighbors' were thought to be have more important functions and could be identified by the user in their web browser. In addition, ReCGiP provided integrated GO annotation, OMIM and biological pathway information collected from the Internet. Both pig and human gene information can be found in the database, which is now available. Conclusions ReCGiP is a unique database providing information on reproduction related genes for pig. It can be used in the area of the molecular genetics, the genetic linkage map, and the breeding of the pig and other livestock. Moreover, it can be used as a reference for human reproduction research.

  9. Handwritten Japanese Address Recognition Technique Based on Improved Phased Search of Candidate Rectangle Lattice

    Directory of Open Access Journals (Sweden)

    Hidehisa NAKAYAMA

    2004-08-01

    Full Text Available In the field of handwritten Japanese address recognition, it is common to recognize place-name strings from place-name images. However, in practice, it is necessary to recognize the place-name strings from address images. Therefore, we have proposed the post-processing system, which checks the list of the place-name strings in two-stages for recognizing the place-name images. In this paper, we propose a new technique based on phased search of candidate rectangle lattice, and improve the technique with the detection of key-characters for final output. Applying our proposal to the IPTP 1840 image data of address strings, the results of experiments clearly show the efficiency of our system in handwritten Japanese address recognition.

  10. A PROJECT-BASED LEARNING PACKAGE FOR PH. D CANDIDATES AT HIT

    Institute of Scientific and Technical Information of China (English)

    ZhaoYuqin

    2004-01-01

    Project-based learning is to involve students in a project-like learning program to achieve the required purposes of language learning, It is a new pedagogical approach composed of a series of tasks, requiring students to use various languages and other skills to accomplish respectively. It is to provide students with opportunities to learn the language in a simulated authentic communicative situation when they are using the language. A project-based learning program was desigued for the Ph. D.candidates at HIT, named “simulating an international conference”. It involves the students in the whole process of organizing and participating an international conference. In the simulated context, students have opportunities to learn and practice English while they are using English to fulfill some tasks. Meanwhile, students are able to practice other skills, such as using information technologies, word editing and publishing. More importantly, students need to collaborate and cooperate with each other. The abilities to use English as a communicative tool for international communication, to use information technologies and to be able to cooperate with other sare the aims of education in the 21st century.

  11. Solid particle erosion of steels and nickel based alloys candidates for USC steam turbine blading

    Energy Technology Data Exchange (ETDEWEB)

    Cernuschi, Federico; Guardamagna, Cristina; Lorenzoni, Lorenzo [ERSE SpA, Milan (Italy); Robba, Davide [CESI, Milan (Italy)

    2010-07-01

    The main objective of COST536 Action is to develop highly efficient steam power plant with low emissions, from innovative alloy development to validation of component integrity. In this perspective, to improve the operating efficiency, materials capable of withstanding higher operating temperatures are required. For the manufacturing of components for steam power plants with higher efficiency steels and nickel-based alloys with improved oxidation resistance and creep strength at temperature as high as 650 C - 700 C have to be developed. Candidate alloys for manufacturing high pressure steam turbine diaphragms, buckets, radial seals and control valves should exhibit, among other properties, a good resistance at the erosion phenomena induced by hard solid particles. Ferric oxide (magnetite) scales cause SPE by exfoliating from boiler tubes and steam pipes (mainly super-heaters and re-heaters) and being transported within the steam flow to the turbine. In order to comparatively study the erosion behaviour of different materials in relatively short times, an accelerated experimental simulation of the erosion phenomena must be carried out. Among different techniques to induce erosion on material targets, the use of an air jet tester is well recognised to be one of the most valid and reliable. In this work the results of SPE comparative tests performed at high temperatures (550 C, 600 C and 650 C) at different impaction angles on some steels and nickel based alloys samples are reported. (orig.)

  12. Novel chikungunya vaccine candidate with an IRES-based attenuation and host range alteration mechanism.

    Directory of Open Access Journals (Sweden)

    Kenneth Plante

    2011-07-01

    Full Text Available Chikungunya virus (CHIKV is a reemerging mosquito-borne pathogen that has recently caused devastating urban epidemics of severe and sometimes chronic arthralgia. As with most other mosquito-borne viral diseases, control relies on reducing mosquito populations and their contact with people, which has been ineffective in most locations. Therefore, vaccines remain the best strategy to prevent most vector-borne diseases. Ideally, vaccines for diseases of resource-limited countries should combine low cost and single dose efficacy, yet induce rapid and long-lived immunity with negligible risk of serious adverse reactions. To develop such a vaccine to protect against chikungunya fever, we employed a rational attenuation mechanism that also prevents the infection of mosquito vectors. The internal ribosome entry site (IRES from encephalomyocarditis virus replaced the subgenomic promoter in a cDNA CHIKV clone, thus altering the levels and host-specific mechanism of structural protein gene expression. Testing in both normal outbred and interferon response-defective mice indicated that the new vaccine candidate is highly attenuated, immunogenic and efficacious after a single dose. Furthermore, it is incapable of replicating in mosquito cells or infecting mosquitoes in vivo. This IRES-based attenuation platform technology may be useful for the predictable attenuation of any alphavirus.

  13. Trust Based Algorithm for Candidate Node Selection in Hybrid MANET-DTN

    Directory of Open Access Journals (Sweden)

    Jan Papaj

    2014-01-01

    Full Text Available The hybrid MANET - DTN is a mobile network that enables transport of the data between groups of the disconnected mobile nodes. The network provides benefits of the Mobile Ad-Hoc Networks (MANET and Delay Tolerant Network (DTN. The main problem of the MANET occurs if the communication path is broken or disconnected for some short time period. On the other side, DTN allows sending data in the disconnected environment with respect to higher tolerance to delay. Hybrid MANET - DTN provides optimal solution for emergency situation in order to transport information. Moreover, the security is the critical factor because the data are transported by mobile devices. In this paper, we investigate the issue of secure candidate node selection for transportation of the data in a disconnected environment for hybrid MANET- DTN. To achieve the secure selection of the reliable mobile nodes, the trust algorithm is introduced. The algorithm enables select reliable nodes based on collecting routing information. This algorithm is implemented to the simulator OPNET modeler.

  14. 1WHSP: An IR-based sample of ~1000 VHE γ-ray blazar candidates

    Science.gov (United States)

    Arsioli, B.; Fraga, B.; Giommi, P.; Padovani, P.; Marrese, P. M.

    2015-07-01

    Context. Blazars are the dominant type of extragalactic sources at microwave and at γ-ray energies. In the most energetic part of the electromagnetic spectrum (E ≳ 100 GeV) a high fraction of high Galactic latitude sources are blazars of the high synchrotron peaked (HSP) type, that is BL Lac objects with synchrotron power peaking in the UV or in the X-ray band. Building new large samples of HSP blazars is key to understand the properties of jets under extreme conditions, and to study the demographics and the peculiar cosmological evolution of these sources. Aims: High synchrotron peaked blazars are remarkably rare, with only a few hundreds of them expected to be above the sensitivity limits of currently available surveys, some of which include hundreds of millions of sources. To find these very uncommon objects, we have devised a method that combines ALLWISE survey data with multi-frequency selection criteria. Methods: The sample was defined starting from a primary list of infrared colour-colour selected sources from the ALLWISE all sky survey database, and applying further restrictions on IR-radio and IR-X-ray flux ratios. Using a polynomial fit to the multi-frequency data (radio to X-ray), we estimated synchrotron peak frequencies and fluxes of each object. Results: We assembled a sample including 992 sources, which is currently the largest existing list of confirmed and candidates HSP blazars. All objects are expected to radiate up to the highest γ-ray photon energies. In fact, 299 of these are confirmed emitters of GeV γ-ray photons (based on Fermi-LAT catalogues), and 36 have already been detected in the TeV band. The majority of sources in the sample are within reach of the upcoming Cherenkov Telescope Array (CTA), and many may be detectable even by the current generation of Cherenkov telescopes during flaring episodes. The sample includes 425 previously known blazars, 151 new identifications, and 416 HSP candidates (mostly faint sources) for which no

  15. A candidate gene-based association study of tocopherol content and composition in rapeseed (Brassica napus

    Directory of Open Access Journals (Sweden)

    Steffi eFritsche

    2012-06-01

    Full Text Available Rapeseed (Brassica napus L. is the most important oil crop of temperate climates. Rapeseed oil contains tocopherols, also known as vitamin E, which is an indispensable nutrient for humans and animals due to its antioxidant and radical scavenging abilities. Moreover, tocopherols are also important for the oxidative stability of vegetable oils. Therefore, seed oil with increased tocopherol content or altered tocopherol composition is a target for breeding. We investigated the role of nucleotide variations within candidate genes from the tocopherol biosynthesis pathway. Field trials were carried out with 229 accessions from a worldwide B. napus collection which was divided into two panels of 96 and 133 accessions. Seed tocopherol content and composition were measured by HPLC. High heritabilities were found for both traits, ranging from 0.62 to 0.94. We identified polymorphisms by sequencing selected regions of the tocopherol genes from the 96 accession panel. Subsequently, we determined the population structure (Q and relative kinship (K as detected by genotyping with genome-wide distributed SSR markers. Association studies were performed using two models, the structure-based GLM+Q and the PK mixed model. Between 26 and 12 polymorphisms within two genes (BnaX.VTE3.a, BnaA.PDS1.c were significantly associated with tocopherol traits. The SNPs explained up to 16.93 % of the genetic variance for tocopherol composition and up to 10.48 % for total tocopherol content. Based on the sequence information we designed CAPS markers for genotyping the 133 accessions from the 2nd panel. Significant associations with various tocopherol traits confirmed the results from the first experiment. We demonstrate that the polymorphisms within the tocopherol genes clearly impact tocopherol content and composition in B. napus seeds. We suggest that these nucleotide variations may be used as selectable markers for breeding rapeseed with enhanced tocopherol quality.

  16. Detection of the early keratoconus based on corneal biomechanical properties in the refractive surgery candidates

    Directory of Open Access Journals (Sweden)

    Zofia Pniakowska

    2016-01-01

    Full Text Available Context: Subclinical keratoconus is contraindication to refractive surgery. The currently used methods of preoperative screening do not always allow differentiating between healthy eyes and those with subclinical keratoconus. Aim: To evaluate biomechanical parameters of the cornea, waveform score (WS, and intraocular pressure (IOP as potentially useful adjuncts to the diagnostic algorithm for precise detection of the early keratoconus stages and selection of refractive surgery candidates. Settings and Design: Department of Ophthalmology and prospective cross-sectional study. Patients and Methods: Patients enrolled in the study were diagnosed with refractive disorders. We assessed parameters of corneal biomechanics such as corneal hysteresis (CH, corneal resistance factor (CRF, Goldman-correlated IOP (IOPg, corneal compensated IOP, WS, and keratoconus match index (KMI. They were classified into one of three groups based on the predefined KMI range: Group 1 (from 0.352 to 0.757 – 45 eyes, Group 2 (from −0.08 to 0.313 – 52 eyes, and Group 0 - control group (from 0.761 to 1.642 – 80 eyes. Results: In both study groups, IOPg, CRF, and CH were decreased when compared to control (P < 0.0001. In control group, there was positive correlation between CH and KMI (P < 0.05, with no correlations in any of the two study groups. CRF correlated positively with KMI in control (P < 0.0001 and in Group 2 (P < 0.05. Conclusions: CH and CRF, together with WS and IOPg, consist a clinically useful adjunct to detect subclinical keratoconus in patients referred for refractive surgery when based on KMI staging.

  17. Modular construction of quaternary hemiaminal-based inhibitor candidates and their in cellulo assessment with HIV-1 protease.

    Science.gov (United States)

    Gros, Guillaume; Martinez, Lorena; Gimenez, Anna Servat; Adler, Paula; Maurin, Philippe; Wolkowicz, Roland; Falson, Pierre; Hasserodt, Jens

    2013-09-01

    Non-peptidomimetic drug-like protease inhibitors have potential for circumventing drug resistance. We developed a much-improved synthetic route to our previously reported inhibitor candidate displaying an unusual quaternized hemi-aminal. This functional group forms from a linear precursor upon passage into physiological media. Seven variants were prepared and tested in cellulo with our HIV-1 fusion-protein technology that result in an eGFP-based fluorescent readout. Three candidates showed inhibition potency above 20μM and toxicity at higher concentrations, making them attractive targets for further refinement. Importantly, our class of original inhibitor candidates is not recognized by two major multidrug resistance pumps, quite in contrast to most clinically applied HIV-1 protease inhibitors.

  18. Chest Fat Quantification via CT Based on Standardized Anatomy Space in Adult Lung Transplant Candidates

    Science.gov (United States)

    Tong, Yubing; Udupa, Jayaram K.; Torigian, Drew A.; Odhner, Dewey; Wu, Caiyun; Pednekar, Gargi; Palmer, Scott; Rozenshtein, Anna; Shirk, Melissa A.; Newell, John D.; Porteous, Mary; Diamond, Joshua M.

    2017-01-01

    Purpose Overweight and underweight conditions are considered relative contraindications to lung transplantation due to their association with excess mortality. Yet, recent work suggests that body mass index (BMI) does not accurately reflect adipose tissue mass in adults with advanced lung diseases. Alternative and more accurate measures of adiposity are needed. Chest fat estimation by routine computed tomography (CT) imaging may therefore be important for identifying high-risk lung transplant candidates. In this paper, an approach to chest fat quantification and quality assessment based on a recently formulated concept of standardized anatomic space (SAS) is presented. The goal of the paper is to seek answers to several key questions related to chest fat quantity and quality assessment based on a single slice CT (whether in the chest, abdomen, or thigh) versus a volumetric CT, which have not been addressed in the literature. Methods Unenhanced chest CT image data sets from 40 adult lung transplant candidates (age 58 ± 12 yrs and BMI 26.4 ± 4.3 kg/m2), 16 with chronic obstructive pulmonary disease (COPD), 16 with idiopathic pulmonary fibrosis (IPF), and the remainder with other conditions were analyzed together with a single slice acquired for each patient at the L5 vertebral level and mid-thigh level. The thoracic body region and the interface between subcutaneous adipose tissue (SAT) and visceral adipose tissue (VAT) in the chest were consistently defined in all patients and delineated using Live Wire tools. The SAT and VAT components of chest were then segmented guided by this interface. The SAS approach was used to identify the corresponding anatomic slices in each chest CT study, and SAT and VAT areas in each slice as well as their whole volumes were quantified. Similarly, the SAT and VAT components were segmented in the abdomen and thigh slices. Key parameters of the attenuation (Hounsfield unit (HU) distributions) were determined from each chest slice and

  19. A cell wall protein-based vaccine candidate induce protective immune response against Sporothrix schenckii infection.

    Science.gov (United States)

    Portuondo, Deivys Leandro; Batista-Duharte, Alexander; Ferreira, Lucas Souza; Martínez, Damiana Téllez; Polesi, Marisa Campos; Duarte, Roberta Aparecida; de Paula E Silva, Ana Carolina Alves; Marcos, Caroline Maria; Almeida, Ana Marisa Fusco de; Carlos, Iracilda Zeppone

    2016-02-01

    Sporotrichosis is a subcutaneous mycosis caused by several closely related thermo-dimorphic fungi of the Sporothrix schenckii species complex, affecting humans and other mammals. In the last few years, new strategies have been proposed for controlling sporotrichosis owning to concerns about its growing incidence in humans, cats, and dogs in Brazil, as well as the toxicity and limited efficacy of conventional antifungal drugs. In this study, we assessed the immunogenicity and protective properties of two aluminum hydroxide (AH)-adsorbed S. schenckii cell wall protein (ssCWP)-based vaccine formulations in a mouse model of systemic S. schenckii infection. Fractioning by SDS-PAGE revealed nine protein bands, two of which were functionally characterized: a 44kDa peptide hydrolase and a 47kDa enolase, which was predicted to be an adhesin. Sera from immunized mice recognized the 47kDa enolase and another unidentified 71kDa protein, whereas serum from S. schenckii-infected mice recognized both these proteins plus another unidentified 9.4kDa protein. Furthermore, opsonization with the anti-ssCWP sera led to markedly increased phagocytosis and was able to strongly inhibit the fungus' adhesion to fibroblasts. Immunization with the higher-dose AH-adjuvanted formulation led to increased ex vivo release of IL-12, IFN-γ, IL-4, and IL-17, whereas only IL-12 and IFN-γ were induced by the higher-dose non-adjuvanted formulation. Lastly, passive transference of the higher-dose AH-adjuvanted formulation's anti-ssCWP serum was able to afford in vivo protection in a subsequent challenge with S. schenckii, becoming a viable vaccine candidate for further testing.

  20. Exploring Mathematical Knowledge in Elementary Teacher Candidates with the Use of Classroom-Based Artifacts

    Science.gov (United States)

    Gillentine, E. Paige

    2013-01-01

    Researchers have suggested that teachers use a specialized type of knowledge specifically attributed to the work of teaching. One aspect of this specific type of knowledge is the ability to analyze children's work. With continued emphasis on a teacher's ability to analyze their students' thought processes, teacher candidates will need to develop…

  1. Fully Pipelined Parallel Architecture for Candidate Block and Pixel-Subsampling-Based Motion Estimation

    Directory of Open Access Journals (Sweden)

    Reeba Korah

    2008-01-01

    Full Text Available This paper presents a low power and high speed architecture for motion estimation with Candidate Block and Pixel Subsampling (CBPS Algorithm. Coarse-to-fine search approach is employed to find the motion vector so that the local minima problem is totally eliminated. Pixel subsampling is performed in the selected candidate blocks which significantly reduces computational cost with low quality degradation. The architecture developed is a fully pipelined parallel design with 9 processing elements. Two different methods are deployed to reduce the power consumption, parallel and pipelined implementation and parallel accessing to memory. For processing 30 CIF frames per second our architecture requires a clock frequency of 4.5 MHz.

  2. Multiple candidates and multiple constraints based accurate depth estimation for multi-view stereo

    Science.gov (United States)

    Zhang, Chao; Zhou, Fugen; Xue, Bindang

    2017-02-01

    In this paper, we propose a depth estimation method for multi-view image sequence. To enhance the accuracy of dense matching and reduce the inaccurate matching which is produced by inaccurate feature description, we select multiple matching points to build candidate matching sets. Then we compute an optimal depth from a candidate matching set which satisfies multiple constraints (epipolar constraint, similarity constraint and depth consistency constraint). To further increase the accuracy of depth estimation, depth consistency constraint of neighbor pixels is used to filter the inaccurate matching. On this basis, in order to get more complete depth map, depth diffusion is performed by neighbor pixels' depth consistency constraint. Through experiments on the benchmark datasets for multiple view stereo, we demonstrate the superiority of proposed method over the state-of-the-art method in terms of accuracy.

  3. Characterization nanoparticles-based vaccines and vaccine candidates: a Transmission Electron Microscopy study

    Directory of Open Access Journals (Sweden)

    I. Menéndez I

    2016-05-01

    Full Text Available Transmission Electron Microscopy (TEM is a valuable tool for the biotech industry. This paper summarizes some of the contributions of MET in the characterization of the recombinant antigens are part of vaccines or vaccine candidates obtained in the CIGB. It mentions the use of complementary techniques MET (Negative staining, and immunoelectron that enhance visualization and ultrastructural characterization of the recombinant proteins obtained by Genetic Engineering.

  4. Identification of Novel Potential Vaccine Candidates against Tuberculosis Based on Reverse Vaccinology.

    Science.gov (United States)

    Monterrubio-López, Gloria P; González-Y-Merchand, Jorge A; Ribas-Aparicio, Rosa María

    2015-01-01

    Tuberculosis (TB) is a chronic infectious disease, considered as the second leading cause of death worldwide, caused by Mycobacterium tuberculosis. The limited efficacy of the bacillus Calmette-Guérin (BCG) vaccine against pulmonary TB and the emergence of multidrug-resistant TB warrants the need for more efficacious vaccines. Reverse vaccinology uses the entire proteome of a pathogen to select the best vaccine antigens by in silico approaches. M. tuberculosis H37Rv proteome was analyzed with NERVE (New Enhanced Reverse Vaccinology Environment) prediction software to identify potential vaccine targets; these 331 proteins were further analyzed with VaxiJen for the determination of their antigenicity value. Only candidates with values ≥0.5 of antigenicity and 50% of adhesin probability and without homology with human proteins or transmembrane regions were selected, resulting in 73 antigens. These proteins were grouped by families in seven groups and analyzed by amino acid sequence alignments, selecting 16 representative proteins. For each candidate, a search of the literature and protein analysis with different bioinformatics tools, as well as a simulation of the immune response, was conducted. Finally, we selected six novel vaccine candidates, EsxL, PE26, PPE65, PE_PGRS49, PBP1, and Erp, from M. tuberculosis that can be used to improve or design new TB vaccines.

  5. Identification of Novel Potential Vaccine Candidates against Tuberculosis Based on Reverse Vaccinology

    Directory of Open Access Journals (Sweden)

    Gloria P. Monterrubio-López

    2015-01-01

    Full Text Available Tuberculosis (TB is a chronic infectious disease, considered as the second leading cause of death worldwide, caused by Mycobacterium tuberculosis. The limited efficacy of the bacillus Calmette-Guérin (BCG vaccine against pulmonary TB and the emergence of multidrug-resistant TB warrants the need for more efficacious vaccines. Reverse vaccinology uses the entire proteome of a pathogen to select the best vaccine antigens by in silico approaches. M. tuberculosis H37Rv proteome was analyzed with NERVE (New Enhanced Reverse Vaccinology Environment prediction software to identify potential vaccine targets; these 331 proteins were further analyzed with VaxiJen for the determination of their antigenicity value. Only candidates with values ≥0.5 of antigenicity and 50% of adhesin probability and without homology with human proteins or transmembrane regions were selected, resulting in 73 antigens. These proteins were grouped by families in seven groups and analyzed by amino acid sequence alignments, selecting 16 representative proteins. For each candidate, a search of the literature and protein analysis with different bioinformatics tools, as well as a simulation of the immune response, was conducted. Finally, we selected six novel vaccine candidates, EsxL, PE26, PPE65, PE_PGRS49, PBP1, and Erp, from M. tuberculosis that can be used to improve or design new TB vaccines.

  6. Prime candidate earth targets for the post-launch radiometric calibration of space-based optical imaging instruments

    Science.gov (United States)

    Teillet, P.M.; Barsi, J.A.; Chander, G.; Thome, K.J.

    2007-01-01

    This paper provides a comprehensive list of prime candidate terrestrial targets for consideration as benchmark sites for the post-launch radiometric calibration of space-based instruments. The key characteristics of suitable sites are outlined primarily with respect to selection criteria, spatial uniformity, and temporal stability. The establishment and utilization of such benchmark sites is considered an important element of the radiometric traceability of satellite image data products for use in the accurate monitoring of environmental change.

  7. Double layer structure-based virtual screening reveals 3'-Hydroxy-A-Naphthoflavone as novel inhibitor candidate of human acetylcholinesterase

    Science.gov (United States)

    Ichsan, Mochammad; Pangastuti, Ardini; Habibi, Mohammad Wildan; Juliana, Kartika

    2016-03-01

    One of the most effective target for Alzheimer's disease's (AD) treatment is the inhibition of human acetylcholinesterase (hAChE) eventhough it has many side effects. So that, this study was aimed to discover a new candidate of hAChE's inhibitor that has more negative binding affinity than existing drugs. hAChE's 3D model used in this study has a good quality according to its number of residues in most favoured regions (92%), three bad contacts, >50 ERRAT's score (85,870) and successfully passed the VERIFY 3D threshold (>80%). Based on the first layer of SBVS againts more than 12.180.630 ligands, we discovered 11.806 hits and then we found 359 hits from the second layer of SBVS. Based on our previous steps, we found that 3'-Hydroxy-a-Naphthoflavone was the only one candidate, that directly interacted with Trp286 via hydrogen bond and hydrophobic interactions and also has the most negative binding affinity (-10,6 kcal/mol) and also has more negative than existing hAChE's inhibitors, such as tacrine, donepezil, etc. 3'-Hydroxy-a-Naphthoflavone is the best candidate of hAChE's inhibitor based on its binding affinity (-10,6 kcal/mol) that is more negative than existing hAChE's inhibitors, such as tacrine, donepezil, etc.

  8. Fast-Solving Quasi-Optimal LS-S$³$VM Based on an Extended Candidate Set.

    Science.gov (United States)

    Ma, Yuefeng; Liang, Xun; Kwok, James T; Li, Jianping; Zhou, Xiaoping; Zhang, Haiyan

    2017-02-14

    The semisupervised least squares support vector machine (LS-S³VM) is an important enhancement of least squares support vector machines in semisupervised learning. Given that most data collected from the real world are without labels, semisupervised approaches are more applicable than standard supervised approaches. Although a few training methods for LS-S³VM exist, the problem of deriving the optimal decision hyperplane efficiently and effectually has not been solved. In this paper, a fully weighted model of LS-S³VM is proposed, and a simple integer programming (IP) model is introduced through an equivalent transformation to solve the model. Based on the distances between the unlabeled data and the decision hyperplane, a new indicator is designed to represent the possibility that the label of an unlabeled datum should be reversed in each iteration during training. Using the indicator, we construct an extended candidate set consisting of the indices of unlabeled data with high possibilities, which integrates more information from unlabeled data. Our algorithm is degenerated into a special scenario of the previous algorithm when the extended candidate set is reduced into a set with only one element. Two strategies are utilized to determine the descent directions based on the extended candidate set. Furthermore, we developed a novel method for locating a good starting point based on the properties of the equivalent IP model. Combined with the extended candidate set and the carefully computed starting point, a fast algorithm to solve LS-S³VM quasi-optimally is proposed. The choice of quasi-optimal solutions results in low computational cost and avoidance of overfitting. Experiments show that our algorithm equipped with the two designed strategies is more effective than other algorithms in at least one of the following three aspects: 1) computational complexity; 2) generalization ability; and 3) flexibility. However, our algorithm and other algorithms have similar

  9. Establishing a Th17 based mouse model for preclinical assessment of the toxicity of candidate microbicides

    Institute of Scientific and Technical Information of China (English)

    LI Liang-zhu; YANG Yu; YUAN Song-hua; WAN Yan-min; QIU Chao; FENG Yan-ling; XU Jian-qing; ZHANG Xiao-yan

    2010-01-01

    one mouse (score: 8), which were significantly associated with both inflammatory cytokines IL-17A and IL-6 and anti-inflammatory cytokines IL-4 and IL-10. Interestingly, IL-17A showed significant positive association with inflammatory cytokine TNF-α (r=0.739; P <0.05), anti-inflammatory cytokines IL-10 (r=0.804; P <0.01) and IL-4 (r=0.668; P <0.05).Conclusions Our data demonstrate that a panel of cytokines (IL-17A, IL-6, IL-4 and IL-10) could be used as surrogate biomarkers to predict the histopathological damage. Th17 may play a central role in orchestrating inflammatory cytokine responses. This Th17 based mouse model is cost-effective and suitable to assess the toxicity of candidate microbicides in preclinical studies.

  10. A PSF-based approach to Kepler/K2 data. II. Exoplanet candidates in Praesepe (M 44)

    CERN Document Server

    Libralato, M; Bedin, L R; Borsato, L; Granata, V; Malavolta, L; Piotto, G; Ochner, P; Cunial, A; Nascimbeni, V

    2016-01-01

    In this work we keep pushing K2 data to a high photometric precision, close to that of the Kepler main mission, using a PSF-based, neighbour-subtraction technique, which also overcome the dilution effects in crowded environments. We analyse the open cluster M 44 (NGC 2632), observed during the K2 Campaign 5, and extract light curves of stars imaged on module 14, where most of the cluster lies. We present two candidate exoplanets hosted by cluster members and five by field stars. As a by-product of our investigation, we find 1680 eclipsing binaries and variable stars, 1071 of which are new discoveries. Among them, we report the presence of a heartbeat binary star. Together with this work, we release to the community a catalogue with the variable stars and the candidate exoplanets found, as well as all our raw and detrended light curves.

  11. Imputation-based analysis of association studies: candidate regions and quantitative traits.

    Directory of Open Access Journals (Sweden)

    Bertrand Servin

    2007-07-01

    Full Text Available We introduce a new framework for the analysis of association studies, designed to allow untyped variants to be more effectively and directly tested for association with a phenotype. The idea is to combine knowledge on patterns of correlation among SNPs (e.g., from the International HapMap project or resequencing data in a candidate region of interest with genotype data at tag SNPs collected on a phenotyped study sample, to estimate ("impute" unmeasured genotypes, and then assess association between the phenotype and these estimated genotypes. Compared with standard single-SNP tests, this approach results in increased power to detect association, even in cases in which the causal variant is typed, with the greatest gain occurring when multiple causal variants are present. It also provides more interpretable explanations for observed associations, including assessing, for each SNP, the strength of the evidence that it (rather than another correlated SNP is causal. Although we focus on association studies with quantitative phenotype and a relatively restricted region (e.g., a candidate gene, the framework is applicable and computationally practical for whole genome association studies. Methods described here are implemented in a software package, Bim-Bam, available from the Stephens Lab website http://stephenslab.uchicago.edu/software.html.

  12. Investigations into the Antibacterial Activity of the Silver-Based Antibiotic Drug Candidate SBC3

    Directory of Open Access Journals (Sweden)

    Matthias Tacke

    2012-11-01

    Full Text Available The synthesis of N-heterocyclic carbene (NHC silver(I acetate complexes with varying lipophilic benzyl-substituents at the 1 and 3 positions starting from 4,5-diphenylimidazole, opened a new class of antibiotic drug candidates. These NHC-silver(I acetate derivatives exhibit interesting structural motifs in the solid state and proved to be soluble and stable in biological media. The leading candidate, SBC3, which was known to exhibit good antibacterial activity in preliminary Kirby-Bauer tests, was tested quantitatively using minimum inhibitory concentrations. NHC-silver(I acetate complexes were found to have MIC values ranging from 20 to 3.13 μg/mL for a variety of Gram-positive, Gram-negative and mycobacteria tested. These values represent good antibiotic activities against potential pathogens when compared to clinically approved antibiotics. Most striking is the fact that SBC3 is active against methicillin-resistant Staphylococcus aureus with a MIC value of 12.5 μg/mL.

  13. Old and Unemployable? How Age‐Based Stereotypes Affect Willingness to Hire Job Candidates

    Science.gov (United States)

    Swift, Hannah J.; Drury, Lisbeth

    2016-01-01

    Across the world, people are required, or want, to work until an increasingly old age. But how might prospective employers view job applicants who have skills and qualities that they associate with older adults? This article draws on social role theory, age stereotypes and research on hiring biases, and reports three studies using age‐diverse North American participants. These studies reveal that: (1) positive older age stereotype characteristics are viewed less favorably as criteria for job hire, (2) even when the job role is low‐status, a younger stereotype profile tends to be preferred, and (3) an older stereotype profile is only considered hirable when the role is explicitly cast as subordinate to that of a candidate with a younger age profile. Implications for age‐positive selection procedures and ways to reduce the impact of implicit age biases are discussed. PMID:27635102

  14. Anti-Lyme Subunit Vaccines: Design and Development of Peptide-Based Vaccine Candidates.

    Science.gov (United States)

    Small, Christina M; Mwangi, Waithaka; Esteve-Gassent, Maria D

    2016-01-01

    Vaccinology today has been presented with several avenues to improve protection against infectious disease. The recent employment of the reverse vaccinology technique has changed the face of vaccine development against many pathogens, including Borrelia burgdorferi, the causative agent of Lyme disease. Using this technique, genomics and in silico analyses come together to identify potentially antigenic epitopes in a high-throughput fashion. The forward methodology of vaccine development was used previously to generate the only licensed human vaccine for Lyme disease, which is no longer on the market. Using reverse vaccinology to identify new antigens and isolate specific epitopes to protect against B. burgdorferi, subunit vaccines will be generated that lack reactogenic and nonspecific epitopes, yielding more effective vaccine candidates. Additionally, novel epitopes are being utilized and are presently in the commercialization pipeline both for B. burgdorferi and other spirochaetal pathogens. The versatility and methodology of the subunit protein vaccine are described as it pertains to Lyme disease from conception to performance evaluation.

  15. A recombinant, chimeric tetravalent dengue vaccine candidate based on a dengue virus serotype 2 backbone.

    Science.gov (United States)

    Osorio, Jorge E; Wallace, Derek; Stinchcomb, Dan T

    2016-01-01

    Dengue fever is caused by infection with one of four dengue virus (DENV) serotypes (DENV-1-4), necessitating tetravalent dengue vaccines that can induce protection against all four DENV. Takeda's live attenuated tetravalent dengue vaccine candidate (TDV) comprises an attenuated DENV-2 strain plus chimeric viruses containing the prM and E genes of DENV-1, -3 and -4 cloned into the attenuated DENV-2 'backbone'. In Phase 1 and 2 studies, TDV was well tolerated by children and adults aged 1.5-45 years, irrespective of prior dengue exposure; mild injection-site symptoms were the most common adverse events. TDV induced neutralizing antibody responses and seroconversion to all four DENV as well as cross-reactive T cell-mediated responses that may be necessary for broad protection against dengue fever.

  16. Improving low-level plasma protein mass spectrometry-based detection for candidate biomarker discovery and validation

    Energy Technology Data Exchange (ETDEWEB)

    Page, Jason S.; Kelly, Ryan T.; Camp, David G.; Smith, Richard D.

    2008-09-01

    Methods. To improve the detection of low abundance protein candidate biomarker discovery and validation, particularly in complex biological fluids such as blood plasma, increased sensitivity is desired using mass spectrometry (MS)-based instrumentation. A key current limitation on the sensitivity of electrospray ionization (ESI) MS is due to the fact that many sample molecules in solution are never ionized, and the vast majority of the ions that are created are lost during transmission from atmospheric pressure to the low pressure region of the mass analyzer. Two key technologies, multi-nanoelectrospray emitters and the electrodynamic ion funnel have recently been developed and refined at Pacific Northwest National Laboratory (PNNL) to greatly improve the ionization and transmission efficiency of ESI MS based analyses. Multi-emitter based ESI enables the flow from a single source (typically a liquid chromatography [LC] column) to be divided among an array of emitters (Figure 1). The flow rate delivered to each emitter is thus reduced, allowing the well-documented benefits of nanoelectrospray 1 for both sensitivity and quantitation to be realized for higher flow rate separations. To complement the increased ionization efficiency afforded by multi-ESI, tandem electrodynamic ion funnels have also been developed at PNNL, and shown to greatly improve ion transmission efficiency in the ion source interface.2, 3 These technologies have been integrated into a triple quadrupole mass spectrometer for multiple reaction monitoring (MRM) of probable biomarker candidates in blood plasma and show promise for the identification of new species even at low level concentrations.

  17. A meta-analysis based method for prioritizing candidate genes involved in a pre-specific function

    Directory of Open Access Journals (Sweden)

    Jingjing Zhai

    2016-12-01

    Full Text Available The identification of genes associated with a given biological function in plants remains a challenge, although network-based gene prioritization algorithms have been developed for Arabidopsis thaliana and many non-model plant species. Nevertheless, these network-based gene prioritization algorithms have encountered several problems; one in particular is that of unsatisfactory prediction accuracy due to limited network coverage, varying link quality, and/or uncertain network connectivity. Thus a model that integrates complementary biological data may be expected to increase the prediction accuracy of gene prioritization. Towards this goal, we developed a novel gene prioritization method named RafSee, to rank candidate genes using a random forest algorithm that integrates sequence, evolutionary, and epigenetic features of plants. Subsequently, we proposed an integrative approach named RAP (Rank Aggregation-based data fusion for gene Prioritization, in which an order statistics-based meta-analysis was used to aggregate the rank of the network-based gene prioritization method and RafSee, for accurately prioritizing candidate genes involved in a pre-specific biological function. Finally, we showcased the utility of RAP by prioritizing 380 flowering-time genes in Arabidopsis. The ‘leave-one-out’ cross-validation experiment showed that RafSee could work as a complement to a current state-of-art network-based gene prioritization system (AraNet v2. Moreover, RAP ranked 53.68% (204/380 flowering-time genes higher than AraNet v2, resulting in an 39.46% improvement in term of the first quartile rank. Further evaluations also showed that RAP was effective in prioritizing genes-related to different abiotic stresses. To enhance the usability of RAP for Arabidopsis and non-model plant species, an R package implementing the method is freely available at http://bioinfo.nwafu.edu.cn/software.

  18. Phylogeography, salinity adaptations and metabolic potential of the Candidate Division KB1 Bacteria based on a partial single cell genome.

    Directory of Open Access Journals (Sweden)

    Lisa M Nigro

    2016-08-01

    Full Text Available Deep-sea hypersaline anoxic basins (DHABs and other hypersaline environments contain abundant and diverse microbial life that has adapted to these extreme conditions. The bacterial Candidate Division KB1 represents one of several uncultured groups that has been consistently observed in hypersaline microbial diversity studies. Here we report the phylogeography of KB1, its phylogenetic relationships to Candidate Division OP1 Bacteria, and its potential metabolic and osmotic stress adaptations based on a partial single cell amplified genome (SAG of KB1 from Orca Basin, the largest hypersaline seafloor brine basin in the Gulf of Mexico. Our results are consistent with the hypothesis – previously developed based on 14C incorporation experiments with mixed-species enrichments from Mediterranean seafloor brines - that KB1 has adapted its proteins to elevated intracellular salinity, but at the same time KB1 apparently imports glycine betaine; this compatible solute is potentially not limited to osmoregulation but could also serve as a carbon and energy source.

  19. Recognition-Based Pedagogy: Teacher Candidates' Experience of Deficit

    Science.gov (United States)

    Parkison, Paul T.; DaoJensen, Thuy

    2014-01-01

    This study seeks to introduce what we call "recognition-based pedagogy" as a conceptual frame through which teachers and instructors can collaboratively develop educative experiences with students. Recognition-based pedagogy connects the theories of critical pedagogy, identity politics, and the politics of recognition with the educative…

  20. Thermally induced degradation pathways of three different antibody-based drug development candidates.

    Science.gov (United States)

    Fincke, Anja; Winter, Jonas; Bunte, Thomas; Olbrich, Carsten

    2014-10-01

    Protein-based medicinal products are prone to undergo a variety of chemical and physical degradation pathways. One of the most important exogenous stress condition to consider during manufacturing, transport and storage processes is temperature, because antibody-based therapeutics are only stable in a limited temperature range. In this study, three different formats of antibody-based molecules (IgG1, a bispecific scFv and a fab fragment) were exposed to thermal stress conditions occurring during transport and storage. For evaluation, an analytical platform was developed for the detection and characterization of relevant degradation pathways of different antibody-based therapeutics. The effect of thermal stress conditions on the stability of the three antibody-based formats was therefore investigated using visual inspection, different spectroscopic measurements, dynamic light scattering (DLS), differential scanning calorimetry (DSC), electrophoresis, asymmetric flow field-flow fractionation (AF4) and surface plasmon resonance technology (SPR). In summary, thermal stress led to heterogeneous chemical and physical degradation pathways of all three antibody-based formats used. In addition, identical exogenous stress conditions resulted in different kinds and levels of aggregates and fragmentation products. This knowledge is fundamental for a systematic and successful stabilization of protein-based therapeutics by the use of formulation additives.

  1. Evaluation of Candidate Measures for Home-Based Screening of Sleep Disordered Breathing in Taiwanese Bus Drivers

    Directory of Open Access Journals (Sweden)

    Hua Ting

    2014-05-01

    Full Text Available Background: Sleepiness-at-the-wheel has been identified as a major cause of highway accidents. The aim of our study is identifying the candidate measures for home-based screening of sleep disordered breathing in Taiwanese bus drivers, instead of polysomnography. Methods: Overnight polysomnography accompanied with simultaneous measurements of alternative screening devices (pulse oximetry, ApneaLink, and Actigraphy, heart rate variability, wake-up systolic blood pressure and questionnaires were completed by 151 eligible participants who were long-haul bus drivers with a duty period of more than 12 h a day and duty shifting. Results: 63.6% of professional bus drivers were diagnosed as having sleep disordered breathing and had a higher body mass index, neck circumference, systolic blood pressure, arousal index and desaturation index than those professional bus drivers without evidence of sleep disordered breathing. Simple home-based candidate measures: (1 Pulse oximetry, oxygen-desaturation indices by ≥3% and 4% (r = 0.87~0.92; (2 Pulse oximetry, pulse-rising indices by ≥7% and 8% from a baseline (r = 0.61~0.89; and (3 ApneaLink airflow detection, apnea-hypopnea indices (r = 0.70~0.70, based on recording-time or Actigraphy-corrected total sleep time were all significantly correlated with, and had high agreement with, corresponding polysomnographic apnea-hypopnea indices [(1 94.5%~96.6%, (2 93.8%~97.2%, (3 91.1%~91.3%, respectively]. Conversely, no validities of SDB screening were found in the multi-variables apnea prediction questionnaire, Epworth Sleepiness Scale, night-sleep heart rate variability, wake-up systolic blood pressure and anthropometric variables. Conclusions: The indices of pulse oximetry and apnea flow detection are eligible criteria for home-based screening of sleep disordered breathing, specifically for professional drivers.

  2. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Li-Puma, Antonella, E-mail: antonella.lipuma@cea.fr [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Richou, Marianne; Magaud, Philippe; Missirlian, Marc [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy); Ridolfini, Vincenzo Pericoli [EFDA-CSU Garching, PPPT department, D-85748 Garching bei München (Germany)

    2013-10-15

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities.

  3. Usability of a Web-Based School Experience System: Opinions of IT Teachers and Teacher Candidates

    Science.gov (United States)

    Genç, Zülfü

    2015-01-01

    With advances in information and communication technologies, the classical nature of educational institutions has changed. One innovative effort within teacher training is the Web-Based School Experience System (WBSES) developed by the researcher. In this study, the usability of an existing WBSES is evaluated from both teachers' (n = 13) and…

  4. Problem-Based Learning in the Educational Psychology Classroom: Bahraini Teacher Candidates' Experience

    Science.gov (United States)

    Razzak, Nina Abdul

    2012-01-01

    There was a concern from faculty at Bahrain Teachers' College that undergraduate Bahraini students lack the necessary competencies needed for success in educational contexts that are conducive to active, student-centered learning. It was decided that the students be introduced to a problem-based learning (PBL) strategy in one of their educational…

  5. Immunostimulation by Synthetic Lipopeptide-Based Vaccine Candidates: Structure-Activity Relationships

    OpenAIRE

    Zaman, Mehfuz; Toth, Istvan

    2013-01-01

    Peptide-based vaccines offer several advantages over conventional whole organism or protein approaches by offering improved purity and specificity in inducing immune response. However, peptides alone are generally non-immunogenic. Concerns remain about the toxicity of adjuvants which are critical for immunogenicity of synthetic peptides. The use of lipopeptides in peptide vaccines is currently under intensive investigation because potent immune responses can be generated without the use of ad...

  6. Discovery and characterization of antibody variants using mass spectrometry-based comparative analysis for biosimilar candidates of monoclonal antibody drugs.

    Science.gov (United States)

    Li, Wenhua; Yang, Bin; Zhou, Dongmei; Xu, Jun; Ke, Zhi; Suen, Wen-Chen

    2016-07-01

    Liquid chromatography mass spectrometry (LC-MS) is the most commonly used technique for the characterization of antibody variants. MAb-X and mAb-Y are two approved IgG1 subtype monoclonal antibody drugs recombinantly produced in Chinese hamster ovary (CHO) cells. We report here that two unexpected and rare antibody variants have been discovered during cell culture process development of biosimilars for these two approved drugs through intact mass analysis. We then used comprehensive mass spectrometry-based comparative analysis including reduced light, heavy chains, and domain-specific mass as well as peptide mapping analysis to fully characterize the observed antibody variants. The "middle-up" mass comparative analysis demonstrated that the antibody variant from mAb-X biosimilar candidate was caused by mass variation of antibody crystalline fragment (Fc), whereas a different variant with mass variation in antibody antigen-binding fragment (Fab) from mAb-Y biosimilar candidate was identified. Endoproteinase Lys-C digested peptide mapping and tandem mass spectrometry analysis further revealed that a leucine to glutamine change in N-terminal 402 site of heavy chain was responsible for the generation of mAb-X antibody variant. Lys-C and trypsin coupled non-reduced and reduced peptide mapping comparative analysis showed that the formation of the light-heavy interchain trisulfide bond resulted in the mAb-Y antibody variant. These two cases confirmed that mass spectrometry-based comparative analysis plays a critical role for the characterization of monoclonal antibody variants, and biosimilar developers should start with a comprehensive structural assessment and comparative analysis to decrease the risk of the process development for biosimilars.

  7. Investigation of candidate data structures and search algorithms to support a knowledge based fault diagnosis system

    Science.gov (United States)

    Bosworth, Edward L., Jr.

    1987-01-01

    The focus of this research is the investigation of data structures and associated search algorithms for automated fault diagnosis of complex systems such as the Hubble Space Telescope. Such data structures and algorithms will form the basis of a more sophisticated Knowledge Based Fault Diagnosis System. As a part of the research, several prototypes were written in VAXLISP and implemented on one of the VAX-11/780's at the Marshall Space Flight Center. This report describes and gives the rationale for both the data structures and algorithms selected. A brief discussion of a user interface is also included.

  8. Conservation analysis of dengue virust-cell epitope-based vaccine candidates using peptide block entropy

    DEFF Research Database (Denmark)

    Olsen, Lars Rønn; Zhang, Guang Lan; Keskin, Derin B.;

    2011-01-01

    Broad coverage of the pathogen population is particularly important when designing CD8+ T-cell epitope vaccines against viral pathogens. Traditional approaches are based on combinations of highly conserved T-cell epitopes. Peptide block entropy analysis is a novel approach for assembling sets...... residues. The block entropy analysis provides broad coverage of variant antigens. We applied the block entropy analysis method to the proteomes of the four serotypes of dengue virus (DENV) and found 1,551 blocks of 9-mer peptides, which cover 99% of available sequences with five or fewer unique peptides...

  9. Key enzymes and proteins of crop insects as candidate for RNAi based gene silencing.

    Science.gov (United States)

    Kola, Vijaya Sudhakara Rao; Renuka, P; Madhav, Maganti Sheshu; Mangrauthia, Satendra K

    2015-01-01

    RNA interference (RNAi) is a mechanism of homology dependent gene silencing present in plants and animals. It operates through 21-24 nucleotides small RNAs which are processed through a set of core enzymatic machinery that involves Dicer and Argonaute proteins. In recent past, the technology has been well appreciated toward the control of plant pathogens and insects through suppression of key genes/proteins of infecting organisms. The genes encoding key enzymes/proteins with the great potential for developing an effective insect control by RNAi approach are actylcholinesterase, cytochrome P450 enzymes, amino peptidase N, allatostatin, allatotropin, tryptophan oxygenase, arginine kinase, vacuolar ATPase, chitin synthase, glutathione-S-transferase, catalase, trehalose phosphate synthase, vitellogenin, hydroxy-3-methylglutaryl coenzyme A reductase, and hormone receptor genes. Through various studies, it is demonstrated that RNAi is a reliable molecular tool which offers great promises in meeting the challenges imposed by crop insects with careful selection of key enzymes/proteins. Utilization of RNAi tool to target some of these key proteins of crop insects through various approaches is described here. The major challenges of RNAi based insect control such as identifying potential targets, delivery methods of silencing trigger, off target effects, and complexity of insect biology are very well illustrated. Further, required efforts to address these challenges are also discussed.

  10. Immunostimulation by synthetic lipopeptide based vaccine candidates: structure-activity relationships.

    Directory of Open Access Journals (Sweden)

    Mehfuz eZaman

    2013-10-01

    Full Text Available Peptide based vaccines offer several advantages over conventional whole organism or protein approaches by offering improved purity and specificity in inducing immune response. However, peptides alone are generally non-immunogenic. Concerns remain about the toxicity of adjuvants which are critical for immunogenicity of synthetic peptides. The use of lipopeptides in peptide vaccines is currently under intensive investigation because potent immune responses can be generated without the use of adjuvant (thus are self-adjuvanting. Several lipopeptides derived from microbial origin, and their synthetic versions or simpler fatty acid moieties impart this self-adjuvanting activity by signalling via Toll-like receptor 2 (TLR2. Engagement of this innate immune receptor on antigen-presenting cell leads to the initiation and development of potent immune responses. Therefore optimization of lipopeptides to enhance TLR2-mediated activation is a promising strategy for vaccine development. Considerable structure-activity relationships that determine TLR2 binding and consequent stimulation of innate immune responses have been investigated for a range of lipopeptides. In this review we address the development of lipopeptide vaccines, mechanism of TLR2 recognition, and immune activation. An overview is provided of the best studied lipopeptide vaccine systems.

  11. Losing on all fronts: the effects of negative versus positive person-based campaigns on implicit and explicit evaluations of political candidates.

    Science.gov (United States)

    Carraro, Luciana; Gawronski, Bertram; Castelli, Luigi

    2010-09-01

    The current research investigated the effects of negative as compared to positive person-based political campaigns on explicit and implicit evaluations of the involved candidates. Participants were presented with two political candidates and statements that one of them ostensibly said during the last political campaign. For half of the participants, the campaign included positive remarks about the source of the statement (positive campaign); for the remaining half, the campaign included negative remarks about the opponent (negative campaign). Afterwards, participants completed measures of explicit and implicit evaluations of both candidates. Results indicate that explicit evaluations of the source, but not the opponent, were less favourable after negative as compared to positive campaigns. In contrast, implicit evaluations were less favourable for both candidates after negative campaigns. The results are discussed in terms of associative and propositional processes, highlighting the importance of associative processes in political decision making.

  12. A malaria diagnostic tool based on computer vision screening and visualization of Plasmodium falciparum candidate areas in digitized blood smears.

    Directory of Open Access Journals (Sweden)

    Nina Linder

    Full Text Available INTRODUCTION: Microscopy is the gold standard for diagnosis of malaria, however, manual evaluation of blood films is highly dependent on skilled personnel in a time-consuming, error-prone and repetitive process. In this study we propose a method using computer vision detection and visualization of only the diagnostically most relevant sample regions in digitized blood smears. METHODS: Giemsa-stained thin blood films with P. falciparum ring-stage trophozoites (n = 27 and uninfected controls (n = 20 were digitally scanned with an oil immersion objective (0.1 µm/pixel to capture approximately 50,000 erythrocytes per sample. Parasite candidate regions were identified based on color and object size, followed by extraction of image features (local binary patterns, local contrast and Scale-invariant feature transform descriptors used as input to a support vector machine classifier. The classifier was trained on digital slides from ten patients and validated on six samples. RESULTS: The diagnostic accuracy was tested on 31 samples (19 infected and 12 controls. From each digitized area of a blood smear, a panel with the 128 most probable parasite candidate regions was generated. Two expert microscopists were asked to visually inspect the panel on a tablet computer and to judge whether the patient was infected with P. falciparum. The method achieved a diagnostic sensitivity and specificity of 95% and 100% as well as 90% and 100% for the two readers respectively using the diagnostic tool. Parasitemia was separately calculated by the automated system and the correlation coefficient between manual and automated parasitemia counts was 0.97. CONCLUSION: We developed a decision support system for detecting malaria parasites using a computer vision algorithm combined with visualization of sample areas with the highest probability of malaria infection. The system provides a novel method for blood smear screening with a significantly reduced need for

  13. Recombinant vesicular stomatitis virus-based dengue-2 vaccine candidate induces humoral response and protects mice against lethal infection.

    Science.gov (United States)

    Lauretti, Flavio; Chattopadhyay, Anasuya; de Oliveira França, Rafael Freitas; Castro-Jorge, Luiza; Rose, John; Fonseca, Benedito A L da

    2016-09-01

    Dengue is the most important arbovirus disease throughout the world and it is responsible for more than 500,000 dengue hemorrhagic cases and 22,000 deaths every year. One vaccine was recently licensed for human use in Brazil, Mexico and Philippines and although at least seven candidates have been in clinical trials the results of the most developed CYD vaccine have demonstrated immunization problems, such as uneven protection and interference between serotypes. We constructed a vaccine candidate based on vesicular stomatitis virus (VSV) expression of pre-membrane (prM) and envelope (E) proteins of dengue-2 virus (DENV-2) and tested it in mice to evaluate immunogenicity and protection against DENV-2 infection. VSV has been successfully used as vaccine vectors for several viruses to induce strong humoral and cellular immune responses. The VSV-DENV-2 recombinant was constructed by inserting the DENV-2 structural proteins into a VSV plasmid DNA for recombinant VSV-DENV-2 recovery. Infectious recombinant VSV viruses were plaque purified and prM and E expression were confirmed by immunofluorescence and radiolabeling of proteins of infected cells. Forty Balb/C mice were inoculated through subcutaneous (s.c.) route with VSV-DENV-2 vaccine in a two doses schedule 15 d apart and 29 d after first inoculation, sera were collected and the mice were challenged with 50 lethal doses (LD50) of a neurovirulent DENV-2. The VSV-DENV-2 induced anti-DENV-2 antibodies and protected animals in the challenge experiment comparable to DENV-2 immunization control group. We conclude that VSV is a promising platform to test as a DENV vaccine and perhaps against others Flaviviridae.

  14. Selecting candidate service based on functional reusability%基于功能重用性的候选服务选定方法

    Institute of Scientific and Technical Information of China (English)

    昌广才; 蒋溢; 熊安萍

    2012-01-01

    SOA-based service modeling is widely used in the enterprise applications. During SOMA service is modeling, according to the identification inaccuracy of function reusability between use case when selecting reusable candidate services, based on the expansion and containment relationship, the selection process of reusable candidate services are provided, which join generalization relationship between the use case, and the selection of reusability candidate services is improved. Practice shows that the improved candidate services selection methods not only simplify reusable candidate selection process, but also improve the selection accuracy of reusability candidate services.%基于SOA的服务建模在企业中得到了广泛运用,针对SOMA服务建模过程中基于用例间包含与扩展关系对可重用候选服务进行选定时存在功能重用性用例确定不准确的问题,给出了加入用例泛化关系的可重用候选服务选定方法,完善了可重用性候选服务的选定.实践表明,改进后的候选服务选定方法不仅使简化了可重用性候选服务选定过程,还提高了可重用性候选服务选定的准确率.

  15. Identification of putative candidate genes for red rot resistance in sugarcane (Saccharum species hybrid) using LD-based association mapping.

    Science.gov (United States)

    Singh, Ram K; Banerjee, Nandita; Khan, M S; Yadav, Sonia; Kumar, Sanjeev; Duttamajumder, S K; Lal, Ram Ji; Patel, Jinesh D; Guo, H; Zhang, Dong; Paterson, Andrew H

    2016-06-01

    Red rot is a serious disease of sugarcane caused by the fungus Colletotrichum falcatum that has a colossal damage potential. The fungus, prevalent mainly in the Indian sub-continent, keeps on producing new pathogenic strains leading to breakdown of resistance in newly released varieties and hence the deployment of linked markers for marker-assisted selection for resistance to this disease can fine tune the breeding programme. This study based on a panel of 119 sugarcane genotypes fingerprinted for 944 SSR alleles was undertaken with an aim to identify marker-trait associations (MTAs) for resistance to red rot. Mixed linear model containing population structure and kinship as co-factor detected four MTAs that were able to explain 10-16 % of the trait variation, individually. Among the four MTAs, EST sequences diagnostic of three could be BLAST searched to the sorghum genome with significant sequence homology. Several genes encoding important plant defence related proteins, viz., cytochrome P450, Glycerol-3-phosphate transporter-1, MAP Kinase-4, Serine/threonine-protein kinase, Ring finger domain protein and others were localized to the vicinity of these MTAs. These positional candidate genes are worth of further investigation and possibly these could contribute directly to red rot resistance, and may find a potential application in marker-assisted sugarcane breeding.

  16. New π-Conjugated Materials Based on Furylenevinylene Candidate for Organic Solar Cells Application: A DFT Study

    Directory of Open Access Journals (Sweden)

    El Alamy Aziz

    2015-12-01

    Full Text Available The specific properties of organic-conjugated molecules and polymers are of great importance since they have become the most promising materials for the optoelectronic device technology such as solar cells. The use of low band gap materials is a viable method for better harvesting of the solar spectrum and increasing its efficiency. The control of the parameters of these materials is a research issue of ongoing interest. In this work, a quantum chemical investigation was performed to explore the optical and electronic properties of a series of different compounds based on furylenevinylene. Different electron side groups were introduced to investigate their effects on the electronic structure. The theoretical knowledge of the highest occupied molecular orbital (HOMO and lowest unoccupied molecular orbital (LUMO energy levels of the components is basic in studying organic solar cells; so the HOMO, LUMO, Gap energy and open circuit voltage (Voc of the studied compounds have been calculated and reported. These properties suggest that these materials behave as good candidate for organic solar cells. DOI: http://dx.doi.org/10.17807/orbital.v7i4.763 

  17. Glutathione transferase (GST) as a candidate molecular-based biomarker for soil toxin exposure in the earthworm Lumbricus rubellus

    Energy Technology Data Exchange (ETDEWEB)

    LaCourse, E. James, E-mail: james.la-course@liverpool.ac.u [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom); Hernandez-Viadel, Mariluz; Jefferies, James R. [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom); Svendsen, Claus; Spurgeon, David J. [Centre for Ecology and Hydrology, Huntingdon PE28 2LS (United Kingdom); Barrett, John [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom); John Morgan, A.; Kille, Peter [Biosciences, University of Cardiff, Cardiff CF10 3TL (United Kingdom); Brophy, Peter M. [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom)

    2009-08-15

    The earthworm Lumbricus rubellus (Hoffmeister, 1843) is a terrestrial pollution sentinel. Enzyme activity and transcription of phase II detoxification superfamily glutathione transferases (GST) is known to respond in earthworms after soil toxin exposure, suggesting GST as a candidate molecular-based pollution biomarker. This study combined sub-proteomics, bioinformatics and biochemical assay to characterise the L. rubellus GST complement as pre-requisite to initialise assessment of the applicability of GST as a biomarker. L. rubellus possesses a range of GSTs related to known classes, with evidence of tissue-specific synthesis. Two affinity-purified GSTs dominating GST protein synthesis (Sigma and Pi class) were cloned, expressed and characterised for enzyme activity with various substrates. Electrospray ionisation mass spectrometry (ESI-MS) and tandem mass spectrometry (MS/MS) following SDS-PAGE were superior in retaining subunit stability relative to two-dimensional gel electrophoresis (2-DE). This study provides greater understanding of Phase II detoxification GST superfamily status of an important environmental pollution sentinel organism. - This study currently provides the most comprehensive view of the Phase II detoxification enzyme superfamily of glutathione transferases within the important environmental pollution sentinel earthworm Lumbricus rubellus.

  18. The (w)hole survey: an unbiased sample study of transition disk candidates based on Spitzer catalogs

    CERN Document Server

    van der Marel, Nienke; van Terwisga, Sierk; Merin, Bruno; Herczeg, Gregory; Ligterink, Niels F W; van Dishoeck, Ewine F

    2016-01-01

    Understanding disk evolution and dissipation is essential for studies of planet formation. Transition disks, i.e., disks with large dust cavities and gaps, are promising candidates of active evolution. About two dozen SED-selected candidates have been confirmed to have dust cavities through millimeter interferometric imaging, but this sample is biased towards the brightest disks. The Spitzer surveys of nearby low-mass star forming regions have resulted in more than 4000 Young Stellar Objects (YSOs). Using color criteria we have selected a sample of ~150 candidates, and an additional 40 candidates and known transition disks from the literature. The Spitzer data were complemented by new observations at longer wavelengths, including new JCMT and APEX submillimeter photometry, and WISE and Herschel-PACS mid and far-infrared photometry. Furthermore, optical spectroscopy was obtained and stellar types were derived for 85% of the sample, including information from the literature. The SEDs were fit to a grid of RADMC...

  19. Conservation analysis of dengue virus T-cell epitope-based vaccine candidates using peptide block entropy

    Directory of Open Access Journals (Sweden)

    Lars Ronn Olsen

    2011-12-01

    Full Text Available Broad coverage of the pathogen population is particularly important when designing CD8+ T-cell epitope vaccines against viral pathogens. Traditional approaches to assembling broadly covering sets of peptides are commonly based on assembling highly conserved epitopes. Peptide block entropy analysis is a novel approach to assembling sets of broadly covering antigens. Since T-cell epitopes are recognized as peptides rather than individual residues, this method is based on calculating the information content of blocks of peptides from a multiple sequence alignment of homologous proteins rather than individual residues. The block entropy analysis provides broad coverage by variant inclusion, since high frequency may not be the sole determinant of the immunogenic potential of a predicted MHC class I binder. We applied block entropy analysis method to the proteomes of the four serotypes of dengue virus and found 1,551 blocks of 9-mer peptides, which covered all available sequences with five or fewer unique peptides. In contrast, the benchmark study by Khan et al. (2008, resulted in 165 9-mers being determined as conserved. Many of the blocks are located consecutively in the proteins, so connecting these blocks resulted in 78 conserved regions which can be covered with 457 subunit peptides. Of the 1551 blocks of 9-mer peptides, 110 blocks consisted of peptides all predicted to bind to MHC with similar affinity and the same HLA restriction. In total, we identified a pool of 333 peptides as T-cell epitope candidates. This set could form the basis for a broadly neutralizing dengue virus vaccine. The peptide block entropy analysis approach significantly increases the number of conserved peptide regions in comparison to traditional conservation analysis of individual residues. We determined 457 subunit peptides with the capacity to encompass the diversity of all sequenced DENV strains.

  20. Candidates for Intracluster Planetary Nebulae in the Virgo Cluster based on the Suprime-Cam Narrow-Band Imaging in O[III] and Halpha

    CERN Document Server

    Okamura, S; Arnaboldi, M; Freeman, K C; Ando, H; Doi, M; Furusawa, H; Gerhard, O E; Hamabe, M; Kimura, M; Kajino, T; Komiyama, Yu; Miyazaki, S; Nakata, F; Napolitano, N R; Ouchi, M; Pannella, M; Sekiguchi, M; Shimasaku, K; Yagi, M

    2002-01-01

    We have identified 38 candidates of intracluster planetary nebulae (ICPNe) in a $34'\\times27'$ field in the core of the Virgo cluster based on the Suprime-Cam imaging through two narrow-band filters centered at the redshifted wavelengths of the [OIII]$\\lambda=5007\\AA$ and the Halpha \\lambda=6563\\AA lines. Broad-band images in V and R bands are used to check for any emissions in the adjacent continuum. We describe the method briefly and present the list of intracluster planetary nebulae candidates, together with their finding charts. The ICPN candidates show a highly inhomogeneous distribution, which may suggest an association with the M86-M84 subcluster. Fraction of diffuse intracluster light with respect to total light in galaxies is estimated to be about 10%, leading to an estimate of about 20% for the baryon fraction. Spectroscopic follow up and a wider survey are critical to reveal the nature of intracluster stellar population.

  1. Codominant PCR-based markers and candidate genes for powdery mildew resistance in melon (Cucumis melo L.).

    Science.gov (United States)

    Yuste-Lisbona, Fernando J; Capel, Carmen; Gómez-Guillamón, María L; Capel, Juan; López-Sesé, Ana I; Lozano, Rafael

    2011-03-01

    Powdery mildew caused by Podosphaera xanthii is a major disease in melon crops, and races 1, 2, and 5 of this fungus are those that occur most frequently in southern Europe. The genotype TGR-1551 bears a dominant gene that provides resistance to these three races of P. xanthii. By combining bulked segregant analysis and amplified fragment length polymorphisms (AFLP), we identified eight markers linked to this dominant gene. Cloning and sequencing of the selected AFLP fragments allowed the development of six codominant PCR-based markers which mapped on the linkage group (LG) V. Sequence analysis of these markers led to the identification of two resistance-like genes, MRGH5 and MRGH63, belonging to the nucleotide binding site (NBS)-leucine-rich repeat (LRR) gene family. Quantitative trait loci (QTL) analysis detected two QTLs, Pm-R1-2 and Pm-R5, the former significantly associated with the resistance to races 1 and 2 (LOD score of 26.5 and 33.3; 53.6 and 61.9% of phenotypic variation, respectively), and the latter with resistance to race 5 (LOD score of 36.8; 65.5% of phenotypic variation), which have been found to be colocalized with the MRGH5 and MRGH63 genes, respectively. The results suggest that the cluster of NBS-LRR genes identified in LG V harbours candidate genes for resistance to races 1, 2, and 5 of P. xanthii. The evaluation of other resistant germplasm showed that the codominant markers here reported are also linked to the Pm-w resistance gene carried by the accession 'WMR-29' proving their usefulness as genotyping tools in melon breeding programmes.

  2. Identification of HSPA8 as a candidate biomarker for endometrial carcinoma by using iTRAQ-based proteomic analysis

    Directory of Open Access Journals (Sweden)

    Shan N

    2016-04-01

    Full Text Available Nianchun Shan,1 Wei Zhou,2 Shufen Zhang,1 Yu Zhang1 1Department of Obstetric and Gynecology, 2Health Management Center, Xiangya Hospital, Central South University, Changsha, Hunan, People’s Republic of China Abstract: Although there are advances in diagnostic, predictive, and therapeutic strategies, discovering protein biomarker for early detection is required for improving the survival rate of the patients with endometrial carcinoma. In this study, we identify proteins that are differentially expressed between the Stage I endometrial carcinoma and the normal pericarcinous tissues by using isobaric tags for relative and absolute quantitation (iTRAQ-based proteomic analysis. Totally, we screened 1,266 proteins. Among them, 103 proteins were significantly overexpressed, and 30 were significantly downexpressed in endometrial carcinoma. Using the bioinformatics analysis, we identified a list of proteins that might be closely associated with endometrial carcinoma, including CCT7, HSPA8, PCBP2, LONP1, PFN1, and EEF2. We validated the gene overexpression of these molecules in the endometrial carcinoma tissues and found that HSPA8 was most significantly upregulated. We further validated the overexpression of HSPA8 by using immunoblot analysis. Then, HSPA8 siRNA was transferred into the endometrial cancer cells RL-95-2 and HEC-1B. The depletion of HSPA8 siRNAs significantly reduced cell proliferation, promoted cell apoptosis, and suppressed cell growth in both cell lines. Taken together, HSPA8 plays a vital role in the development of endometrial carcinoma. HSPA8 is a candidate biomarker for early diagnosis and therapy of Stage I endometrial carcinoma. Keywords: iTRAQ, HSPA8, endometrial carcinoma, RL-95-2 cells

  3. Candidates of eclipsing multiples based on extraneous eclipses on binary light curves: KIC 7622486, KIC 7668648, KIC 7670485 and KIC 8938628

    CERN Document Server

    Zhang, Jia; He, Jian-Duo

    2016-01-01

    Four candidates of eclipsing multiples, based on new extraneous eclipses found on Kepler binary light curves, are presented and studied. KIC 7622486 is a double eclipsing binary candidate with orbital period of 2.2799960 days and 40.246503 days. The two binary systems do not eclipse each other in the line of sight, but there is mutual gravitational influence between them which leads to the small but definite eccentricity 0.0035(0.0022) on the short 2.2799960 days period orbit. KIC 7668648 is hierarchical quadruple system candidate, with two sets of solid 203(+-5) days period extraneous eclipses and another independent set of extraneous eclipses. A clear and credible extraneous eclipse is found on the binary light curve of KIC 7670485 which made it a triple system candidates. Two sets of extraneous eclipse of about 390 days and 220 days period are found on KIC 8938628 binary curves, which not only confirms the previous conclusion of $388.5(+-0.3) triple system, but also proposed a new additional objects that m...

  4. Quantitative iTRAQ-Based Proteomic Identification of Candidate Biomarkers for Diabetic Nephropathy in Plasma of Type 1 Diabetic Patients

    DEFF Research Database (Denmark)

    Overgaard, Anne Julie; Thingholm, Tine Engberg; Larsen, Martin R

    2010-01-01

    INTRODUCTION: As part of a clinical proteomics programme focused on diabetes and its complications, it was our goal to investigate the proteome of plasma in order to find improved candidate biomarkers to predict diabetic nephropathy. METHODS: Proteins derived from plasma from a cross...... immunoassay confirmed the overall protein expression patterns observed by the iTRAQ analysis. CONCLUSION: The candidate biomarkers discovered in this cross-sectional cohort may turn out to be progression biomarkers and might have several clinical applications in the treatment and monitoring of diabetic......-sectional cohort of 123 type 1 diabetic patients previously diagnosed as normoalbuminuric, microalbuminuric or macroalbuminuric were enriched with hexapeptide library beads and subsequently pooled within three groups. Proteins from the three groups were compared by online liquid chromatography and tandem mass...

  5. Network-based data integration for selecting candidate virulence associated proteins in the cereal infecting fungus Fusarium graminearum.

    Directory of Open Access Journals (Sweden)

    Artem Lysenko

    Full Text Available The identification of virulence genes in plant pathogenic fungi is important for understanding the infection process, host range and for developing control strategies. The analysis of already verified virulence genes in phytopathogenic fungi in the context of integrated functional networks can give clues about the underlying mechanisms and pathways directly or indirectly linked to fungal pathogenicity and can suggest new candidates for further experimental investigation, using a 'guilt by association' approach. Here we study 133 genes in the globally important Ascomycete fungus Fusarium graminearum that have been experimentally tested for their involvement in virulence. An integrated network that combines information from gene co-expression, predicted protein-protein interactions and sequence similarity was employed and, using 100 genes known to be required for virulence, we found a total of 215 new proteins potentially associated with virulence of which 29 are annotated as hypothetical proteins. The majority of these potential virulence genes are located in chromosomal regions known to have a low recombination frequency. We have also explored the taxonomic diversity of these candidates and found 25 sequences, which are likely to be fungal specific. We discuss the biological relevance of a few of the potentially novel virulence associated genes in detail. The analysis of already verified virulence genes in phytopathogenic fungi in the context of integrated functional networks can give clues about the underlying mechanisms and pathways directly or indirectly linked to fungal pathogenicity and can suggest new candidates for further experimental investigation, using a 'guilt by association' approach.

  6. Allele diversity for abiotic stress responsive candidate genes in chickpea reference set using gene based SNP markers

    Directory of Open Access Journals (Sweden)

    Manish eRoorkiwal

    2014-06-01

    Full Text Available Chickpea is an important food legume crop for the semi-arid regions, however, its productivity is adversely affected by various biotic and abiotic stresses. Identification of candidate genes associated with abiotic stress response will help breeding efforts aiming to enhance its productivity. With this objective, 10 abiotic stress responsive candidate genes were selected on the basis of prior knowledge of this complex trait. These 10 genes were subjected to allele specific sequencing across a chickpea reference set comprising 300 genotypes including 211 accessions of chickpea mini core collection. A total of 1.3 Mbp sequence data were generated. Multiple sequence alignment revealed 79 SNPs and 41 indels in nine genes while the CAP2 gene was found to be conserved across all the genotypes. Among ten candidate genes, the maximum number of SNPs (34 was observed in abscisic acid stress and ripening (ASR gene including 22 transitions, 11 transversions and one tri-allelic SNP. Nucleotide diversity varied from 0.0004 to 0.0029 while PIC values ranged from 0.01 (AKIN gene to 0.43 (CAP2 promoter. Haplotype analysis revealed that alleles were represented by more than two haplotype blocks, except alleles of the CAP2 and sucrose synthase (SuSy gene, where only one haplotype was identified. These genes can be used for association analysis and if validated, may be useful for enhancing abiotic stress, including drought tolerance, through molecular breeding.

  7. Novel Plasmodium falciparum malaria vaccines: evidence-based searching for variant surface antigens as candidates for vaccination against pregnancy-associated malaria

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Jensen, Anja T R; Theander, Thor G;

    2002-01-01

    to statistically significant co-variation with protection rather than on demonstration of causal relationships. We have studied the relationship between variant surface antigen-specific antibodies and clinical protection from Plasmodium falciparum malaria in general, and from pregnancy-associated malaria (PAM......) in particular, to provide robust evidence of a causal link between the two in order to allow efficient and evidence-based identification of candidate antigens for malaria vaccine development....

  8. Novel benzamide-based histamine h3 receptor antagonists: the identification of two candidates for clinical development.

    Science.gov (United States)

    Letavic, Michael A; Aluisio, Leah; Apodaca, Richard; Bajpai, Manoj; Barbier, Ann J; Bonneville, Anne; Bonaventure, Pascal; Carruthers, Nicholas I; Dugovic, Christine; Fraser, Ian C; Kramer, Michelle L; Lord, Brian; Lovenberg, Timothy W; Li, Lilian Y; Ly, Kiev S; Mcallister, Heather; Mani, Neelakandha S; Morton, Kirsten L; Ndifor, Anthony; Nepomuceno, S Diane; Pandit, Chennagiri R; Sands, Steven B; Shah, Chandra R; Shelton, Jonathan E; Snook, Sandra S; Swanson, Devin M; Xiao, Wei

    2015-04-09

    The preclinical characterization of novel phenyl(piperazin-1-yl)methanones that are histamine H3 receptor antagonists is described. The compounds described are high affinity histamine H3 antagonists. Optimization of the physical properties of these histamine H3 antagonists led to the discovery of several promising lead compounds, and extensive preclinical profiling aided in the identification of compounds with optimal duration of action for wake promoting activity. This led to the discovery of two development candidates for Phase I and Phase II clinical trials.

  9. Planetary Candidates Observed by Kepler. VII. The First Fully Uniform Catalog Based on The Entire 48 Month Dataset (Q1-Q17 DR24)

    CERN Document Server

    Coughlin, Jeffrey L; Thompson, Susan E; Rowe, Jason F; Burke, Christopher J; Latham, David W; Batalha, Natalie M; Ofir, Aviv; Quarles, Billy L; Henze, Christopher E; Wolfgang, Angie; Caldwell, Douglas A; Bryson, Stephen T; Shporer, Avi; Catanzarite, Joseph; Akeson, Rachel; Barclay, Thomas; Borucki, William J; Boyajian, Tabetha S; Campbell, Jennifer R; Christiansen, Jessie L; Girouard, Forrest R; Haas, Michael R; Howell, Steve B; Huber, Daniel; Jenkins, Jon M; Li, Jie; Patil-Sabale, Anima; Quintana, Elisa V; Ramirez, Solange; Seader, Shawn; Smith, Jeffrey C; Tenenbaum, Peter; Twicken, Joseph D; Zamudio, Khadeejah A

    2015-01-01

    We present the seventh Kepler planet candidate catalog, which is the first to be based on the entire, uniformly processed, 48 month Kepler dataset. This is the first fully automated catalog, employing robotic vetting procedures to uniformly evaluate every periodic signal detected by the Q1-Q17 Data Release 24 (DR24) Kepler pipeline. While we prioritize uniform vetting over the absolute correctness of individual objects, we find that our robotic vetting is overall comparable to, and in most cases is superior to, the human vetting procedures employed by past catalogs. This catalog is the first to utilize artificial transit injection to evaluate the performance of our vetting procedures and quantify potential biases, which are essential for accurate computation of planetary occurrence rates. With respect to the cumulative Kepler Object of Interest (KOI) catalog, we designate 1,478 new KOIs, of which 402 are dispositioned as planet candidates (PCs). Also, 237 KOIs dispositioned as false positives (FPs) in previou...

  10. VennPainter: A Tool for the Comparison and Identification of Candidate Genes Based on Venn Diagrams.

    Directory of Open Access Journals (Sweden)

    Guoliang Lin

    Full Text Available VennPainter is a program for depicting unique and shared sets of genes lists and generating Venn diagrams, by using the Qt C++ framework. The software produces Classic Venn, Edwards' Venn and Nested Venn diagrams and allows for eight sets in a graph mode and 31 sets in data processing mode only. In comparison, previous programs produce Classic Venn and Edwards' Venn diagrams and allow for a maximum of six sets. The software incorporates user-friendly features and works in Windows, Linux and Mac OS. Its graphical interface does not require a user to have programing skills. Users can modify diagram content for up to eight datasets because of the Scalable Vector Graphics output. VennPainter can provide output results in vertical, horizontal and matrix formats, which facilitates sharing datasets as required for further identification of candidate genes. Users can obtain gene lists from shared sets by clicking the numbers on the diagram. Thus, VennPainter is an easy-to-use, highly efficient, cross-platform and powerful program that provides a more comprehensive tool for identifying candidate genes and visualizing the relationships among genes or gene families in comparative analysis.

  11. Generation and Characterization of Live Attenuated Influenza A(H7N9 Candidate Vaccine Virus Based on Russian Donor of Attenuation.

    Directory of Open Access Journals (Sweden)

    Svetlana Shcherbik

    Full Text Available Avian influenza A (H7N9 virus has emerged recently and continues to cause severe disease with a high mortality rate in humans prompting the development of candidate vaccine viruses. Live attenuated influenza vaccines (LAIV are 6:2 reassortant viruses containing the HA and NA gene segments from wild type influenza viruses to induce protective immune responses and the six internal genes from Master Donor Viruses (MDV to provide temperature sensitive, cold-adapted and attenuated phenotypes.LAIV candidate A/Anhui/1/2013(H7N9-CDC-LV7A (abbreviated as CDC-LV7A, based on the Russian MDV, A/Leningrad/134/17/57 (H2N2, was generated by classical reassortment in eggs and retained MDV temperature-sensitive and cold-adapted phenotypes. CDC-LV7A had two amino acid substitutions N123D and N149D (H7 numbering in HA and one substitution T10I in NA. To evaluate the role of these mutations on the replication capacity of the reassortants in eggs, the recombinant viruses A(H7N9RG-LV1 and A(H7N9RG-LV2 were generated by reverse genetics. These changes did not alter virus antigenicity as ferret antiserum to CDC-LV7A vaccine candidate inhibited hemagglutination by homologous A(H7N9 virus efficiently. Safety studies in ferrets confirmed that CDC-LV7A was attenuated compared to wild-type A/Anhui/1/2013. In addition, the genetic stability of this vaccine candidate was examined in eggs and ferrets by monitoring sequence changes acquired during virus replication in the two host models. No changes in the viral genome were detected after five passages in eggs. However, after ten passages additional mutations were detected in the HA gene. The vaccine candidate was shown to be stable in the ferret model; post-vaccination sequence data analysis showed no changes in viruses collected in nasal washes present at day 5 or day 7.Our data indicate that the A/Anhui/1/2013(H7N9-CDC-LV7A reassortant virus is a safe and genetically stable candidate vaccine virus that is now available for

  12. Generation and Characterization of Live Attenuated Influenza A(H7N9) Candidate Vaccine Virus Based on Russian Donor of Attenuation

    Science.gov (United States)

    Shcherbik, Svetlana; Pearce, Nicholas; Balish, Amanda; Jones, Joyce; Thor, Sharmi; Davis, Charles Todd; Pearce, Melissa; Tumpey, Terrence; Cureton, David; Chen, Li-Mei; Villanueva, Julie; Bousse, Tatiana L.

    2015-01-01

    Background Avian influenza A (H7N9) virus has emerged recently and continues to cause severe disease with a high mortality rate in humans prompting the development of candidate vaccine viruses. Live attenuated influenza vaccines (LAIV) are 6:2 reassortant viruses containing the HA and NA gene segments from wild type influenza viruses to induce protective immune responses and the six internal genes from Master Donor Viruses (MDV) to provide temperature sensitive, cold-adapted and attenuated phenotypes. Methodology/Principal Findings LAIV candidate A/Anhui/1/2013(H7N9)-CDC-LV7A (abbreviated as CDC-LV7A), based on the Russian MDV, A/Leningrad/134/17/57 (H2N2), was generated by classical reassortment in eggs and retained MDV temperature-sensitive and cold-adapted phenotypes. CDC-LV7A had two amino acid substitutions N123D and N149D (H7 numbering) in HA and one substitution T10I in NA. To evaluate the role of these mutations on the replication capacity of the reassortants in eggs, the recombinant viruses A(H7N9)RG-LV1 and A(H7N9)RG-LV2 were generated by reverse genetics. These changes did not alter virus antigenicity as ferret antiserum to CDC-LV7A vaccine candidate inhibited hemagglutination by homologous A(H7N9) virus efficiently. Safety studies in ferrets confirmed that CDC-LV7A was attenuated compared to wild-type A/Anhui/1/2013. In addition, the genetic stability of this vaccine candidate was examined in eggs and ferrets by monitoring sequence changes acquired during virus replication in the two host models. No changes in the viral genome were detected after five passages in eggs. However, after ten passages additional mutations were detected in the HA gene. The vaccine candidate was shown to be stable in the ferret model; post-vaccination sequence data analysis showed no changes in viruses collected in nasal washes present at day 5 or day 7. Conclusions/Significance Our data indicate that the A/Anhui/1/2013(H7N9)-CDC-LV7A reassortant virus is a safe and

  13. Integration of gene-based markers in a pearl millet genetic map for identification of candidate genes underlying drought tolerance quantitative trait loci

    Directory of Open Access Journals (Sweden)

    Sehgal Deepmala

    2012-01-01

    Full Text Available Abstract Background Identification of genes underlying drought tolerance (DT quantitative trait loci (QTLs will facilitate understanding of molecular mechanisms of drought tolerance, and also will accelerate genetic improvement of pearl millet through marker-assisted selection. We report a map based on genes with assigned functional roles in plant adaptation to drought and other abiotic stresses and demonstrate its use in identifying candidate genes underlying a major DT-QTL. Results Seventy five single nucleotide polymorphism (SNP and conserved intron spanning primer (CISP markers were developed from available expressed sequence tags (ESTs using four genotypes, H 77/833-2, PRLT 2/89-33, ICMR 01029 and ICMR 01004, representing parents of two mapping populations. A total of 228 SNPs were obtained from 30.5 kb sequenced region resulting in a SNP frequency of 1/134 bp. The positions of major pearl millet linkage group (LG 2 DT-QTLs (reported from crosses H 77/833-2 × PRLT 2/89-33 and 841B × 863B were added to the present consensus function map which identified 18 genes, coding for PSI reaction center subunit III, PHYC, actin, alanine glyoxylate aminotransferase, uridylate kinase, acyl-CoA oxidase, dipeptidyl peptidase IV, MADS-box, serine/threonine protein kinase, ubiquitin conjugating enzyme, zinc finger C- × 8-C × 5-C × 3-H type, Hd3, acetyl CoA carboxylase, chlorophyll a/b binding protein, photolyase, protein phosphatase1 regulatory subunit SDS22 and two hypothetical proteins, co-mapping in this DT-QTL interval. Many of these candidate genes were found to have significant association with QTLs of grain yield, flowering time and leaf rolling under drought stress conditions. Conclusions We have exploited available pearl millet EST sequences to generate a mapped resource of seventy five new gene-based markers for pearl millet and demonstrated its use in identifying candidate genes underlying a major DT-QTL in this species. The reported gene-based

  14. Immunogenicity of a Candidate DNA Vaccine Based on the prM/E Genes of a Dengue Type 2 Virus Cosmopolitan Genotype Strain.

    Science.gov (United States)

    Putri, Dwi Hilda; Sudiro, Tjahjani Mirawati; Yunita, Rina; Jaya, Ungke Anton; Dewi, Beti Ernawati; Sjatha, Fithriyah; Konishi, Eiji; Hotta, Hak; Sudarmono, Pratiwi

    2015-01-01

    The development of a dengue virus vaccine is a major priority in efforts to control the diseases. Several researchers are currently using the Asian 1 and Asian 2 genotypes as vaccine candidates for dengue type 2 virus (DENV-2). However, in this study, we constructed a recombinant plasmid-based prM/E gene, from a DENV-2 Cosmopolitan genotype strain as a dengue DNA vaccine candidate. The protein expression of the recombinant plasmid in CHO cells was analyzed using an enzyme-linked immunosorbent assay, western blotting, and sucrose gradient sedimentation. After being used to immunize ddY mice three times at doses of 25 or 100 μg, the DNA vaccine induced humoral immune responses. There was no difference in the neutralizing antibody titer (focus reduction neutralization test 50% value) of mice immunized with 25 and 100 μg DNA vaccine doses. When challenged with 3 × 10(5) FFU DENV-2, immunized mice could raise anamnestic neutralizing antibody responses, which were observed at day 4 and day 8 post-challenge. Analysis of immunogenicity using BALB/c mice showed that their antibody neutralization titers were lower than those of ddY mice. In addition, the antibodies produced after immunization and challenge could also neutralize a DENV-2 Asian 2 genotype (New Guinea C) strain. Therefore, the DENV-2 Cosmopolitan genotype may be a DENV-2 vaccine candidate.

  15. Stochastic Dynamics of the Multi-State Voter Model over a Network based on Interacting Cliques and Zealot Candidates

    CERN Document Server

    Palombi, Filippo

    2013-01-01

    The stochastic dynamics of the multi-state voter model is investigated on a class of complex networks made of non-overlapping cliques, each hosting a political candidate and interacting with the others via Erd\\H{o}s-R\\'enyi links. Numerical simulations of the model are interpreted in terms of an ad-hoc mean field theory, specifically tuned to resolve the inter/intra-clique interactions. Under a proper definition of the thermodynamic limit (with the average degree of the agents kept fixed while increasing the network size), the model is found to display the empirical scaling discovered by Fortunato and Castellano (2007) [1] and the vote distribution resembles qualitatively that observed in Brazilian elections.

  16. Stochastic Dynamics of the Multi-State Voter Model Over a Network Based on Interacting Cliques and Zealot Candidates

    Science.gov (United States)

    Palombi, Filippo; Toti, Simona

    2014-07-01

    The stochastic dynamics of the multi-state voter model is investigated on a class of complex networks made of non-overlapping cliques, each hosting a political candidate and interacting with the others via Erdős-Rényi links. Numerical simulations of the model are interpreted in terms of an ad-hoc mean field theory, specifically tuned to resolve the inter/intra-clique interactions. Under a proper definition of the thermodynamic limit (with the average degree of the agents kept fixed while increasing the network size), the model is found to display the empirical scaling discovered by Fortunato and Castellano (Phys Rev Lett 99(13):138701, 2007) , while the vote distribution resembles roughly that observed in Brazilian elections.

  17. Identification of candidate categories of the International Classification of Functioning Disability and Health (ICF for a Generic ICF Core Set based on regression modelling

    Directory of Open Access Journals (Sweden)

    Üstün Bedirhan T

    2006-07-01

    Full Text Available Abstract Background The International Classification of Functioning, Disability and Health (ICF is the framework developed by WHO to describe functioning and disability at both the individual and population levels. While condition-specific ICF Core Sets are useful, a Generic ICF Core Set is needed to describe and compare problems in functioning across health conditions. Methods The aims of the multi-centre, cross-sectional study presented here were: a to propose a method to select ICF categories when a large amount of ICF-based data have to be handled, and b to identify candidate ICF categories for a Generic ICF Core Set by examining their explanatory power in relation to item one of the SF-36. The data were collected from 1039 patients using the ICF checklist, the SF-36 and a Comorbidity Questionnaire. ICF categories to be entered in an initial regression model were selected following systematic steps in accordance with the ICF structure. Based on an initial regression model, additional models were designed by systematically substituting the ICF categories included in it with ICF categories with which they were highly correlated. Results Fourteen different regression models were performed. The variance the performed models account for ranged from 22.27% to 24.0%. The ICF category that explained the highest amount of variance in all the models was sensation of pain. In total, thirteen candidate ICF categories for a Generic ICF Core Set were proposed. Conclusion The selection strategy based on the ICF structure and the examination of the best possible alternative models does not provide a final answer about which ICF categories must be considered, but leads to a selection of suitable candidates which needs further consideration and comparison with the results of other selection strategies in developing a Generic ICF Core Set.

  18. A new high-throughput method utilizing porous silica-based nano-composites for the determination of partition coefficients of drug candidates.

    Science.gov (United States)

    Yu, Chih H; Tam, Kin; Tsang, Shik C

    2011-09-01

    We show that highly porous silica-based nanoparticles prepared via micro-emulsion and sol-gel techniques are stable colloids in aqueous solution. By incorporating a magnetic core into the porous silica nano-composite, it is found that the material can be rapidly separated (precipitated) upon exposure to an external magnetic field. Alternatively, the porous silica nanoparticles without magnetic cores can be equally separated from solution by applying a high-speed centrifugation. Using these silica-based nanostructures a new high-throughput method for the determination of partition coefficient for water/n-octanol is hereby described. First, a tiny quantity of n-octanol phase is pre-absorbed in the porous silica nano-composite colloids, which allows an establishment of interface at nano-scale between the adsorbed n-octanol with the bulk aqueous phase. Organic compounds added to the mixture can therefore undergo a rapid partition between the two phases. The concentration of drug compound in the supernatant in a small vial can be determined by UV-visible absorption spectroscopy. With the adaptation of a robotic liquid handler, a high-throughput technology for the determination of partition coefficients of drug candidates can be employed for drug screening in the industry based on these nano-separation skills. The experimental results clearly suggest that this new method can provide partition coefficient values of potential drug candidates comparable to the conventional shake-flask method but requires much shorter analytical time and lesser quantity of chemicals.

  19. Systematic exploration of a class of hydrophobic unnatural base pairs yields multiple new candidates for the expansion of the genetic alphabet.

    Science.gov (United States)

    Dhami, Kirandeep; Malyshev, Denis A; Ordoukhanian, Phillip; Kubelka, Tomáš; Hocek, Michal; Romesberg, Floyd E

    2014-01-01

    We have developed a family of unnatural base pairs (UBPs), which rely on hydrophobic and packing interactions for pairing and which are well replicated and transcribed. While the pair formed between d5SICS and dNaM (d5SICS-dNaM) has received the most attention, and has been used to expand the genetic alphabet of a living organism, recent efforts have identified dTPT3-dNaM, which is replicated with even higher fidelity. These efforts also resulted in more UBPs than could be independently analyzed, and thus we now report a PCR-based screen to identify the most promising. While we found that dTPT3-dNaM is generally the most promising UBP, we identified several others that are replicated nearly as well and significantly better than d5SICS-dNaM, and are thus viable candidates for the expansion of the genetic alphabet of a living organism. Moreover, the results suggest that continued optimization should be possible, and that the putatively essential hydrogen-bond acceptor at the position ortho to the glycosidic linkage may not be required. These results clearly demonstrate the generality of hydrophobic forces for the control of base pairing within DNA, provide a wealth of new structure-activity relationship data and importantly identify multiple new candidates for in vivo evaluation and further optimization.

  20. An In Silico Identification of Common Putative Vaccine Candidates against Treponema pallidum: A Reverse Vaccinology and Subtractive Genomics Based Approach

    Science.gov (United States)

    Kumar Jaiswal, Arun; Tiwari, Sandeep; Jamal, Syed Babar; Barh, Debmalya; Azevedo, Vasco; Soares, Siomar C.

    2017-01-01

    Sexually transmitted infections (STIs) are caused by a wide variety of bacteria, viruses, and parasites that are transmitted from one person to another primarily by vaginal, anal, or oral sexual contact. Syphilis is a serious disease caused by a sexually transmitted infection. Syphilis is caused by the bacterium Treponema pallidum subspecies pallidum. Treponema pallidum (T. pallidum) is a motile, gram-negative spirochete, which can be transmitted both sexually and from mother to child, and can invade virtually any organ or structure in the human body. The current worldwide prevalence of syphilis emphasizes the need for continued preventive measures and strategies. Unfortunately, effective measures are limited. In this study, we focus on the identification of vaccine targets and putative drugs against syphilis disease using reverse vaccinology and subtractive genomics. We compared 13 strains of T. pallidum using T. pallidum Nichols as the reference genome. Using an in silicoapproach, four pathogenic islands were detected in the genome of T. pallidum Nichols. We identified 15 putative antigenic proteins and sixdrug targets through reverse vaccinology and subtractive genomics, respectively, which can be used as candidate therapeutic targets in the future. PMID:28216574

  1. Plant-based production of recombinant Plasmodium surface protein pf38 and evaluation of its potential as a vaccine candidate.

    Science.gov (United States)

    Feller, Tatjana; Thom, Pascal; Koch, Natalie; Spiegel, Holger; Addai-Mensah, Otchere; Fischer, Rainer; Reimann, Andreas; Pradel, Gabriele; Fendel, Rolf; Schillberg, Stefan; Scheuermayer, Matthias; Schinkel, Helga

    2013-01-01

    Pf38 is a surface protein of the malarial parasite Plasmodium falciparum. In this study, we produced and purified recombinant Pf38 and a fusion protein composed of red fluorescent protein and Pf38 (RFP-Pf38) using a transient expression system in the plant Nicotiana benthamiana. To our knowledge, this is the first description of the production of recombinant Pf38. To verify the quality of the recombinant Pf38, plasma from semi-immune African donors was used to confirm specific binding to Pf38. ELISA measurements revealed that immune responses to Pf38 in this African subset were comparable to reactivities to AMA-1 and MSP119. Pf38 and RFP-Pf38 were successfully used to immunise mice, although titres from these mice were low (on average 1∶11.000 and 1∶39.000, respectively). In immune fluorescence assays, the purified IgG fraction from the sera of immunised mice recognised Pf38 on the surface of schizonts, gametocytes, macrogametes and zygotes, but not sporozoites. Growth inhibition assays using αPf38 antibodies demonstrated strong inhibition (≥60%) of the growth of blood-stage P. falciparum. The development of zygotes was also effectively inhibited by αPf38 antibodies, as determined by the zygote development assay. Collectively, these results suggest that Pf38 is an interesting candidate for the development of a malaria vaccine.

  2. Plant-based production of recombinant Plasmodium surface protein pf38 and evaluation of its potential as a vaccine candidate.

    Directory of Open Access Journals (Sweden)

    Tatjana Feller

    Full Text Available Pf38 is a surface protein of the malarial parasite Plasmodium falciparum. In this study, we produced and purified recombinant Pf38 and a fusion protein composed of red fluorescent protein and Pf38 (RFP-Pf38 using a transient expression system in the plant Nicotiana benthamiana. To our knowledge, this is the first description of the production of recombinant Pf38. To verify the quality of the recombinant Pf38, plasma from semi-immune African donors was used to confirm specific binding to Pf38. ELISA measurements revealed that immune responses to Pf38 in this African subset were comparable to reactivities to AMA-1 and MSP119. Pf38 and RFP-Pf38 were successfully used to immunise mice, although titres from these mice were low (on average 1∶11.000 and 1∶39.000, respectively. In immune fluorescence assays, the purified IgG fraction from the sera of immunised mice recognised Pf38 on the surface of schizonts, gametocytes, macrogametes and zygotes, but not sporozoites. Growth inhibition assays using αPf38 antibodies demonstrated strong inhibition (≥60% of the growth of blood-stage P. falciparum. The development of zygotes was also effectively inhibited by αPf38 antibodies, as determined by the zygote development assay. Collectively, these results suggest that Pf38 is an interesting candidate for the development of a malaria vaccine.

  3. GC-MS Based Plasma Metabolomics for Identification of Candidate Biomarkers for Hepatocellular Carcinoma in Egyptian Cohort.

    Directory of Open Access Journals (Sweden)

    Mohammad R Nezami Ranjbar

    Full Text Available This study evaluates changes in metabolite levels in hepatocellular carcinoma (HCC cases vs. patients with liver cirrhosis by analysis of human blood plasma using gas chromatography coupled with mass spectrometry (GC-MS. Untargeted metabolomic analysis of plasma samples from participants recruited in Egypt was performed using two GC-MS platforms: a GC coupled to single quadruple mass spectrometer (GC-qMS and a GC coupled to a time-of-flight mass spectrometer (GC-TOFMS. Analytes that showed statistically significant changes in ion intensities were selected using ANOVA models. These analytes and other candidates selected from related studies were further evaluated by targeted analysis in plasma samples from the same participants as in the untargeted metabolomic analysis. The targeted analysis was performed using the GC-qMS in selected ion monitoring (SIM mode. The method confirmed significant changes in the levels of glutamic acid, citric acid, lactic acid, valine, isoleucine, leucine, alpha tocopherol, cholesterol, and sorbose in HCC cases vs. patients with liver cirrhosis. Specifically, our findings indicate up-regulation of metabolites involved in branched-chain amino acid (BCAA metabolism. Although BCAAs are increasingly used as a treatment for cancer cachexia, others have shown that BCAA supplementation caused significant enhancement of tumor growth via activation of mTOR/AKT pathway, which is consistent with our results that BCAAs are up-regulated in HCC.

  4. Gonadotrophin releasing hormone-based vaccine, an effective candidate for prostate cancer and other hormone-sensitive neoplasms.

    Science.gov (United States)

    Junco, Jesús A; Basalto, Roberto; Fuentes, Franklin; Bover, Eddy; Reyes, Osvaldo; Pimentel, Eulogio; Calzada, Lesvia; Castro, Maria D; Arteaga, Niurka; López, Yovisleidis; Hernández, Héctor; Bringas, Ricardo; Garay, Hilda; Peschke, Peter; Bertot, José; Guillén, Gerardo

    2008-01-01

    Prostate growth, development, functions, and neoplastic transformation is androgen dependent. Estrogens have similar effects in the ovary and breast. Previous studies using gonadotrophin releasing hormone (GnRH/LHRH) vaccines have shown the usefulness of immunization against this hormone in prostate (PC) and breast cancer (BC). We have synthesized a peptide mutated at position 6 and attached to the 830-844 tetanic toxoid (TT) helper T cell sequence in the same synthesis process. After repeated pig immunizations, we have demonstrated a vaccine that significantly decreased testes size (p < 0.001), prostate (p < 0.01), seminal vesicles (p < 0.01), and testosterone (T) castration [0.05 nM ml(-1) (p < 0. 01)]. Similar results were obtained in adult male and female healthy dogs and Macaca fascicularis models. These data indicate that this GnRHm1-TT vaccine is safe and able to induce significant tumor growth inhibition in the Dunning R3327-H rat androgen responsive prostate tumor model. In these rats, the immunization induced high anti-GnRH titers concomitant with T castration reduction (p < 0.01) in 90% of the animals tested. In addition, 70% of the responders exhibited tumor growth inhibition (p = 0.02) and a survival rate approximately three times longer that those of untreated rats. These data indicate that GnRHm1-TT vaccine may be a potential candidate in the treatment of PC, BC, and other hormone-dependent cancers.

  5. Candidate Gene Identification with SNP Marker-Based Fine Mapping of Anthracnose Resistance Gene Co-4 in Common Bean

    Science.gov (United States)

    Burt, Andrew J.; William, H. Manilal; Perry, Gregory; Khanal, Raja; Pauls, K. Peter; Kelly, James D.; Navabi, Alireza

    2015-01-01

    Anthracnose, caused by Colletotrichum lindemuthianum, is an important fungal disease of common bean (Phaseolus vulgaris). Alleles at the Co–4 locus confer resistance to a number of races of C. lindemuthianum. A population of 94 F4:5 recombinant inbred lines of a cross between resistant black bean genotype B09197 and susceptible navy bean cultivar Nautica was used to identify markers associated with resistance in bean chromosome 8 (Pv08) where Co–4 is localized. Three SCAR markers with known linkage to Co–4 and a panel of single nucleotide markers were used for genotyping. A refined physical region on Pv08 with significant association with anthracnose resistance identified by markers was used in BLAST searches with the genomic sequence of common bean accession G19833. Thirty two unique annotated candidate genes were identified that spanned a physical region of 936.46 kb. A majority of the annotated genes identified had functional similarity to leucine rich repeats/receptor like kinase domains. Three annotated genes had similarity to 1, 3-β-glucanase domains. There were sequence similarities between some of the annotated genes found in the study and the genes associated with phosphoinositide-specific phosphilipases C associated with Co-x and the COK–4 loci found in previous studies. It is possible that the Co–4 locus is structured as a group of genes with functional domains dominated by protein tyrosine kinase along with leucine rich repeats/nucleotide binding site, phosphilipases C as well as β-glucanases. PMID:26431031

  6. Immunogenicity of a polyvalent HIV-1 candidate vaccine based on fourteen wild type gp120 proteins in golden hamsters

    Directory of Open Access Journals (Sweden)

    Ghorbani Masoud

    2006-10-01

    Full Text Available Abstract Background One of the major obstacles in the design of an effective vaccine against HIV-1 is the hypervariability of the HIV-1 envelope glycoprotein. Most HIV-1 vaccine candidates have utilized envelope glycoprotein from a single virus isolate, but to date, none of them elicited broadly reactive humoral immunity. Herein, we hypothesised that a cocktail of HIV-1 gp120 proteins containing multiple epitopes may increase the breadth of immune responses against HIV-1. We compared and evaluated the immunogenicity of HIV-1 vaccines containing either gp120 protein alone or in combinations of four or fourteen gp120s from different primary HIV-1 isolates in immunized hamsters. Results We amplified and characterized 14 different gp120s from primary subtype B isolates with both syncytium and non-syncytium inducing properties, and expressed the proteins in Chinese Hamster Ovary (CHO cell lines. Purified proteins were used either alone or in combinations of four or fourteen different gp120s to vaccinate golden hamsters. The polyvalent vaccine showed higher antibody titers to HIV-1 subtype B isolates MN and SF162 compared to the groups that received one or four gp120 proteins. However, the polyvalent vaccine was not able to show higher neutralizing antibody responses against HIV-1 primary isolates. Interestingly, the polyvalent vaccine group had the highest proliferative immune responses and showed a substantial proportion of cross-subtype CD4 reactivity to HIV-1 subtypes B, C, and A/E Conclusion Although the polyvalent approach achieved only a modest increase in the breadth of humoral and cellular immunity, the qualitative change in the vaccine (14 vs. 1 gp120 resulted in a quantitative improvement in vaccine-induced immunity.

  7. Selection and validation of potato candidate genes for maturity corrected resistance to Phytophthora infestans based on differential expression combined with SNP association and linkage mapping

    Directory of Open Access Journals (Sweden)

    Meki Shehabu Muktar

    2015-09-01

    Full Text Available Late blight of potato (Solanum tuberosum L. caused by the oomycete Phytophthora infestans (Mont. de Bary, is one of the most important bottlenecks of potato production worldwide. Cultivars with high levels of durable, race unspecific, quantitative resistance are part of a solution to this problem. However, breeding for quantitative resistance is hampered by the correlation between resistance and late plant maturity, which is an undesirable agricultural attribute. The objectives of our research are (i the identification of genes that condition quantitative resistance to P. infestans not compromised by late plant maturity and (ii the discovery of diagnostic single nucleotide polymorphism (SNP markers to be used as molecular tools to increase efficiency and precision of resistance breeding. Twenty two novel candidate genes were selected based on comparative transcript profiling by SuperSAGE (serial analysis of gene expression in groups of plants with contrasting levels of maturity corrected resistance (MCR. Reproducibility of differential expression was tested by quantitative real time PCR and allele specific pyrosequencing in four new sets of genotype pools with contrasting late blight resistance levels, at three infection time points and in three independent infection experiments. Reproducibility of expression patterns ranged from 28% to 97%. Association mapping in a panel of 184 tetraploid cultivars identified SNPs in five candidate genes that were associated with MCR. These SNPs can be used in marker-assisted resistance breeding. Linkage mapping in two half-sib families (n = 111 identified SNPs in three candidate genes that were linked with MCR. The differentially expressed genes that showed association and/or linkage with MCR putatively function in phytosterol synthesis, fatty acid synthesis, asparagine synthesis, chlorophyll synthesis, cell wall modification and in the response to pathogen elicitors.

  8. Serum-free microcarrier based production of replication deficient Influenza vaccine candidate virus lacking NS1 using Vero cells

    Directory of Open Access Journals (Sweden)

    Yan Mylene L

    2011-08-01

    Full Text Available Abstract Background Influenza virus is a major health concern that has huge impacts on the human society, and vaccination remains as one of the most effective ways to mitigate this disease. Comparing the two types of commercially available Influenza vaccine, the live attenuated virus vaccine is more cross-reactive and easier to administer than the traditional inactivated vaccines. One promising live attenuated Influenza vaccine that has completed Phase I clinical trial is deltaFLU, a deletion mutant lacking the viral Nonstructural Protein 1 (NS1 gene. As a consequence of this gene deletion, this mutant virus can only propagate effectively in cells with a deficient interferon-mediated antiviral response. To demonstrate the manufacturability of this vaccine candidate, a batch bioreactor production process using adherent Vero cells on microcarriers in commercially available animal-component free, serum-free media is described. Results Five commercially available animal-component free, serum-free media (SFM were evaluated for growth of Vero cells in agitated Cytodex 1 spinner flask microcarrier cultures. EX-CELL Vero SFM achieved the highest cell concentration of 2.6 × 10^6 cells/ml, whereas other SFM achieved about 1.2 × 10^6 cells/ml. Time points for infection between the late exponential and stationary phases of cell growth had no significant effect in the final virus titres. A virus yield of 7.6 Log10 TCID50/ml was achieved using trypsin concentration of 10 μg/ml and MOI of 0.001. The Influenza vaccine production process was scaled up to a 3 liter controlled stirred tank bioreactor to achieve a cell density of 2.7 × 10^6 cells/ml and virus titre of 8.3 Log10 TCID50/ml. Finally, the bioreactor system was tested for the production of the corresponding wild type H1N1 Influenza virus, which is conventionally used in the production of inactivated vaccine. High virus titres of up to 10 Log10 TCID50/ml were achieved. Conclusions We describe for the

  9. Independent candidates in Mexico

    OpenAIRE

    Campos, Gonzalo Santiago

    2014-01-01

    In this paper we discuss the issue of independent candidates in Mexico, because through the so-called political reform of 2012 was incorporated in the Political Constitution of the Mexican United States the right of citizens to be registered as independent candidates. Also, in September 2013 was carried out a reform of Article 116 of the Political Constitution of the Mexican United States in order to allow independent candidates in each state of the Republic. However, prior to the constitutio...

  10. HLAMatchmaker-based strategy to identify acceptable HLA class I mismatches for highly sensitized kidney transplant candidates.

    Science.gov (United States)

    Duquesnoy, Rene J; Witvliet, Marian; Doxiadis, Ilias I N; de Fijter, Hans; Claas, Frans H J

    2004-01-01

    HLAMatchmaker determines HLA compatibility at the level of polymorphic amino acid triplets in antibody-accessible sequence positions. Recent studies have shown that among HLA-DR-matched kidney transplants, the HLA-A,B antigen mismatches which are compatible at the triplet level have almost identical graft survival rates as the zero-HLA-A,B antigen mismatches. This finding provides the basis of a new strategy to identify HLA-mismatched organs that have similar success rates as the zero-HLA-antigen mismatches. This report describes how in conjunction with the Acceptable Mismatch program in Eurotransplant, HLAMatchmaker can expand the pool of potential donors for highly sensitized patients, for whom it is very difficult to find a compatible transplant. Sera from 35 highly sensitized kidney transplant candidates with an average PRA of 96% were screened by lymphocytotoxicity with HLA-typed panels that included cells that were selectively mismatched for one or two HLA antigens for each patient. Acceptable and unacceptable HLA-A,B antigen mismatches were determined from the serum reactivity with the cell panel. HLAMatchmaker analysis was applied to identify additional HLA class I antigens that were matched at the triplet level. For each patient, we calculated the probability of finding a donor (PFD) in the different match categories from HLA gene frequencies in the kidney donor population. The median PFD for a zero-antigen mismatch was 0.025%. Matching at the triplet level increased the median PFD to 0.037% ( P = 0.008). The median PFD was 0.058% for a 0-1-triplet mismatch and 0.226% for a 0-2-triplet mismatch. Serum screening identified acceptable antigen mismatches for 28 of 35 highly sensitized patients, and the median PFD increased to 0.307% for a zero/acceptable antigen mismatch. The application of HLAMatchmaker permitted for 33 patients (or 92%) the identification of additional antigens that were acceptable at the triplet level, and the median PFD for a zero

  11. Candidate lesion-based criteria for defining a positive sacroiliac joint MRI in two cohorts of patients with axial spondyloarthritis

    DEFF Research Database (Denmark)

    Weber, Ulrich; Østergaard, Mikkel; Lambert, Robert G W

    2015-01-01

    . METHODS: Two independent cohorts A/B of 69/88 consecutive patients with back pain aged ≤50 years, with median symptom duration 1.3/10.0 years, were referred for suspected SpA (A) or acute anterior uveitis plus back pain (B). Patients were classified according to rheumatologist expert opinion based...

  12. 5-Fluorouracil-lipid conjugate: potential candidate for drug delivery through encapsulation in hydrophobic polyester-based nanoparticles.

    Science.gov (United States)

    Ashwanikumar, N; Kumar, Nisha Asok; Nair, S Asha; Kumar, G S Vinod

    2014-11-01

    The encapsulation of 5-fluorouracil (5-FU) in hydrophobic polymeric materials is made feasible by a lipid-based prodrug approach. A lipid-5-FU conjugate of 5-FU with palmitic acid was synthesized in two-step process. A synthesized dipalmitoyl derivative (5-FUDIPAL) was characterized using Fourier transform infrared spectroscopy and (1)H-nuclear magnetic resonance. The 5-FUDIPAL was encapsulated in polyester-based polymers by the double emulsion-solvent evaporation method. The nanoparticles were characterized by scanning electron microscopy, transmission electron microscopy and dynamic light scattering. The thermal stability was assessed by differential scanning calorimetry data. In vitro release kinetics measurements of the drug from nanoparticles showed the controlled release pattern over a period of time. Cytotoxicity measurements by MTT assay confirmed that dipalmitoyl derivative in nano formulation successfully inhibited the cell growth. Thus the combined physical and biological evaluation of the different polyester-based nanoparticle containing the modified drug showed a facile approach to delivering 5-FU to the tumour site with enhanced efficacy.

  13. Identification and prioritization of candidate genes for symptom variability in breast cancer survivors based on disease characteristics at the cellular level

    Directory of Open Access Journals (Sweden)

    Koleck TA

    2016-03-01

    Full Text Available Theresa A Koleck,1 Yvette P Conley2 1School of Nursing, 2Department of Human Genetics, School of Nursing and Graduate School of Public Health, University of Pittsburgh, Pittsburgh, PA, USA Abstract: Research is beginning to suggest that the presence and/or severity of symptoms reported by breast cancer survivors may be associated with disease-related factors of cancer. In this article, we present a novel approach to the identification and prioritization of biologically plausible candidate genes to investigate relationships between genomic variation and symptom variability in breast cancer survivors. Cognitive dysfunction is utilized as a representative breast cancer survivor symptom to elucidate the conceptualization of and justification for our cellular, disease-based approach to address symptom variability in cancer survivors. Initial candidate gene identification was based on genes evaluated as part of multigene expression profiles for breast cancer, which are commonly used in the clinical setting to characterize the biology of cancer cells for the purpose of describing overall tumor aggressiveness, prognostication, and individualization of therapy. A list of genes evaluated within five multigene expression profiles for breast cancer was compiled. In order to prioritize candidate genes for investigation, genes used in each profile were compared for duplication. Twenty-one genes (BAG1, BCL2, BIRC5, CCNB1, CENPA, CMC2, DIAPH3, ERBB2, ESR1, GRB7, MELK, MKI67, MMP11, MYBL2, NDC80, ORC6, PGR, RACGAP1, RFC4, RRM2, and SCUBE2 are utilized in two or more profiles, including five genes (CCNB1, CENPA, MELK, MYBL2, and ORC6 used in three profiles. To ensure that the parsimonious 21 gene set is representative of the more global biological hallmarks of cancer, an Ingenuity Pathway Analysis was conducted. Evaluation of genes known to impact pathways involved with cancer development and progression provide a means to evaluate the overlap between the

  14. Benefit-of-doubt (BOD) scoring: a sequencing-based method for SNP candidate assessment from high to medium read number data sets.

    Science.gov (United States)

    Sedlazeck, Fritz Joachim; Talloji, Prabhavathi; von Haeseler, Arndt; Bachmair, Andreas

    2013-03-01

    Identification of single nucleotide polymorphisms (SNPs) is a key element in sequence-based genetic analysis. Next generation sequencing offers a cost-effective basis to generate the necessary, large sequence data sets, and bioinformatic methods are being developed to process sequencing machine readouts. We were interested in detection of SNPs in a 350 kb region of an EMS-mutagenized Arabidopsis chromosome 3. The region was selectively analyzed using PCR-generated, overlapping fragments for Solexa sequencing. The ensuing reads provided a high coverage and were processed bioinformatically. In order to assess the SNP candidates obtained with a frequently used alignment program and SNP caller, we developed an additional method that allows the identification of high confidence SNP loci. The method can easily be applied to complete genome sequence data of sufficient coverage.

  15. Single crystal growth of europium and ytterbium based intermetallic compounds using metal flux technique

    Indian Academy of Sciences (India)

    Sumanta Sarkar; Sebastian C Peter

    2012-11-01

    This article covers the use of indium as a potential metal solvent for the crystal growth of europium and ytterbium-based intermetallic compounds. A brief view about the advantage of metal flux technique and the use of indium as reactive and non-reactive flux are outlined. Large single crystals of EuGe2, EuCoGe3 and Yb2AuGe3 compounds were obtained in high yield from the reactions of the elements in liquid indium. The results presented here demonstrate that considerable advances in the discovery of single crystal growth of complex phases are achievable utilizing molten metals as solvents.

  16. Conservation and diversity of influenza A H1N1 HLA-restricted T cell epitope candidates for epitope-based vaccines.

    Directory of Open Access Journals (Sweden)

    Paul Thiamjoo Tan

    Full Text Available BACKGROUND: The immune-related evolution of influenza viruses is exceedingly complex and current vaccines against influenza must be reformulated for each influenza season because of the high degree of antigenic drift among circulating influenza strains. Delay in vaccine production is a serious problem in responding to a pandemic situation, such as that of the current H1N1 strain. Immune escape is generally attributed to reduced antibody recognition of the viral hemagglutinin and neuraminidase proteins whose rate of mutation is much greater than that of the internal non-structural proteins. As a possible alternative, vaccines directed at T cell epitope domains of internal influenza proteins, that are less susceptible to antigenic variation, have been investigated. METHODOLOGY/PRINCIPAL FINDINGS: HLA transgenic mouse strains expressing HLA class I A*0201, A*2402, and B*0702, and class II DRB1*1501, DRB1*0301 and DRB1*0401 were immunized with 196 influenza H1N1 peptides that contained residues of highly conserved proteome sequences of the human H1N1, H3N2, H1N2, H5N1, and avian influenza A strains. Fifty-four (54 peptides that elicited 63 HLA-restricted peptide-specific T cell epitope responses were identified by IFN-gamma ELISpot assay. The 54 peptides were compared to the 2007-2009 human H1N1 sequences for selection of sequences in the design of a new candidate H1N1 vaccine, specifically targeted to highly-conserved HLA-restricted T cell epitopes. CONCLUSIONS/SIGNIFICANCE: Seventeen (17 T cell epitopes in PB1, PB2, and M1 were selected as vaccine targets based on sequence conservation over the past 30 years, high functional avidity, non-identity to human peptides, clustered localization, and promiscuity to multiple HLA alleles. These candidate vaccine antigen sequences may be applicable to any avian or human influenza A virus.

  17. Candidate genes involved in cardiovascular risk factors by a family-based association study on the island of Kosrae, Federated States of Micronesia.

    Science.gov (United States)

    Han, Zhihua; Heath, Simon C; Shmulewitz, Dvora; Li, Wentian; Auerbach, Steve B; Blundell, Maude L; Lehner, Thomas; Ott, Jurg; Stoffel, Markus; Friedman, Jeffrey M; Breslow, Jan L

    2002-07-01

    Altered plasma levels of lipids and lipoproteins, obesity, hypertension, and diabetes are major risk factors for atherosclerotic cardiovascular disease. To identify genes that affect these traits and disorders, we looked for association between markers in candidate genes (apolipoprotein AII (apo AII), apolipoprotein AI-CIII-AIV gene cluster (apo AI-CIII-AIV), apolipoprotein E (apo E), cholesteryl ester transfer protein (CETP), cholesterol 7alpha-hydroxylase (CYP7a), hepatic lipase (HL), and microsomal triglyceride transfer protein (MTP)) and known risk factors (triglycerides (Tg), total cholesterol (TC), apolipoprotein AI (apo AI), apolipoprotein AII (apo AII), apolipoprotein B (apo B), body mass index (BMI), blood pressure (BP), leptin, and fasting blood sugar (FBS) levels.) A total of 1,102 individuals from the Pacific island of Kosrae were genotyped for the following markers: Apo AII/MspI, Apo CIII/SstI, Apo AI/XmnI, Apo E/HhaI, CETP/TaqIB, CYP7a/BsaI, HL/DraI, and MTP/HhpI. After testing for population stratification, family-based association analysis was carried out. Novel associations found were: 1) the apo AII/MspI with apo AI and BP levels, 2) the CYP7a/BsaI with apo AI and BMI levels. We also confirmed the following associations: 1) the apo AII/MspI with Tg level; 2) the apo CIII/SstI with Tg, TC, and apo B levels; 3) the Apo E/HhaI E2, E3, and E4 alleles with TC, apo AI, and apo B levels; and 4) the CETP/TaqIB with apo AI level. We further confirmed the connection between the apo AII gene and Tg level by a nonparametric linkage analysis. We therefore conclude that many of these candidate genes may play a significant role in susceptibility to heart disease.

  18. High-yield production of a stable Vero cell-based vaccine candidate against the highly pathogenic avian influenza virus H5N1

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Fangye; Zhou, Jian; Ma, Lei; Song, Shaohui; Zhang, Xinwen; Li, Weidong; Jiang, Shude [No. 5, Department of Bioproducts, Institute of Medical Biology, Chinese Academy of Medical Science and Pecking Union Medical College, Jiaoling Avenue 935, Kunming, Yunnan Province 650102, People' s Republic of China (China); Wang, Yue, E-mail: euy-tokyo@umin.ac.jp [National Institute for Viral Disease Control and Prevention, China Center for Disease Control and Prevention, Yingxin Lane 100, Xicheng District, Beijing 100052, People' s Republic of China (China); Liao, Guoyang, E-mail: liaogy@21cn.com [No. 5, Department of Bioproducts, Institute of Medical Biology, Chinese Academy of Medical Science and Pecking Union Medical College, Jiaoling Avenue 935, Kunming, Yunnan Province 650102, People' s Republic of China (China)

    2012-05-18

    Highlights: Black-Right-Pointing-Pointer Vero cell-based HPAI H5N1 vaccine with stable high yield. Black-Right-Pointing-Pointer Stable high yield derived from the YNVa H3N2 backbone. Black-Right-Pointing-Pointer H5N1/YNVa has a similar safety and immunogenicity to H5N1delta. -- Abstract: Highly pathogenic avian influenza (HPAI) viruses pose a global pandemic threat, for which rapid large-scale vaccine production technology is critical for prevention and control. Because chickens are highly susceptible to HPAI viruses, the supply of chicken embryos for vaccine production might be depleted during a virus outbreak. Therefore, developing HPAI virus vaccines using other technologies is critical. Meeting vaccine demand using the Vero cell-based fermentation process has been hindered by low stability and yield. In this study, a Vero cell-based HPAI H5N1 vaccine candidate (H5N1/YNVa) with stable high yield was achieved by reassortment of the Vero-adapted (Va) high growth A/Yunnan/1/2005(H3N2) (YNVa) virus with the A/Anhui/1/2005(H5N1) attenuated influenza vaccine strain (H5N1delta) using the 6/2 method. The reassorted H5N1/YNVa vaccine maintained a high hemagglutination (HA) titer of 1024. Furthermore, H5N1/YNVa displayed low pathogenicity and uniform immunogenicity compared to that of the parent virus.

  19. A finite element-based injury metric for pulmonary contusion: investigation of candidate metrics through correlation with computed tomography.

    Science.gov (United States)

    Gayzik, F Scott; Hoth, J Jason; Daly, Melissa; Meredith, J Wayne; Stitzel, Joel D

    2007-10-01

    Pulmonary contusion (PC) is the most common thoracic soft tissue injury following non-penetrating blunt trauma and has been associated with mortality rates as high as 25%. This study is part of an ongoing effort to develop a finite element based injury criteria for PC. The aims of this study are two fold. The first is to investigate the use of computed tomography (CT) to quantify the volume of pathologic lung tissue in a prospective study of PC. The second is to use a finite element model (FEM) of the lung to investigate several mathematical predictors of contusion to determine the injury metric that best matches the spatial distribution of contusion obtained from the CT analysis. PC is induced in-situ utilizing male Sprague Dawley rats (n = 24) through direct impact to the right lung at 5.0 ms(-1). Force vs. deflection data are collected and used for model validation and optimization. CT scans are taken at 24 hours, 48 hours, 1 week, and 1 month post contusion. A numerical simulation is performed using an FEM of the rat lung and surrounding structures. Injury predictors investigated include maximum first principal strain, maximum shear strain, triaxial mean strain, octahedral shear stress, and maximum shear stress. Strain rate and the product of strain and strain rate are evaluated for all listed strains. At each post-impact time point, the volume of contused lung is used to determine the specific elements representing pathologic lung. Through this method, a threshold is determined for all listed metrics. The spatial distribution of the elements exceeding this threshold is compared to the spatial distribution of high-radiopacity lung tissue in the CT through a three dimensional registration technique to determine the predictor with the best correlation to the outcome. Impacts resulted in a mean energy input to the lung of 8.74 +/- 2.5 mJ. Segmentation of the imaging data yielded a mean unilateral high-radiopacity tissue estimate of 14.5% by volume at 24 hours with

  20. Comparative testing of six antigen-based malaria vaccine candidates directed toward merozoite-stage Plasmodium falciparum

    DEFF Research Database (Denmark)

    Arnot, David E; Cavanagh, David R; Remarque, Edmond J;

    2008-01-01

    Immunogenicity testing of Plasmodium falciparum antigens being considered as malaria vaccine candidates was undertaken in rabbits. The antigens compared were recombinant baculovirus MSP-1(19) and five Pichia pastoris candidates, including two versions of MSP-1(19), AMA-1 (domains I and II), AMA-1...

  1. [Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice].

    Science.gov (United States)

    Lan, Jiaming; Lu, Shuai; Deng, Yao; Wen, Bo; Chen, Hong; Wang, Wen; Tan, Wenjie

    2016-01-01

    Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.

  2. A case-based evaluation of SRD5A1, SRD5A2, AR, and ADRA1A as candidate genes for severity of BPH.

    Science.gov (United States)

    Klotsman, M; Weinberg, C R; Davis, K; Binnie, C G; Hartmann, K E

    2004-01-01

    In men with a clinical diagnosis of benign prostatic hyperplasia (BPH), polytomous logistic regression analysis was conducted to evaluate associations between two silent polymorphisms in SRD5A1 (codon positions 30 and 116), two polymorphisms in SRD5A2 (Val89Leu substitution and C to T transition in intron 1), a trinucleotide (CAG)n repeat in androgen receptor (AR), and an Arg492Cys substitution in ADRA1A and clinical parameters that characterize severity of BPH. Candidate gene selection was based on two mechanistic pathways targeted by pharmacotherapy for BPH: (1) androgen metabolic loci contributing to prostate growth (static obstruction); and (2) factors affecting smooth muscle tone (dynamic obstruction). Polymorphisms in SRD5A2 were not associated with severity of BPH; however, SRD5A1 polymorphisms were associated with severity of BPH. The process(es) in which these silent single-nucleotide polymorphisms (SNPs) influence BPH phenotypes is unknown and additional studies will be needed to assess whether these SNPs have direct functional consequences. The characterization of additional molecular factors that contribute to static and dynamic obstruction may help predict response to pharmacotherapy and serve to identify novel drug targets for the clinical management of BPH.

  3. TAXONOMY AND BIOSTRATIGRAPHIC RECORD OF THE UPPER TRIASSIC CONODONTS OF THE PIZZO MONDELLO SECTION (WESTERN SICILY, ITALY, GSSP CANDIDATE FOR THE BASE OF THE NORIAN

    Directory of Open Access Journals (Sweden)

    MICHELE MAZZA

    2012-03-01

    Full Text Available New taxonomic and biostratigraphic investigations on the late Carnian to Rhaetian (Upper Triassic platform conodonts from the Pizzo Mondello section (Western Sicily, Italy, Sicano basin are here presented. Pizzo Mondello is one of the two GSSP candidates for the Carnian/Norian boundary; the section is a 430 m thick continuous succession of upper Carnian to upper Norian marine limestones (Scillato Formation, characterized by uniform facies and high sedimentation rates, and ca. 20 m of Rhaetian white calcilutites (Portella Gebbia limestone. Pizzo Mondello offers one of the most complete conodont records for this time interval in the Tethys. The conodont faunas are characterized by a large variety of species, belonging to the genera Carnepigondolella, Epigondolella, Metapolygnathus, Misikella, Mockina, Neocavitella, Norigondolella, Paragondolella, and Parvigondolella. The richness of the populations allowed a detailed revision and description of all the Upper Triassic species and morphotypes recovered. The revision of the problematic species Carnepigondolella nodosa and "Metapolygnathus communisti B" was thus possible, leading to the establishment of two new species: Carnepigondolella tuvalica n.sp. and Carnepigondolella gulloae n.sp. The latter species would be a good proxy for the Carnian/Norian boundary in the case that the FAD of Halobia austriaca (sample FNP135a will be selected as the primary biomarker for the base of the Norian. 

  4. ZDHHC8 as a candidate gene for schizophrenia: Analysis of a putative functional intronic marker in case-control and family-based association studies

    Directory of Open Access Journals (Sweden)

    Jabs Burkhard

    2005-10-01

    Full Text Available Abstract Background The chromosome 22q11 region is proposed as a major candidate locus for susceptibility genes to schizophrenia. Recently, the gene ZDHHC8 encoding a putative palmitoyltransferase at 22q11 was proposed to increase liability to schizophrenia based on both animal models and human association studies by significant over-transmission of allele rs175174A in female, but not male subjects with schizophrenia. Methods Given the genetic complexity of schizophrenia and the potential genetic heterogeneity in different populations, we examined rs175174 in 204 German proband-parent triads and in an independent case-control study (schizophrenic cases: n = 433; controls: n = 186. Results In the triads heterozygous parents transmitted allele G preferentially to females, and allele A to males (heterogeneity χ2 = 4.43; p = 0.035. The case-control sample provided no further evidence for overall or gender-specific effects regarding allele and genotype frequency distributions. Conclusion The findings on rs175174 at ZDHHC8 are still far from being conclusive, but evidence for sexual dimorphism is moderate, and our data do not support a significant genetic contribution of rs175174 to the aetiopathogenesis of schizophrenia.

  5. Protection against multiple influenza A virus strains induced by candidate recombinant vaccine based on heterologous M2e peptides linked to flagellin.

    Directory of Open Access Journals (Sweden)

    Liudmila A Stepanova

    Full Text Available Matrix 2 protein ectodomain (M2e is considered a promising candidate for a broadly protective influenza vaccine. M2e-based vaccines against human influenza A provide only partial protection against avian influenza viruses because of differences in the M2e sequences. In this work, we evaluated the possibility of obtaining equal protection and immune response by using recombinant protein on the basis of flagellin as a carrier of the M2e peptides of human and avian influenza A viruses. Recombinant protein was generated by the fusion of two tandem copies of consensus M2e sequence from human influenza A and two copies of M2e from avian A/H5N1 viruses to flagellin (Flg-2M2eh2M2ek. Intranasal immunisation of Balb/c mice with recombinant protein significantly elicited anti-M2e IgG in serum, IgG and sIgA in BAL. Antibodies induced by the fusion protein Flg-2M2eh2M2ek bound efficiently to synthetic peptides corresponding to the human consensus M2e sequence as well as to the M2e sequence of A/Chicken/Kurgan/05/05 RG (H5N1 and recognised native M2e epitopes exposed on the surface of the MDCK cells infected with A/PR/8/34 (H1N1 and A/Chicken/Kurgan/05/05 RG (H5N1 to an equal degree. Immunisation led to both anti-M2e IgG1 and IgG2a response with IgG1 prevalence. We observed a significant intracellular production of IL-4, but not IFN-γ, by CD4+ T-cells in spleen of mice following immunisation with Flg-2M2eh2M2ek. Immunisation with the Flg-2M2eh2M2ek fusion protein provided similar protection from lethal challenge with human influenza A viruses (H1N1, H3N2 and avian influenza virus (H5N1. Immunised mice experienced significantly less weight loss and decreased lung viral titres compared to control mice. The data obtained show the potential for the development of an M2e-flagellin candidate influenza vaccine with broad spectrum protection against influenza A viruses of various origins.

  6. Primary and Presidential Candidates

    DEFF Research Database (Denmark)

    Goddard, Joseph

    2012-01-01

    This article looks at primary and presidential candidates in 2008 and 2012. Evidence suggests that voters are less influenced by candidates’ color, gender, or religious observation than previously. Conversely, markers of difference remain salient in the imaginations of pollsters and journalists...

  7. Genetic dissection of drought and heat tolerance in chickpea through genome-wide and candidate gene-based association mapping approaches.

    Directory of Open Access Journals (Sweden)

    Mahendar Thudi

    Full Text Available To understand the genetic basis of tolerance to drought and heat stresses in chickpea, a comprehensive association mapping approach has been undertaken. Phenotypic data were generated on the reference set (300 accessions, including 211 mini-core collection accessions for drought tolerance related root traits, heat tolerance, yield and yield component traits from 1-7 seasons and 1-3 locations in India (Patancheru, Kanpur, Bangalore and three locations in Africa (Nairobi, Egerton in Kenya and Debre Zeit in Ethiopia. Diversity Array Technology (DArT markers equally distributed across chickpea genome were used to determine population structure and three sub-populations were identified using admixture model in STRUCTURE. The pairwise linkage disequilibrium (LD estimated using the squared-allele frequency correlations (r2; when r2<0.20 was found to decay rapidly with the genetic distance of 5 cM. For establishing marker-trait associations (MTAs, both genome-wide and candidate gene-sequencing based association mapping approaches were conducted using 1,872 markers (1,072 DArTs, 651 single nucleotide polymorphisms [SNPs], 113 gene-based SNPs and 36 simple sequence repeats [SSRs] and phenotyping data mentioned above employing mixed linear model (MLM analysis with optimum compression with P3D method and kinship matrix. As a result, 312 significant MTAs were identified and a maximum number of MTAs (70 was identified for 100-seed weight. A total of 18 SNPs from 5 genes (ERECTA, 11 SNPs; ASR, 4 SNPs; DREB, 1 SNP; CAP2 promoter, 1 SNP and AMDH, 1SNP were significantly associated with different traits. This study provides significant MTAs for drought and heat tolerance in chickpea that can be used, after validation, in molecular breeding for developing superior varieties with enhanced drought and heat tolerance.

  8. Planetary Candidates Observed by Kepler. VII. The First Fully Uniform Catalog Based on the Entire 48-month Data Set (Q1-Q17 DR24)

    Science.gov (United States)

    Coughlin, Jeffrey L.; Mullally, F.; Thompson, Susan E.; Rowe, Jason F.; Burke, Christopher J.; Latham, David W.; Batalha, Natalie M.; Ofir, Aviv; Quarles, Billy L.; Henze, Christopher E.; Wolfgang, Angie; Caldwell, Douglas A.; Bryson, Stephen T.; Shporer, Avi; Catanzarite, Joseph; Akeson, Rachel; Barclay, Thomas; Borucki, William J.; Boyajian, Tabetha S.; Campbell, Jennifer R.; Christiansen, Jessie L.; Girouard, Forrest R.; Haas, Michael R.; Howell, Steve B.; Huber, Daniel; Jenkins, Jon M.; Li, Jie; Patil-Sabale, Anima; Quintana, Elisa V.; Ramirez, Solange; Seader, Shawn; Smith, Jeffrey C.; Tenenbaum, Peter; Twicken, Joseph D.; Zamudio, Khadeejah A.

    2016-05-01

    We present the seventh Kepler planet candidate (PC) catalog, which is the first catalog to be based on the entire, uniformly processed 48-month Kepler data set. This is the first fully automated catalog, employing robotic vetting procedures to uniformly evaluate every periodic signal detected by the Q1-Q17 Data Release 24 (DR24) Kepler pipeline. While we prioritize uniform vetting over the absolute correctness of individual objects, we find that our robotic vetting is overall comparable to, and in most cases superior to, the human vetting procedures employed by past catalogs. This catalog is the first to utilize artificial transit injection to evaluate the performance of our vetting procedures and to quantify potential biases, which are essential for accurate computation of planetary occurrence rates. With respect to the cumulative Kepler Object of Interest (KOI) catalog, we designate 1478 new KOIs, of which 402 are dispositioned as PCs. Also, 237 KOIs dispositioned as false positives (FPs) in previous Kepler catalogs have their disposition changed to PC and 118 PCs have their disposition changed to FPs. This brings the total number of known KOIs to 8826 and PCs to 4696. We compare the Q1-Q17 DR24 KOI catalog to previous KOI catalogs, as well as ancillary Kepler catalogs, finding good agreement between them. We highlight new PCs that are both potentially rocky and potentially in the habitable zone of their host stars, many of which orbit solar-type stars. This work represents significant progress in accurately determining the fraction of Earth-size planets in the habitable zone of Sun-like stars. The full catalog is publicly available at the NASA Exoplanet Archive.

  9. Evaluation and Selection of Bacillus Species Based on Enzyme Production, Antimicrobial Activity, and Biofilm Synthesis as Direct-Fed Microbial Candidates for Poultry

    Science.gov (United States)

    Latorre, Juan D.; Hernandez-Velasco, Xochitl; Wolfenden, Ross E.; Vicente, Jose L.; Wolfenden, Amanda D.; Menconi, Anita; Bielke, Lisa R.; Hargis, Billy M.; Tellez, Guillermo

    2016-01-01

    Social concern about misuse of antibiotics as growth promoters (AGP) and generation of multidrug-resistant bacteria have restricted the dietary inclusion of antibiotics in livestock feed in several countries. Direct-fed microbials (DFM) are one of the multiple alternatives commonly evaluated as substitutes of AGP. Sporeformer bacteria from the genus Bacillus have been extensively investigated because of their extraordinary properties to form highly resistant endospores, produce antimicrobial compounds, and synthesize different exogenous enzymes. The purpose of the present study was to evaluate and select Bacillus spp. from environmental and poultry sources as DFM candidates, considering their enzyme production profile, biofilm synthesis capacity, and pathogen-inhibition activity. Thirty-one Bacillus isolates were screened for in vitro relative enzyme activity of amylase, protease, lipase, and phytase using a selective media for each enzyme, with 3/31 strains selected as superior enzyme producers. These three isolates were identified as Bacillus subtilis (1/3), and Bacillus amyloliquefaciens (2/3), based on biochemical tests and 16S rRNA sequence analysis. For evaluation of biofilm synthesis, the generation of an adherent crystal violet-stained ring was determined in polypropylene tubes, resulting in 11/31 strains showing a strong biofilm formation. Moreover, all Bacillus strains were evaluated for growth inhibition activity against Salmonella enterica serovar Enteritidis (26/31), Escherichia coli (28/31), and Clostridioides difficile (29/31). Additionally, in previous in vitro and in vivo studies, these selected Bacillus strains have shown to be resistant to different biochemical conditions of the gastrointestinal tract of poultry. Results of the present study suggest that the selection and consumption of Bacillus-DFM, producing a variable set of enzymes and antimicrobial compounds, may contribute to enhanced performance through improving nutrient digestibility

  10. Identification of candidate agents active against N. ceranae infection in honey bees: establishment of a medium throughput screening assay based on N. ceranae infected cultured cells.

    Science.gov (United States)

    Gisder, Sebastian; Genersch, Elke

    2015-01-01

    Many flowering plants in both natural ecosytems and agriculture are dependent on insect pollination for fruit set and seed production. Managed honey bees (Apis mellifera) and wild bees are key pollinators providing this indispensable eco- and agrosystem service. Like all other organisms, bees are attacked by numerous pathogens and parasites. Nosema apis is a honey bee pathogenic microsporidium which is widely distributed in honey bee populations without causing much harm. Its congener Nosema ceranae was originally described as pathogen of the Eastern honey bee (Apis cerana) but jumped host from A. cerana to A. mellifera about 20 years ago and spilled over from A. mellifera to Bombus spp. quite recently. N. ceranae is now considered a deadly emerging parasite of both Western honey bees and bumblebees. Hence, novel and sustainable treatment strategies against N. ceranae are urgently needed to protect honey and wild bees. We here present the development of an in vitro medium throughput screening assay for the identification of candidate agents active against N. ceranae infections. This novel assay is based on our recently developed cell culture model for N. ceranae and coupled with an RT-PCR-ELISA protocol for quantification of N. ceranae in infected cells. The assay has been adapted to the 96-well microplate format to allow automated analysis. Several substances with known (fumagillin) or presumed (surfactin) or no (paromomycin) activity against N. ceranae were tested as well as substances for which no data concerning N. ceranae inhibition existed. While fumagillin and two nitroimidazoles (metronidazole, tinidazole) totally inhibited N. ceranae proliferation, all other test substances were inactive. In summary, the assay proved suitable for substance screening and demonstrated the activity of two synthetic antibiotics against N. ceranae.

  11. Phase 1 safety and immunogenicity evaluation of ADVAX, a multigenic, DNA-based clade C/B' HIV-1 candidate vaccine.

    Directory of Open Access Journals (Sweden)

    Sandhya Vasan

    Full Text Available BACKGROUND: We conducted a Phase I dose escalation trial of ADVAX, a DNA-based candidate HIV-1 vaccine expressing Clade C/B' env, gag, pol, nef, and tat genes. Sequences were derived from a prevalent circulating recombinant form in Yunnan, China, an area of high HIV-1 incidence. The objective was to evaluate the safety and immunogenicity of ADVAX in human volunteers. METHODOLOGY/PRINCIPAL FINDINGS: ADVAX or placebo was administered intramuscularly at months 0, 1 and 3 to 45 healthy volunteers not at high risk for HIV-1. Three dosage levels [0.2 mg (low, 1.0 mg (mid, and 4.0 mg (high] were tested. Twelve volunteers in each dosage group were assigned to receive ADVAX and three to receive placebo in a double-blind design. Subjects were followed for local and systemic reactogenicity, adverse events, and clinical laboratory parameters. Study follow up was 18 months. Humoral immunogenicity was evaluated by anti-gp120 binding ELISA. Cellular immunogenicity was assessed by a validated IFNgamma ELISpot assay and intracellular cytokine staining. ADVAX was safe and well-tolerated, with no vaccine-related serious adverse events. Local and systemic reactogenicity events were reported by 64% and 42% of vaccine recipients, respectively. The majority of events were mild. The IFNgamma ELISpot response rates to any HIV antigen were 0/9 (0% in the placebo group, 3/12 (25% in the low-dosage group, 4/12 (33% in the mid-dosage group, and 2/12 (17% in the high-dosage group. Overall, responses were generally transient and occurred to each gene product, although volunteers responded to single antigens only. Binding antibodies to gp120 were not detected in any volunteers, and HIV seroconversion did not occur. CONCLUSIONS/SIGNIFICANCE: ADVAX delivered intramuscularly is safe, well-tolerated, and elicits modest but transient cellular immune responses. TRIAL REGISTRATION: Clinicaltrials.gov NCT00249106.

  12. Evaluation and selection of Bacillus species based on enzyme production, antimicrobial activity and biofilm synthesis as direct-fed microbials candidates for poultry

    Directory of Open Access Journals (Sweden)

    Juan D Latorre

    2016-10-01

    Full Text Available Social concern about misuse of antibiotics as growth promoters (AGP and generation of multidrug-resistant bacteria have restricted the dietary inclusion of antibiotics in livestock feed in several countries. Direct-fed microbials (DFM are one of the multiple alternatives commonly evaluated as substitutes of AGP. Sporeformer bacteria from the genus Bacillus have been extensively investigated because of their extraordinary properties to form highly-resistant endospores, production of antimicrobial compounds and synthesize different exogenous enzymes. The purpose of the present study was to evaluate and select Bacillus spp. from environmental and poultry sources as DFM candidates, considering their enzyme production profile, biofilm synthesis capacity and pathogen-inhibition activity. Thirty one Bacillus isolates were screened for in vitro relative enzyme activity of amylase, protease, lipase and phytase using a selective media for each enzyme, with 3/31 strains selected as superior enzyme producers. These three isolates were identified as B. subtilis (1/3, and B. amyloliquefaciens (2/3 based on biochemical tests and 16S rRNA sequence analysis. For evaluation of biofilm synthesis, the generation of an adherent crystal violet-stained ring was determined in polypropylene tubes, resulting in 11/31 strains showing a strong biofilm formation. Moreover, all Bacillus strains were evaluated for growth inhibition activity against Salmonella enterica serovar Enteritidis (26/31, Escherichia coli (28/31 and Clostridioides difficile (29/31. Additionally, in previous in vitro and in vivo studies, these selected Bacillus strains have shown to be resistant to different biochemical conditions of the gastrointestinal tract of poultry. Results of the present study suggest that the selection and consumption of Bacillus-DFM, producing a variable set of enzymes and antimicrobial compounds may contribute to enhanced performance through improving nutrient digestibility

  13. Oral Candidal Colonization in the Patients with RPDs by Different Base Materials%RPDs基托材料对口腔念珠菌定植的影响

    Institute of Scientific and Technical Information of China (English)

    姜薇; 陈骏; 吴凌莉; 何祥一; 车团结

    2011-01-01

    目的:初步研究可摘局部义齿(RPDs)不同基托材料对口腔念珠菌的定植的影响.方法:临床随机选择RPDs修复患者147例.其中树脂基托义齿(A组)58例,钴铬合金铸造基托义齿(B组)63例,纯钛及钛合金铸造基托义齿(C组)26例.吐唾法取样,用CHROMagar培养基鉴定念珠菌菌种.培养基中念珠菌菌落计数为每个样本的念珠菌检出强度.通过统计学方法,比较3组不同基托材料义齿戴用人群念珠菌检出率和检出强度的差异.结果:147例不同基托材料义齿戴用人群中检出的念珠菌包括白色念珠菌、热带念珠菌、克柔念珠菌3个菌种.A、B、C组白色念珠菌和非白色念珠菌检出率无显著差异.白色念珠菌的菌落形成单位数,A组显著高于B、C组(P<0.05);B组显著高于C组(P<0.05).非白色念珠菌间的菌落形成单位数无明显差异.结论:戴不同材料义齿患者口腔除了能检出白色念珠菌,还可检出非白色念珠菌;口腔念珠菌的菌落形成单位数与义齿基托材料密切相关,钛及钛合金基托义齿应为预防义齿性口炎的首选义齿.%Objective: To study of the oral Candidal colonization status with different base-materials denture. Methods: 147 cases who wear RPDs were divided into three groups: group A (resin base denture), group B (Co- Cr alloy base denture) . And group C (Titanium and Titanium alloy base denture). Non- stimulated saliva were collected by standard procedure as before. Salivary samples were inoculated on CHROMagar Candida? To identify Candida strains. The total number of colonies was considered as the detectable intensity of oral Candida. Statistical analysis was used to compare the differences of detection rate and detection intensity between three denture materials. Results; Candida was isolated from 147 cases who wear different base materials denture, such as Candida albi-cans. Candida tropical, Candida krusei. The frequency of Candida

  14. Pilot Candidate Selection

    Science.gov (United States)

    1989-05-01

    pilot selection system and to best support up-front track selection for SUPT? Assumptions The USAF Trainer Masterplan does not include a plan to...replace the T-41 with a new flight screening aircraft. In addition, the Masterplan states that candidates will be track selected prior to entry into primary...training. (3:10) While the Masterplan is not a static document and aircraft procurement plans and/or the timing of track selection are subject to

  15. Do People 'Like' Candidates on Facebook?

    DEFF Research Database (Denmark)

    Nielsen, Rasmus Kleis

    The online popularity of a few exceptional candidates has led many to suggest that social media have given politicians powerful ways of communicating directly with voters. In this paper, we examine whether this is happening on a significant scale and show, based on analysis of 224 candidates....... We therefore suggest that the political implications of social media are generally better understood in terms of facilitating indirect communication and institutional change than in terms of direct communication....

  16. Congenital diaphragmatic hernia and chromosome 15q26: determination of a candidate region by use of fluorescent in situ hybridization and array-based comparative genomic hybridization

    NARCIS (Netherlands)

    M. Klaassens (Merel); C. Wouters (Cokkie); M.F. van Dooren (Marieke); H.J.F.M.M. Eussen (Bert); H. Douben (Hannie); J.E.M.M. de Klein (Annelies); A.T. den Dekker (Alexander); C. Lee; P.K. Donahoe; D. Tibboel (Dick); R-J.H. Galjaard (Robert-Jan); N.N.T. Goemaere (Natascha); B.A. Oostra (Ben); R.R. de Krijger (Ronald); J. Wauters (Jan)

    2005-01-01

    textabstractCongenital diaphragmatic hernia (CDH) has an incidence of 1 in 3,000 births and a high mortality rate (33%-58%). Multifactorial inheritance, teratogenic agents, and genetic abnormalities have all been suggested as possible etiologic factors. To define candidate regions

  17. Immunogenicity of a virosomally-formulated Plasmodium falciparum GLURP-MSP3 chimeric protein-based malaria vaccine candidate in comparison to adjuvanted formulations

    DEFF Research Database (Denmark)

    Tamborrini, Marco; Stoffel, Sabine A; Westerfeld, Nicole;

    2011-01-01

    In clinical trials, immunopotentiating reconstituted influenza virosomes (IRIVs) have shown great potential as a versatile antigen delivery platform for synthetic peptides derived from Plasmodium falciparum antigens. This study describes the immunogenicity of a virosomally-formulated recombinant...... fusion protein comprising domains of the two malaria vaccine candidate antigens MSP3 and GLURP....

  18. The Relating Level of Teacher Candidates Based on Scientific Information with Their Daily Lives: A Case of Ataturk and Caucasian Universities

    Science.gov (United States)

    Kurt, Murat

    2014-01-01

    The aim of this research is to determine and compare candidate teachers' level of relating scientific information with their daily lives. The teachers were studying in the 1st and 4th classes in Atatürk and Caucasian Universities, Education Faculty, Elementary School Science Teaching Department during the 2012-2013 academic year. The research…

  19. RNA-Seq Based Identification of Candidate Parasitism Genes of Cereal Cyst Nematode (Heterodera avenae during Incompatible Infection to Aegilops variabilis.

    Directory of Open Access Journals (Sweden)

    Minghui Zheng

    targets with potential lethality were screened out and primarily validated, which provide candidates for engineering-based control of cereal cyst nematode in crops breeding.

  20. Prospects for high-z cluster detections with Planck, based on a follow-up of 28 candidates using MegaCam@CFHT

    CERN Document Server

    van der Burg, R F J; Pratt, G W; Arnaud, M; Melin, J -B; Aghanim, N; Barrena, R; Dahle, H; Douspis, M; Ferragamo, A; Fromenteau, S; Herbonnet, R; Hurier, G; Pointecouteau, E; Rubino-Martin, J A; Streblyanska, A

    2015-01-01

    The Planck catalogue of SZ sources limits itself to a significance threshold of 4.5 to ensure a low contamination rate by false cluster candidates. This means that only the most massive clusters at redshift z>0.5, and in particular z>0.7, are expected to enter into the catalogue, with a large number of systems in that redshift regime being expected around and just below that threshold. In this paper, we follow-up a sample of SZ sources from the Planck SZ catalogues from 2013 and 2015. In the latter maps, we consider detections around and at lower significance than the threshold adopted by the Planck Collaboration. To keep the contamination rate low, our 28 candidates are chosen to have significant WISE detections, in combination with non-detections in SDSS/DSS, which effectively selects galaxy cluster candidates at redshifts $z\\gtrsim0.5$. By taking r- and z-band imaging with MegaCam@CFHT, we bridge the 4000A rest-frame break over a significant redshift range, thus allowing accurate redshift estimates of red-...

  1. Association study of 167 candidate genes for schizophrenia selected by a multi-domain evidence-based prioritization algorithm and neurodevelopmental hypothesis.

    Science.gov (United States)

    Zhao, Zhongming; Webb, Bradley T; Jia, Peilin; Bigdeli, T Bernard; Maher, Brion S; van den Oord, Edwin; Bergen, Sarah E; Amdur, Richard L; O'Neill, Francis A; Walsh, Dermot; Thiselton, Dawn L; Chen, Xiangning; Pato, Carlos N; Riley, Brien P; Kendler, Kenneth S; Fanous, Ayman H

    2013-01-01

    Integrating evidence from multiple domains is useful in prioritizing disease candidate genes for subsequent testing. We ranked all known human genes (n=3819) under linkage peaks in the Irish Study of High-Density Schizophrenia Families using three different evidence domains: 1) a meta-analysis of microarray gene expression results using the Stanley Brain collection, 2) a schizophrenia protein-protein interaction network, and 3) a systematic literature search. Each gene was assigned a domain-specific p-value and ranked after evaluating the evidence within each domain. For comparison to this ranking process, a large-scale candidate gene hypothesis was also tested by including genes with Gene Ontology terms related to neurodevelopment. Subsequently, genotypes of 3725 SNPs in 167 genes from a custom Illumina iSelect array were used to evaluate the top ranked vs. hypothesis selected genes. Seventy-three genes were both highly ranked and involved in neurodevelopment (category 1) while 42 and 52 genes were exclusive to neurodevelopment (category 2) or highly ranked (category 3), respectively. The most significant associations were observed in genes PRKG1, PRKCE, and CNTN4 but no individual SNPs were significant after correction for multiple testing. Comparison of the approaches showed an excess of significant tests using the hypothesis-driven neurodevelopment category. Random selection of similar sized genes from two independent genome-wide association studies (GWAS) of schizophrenia showed the excess was unlikely by chance. In a further meta-analysis of three GWAS datasets, four candidate SNPs reached nominal significance. Although gene ranking using integrated sources of prior information did not enrich for significant results in the current experiment, gene selection using an a priori hypothesis (neurodevelopment) was superior to random selection. As such, further development of gene ranking strategies using more carefully selected sources of information is warranted.

  2. Immunogenicity of a virosomally-formulated Plasmodium falciparum GLURP-MSP3 chimeric protein-based malaria vaccine candidate in comparison to adjuvanted formulations

    Directory of Open Access Journals (Sweden)

    Tamborrini Marco

    2011-12-01

    Full Text Available Abstract Background In clinical trials, immunopotentiating reconstituted influenza virosomes (IRIVs have shown great potential as a versatile antigen delivery platform for synthetic peptides derived from Plasmodium falciparum antigens. This study describes the immunogenicity of a virosomally-formulated recombinant fusion protein comprising domains of the two malaria vaccine candidate antigens MSP3 and GLURP. Methods The highly purified recombinant protein GMZ2 was coupled to phosphatidylethanolamine and the conjugates incorporated into the membrane of IRIVs. The immunogenicity of this adjuvant-free virosomal formulation was compared to GMZ2 formulated with the adjuvants Montanide ISA 720 and Alum in three mouse strains with different genetic backgrounds. Results Intramuscular injections of all three candidate vaccine formulations induced GMZ2-specific antibody responses in all mice tested. In general, the humoral immune response in outbred NMRI mice was stronger than that in inbred BALB/c and C57BL/6 mice. ELISA with the recombinant antigens demonstrated immunodominance of the GLURP component over the MSP3 component. However, compared to the Al(OH3-adjuvanted formulation the two other formulations elicited in NMRI mice a larger proportion of anti-MSP3 antibodies. Analyses of the induced GMZ2-specific IgG subclass profiles showed for all three formulations a predominance of the IgG1 isotype. Immune sera against all three formulations exhibited cross-reactivity with in vitro cultivated blood-stage parasites. Immunofluorescence and immunoblot competition experiments showed that both components of the hybrid protein induced IgG cross-reactive with the corresponding native proteins. Conclusion A virosomal formulation of the chimeric protein GMZ2 induced P. falciparum blood stage parasite cross-reactive IgG responses specific for both MSP3 and GLURP. GMZ2 thus represents a candidate component suitable for inclusion into a multi-valent virosomal

  3. Identification and Comparison of Candidate Olfactory Genes in the Olfactory and Non-Olfactory Organs of Elm Pest Ambrostoma quadriimpressum (Coleoptera: Chrysomelidae Based on Transcriptome Analysis.

    Directory of Open Access Journals (Sweden)

    Yinliang Wang

    Full Text Available The leaf beetle Ambrostoma quadriimpressum (Coleoptera: Chrysomelidae is a predominant forest pest that causes substantial damage to the lumber industry and city management. However, no effective and environmentally friendly chemical method has been discovered to control this pest. Until recently, the molecular basis of the olfactory system in A. quadriimpressum was completely unknown. In this study, antennae and leg transcriptomes were analyzed and compared using deep sequencing data to identify the olfactory genes in A. quadriimpressum. Moreover, the expression profiles of both male and female candidate olfactory genes were analyzed and validated by bioinformatics, motif analysis, homology analysis, semi-quantitative RT-PCR and RT-qPCR experiments in antennal and non-olfactory organs to explore the candidate olfactory genes that might play key roles in the life cycle of A. quadriimpressum. As a result, approximately 102.9 million and 97.3 million clean reads were obtained from the libraries created from the antennas and legs, respectively. Annotation led to 34344 Unigenes, which were matched to known proteins. Annotation data revealed that the number of genes in antenna with binding functions and receptor activity was greater than that of legs. Furthermore, many pathway genes were differentially expressed in the two organs. Sixteen candidate odorant binding proteins (OBPs, 10 chemosensory proteins (CSPs, 34 odorant receptors (ORs, 20 inotropic receptors [1] and 2 sensory neuron membrane proteins (SNMPs and their isoforms were identified. Additionally, 15 OBPs, 9 CSPs, 18 ORs, 6 IRs and 2 SNMPs were predicted to be complete ORFs. Using RT-PCR, RT-qPCR and homology analysis, AquaOBP1/2/4/7/C1/C6, AquaCSP3/9, AquaOR8/9/10/14/15/18/20/26/29/33, AquaIR8a/13/25a showed olfactory-specific expression, indicating that these genes might play a key role in olfaction-related behaviors in A. quadriimpressum such as foraging and seeking. AquaOBP4/C5, Aqua

  4. Identification and Comparison of Candidate Olfactory Genes in the Olfactory and Non-Olfactory Organs of Elm Pest Ambrostoma quadriimpressum (Coleoptera: Chrysomelidae) Based on Transcriptome Analysis.

    Science.gov (United States)

    Wang, Yinliang; Chen, Qi; Zhao, Hanbo; Ren, Bingzhong

    2016-01-01

    The leaf beetle Ambrostoma quadriimpressum (Coleoptera: Chrysomelidae) is a predominant forest pest that causes substantial damage to the lumber industry and city management. However, no effective and environmentally friendly chemical method has been discovered to control this pest. Until recently, the molecular basis of the olfactory system in A. quadriimpressum was completely unknown. In this study, antennae and leg transcriptomes were analyzed and compared using deep sequencing data to identify the olfactory genes in A. quadriimpressum. Moreover, the expression profiles of both male and female candidate olfactory genes were analyzed and validated by bioinformatics, motif analysis, homology analysis, semi-quantitative RT-PCR and RT-qPCR experiments in antennal and non-olfactory organs to explore the candidate olfactory genes that might play key roles in the life cycle of A. quadriimpressum. As a result, approximately 102.9 million and 97.3 million clean reads were obtained from the libraries created from the antennas and legs, respectively. Annotation led to 34344 Unigenes, which were matched to known proteins. Annotation data revealed that the number of genes in antenna with binding functions and receptor activity was greater than that of legs. Furthermore, many pathway genes were differentially expressed in the two organs. Sixteen candidate odorant binding proteins (OBPs), 10 chemosensory proteins (CSPs), 34 odorant receptors (ORs), 20 inotropic receptors [1] and 2 sensory neuron membrane proteins (SNMPs) and their isoforms were identified. Additionally, 15 OBPs, 9 CSPs, 18 ORs, 6 IRs and 2 SNMPs were predicted to be complete ORFs. Using RT-PCR, RT-qPCR and homology analysis, AquaOBP1/2/4/7/C1/C6, AquaCSP3/9, AquaOR8/9/10/14/15/18/20/26/29/33, AquaIR8a/13/25a showed olfactory-specific expression, indicating that these genes might play a key role in olfaction-related behaviors in A. quadriimpressum such as foraging and seeking. AquaOBP4/C5, AquaOBP4/C5, AquaCSP7

  5. Hypervelocity Star Candidates in the SEGUE G & K Dwarf Sample

    CERN Document Server

    Palladino, Lauren E; Holley-Bockelmann, Kelly; Prieto, Carlos Allende; Beers, Timothy C; Lee, Young Sun; Schneider, Donald P

    2013-01-01

    We identify 13 candidate hypervelocity stars from the Sloan Extension for Galactic Understanding and Exploration (SEGUE) G and K dwarf samples. Previous searches for hypervelocity stars have only focused on large radial velocities; in this study we also use proper motions to select the candidates. We determine the hypervelocity likelihood of each candidate, considering the significant errors often associated with high proper motion stars via Monte Carlo simulations. We find that more than half of the candidates exceed their escape velocities with at least 90% probability. All of our candidates also have less than a 60% chance of being a high velocity fluke within the SEGUE sample. Based on orbits calculated using the observed 6-d positions and velocities, few, if any, of these candidates originate from the Galactic Center. If these candidates are truly hypervelocity stars, they were not ejected by interactions with the Milky Way's supermassive black hole. This calls for a more serious examination of alternati...

  6. A novel dengue virus serotype 1 vaccine candidate based on Japanese encephalitis virus vaccine strain SA14-14-2 as the backbone.

    Science.gov (United States)

    Yang, Huiqiang; Li, Zhushi; Lin, Hua; Wang, Wei; Yang, Jian; Liu, Lina; Zeng, Xianwu; Wu, Yonglin; Yu, Yongxin; Li, Yuhua

    2016-06-01

    To develop a potential dengue vaccine candidate, a full-length cDNA clone of a novel chimeric virus was constructed using recombinant DNA technology, with Japanese encephalitis virus (JEV) vaccine strain SA14-14-2 as the backbone, with its premembrane (prM) and envelope (E) genes substituted by their counterparts from dengue virus type 1 (DENV1). The chimeric virus (JEV/DENV1) was successfully recovered from primary hamster kidney (PHK) cells by transfection with the in vitro transcription products of JEV/DENV1 cDNA and was identified by complete genome sequencing and immunofluorescent staining. No neuroinvasiveness of this chimeric virus was observed in mice inoculated by the subcutaneous route (s.c.) or by the intraperitoneal route (i.p.), while some neurovirulence was displayed in mice that were inoculated directly by the intracerebral route (i.c.). The chimeric virus was able to stimulate high-titer production of antibodies against DENV1 and provided protection against lethal challenge with neuroadapted dengue virus in mice. These results suggest that the chimeric virus is a promising dengue vaccine candidate.

  7. Research on the Social-cost-based Model for Bid Evaluation of BOT Project Concession Candidates%考虑社会成本的BOT项目特许经营者评标模型研究

    Institute of Scientific and Technical Information of China (English)

    路浩; 何德文

    2014-01-01

    对于BOT项目委托方而言,项目的价值在于社会效益的实现程度而不仅仅是考虑项目的建设成本。提出了一套考虑社会成本的BOT项目特许经营者评标属性集,当特许经营者评标属性的权重已知,评标委员会对各属性的评价以及业主对特许经营者的偏好不确定的情况下,运用区间数和灰色关联分析来构建特许经营者评标模型,通过引入区间数距离,求得区间数的灰色关联度,最终对各候选特许经营者进行排序。由于该模型考虑了社会成本因素,对促使特许经营者更加合理地规划项目方案,减少社会成本的形成具有一定的作用。此外,引入区间数来处理社会成本等模糊评价信息,提高了评标结果的科学性。%For BOT project clients,the project value is to realize social benefit,rather than merely to consider the construction cost of the project. This paper presents a set of social-cost-based attributes for bid evaluation of BOT project concession candidates. The bid evaluation committee can develop a model for bid evaluation of concession candidates based on interval numbers and grey relational analysis,if they understand weighted attributes and face uncertainties concerning the attributes evaluation and the owner’s preference for concession candidates. The ranking of concession candidates can be done by obtaining grey correlation for interval numbers through the distance between interval numbers. This social-cost-based model is established to contribute to less social costs by forcing a concession candidate to work out a more reasonable operational scheme. Meanwhile,uncertain information for decision making is offset by interval numbers,yielding more practical evaluation results.

  8. Protective effects of a Modified Vaccinia Ankara-based vaccine candidate against Crimean-Congo Haemorrhagic Fever virus require both cellular and humoral responses.

    Directory of Open Access Journals (Sweden)

    Stuart D Dowall

    Full Text Available Crimean-Congo Haemorrhagic Fever (CCHF is a severe tick-borne disease, endemic in many countries in Africa, the Middle East, Eastern Europe and Asia. There is no approved vaccine currently available against CCHF. The most promising candidate, which has previously been shown to confer protection in the small animal model, is a modified Vaccinia Ankara virus vector expressing the CCHF viral glycoprotein (MVA-GP. It has been shown that MVA-GP induces both humoral and cellular immunogenicity. In the present study, sera and T-lymphocytes were passively and adoptively transferred into recipient mice prior to challenge with CCHF virus. Results demonstrated that mediators from both arms of the immune system were required to demonstrate protective effects against lethal challenge.

  9. Protective effects of a Modified Vaccinia Ankara-based vaccine candidate against Crimean-Congo Haemorrhagic Fever virus require both cellular and humoral responses.

    Science.gov (United States)

    Dowall, Stuart D; Graham, Victoria A; Rayner, Emma; Hunter, Laura; Watson, Robert; Taylor, Irene; Rule, Antony; Carroll, Miles W; Hewson, Roger

    2016-01-01

    Crimean-Congo Haemorrhagic Fever (CCHF) is a severe tick-borne disease, endemic in many countries in Africa, the Middle East, Eastern Europe and Asia. There is no approved vaccine currently available against CCHF. The most promising candidate, which has previously been shown to confer protection in the small animal model, is a modified Vaccinia Ankara virus vector expressing the CCHF viral glycoprotein (MVA-GP). It has been shown that MVA-GP induces both humoral and cellular immunogenicity. In the present study, sera and T-lymphocytes were passively and adoptively transferred into recipient mice prior to challenge with CCHF virus. Results demonstrated that mediators from both arms of the immune system were required to demonstrate protective effects against lethal challenge.

  10. Genetic variants determining survival and fertility in an adverse African environment: a population-based large-scale candidate gene association study.

    Science.gov (United States)

    Koopman, Jacob J E; Pijpe, Jeroen; Böhringer, Stefan; van Bodegom, David; Eriksson, Ulrika K; Sanchez-Faddeev, Hernando; Ziem, Juventus B; Zwaan, Bas; Slagboom, P Eline; de Knijff, Peter; Westendorp, Rudi G J

    2016-07-01

    Human survival probability and fertility decline strongly with age. These life history traits have been shaped by evolution. However, research has failed to uncover a consistent genetic determination of variation in survival and fertility. As an explanation, such genetic determinants have been selected in adverse environments, in which humans have lived during most of their history, but are almost exclusively studied in populations in modern affluent environments. Here, we present a large-scale candidate gene association study in a rural African population living in an adverse environment. In 4387 individuals, we studied 4052 SNPs in 148 genes that have previously been identified as possible determinants of survival or fertility in animals or humans. We studied their associations with survival comparing newborns, middle-age adults, and old individuals. In women, we assessed their associations with reported and observed numbers of children. We found no statistically significant associations of these SNPs with survival between the three age groups nor with women's reported and observed fertility. Population stratification was unlikely to explain these results. Apart from a lack of power, we hypothesise that genetic heterogeneity of complex phenotypes and gene-environment interactions prevent the identification of genetic variants explaining variation in survival and fertility in humans.

  11. The power of low-resolution spectroscopy: On the spectral classification of planet candidates in the ground-based CoRoT follow-up

    CERN Document Server

    Eiff, M Ammler-von; Guenther, E W; Stecklum, B; Cabrera, J

    2015-01-01

    Planetary transits detected by the CoRoT mission can be mimicked by a low-mass star in orbit around a giant star. Spectral classification helps to identify the giant stars and also early-type stars which are often excluded from further follow-up. We study the potential and the limitations of low-resolution spectroscopy to improve the photometric spectral types of CoRoT candidates. In particular, we want to study the influence of the signal-to-noise ratio (SNR) of the target spectrum in a quantitative way. We built an own template library and investigate whether a template library from the literature is able to reproduce the classifications. Including previous photometric estimates, we show how the additional spectroscopic information improves the constraints on spectral type. Low-resolution spectroscopy ($R\\approx$1000) of 42 CoRoT targets covering a wide range in SNR (1-437) and of 149 templates was obtained in 2012-2013 with the Nasmyth spectrograph at the Tautenburg 2m telescope. Spectral types have been d...

  12. Query by image example: The CANDID approach

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, P.M.; Cannon, M. [Los Alamos National Lab., NM (United States). Computer Research and Applications Group; Hush, D.R. [Univ. of New Mexico, Albuquerque, NM (United States). Dept. of Electrical and Computer Engineering

    1995-02-01

    CANDID (Comparison Algorithm for Navigating Digital Image Databases) was developed to enable content-based retrieval of digital imagery from large databases using a query-by-example methodology. A user provides an example image to the system, and images in the database that are similar to that example are retrieved. The development of CANDID was inspired by the N-gram approach to document fingerprinting, where a ``global signature`` is computed for every document in a database and these signatures are compared to one another to determine the similarity between any two documents. CANDID computes a global signature for every image in a database, where the signature is derived from various image features such as localized texture, shape, or color information. A distance between probability density functions of feature vectors is then used to compare signatures. In this paper, the authors present CANDID and highlight two results from their current research: subtracting a ``background`` signature from every signature in a database in an attempt to improve system performance when using inner-product similarity measures, and visualizing the contribution of individual pixels in the matching process. These ideas are applicable to any histogram-based comparison technique.

  13. Candidate gene-based association study of antipsychotic-induced movement disorders in long-stay psychiatric patients: a prospective study.

    Directory of Open Access Journals (Sweden)

    P Roberto Bakker

    Full Text Available OBJECTIVE: Four types of antipsychotic-induced movement disorders: tardive dyskinesia (TD, parkinsonism, akathisia and tardive dystonia, subtypes of TD (orofacial and limb truncal dyskinesia, subtypes of parkinsonism (rest tremor, rigidity, and bradykinesia, as well as a principal-factor of the movement disorders and their subtypes, were examined for association with variation in 10 candidate genes (PPP1R1B, BDNF, DRD3, DRD2, HTR2A, HTR2C, COMT, MnSOD, CYP1A2, and RGS2. METHODS: Naturalistic study of 168 white long-stay patients with chronic mental illness requiring long-term antipsychotic treatment, examined by the same rater at least two times over a 4-year period, with a mean follow-up time of 1.1 years, with validated scales for TD, parkinsonism, akathisia, and tardive dystonia. The authors genotyped 31 SNPs, associated with movement disorders or schizophrenia in previous studies. Genotype and allele frequency comparisons were performed with multiple regression methods for continuous movement disorders. RESULTS: VARIOUS SNPS REACHED NOMINAL SIGNIFICANCE: TD and orofacial dyskinesia with rs6265 and rs988748, limb truncal dyskinesia with rs6314, rest tremor with rs6275, rigidity with rs6265 and rs4680, bradykinesia with rs4795390, akathisia with rs4680, tardive dystonia with rs1799732, rs4880 and rs1152746. After controlling for multiple testing, no significant results remained. CONCLUSIONS: The findings suggest that selected SNPs are not associated with a susceptibility to movement disorders. However, as the sample size was small and previous studies show inconsistent results, definite conclusions cannot be made. Replication is needed in larger study samples, preferably in longitudinal studies which take the fluctuating course of movement disorders and gene-environment interactions into account.

  14. Preparing Preservice Teacher Candidates to Differentiate Instructional Practices

    Science.gov (United States)

    Ochoa, Bianca R.

    2013-01-01

    This action research study focused on how various grouping strategies influenced preservice teachers' differentiation of instruction. The participants included a third grade mentor teacher and three preservice teacher candidates. The candidate preparation curriculum consisted of seminars, daily field-based learning experiences, and ongoing…

  15. 基于多候选储位的存取路径优化问题研究%Optimization for Storage or Retrieval Routing Problem Based on Mutil-candidates Storages Location

    Institute of Scientific and Technical Information of China (English)

    胡少龙; 胡志华; 曹杨

    2013-01-01

    针对单储位储存方式可能导致仓库存取通道拥挤和作业效率低的情形,提出了一种基于多候选储位的存取路径优化方法。首先分配了货物的存取储位,然后建立了多候选储位的车辆路径问题( MLVRP)模型,并基于储位优先解码原则设计了遗传算法,最后通过算例证明该方法的有效性和算法的高效性。多候选储位的方法可以为取货任务至少节约18.4%(两个候选储位)和21.8%(三个候选储位)的路程,算法迭代10000次只需要434s。%With respect to the fact that every type of goods has only one storage location in warehouse will lead to crowded aisles and poor operational efficiency , this paper proposes an optimization approach for store and retriev-al routing problem when multi-candidate storages locations are assigned to each type of goods .First,the storage locations are allocated to goods .Then, a model is built for the vehicle routing problem with multi-candidate stor-age locations for each type of goods .A genetic algorithm based on priority-based decoding scheme is developed to solve the model .Finally , a case is given to illustrate the effectiveness of the proposed method and the efficiency of the algorithm.The solution that two-candidate and three candidate storage locations are allocated to each type of goods could at least save 18.4% and 21.8% distance for retrievals respectively .The algorithm iterated for 10000 times costs 434 seconds .

  16. Evaluation of a Bacillus direct-fed microbial candidate on digesta viscosity, bacterial translocation, microbiota composition and bone mineralisation in broiler chickens fed on a rye-based diet.

    Science.gov (United States)

    Latorre, J D; Hernandez-Velasco, X; Bielke, L R; Vicente, J L; Wolfenden, R; Menconi, A; Hargis, B M; Tellez, G

    2015-01-01

    1. The effects of the dietary inclusion of a Bacillus-based direct-fed microbial (DFM) candidate on digesta viscosity, bacterial translocation, microbiota composition and bone mineralisation were evaluated in broilers consuming rye-based diets. 2. In the present study, control mash rye-based diets (CON) or Bacillus-DFM supplemented diets (TRT) were administered ad libitum to male broilers in three independent experiments. 3. In Experiments 1 and 2 (n = 25/group), liver samples were taken to evaluate bacterial translocation, digesta samples were used for viscosity measurements and the intestinal microbial flora was evaluated from different intestinal sections to enumerate total recovered gram-negative bacteria (TGB), lactic acid bacteria (LAB) and anaerobic bacteria (TAB). Additionally, both tibias were removed for assessment of bone quality. 4. In Experiment 3, each experimental group had 8 replicates of 20 chickens (n = 160/group). Weekly, body weight (BW), feed intake (FI) and feed conversion ratio (FCR) were evaluated. At d 28-of-age, samples were taken to determine bacterial translocation, digesta viscosity and bone quality characteristics. 5. In all experiments, consumption of Bacillus-DFM reduced bacterial translocation to the liver and digesta viscosity. Additionally, DFM supplementation improved BW, bone quality measurements and FCR. Moreover, chickens fed on the Bacillus-DFM diet in Experiments 1 and 2 showed a significant reduction in the number of gram-negative and anaerobic bacteria in the duodenal content compared to control. 6. In summary, chickens fed on a rye-based diet without DFM inclusion showed an increase in bacterial translocation and digesta viscosity, accompanied by reduced performance and bone quality variables relative to the Bacillus-DFM candidate group. Hence, incorporation into the feed of a selected DFM ameliorated the adverse anti-nutritional effects related to utilisation of rye-based diets in broilers chickens.

  17. PEACE: Pulsar Evaluation Algorithm for Candidate Extraction -- A software package for post-analysis processing of pulsar survey candidates

    CERN Document Server

    Lee, K J; Jenet, F A; Martinez, J; Dartez, L P; Mata, A; Lunsford, G; Cohen, S; Biwer, C M; Rohr, M; Flanigan, J; Walker, A; Banaszak, S; Allen, B; Barr, E D; Bhat, N D R; Bogdanov, S; Brazier, A; Camilo, F; Champion, D J; Chatterjee, S; Cordes, J; Crawford, F; Deneva, J; Desvignes, G; Ferdman, R D; Freire, P; Hessels, J W T; Karuppusamy, R; Kaspi, V M; Knispel, B; Kramer, M; Lazarus, P; Lynch, R; Lyne, A; McLaughlin, M; Ransom, S; Scholz, P; Siemens, X; Spitler, L; Stairs, I; Tan, M; van Leeuwen, J; Zhu, W W

    2013-01-01

    Modern radio pulsar surveys produce a large volume of prospective candidates, the majority of which are polluted by human-created radio frequency interference or other forms of noise. Typically, large numbers of candidates need to be visually inspected in order to determine if they are real pulsars. This process can be labor intensive. In this paper, we introduce an algorithm called PEACE (Pulsar Evaluation Algorithm for Candidate Extraction) which improves the efficiency of identifying pulsar signals. The algorithm ranks the candidates based on a score function. Unlike popular machine-learning based algorithms, no prior training data sets are required. This algorithm has been applied to data from several large-scale radio pulsar surveys. Using the human-based ranking results generated by students in the Arecibo Remote Command enter programme, the statistical performance of PEACE was evaluated. It was found that PEACE ranked 68% of the student-identified pulsars within the top 0.17% of sorted candidates, 95% ...

  18. Pyrosequencing-based assessment of the bacteria diversity in surface and subsurface peat layers of a northern wetland, with focus on poorly studied phyla and candidate divisions.

    Directory of Open Access Journals (Sweden)

    Yulia M Serkebaeva

    Full Text Available Northern peatlands play a key role in the global carbon and water budget, but the bacterial diversity in these ecosystems remains poorly described. Here, we compared the bacterial community composition in the surface (0-5 cm depth and subsurface (45-50 cm peat layers of an acidic (pH 4.0 Sphagnum-dominated wetland, using pyrosequencing of 16S rRNA genes. The denoised sequences (37,229 reads, average length ∼430 bp were affiliated with 27 bacterial phyla and corresponded to 1,269 operational taxonomic units (OTUs determined at 97% sequence identity. Abundant OTUs were affiliated with the Acidobacteria (35.5±2.4% and 39.2±1.2% of all classified sequences in surface and subsurface peat, respectively, Alphaproteobacteria (15.9±1.7% and 25.8±1.4%, Actinobacteria (9.5±2.0% and 10.7±0.5%, Verrucomicrobia (8.5±1.4% and 0.6±0.2%, Planctomycetes (5.8±0.4% and 9.7±0.6%, Deltaproteobacteria (7.1±0.4% and 4.4%±0.3%, and Gammaproteobacteria (6.6±0.4% and 2.1±0.1%. The taxonomic patterns of the abundant OTUs were uniform across all the subsamples taken from each peat layer. In contrast, the taxonomic patterns of rare OTUs were different from those of the abundant OTUs and varied greatly among subsamples, in both surface and subsurface peat. In addition to the bacterial taxa listed above, rare OTUs represented the following groups: Armatimonadetes, Bacteroidetes, Chlamydia, Chloroflexi, Cyanobacteria, Elusimicrobia, Fibrobacteres, Firmicutes, Gemmatimonadetes, Spirochaetes, AD3, WS1, WS4, WS5, WYO, OD1, OP3, BRC1, TM6, TM7, WPS-2, and FCPU426. OTU richness was notably higher in the surface layer (882 OTUs than in the anoxic subsurface peat (483 OTUs, with only 96 OTUs common to both data sets. Most members of poorly studied phyla, such as the Acidobacteria, Verrucomicrobia, Planctomycetes and the candidate division TM6, showed a clear preference for growth in either oxic or anoxic conditions. Apparently, the bacterial communities in surface and

  19. Characterization of preclinical in vitro and in vivo ADME properties and prediction of human PK using a physiologically based pharmacokinetic model for YQA-14, a new dopamine D3 receptor antagonist candidate for treatment of drug addiction.

    Science.gov (United States)

    Liu, Fei; Zhuang, Xiaomei; Yang, Cuiping; Li, Zheng; Xiong, Shan; Zhang, Zhiwei; Li, Jin; Lu, Chuang; Zhang, Zhenqing

    2014-07-01

    YQA-14 is a novel and selective dopamine D3 receptor antagonist, with potential for the treatment of drug addiction. However, earlier compounds in its structural class tend to have poor oral bioavailability. The objectives of this study were to characterize the preclinical absorption, distribution, metabolism and excretion (ADME) properties and pharmacokinetics (PK) of YQA-14, then to simulate the clinical PK of YQA-14 using a physiologically based pharmacokinetics (PBPK) model to assess the likelihood of developing YQA-14 as a clinical candidate. For human PK prediction, PBPK models were first built in preclinical species, rats and dogs, for validation purposes. The model was then modified by input of human in vitro ADME data obtained from in vitro studies. The study data showed that YQA-14 is a basic lipophilic compound, with rapid absorption (Tmax ~ 1 h) in both rats and dogs. Liver microsomal clearances and in vivo clearances were moderate in rats and dogs consistent with the moderate bioavailability observed in both species. The PBPK models built for rats and dogs simulated the observed PK data well in both species. The PBPK model refined with human data predicted that YQA-14 would have a clearance of 8.0 ml/min/kg, a volume distribution of 1.7 l/kg and a bioavailability of 16.9%. These acceptable PK properties make YQA-14 an improved candidate for further research and development as a potential dopamine D3R antagonism for the treatment of drug addiction in the clinic.

  20. 76 FR 4896 - Call for Candidates

    Science.gov (United States)

    2011-01-27

    ... From the Federal Register Online via the Government Publishing Office FEDERAL ACCOUNTING STANDARDS ADVISORY BOARD Call for Candidates AGENCY: Federal Accounting Standards Advisory Board. ACTION: Notice... Federal Accounting Standards Advisory Board (FASAB) is currently seeking candidates (candidates must...

  1. 15 CFR 922.21 - Selection of active candidates.

    Science.gov (United States)

    2010-01-01

    ... from the SEL for Active Candidate consideration based on a preliminary assessment of the designation... environmental impact statement shall be published in the Federal Register and in newspapers in the area(s)...

  2. Multilocus Family-Based Association Analysis of Seven Candidate Polymorphisms with Essential Hypertension in an African-Derived Semi-Isolated Brazilian Population

    Science.gov (United States)

    Kimura, L.; Angeli, C. B.; Auricchio, M. T. B. M.; Fernandes, G. R.; Pereira, A. C.; Vicente, J. P.; Pereira, T. V.; Mingroni-Netto, R. C.

    2012-01-01

    Background. It has been widely suggested that analyses considering multilocus effects would be crucial to characterize the relationship between gene variability and essential hypertension (EH). Objective. To test for the presence of multilocus effects between/among seven polymorphisms (six genes) on blood pressure-related traits in African-derived semi-isolated Brazilian populations (quilombos). Methods. Analyses were carried out using a family-based design in a sample of 652 participants (97 families). Seven variants were investigated: ACE (rs1799752), AGT (rs669), ADD2 (rs3755351), NOS3 (rs1799983), GNB3 (rs5441 and rs5443), and GRK4 (rs1801058). Sensitivity analyses were further performed under a case-control design with unrelated participants only. Results. None of the investigated variants were associated individually with both systolic and diastolic BP levels (SBP and DBP, respectively) or EH (as a binary outcome). Multifactor dimensionality reduction-based techniques revealed a marginal association of the combined effect of both GNB3 variants on DBP levels in a family-based design (P = 0.040), whereas a putative NOS3-GRK4 interaction also in relation to DBP levels was observed in the case-control design only (P = 0.004). Conclusion. Our results provide limited support for the hypothesis of multilocus effects between/among the studied variants on blood pressure in quilombos. Further larger studies are needed to validate our findings. PMID:23056922

  3. Zero-point energy of vacuum fluctuation as a candidate for dark energy versus a new conjecture of antigravity based on the modified Einstein field equation in general relativity

    CERN Document Server

    Ni, G

    2005-01-01

    In order to clarify why the zero-point energy associated with the vacuum fluctuations cannot be a candidate for the dark energy in the universe, a comparison with the Casimir effect is analyzed in some detail. A principle of epistemology is stressed that it is meaningless to talk about an absolute (isolated) thing. A relative thing can only be observed when it is changing with respect to other things. Then a new conjecture of antigravity --the repulsive force between matter and antimatter derived from the modified Einstein field equation in general relativity-- is proposed. this is due to the particle-antiparticle symmetry based on a new understanding about the essence of special relativity. Its possible consequences in the theory of cosmology are discussed briefly, including a new explanation for the accelerating universe and gamma-ray-bursts.

  4. Candidate Species Selection: Cultural and Photosynthetic Aspects

    Science.gov (United States)

    Mitchell, C. A.

    1982-01-01

    Cultural information is provided for a data base that will be used to select candidate crop species for a controlled ecological life support system (CELSS). Lists of food crops which will satisfy most nutritional requirements of humans and also fit within the scope of cultural restrictions that logically would apply to a closed, regenerating system were generated. Cultural and environmental conditions that will allow the most rapid production of edible biomass from candidate species in the shortest possible time are identified. Cultivars which are most productive in terms of edible biomass production by (CE) conditions, and which respond to the ever-closed approach to optimization realized by each shortened production cycle are selected. The experimental approach with lettuce was to grow the crop hydroponically in a growth chamber and to manipulate such variables as light level and duration, day/night temperature, and nutrient form and level in the solution culture.

  5. Pathogenic Network Analysis Predicts Candidate Genes for Cervical Cancer

    Directory of Open Access Journals (Sweden)

    Yun-Xia Zhang

    2016-01-01

    Full Text Available Purpose. The objective of our study was to predicate candidate genes in cervical cancer (CC using a network-based strategy and to understand the pathogenic process of CC. Methods. A pathogenic network of CC was extracted based on known pathogenic genes (seed genes and differentially expressed genes (DEGs between CC and normal controls. Subsequently, cluster analysis was performed to identify the subnetworks in the pathogenic network using ClusterONE. Each gene in the pathogenic network was assigned a weight value, and then candidate genes were obtained based on the weight distribution. Eventually, pathway enrichment analysis for candidate genes was performed. Results. In this work, a total of 330 DEGs were identified between CC and normal controls. From the pathogenic network, 2 intensely connected clusters were extracted, and a total of 52 candidate genes were detected under the weight values greater than 0.10. Among these candidate genes, VIM had the highest weight value. Moreover, candidate genes MMP1, CDC45, and CAT were, respectively, enriched in pathway in cancer, cell cycle, and methane metabolism. Conclusion. Candidate pathogenic genes including MMP1, CDC45, CAT, and VIM might be involved in the pathogenesis of CC. We believe that our results can provide theoretical guidelines for future clinical application.

  6. A response to information criterion-based clustering with order-restricted candidate profiles in short time-course microarray experiments

    Directory of Open Access Journals (Sweden)

    Umbach David M

    2009-12-01

    Full Text Available Abstract Background For gene expression data obtained from a time-course microarray experiment, Liu et al. 1 developed a new algorithm for clustering genes with similar expression profiles over time. Performance of their proposal was compared with three other methods including the order-restricted inference based methodology of Peddada et al. 23. In this note we point out several inaccuracies in Liu et al. 1 and conclude that the order-restricted inference based methodology of Peddada et al. (programmed in the software ORIOGEN indeed operates at the desired nominal Type 1 error level, an important feature of a statistical decision rule, while being computationally substantially faster than indicated by Liu et al. 1. Results Application of ORIOGEN to the well-known breast cancer cell line data of Lobenhofer et al. 4 revealed that ORIOGEN software took only 21 minutes to run (using 100,000 bootstraps with p = 0.0025, substantially faster than the 72 hours found by Liu et al. 1 using Matlab. Also, based on a data simulated according to the model and parameters of simulation 1 (σ2 = 1, M = 5 in 1 we found that ORIOGEN took less than 30 seconds to run in stark contrast to Liu et al. who reported that their implementation of the same algorithm in R took 2979.29 seconds. Furthermore, for the simulation studies reported in 1, unlike the claims made by Liu et al. 1, ORIOGEN always maintained the desired false positive rate. According to Figure three in Liu et al. 1 their algorithm had a false positive rate ranging approximately from 0.20 to 0.70 for the scenarios that they simulated. Conclusions Our comparisons of run times indicate that the implementations of ORIOGEN's algorithm in Matlab and R by Liu et al. 1 is inefficient compared to the publicly available JAVA implementation. Our results on the false positive rate of ORIOGEN suggest some error in Figure three of Liu et al. 1, perhaps due to a programming error.

  7. Electrical performance verification methodology for large reflector antennas: based on the P-band SAR payload of the ESA BIOMASS candidate mission

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Kim, Oleksiy S.; Nielsen, Jeppe Majlund;

    2013-01-01

    In this paper, an electrical performance verification methodology for large reflector antennas is proposed. The verification methodology was developed for the BIOMASS P-band (435 MHz) synthetic aperture radar (SAR), but can be applied to other large deployable or fixed reflector antennas for which...... the verification of the entire antenna or payload is impossible. The two-step methodology is based on accurate measurement of the feed structure characteristics, such as complex radiation pattern and radiation efficiency, with an appropriate Measurement technique, and then accurate calculation of the radiation...... pattern and gain of the entire antenna including support and satellite structure with an appropriate computational software. A preliminary investigation of the proposed methodology was carried out by performing extensive simulations of different verification approaches. The experimental validation...

  8. Candidate Prediction Models and Methods

    DEFF Research Database (Denmark)

    Nielsen, Henrik Aalborg; Nielsen, Torben Skov; Madsen, Henrik

    2005-01-01

    This document lists candidate prediction models for Work Package 3 (WP3) of the PSO-project called ``Intelligent wind power prediction systems'' (FU4101). The main focus is on the models transforming numerical weather predictions into predictions of power production. The document also outlines...

  9. Candidate gene prioritization with Endeavour.

    Science.gov (United States)

    Tranchevent, Léon-Charles; Ardeshirdavani, Amin; ElShal, Sarah; Alcaide, Daniel; Aerts, Jan; Auboeuf, Didier; Moreau, Yves

    2016-07-08

    Genomic studies and high-throughput experiments often produce large lists of candidate genes among which only a small fraction are truly relevant to the disease, phenotype or biological process of interest. Gene prioritization tackles this problem by ranking candidate genes by profiling candidates across multiple genomic data sources and integrating this heterogeneous information into a global ranking. We describe an extended version of our gene prioritization method, Endeavour, now available for six species and integrating 75 data sources. The performance (Area Under the Curve) of Endeavour on cross-validation benchmarks using 'gold standard' gene sets varies from 88% (for human phenotypes) to 95% (for worm gene function). In addition, we have also validated our approach using a time-stamped benchmark derived from the Human Phenotype Ontology, which provides a setting close to prospective validation. With this benchmark, using 3854 novel gene-phenotype associations, we observe a performance of 82%. Altogether, our results indicate that this extended version of Endeavour efficiently prioritizes candidate genes. The Endeavour web server is freely available at https://endeavour.esat.kuleuven.be/.

  10. Candidate cave entrances on Mars

    Science.gov (United States)

    Cushing, Glen E.

    2012-01-01

    This paper presents newly discovered candidate cave entrances into Martian near-surface lava tubes, volcano-tectonic fracture systems, and pit craters and describes their characteristics and exploration possibilities. These candidates are all collapse features that occur either intermittently along laterally continuous trench-like depressions or in the floors of sheer-walled atypical pit craters. As viewed from orbit, locations of most candidates are visibly consistent with known terrestrial features such as tube-fed lava flows, volcano-tectonic fractures, and pit craters, each of which forms by mechanisms that can produce caves. Although we cannot determine subsurface extents of the Martian features discussed here, some may continue unimpeded for many kilometers if terrestrial examples are indeed analogous. The features presented here were identified in images acquired by the Mars Odyssey's Thermal Emission Imaging System visible-wavelength camera, and by the Mars Reconnaissance Orbiter's Context Camera. Select candidates have since been targeted by the High-Resolution Imaging Science Experiment. Martian caves are promising potential sites for future human habitation and astrobiology investigations; understanding their characteristics is critical for long-term mission planning and for developing the necessary exploration technologies.

  11. Probing the electronic transport on the reconstructed Au/Ge(001 surface

    Directory of Open Access Journals (Sweden)

    Franciszek Krok

    2014-09-01

    Full Text Available By using scanning tunnelling potentiometry we characterized the lateral variation of the electrochemical potential µec on the gold-induced Ge(001-c(8 × 2-Au surface reconstruction while a lateral current flows through the sample. On the reconstruction and across domain boundaries we find that µec shows a constant gradient as a function of the position between the contacts. In addition, nanoscale Au clusters on the surface do not show an electronic coupling to the gold-induced surface reconstruction. In combination with high resolution scanning electron microscopy and transmission electron microscopy, we conclude that an additional transport channel buried about 2 nm underneath the surface represents a major transport channel for electrons.

  12. Dynamics of copper-phthalocyanine molecules on Au/Ge(001)

    Energy Technology Data Exchange (ETDEWEB)

    Sotthewes, K.; Heimbuch, R.; Zandvliet, H. J. W. [Physics of Interfaces and Nanomaterials, MESA" + Institute for Nanotechnology, University of Twente, P.O. Box 217, 7500AE Enschede (Netherlands)

    2015-10-07

    Spatially resolved current-time scanning tunneling spectroscopy combined with current-distance spectroscopy has been used to characterize the dynamic behavior of copper-phthalocyanine (CuPc) molecules adsorbed on a Au-modified Ge(001) surface. The analyzed CuPc molecules are adsorbed in a “molecular bridge” configuration, where two benzopyrrole groups (lobes) are connected to a Au-induced nanowire, whereas the other two lobes are connected to the adjacent nanowire. Three types of lobe configurations are found: a bright lobe, a dim lobe, and a fuzzy lobe. The dim and fuzzy lobes exhibit a well-defined switching behavior between two discrete levels, while the bright lobe shows a broad oscillation band. The observed dynamic behavior is induced by electrons that are injected into the LUMO+1 orbital of the CuPc molecule. By precisely adjusting the tip-molecule distance, the switching frequency of the lobes can be tuned accurately.

  13. Dynamics of copper-phthalocyanine molecules on Au/Ge(001)

    NARCIS (Netherlands)

    Sotthewes, K.; Heimbuch, R.U.; Zandvliet, H.J.W.

    2015-01-01

    Spatially resolved current-time scanning tunneling spectroscopy combined with current-distance spectroscopy has been used to characterize the dynamic behavior of copper-phthalocyanine (CuPc) molecules adsorbed on a Au-modified Ge(001) surface. The analyzed CuPc molecules are adsorbed in a “molecular

  14. Growth response and expression of muscle growth-related candidate genes in adult zebrafish fed plant and fishmeal protein-based diets.

    Science.gov (United States)

    Ulloa, Pilar E; Peña, Andrea A; Lizama, Carla D; Araneda, Cristian; Iturra, Patricia; Neira, Roberto; Medrano, Juan F

    2013-03-01

    The main objective of this study was to examine the effects of a plant protein- vs. fishmeal-based diet on growth response in a population of 24 families, as well as expression of growth-related genes in the muscle of adult zebrafish (Danio rerio). Each family was split to create two fish populations with similar genetic backgrounds, and the fish were fed either fishmeal (FM diet) or plant protein (PP diet) as the unique protein source in their diets from 35 to 98 days postfertilization (dpf). To understand the effect of the PP diet on gene expression, individuals from three families, representative of the mean weight in both populations, were selected. To understand the effect of familiar variation on gene expression, the same families were evaluated separately. At 98 dpf, growth-related genes Igf1a, Igf2a, mTOR, Pld1a, Mrf4, Myod, Myogenin, and Myostatin1b were evaluated. In males, Myogenin, Mrf4, and Igf2a showed changes attributable to the PP diet. In females, the effect of the PP diet did not modulate the expression in any of the eight genes studied. The effect of familiar variation on gene expression was observed among families. This study shows that PP diet and family variation have effects on gene expression in fish muscle.

  15. Optical durability testing of candidate solar mirrors

    Energy Technology Data Exchange (ETDEWEB)

    Jorgensen, G.; Kennedy, C.; King, D.; Terwilliger, K.

    2000-03-24

    Durability testing of a variety of candidate solar reflector materials at outdoor test sites and in laboratory accelerated weathering chambers is the main activity within the Advanced Materials task of the Concentrated Solar Power (CSP) Program. Outdoor exposure testing (OET) at up to eight outdoor, worldwide exposure sites has been underway for several years. This includes collaboration under the auspices of the International Energy Agency (IEA) Solar Power and Chemical Energy Systems (SolarPACES) agreement. Outdoor sites are fully instrumented in terms of monitoring meteorological conditions and solar irradiance. Candidate materials are optically characterized prior to being subjected to exposure in real and simulated weathering environments. Optical durability is quantified by periodically re-measuring hemispherical and specular reflectance as a function of exposure time. By closely monitoring the site- and time-dependent environmental stress conditions experienced by the material samples, site-dependent loss of performance may be quantified. In addition, accelerated exposure testing (AET) of these materials in parallel under laboratory-controlled conditions may permit correlating the outdoor results with AET, and subsequently predicting service lifetimes. Test results to date for a large number of candidate solar reflector materials are presented in this report. Acronyms are defined. Based upon OET and AET results to date, conclusions can be drawn about the optical durability of the candidate reflector materials. The optical durability of thin glass, thick glass, and two metallized polymers can be characterized as excellent. The all-polymeric construction, several of the aluminized reflectors, and a metallized polymer can be characterized as having intermediate durability and require further improvement, testing and evaluation, or both.

  16. Automatic Classification of Kepler Planetary Transit Candidates

    OpenAIRE

    McCauliff, Sean D.; Jenkins, Jon M.; Catanzarite, Joseph; Burke, Christopher J.; Coughlin, Jeffrey L.; Twicken, Joseph D.; Tenenbaum, Peter; Seader, Shawn; Li, Jie; Cote, Miles

    2014-01-01

    In the first three years of operation the Kepler mission found 3,697 planet candidates from a set of 18,406 transit-like features detected on over 200,000 distinct stars. Vetting candidate signals manually by inspecting light curves and other diagnostic information is a labor intensive effort. Additionally, this classification methodology does not yield any information about the quality of planet candidates; all candidates are as credible as any other candidate. The torrent of exoplanet disco...

  17. Enthalpy screen of drug candidates.

    Science.gov (United States)

    Schön, Arne; Freire, Ernesto

    2016-11-15

    The enthalpic and entropic contributions to the binding affinity of drug candidates have been acknowledged to be important determinants of the quality of a drug molecule. These quantities, usually summarized in the thermodynamic signature, provide a rapid assessment of the forces that drive the binding of a ligand. Having access to the thermodynamic signature in the early stages of the drug discovery process will provide critical information towards the selection of the best drug candidates for development. In this paper, the Enthalpy Screen technique is presented. The enthalpy screen allows fast and accurate determination of the binding enthalpy for hundreds of ligands. As such, it appears to be ideally suited to aid in the ranking of the hundreds of hits that are usually identified after standard high throughput screening.

  18. Leishmaniasis: vaccine candidates and perspectives.

    Science.gov (United States)

    Singh, Bhawana; Sundar, Shyam

    2012-06-06

    Leishmania is a protozoan parasite and a causative agent of the various clinical forms of leishmaniasis. High cost, resistance and toxic side effects of traditional drugs entail identification and development of therapeutic alternatives. The sound understanding of parasite biology is key for identifying novel drug targets, that can induce the cell mediated immunity (mainly CD4+ and CD8+ IFN-gamma mediated responses) polarized towards a Th1 response. These aspects are important in designing a new vaccine along with the consideration of the candidates with respect to their ability to raise memory response in order to improve the vaccine performance. This review is an effort to identify molecules according to their homology with the host and their ability to be used as potent vaccine candidates.

  19. Toward organometallic antischistosomal drug candidates.

    Science.gov (United States)

    Hess, Jeannine; Keiser, Jennifer; Gasser, Gilles

    2015-01-01

    In the recent years, there has been a growing interest in the use of novel approaches for the treatment of parasitic diseases such as schistosomiasis. Among the different approaches used, organometallic compounds were found to offer unique opportunities in the design of antiparasitic drug candidates. A ferrocenyl derivative, namely ferroquine, has even entered clinical trials as a novel antimalarial. In this short review, we report on the studies describing the use of organometallic compounds against schistosomiasis.

  20. An Analysis of the Candidate Teachers' Beliefs Related to Knowledge, Learning and Teaching

    Science.gov (United States)

    Bay, Erdal; Vural, Ömer Faruk; Demir, Servet; Bagceci, Birsen

    2015-01-01

    Candidate teachers have several beliefs related to their knowledge, learning and teaching. The purpose of this study is to analyze the beliefs of candidate teachers about knowledge, learning and teaching. Candidate teachers were assigned a scale and from the answers "belief points" were obtained based on their attitudes about these three…

  1. The impact of alternate fuels on future candidate automotive engines

    Energy Technology Data Exchange (ETDEWEB)

    Rahnke, C.J.; Nichols, R.J.

    1982-06-01

    The thermal efficiency that could occur in the future for a variety of automotive engine candidates operating on conventional and alternate fuels is projected based on current automotive engine development trends and the special characteristics of the various alternate fuels. The multi-fuel engine candidates include mixture cycle and direct injection reciprocating engines, as well as adiabatic turbocompound engines and advanced gas turbine and Stirling engines. The alternate fuels considered are propane, methanol, ethanol, diesel and methane.

  2. Current status in research of dengue vaccine candidates based on domain Ⅲof E protein%登革病毒E蛋白结构域Ⅲ疫苗研究进展

    Institute of Scientific and Technical Information of China (English)

    孟胜利; 孙燕

    2011-01-01

    The ideal dengue vaccines should be low reactogenic, induce life-long protection against infection with any of the four serotypes of dengue viruses, and be affordable. The envelope protein domain Ⅲ of dengue virus has been implicated in receptor binding, and it is also the target of specific neutralizing antibodies.In this article, the current state of knowledge on vaccine candidates based on domain Ⅲ is reviewed.%理想的登革热疫苗应该是副作用小,可以诱导持久的抵抗4个血清型登革病毒感染的保护作用,并且价格合适.登革病毒E蛋白结构域Ⅲ介导受体连接作用并可诱导特异性中和抗体.此文主要介绍利用E蛋白结构域Ⅲ来开发登革热疫苗的研究进展.

  3. Three-dimensional measurement method based on mesh candidates assisted with structured light%基于结构光辅助的网格候选点三维测量方法

    Institute of Scientific and Technical Information of China (English)

    刘彬; 徐刚; 张文明; 李海滨

    2009-01-01

    光学三维测量技术是计算机视觉领域中最为活跃的研究主题之一.针对双目立体视觉三维测量方法中无纹理物体表面测量误差较大的问题,提出一种基于结构光投影辅助的网格候选点三维测量方法.设计灰度单调变化的锯齿波图案投射在被测场景中,有助于使三维网格候选点投影像点间的灰度差异最大化,依此提高系统的测量精度,实现了主动测量方法和被动测量方法的有效结合.通过3DS MAX和MATLAB软件平台下的仿真实验,验证了结构光辅助的网格候选点测量方法在计算精度上具有明显优势,且不会增加系统的复杂度,扩展了网格候选点三维测量方法的适用范围.%Optical three-dimensional measurement technology is one of the most active research topics in computer vision domain. Aiming at the problem of larger measurement error for the surface without texture, a mesh candidate based method with structured light illuminating is introduced for adding texture on the scene via further research of the preparatory work. The illuminating sawtooth pattern projected from the mesh candidates in the scene makes the similarity of the corresponding points more distinguishable. The active and passive optical measuring methods are combined effectively. Simulation experiments on 3DS MAX and MATLAB software platforms prove that the precision of the system has been improved obviously.

  4. Recognition of a wide-range of S-RNases by S locus F-box like 2, a general-inhibitor candidate in the Prunus-specific S-RNase-based self-incompatibility system.

    Science.gov (United States)

    Matsumoto, Daiki; Tao, Ryutaro

    2016-07-01

    Many species in the Rosaceae, the Solanaceae, and the Plantaginaceae exhibit S-RNase-based gametophytic self-incompatibility (GSI). This system comprises S-ribonucleases (S-RNases) as the pistil S determinant and a single or multiple F-box proteins as the pollen S determinants. In Prunus, pollen specificity is determined by a single S haplotype-specific F-box protein (SFB). The results of several studies suggested that SFB exerts cognate S-RNase cytotoxicity, and a hypothetical general inhibitor (GI) is assumed to detoxify S-RNases in non-specific manner unless it is affected by SFB. Although the identity of the GI is unknown, phylogenetic and evolutionary analyses have indicated that S locus F-box like 1-3 (or S locus F-box with low allelic sequence polymorphism 1-3; SLFL1-3), which are encoded by a region of the Prunus genome linked to the S locus, are good GI candidates. Here, we examined the biochemical characteristics of SLFL1-3 to determine whether they have appropriate GI characteristics. Pull-down assays and quantitative expression analyses indicated that Prunus avium SLFL1-3 mainly formed a canonical SCF complex with PavSSK1 and PavCul1A. Binding assays with PavS(1,3,4,6)-RNases showed that PavSLFL1, PavSLFL2, and PavSLFL3 bound to PavS(3)-RNase, all PavS-RNases tested, and none of the PavS-RNases tested, respectively. Together, these results suggested that SLFL2 has the appropriate characteristics to be the GI in sweet cherry pollen, while SLFL1 may redundantly work with SLFL2 to detoxify all S-RNases. We discuss the possible roles of SLFL1-3 as the GI in the Prunus-specific S-RNase-based GSI mechanism.

  5. Candidate eco-friendly gas mixtures for MPGDs

    CERN Document Server

    AUTHOR|(CDS)2071648; Saviano, G.; Muhammad, S.; Piccolo, D.; Primavera, F.; Ferrini, M.; Parvis, M.; Grassing, S.; Colafranceschi, S.; Kjøbro, J.; Sharma, A.; Yang, D.; Chen, G.; Ban, Y.; Li, Q.

    2015-01-01

    Modern gas detectors for detection of particles require F-based gases for optimal performance. Recent regulations demand the use of environmentally unfriendly F-based gases to be limited or banned. This review studies properties of potential eco-friendly gas candidate replacements.

  6. Additional TWA Members? Spectroscopic verification of kinematically selected TWA candidates

    CERN Document Server

    Song, I; Zuckerman, B; Song, Inseok

    2002-01-01

    We present spectroscopic measurements of the 23 new candidate members of the TW Hydrae Association from Makarov & Fabricius (2000). Based on Halpha and Li 6708 A strengths together with location on a color-magnitude diagram for Hipparcos TWA candidates, we found only three possible new members (TYC 7760-0835-1, TYC 8238-1462-1, and TYC 8234-2856-1) in addition to the already known member, TWA 19. This eliminated most of the candidates more distant than 100 pc. Three Tycho stars, almost certainly members of the Lower Centaurus Crux association, are the most distant members of the TWA. A claim of isotropic expansion of TWA has to be re-evaluated based on our new results. Generally, one cannot identify new members of a diffuse nearby stellar group based solely on kinematic data. To eliminate interlopers with similar kinematics, spectroscopic verification is essential.

  7. Pulsar Candidates Toward Fermi Unassociated Sources

    CERN Document Server

    Frail, D A; Jagannathan, P; Intema, H T

    2016-01-01

    We report on a search for steep spectrum radio sources within the 95% confidence error ellipses of the Fermi unassociated sources from the Large Array Telescope (LAT). Using existing catalogs and the newly released GMRT all-sky survey at 150 MHz we identify compact radio sources that are bright at MHz frequencies but faint or absent at GHz frequencies. Such steep spectrum radio sources are rare and constitute a sample of pulsar candidates, selected independently of period, dispersion measure, interstellar scattering and orbital parameters. We find point-like, steep spectrum candidates toward 11 Fermi sources. Based on the gamma-ray/radio positional coincidence, the rarity of such radio sources, and the properties of the 3FGL sources themselves, we argue that many of these sources could be pulsars. They may have been missed by previous radio periodicity searches due to interstellar propagation effects or because they lie in an unusually tight binary. If this hypothesis is correct, then renewed gamma-ray and ra...

  8. Transiting exoplanet candidates from K2 Campaigns 5 and 6

    Science.gov (United States)

    Pope, Benjamin J. S.; Parviainen, Hannu; Aigrain, Suzanne

    2016-10-01

    We introduce a new transit search and vetting pipeline for observations from the K2 mission, and present the candidate transiting planets identified by this pipeline out of the targets in Campaigns 5 and 6. Our pipeline uses the Gaussian process-based K2SC code to correct for the K2 pointing systematics and simultaneously model stellar variability. The systematics-corrected, variability-detrended light curves are searched for transits with the box-least-squares method, and a period-dependent detection threshold is used to generate a preliminary candidate list. Two or three individuals vet each candidate manually to produce the final candidate list, using a set of automatically generated transit fits and assorted diagnostic tests to inform the vetting. We detect 145 single-planet system candidates and 5 multi-planet systems, independently recovering the previously published hot Jupiters EPIC 212110888b, WASP-55b (EPIC 212300977b) and Qatar-2b (EPIC 212756297b). We also report the outcome of reconnaissance spectroscopy carried out for all candidates with Kepler magnitude Kp ≤ 13, identifying 12 targets as likely false positives. We compare our results to those of other K2 transit search pipelines, noting that ours performs particularly well for variable and/or active stars, but that the results are very similar overall. All the light curves and code used in the transit search and vetting process are publicly available, as are the follow-up spectra.

  9. Undercover Stars Among Exoplanet Candidates

    Science.gov (United States)

    2005-03-01

    events by monitoring the brightness of a very large number of stars over extended time intervals. During the past years, it has also included a search for periodic, very shallow "dips" in the brightness of stars, caused by the regular transit of small orbiting objects (small stars, brown dwarfs [2] or Jupiter-size planets). The OGLE team has since announced 177 "planetary transit candidates" from their survey of several hundred thousand stars in three southern sky fields, one in the direction of the Galactic Centre, another within the Carina constellation and the third within the Centaurus/Musca constellations. The nature of the transiting object can however only be established by subsequent radial-velocity observations of the parent star. The size of the velocity variations (the amplitude) is directly related to the mass of the companion object and therefore allows discrimination between stars and planets as the cause of the observed brightness "dip". A Bonanza of Low-Mass Stars An international team of astronomers [3] has made use of the 8.2-m VLT Kueyen telescope for this work. Profiting from the multiplex capacity of the FLAMES/UVES facility that permits to obtain high-resolution spectra of up to 8 objects simultaneously, they have looked at 60 OGLE transit candidate stars, measuring their radial velocities with an accuracy of about 50 m/s [4]. This ambitious programme has so far resulted in the discovery of five new transiting exoplanets (see, e.g., ESO PR 11/04 for the announcement of two of those). Most of the other transit candidates identified by OGLE have turned out to be eclipsing binaries, that is, in most cases common, small and low-mass stars passing in front of a solar-like star. This additional wealth of data on small and light stars is a real bonanza for the astronomers. Constraining the Relation Between Mass and Radius Low-mass stars are exceptionally interesting objects, also because the physical conditions in their interiors have much in common with

  10. BL LAC candidates for TeV observations

    Energy Technology Data Exchange (ETDEWEB)

    Massaro, F.; Paggi, A.; Errando, M.; D' Abrusco, R.; Masetti, N.; Tosti, G.; Funk, S.

    2013-07-01

    BL Lac objects are the most numerous class of extragalactic TeV-detected sources. One of the biggest difficulties in investigating their TeV emission is due to their limited number, since only 47 BL Lac objects are known to be TeV emitters. In this paper, we propose new criteria to select TeV BL Lac candidates based on infrared and X-ray observations. We apply our selection criteria to the BL Lac objects listed in the ROMA-BZCAT catalog, thereby identifying 41 potential TeV emitters. We then perform a search over a more extended sample combining the ROSAT bright source catalog and the WISE all-sky survey, revealing 54 additional candidates for TeV observations. Our investigation also led to a tentative classification of 16 unidentified X-ray sources as BL Lac candidates. This analysis provides new interesting BL Lac targets for future observations with ground-based Cherenkov telescopes.

  11. Natural Flavonoids as Promising Analgesic Candidates: A Systematic Review.

    Science.gov (United States)

    Xiao, Xiao; Wang, Xiaoyu; Gui, Xuan; Chen, Lu; Huang, Baokang

    2016-11-01

    Due to the chemical structural diversity and various analgesic mechanisms, an increasing number of studies indicated that some flavonoids from medicinal plants could be promising candidates for new natural analgesic drugs, which attract high interests of advanced users and academic researchers. The aim of this systematic review is to report flavonoids and its derivatives as new analgesic candidates based on the pharmacological evidences. Sixty-four papers were found concerning the potential analgesic activity of 46 flavonoids. In this case, the evidence for analgesic activity of flavonoids and total flavonoids was investigated. Meanwhile, the corresponding analgesic mechanism of flavonoids was discussed by generalizing and analyzing the current publications. Based on this review, the conclusion can be drawn that some flavonoids are promising candidates for painful conditions and deserve particular attention in further research and development.

  12. Planetary Nebula Candidates Uncovered with the HASH Research Platform

    CERN Document Server

    Fragkou, Vasiliki; Frew, David; Parker, Quentin

    2016-01-01

    A detailed examination of new high quality radio catalogues (e.g. Cornish) in combination with available mid-infrared (MIR) satellite imagery (e.g. Glimpse) has allowed us to find 70 new planetary nebula (PN) candidates based on existing knowledge of their typical colors and fluxes. To further examine the nature of these sources, multiple diagnostic tools have been applied to these candidates based on published data and on available imagery in the HASH (Hong Kong/ AAO/ Strasbourg H{\\alpha} planetary nebula) research platform. Some candidates have previously-missed optical counterparts allowing for spectroscopic follow-up. Indeed, the single object spectroscopically observed so far has turned out to be a bona fide PN.

  13. Data Mining Approach to Cataclysmic Variables Candidates Based on Random Forest Algorithm%基于随机森林的激变变星候选体的数据挖掘

    Institute of Scientific and Technical Information of China (English)

    姜斌; 罗阿理; 赵永恒

    2012-01-01

    提出一种适用于在郭守敬望远镜海量光谱中自动、快速筛选激变变星的方法.利用已证认的激变变星光谱作为模板,通过随机森林分类训练,得到一个分类模型,该模型给出了各个波长对应流量的重要性排序,可根据该排序进行降维并用于激变变星判别,结果作为反馈进一步丰富模板库.实验中共发现了16个新的激变变星候选体,表明了该方法的可行性.%An automatic and efficient method for cataclysmic variables candidates is presented in the present paper. The identified CVs were selected as templates. A model was constructed by random forest algorithm with templates and random selected spectra. Wavelength ranking was described by the model and the classifier was constructed afterwards. Most of the non-candidates were excluded by the method. Template matching strategy was used to identify the final candidates which were analyzed to complement the templates as feedback. 16 new CVs candidates were found in the experiment that shows that our approach to finding special celestial bodies can be feasible in LAMOST.

  14. Study on Candidates' Ability Mastery Patterns Based on Cognitive Diagnosis Theory in College Entrance Examination%基于认知诊断的高考考生能力掌握模式研究

    Institute of Scientific and Technical Information of China (English)

    李金波; 朱玉玲

    2012-01-01

    Taking one province' high candidates' math ability-mastery patterns for example to carry out the promotion and applied research of cognitive diagnosis in large-scale tests. The findings classified these candidates into 71 kinds of typical ability-mastery patterns, different candidates have different ability-mastery patterns and the proportions of typical ability-mastery patterns are also different. Candidates have a higher mastery degree in solving the operations, data processing, and reasoning, while have the lowest mastery degree in the application consciousness. City and male candidates are better than rural and female candidates. City candidates have a larger proportion in the high-end ability-mastery patterns than rural ones, on the contrary in the low-end ability-mastery patterns. The findings provide a valuable reference for improving students' learning efficiency and guiding teachers in remedial teaching.%以某省高考考生在数学能力上的掌握模式为样倒,探索认知诊断理论在大规模考试中的推广应用。研究结果将考生划归到71种典型的能力掌握模式,考生之间的能力掌握模式不同,不同的典型能力掌握模式的考生比例也不同。考生在运算求解能力、数据处理能力和推理论证能力上的掌握程度较高,在应用意识上的掌握程度最低。城市考生和男生在各项具体能力上的平均掌握率要高于农村考生和女生;城市考生在高端能力掌握模武上的比例高于农村考生,在低端能力掌握模式上则相反。研究结果为学生提高学习效率和教师进行补救教学等提供了有价值的参考。

  15. Teacher Candidates' Communication Skills and Communicator Styles

    OpenAIRE

    Cem ÇUHADAR; Özgür, Hasan; Akgün, Fatma; GÜNDÜZ, Şemseddin

    2015-01-01

    The purpose of this study is to find out the relationship between the communication skills and the communicator styles of teacher candidates. This research was conducted among the senior class students, studying at Trakya University, Faculty of Education in the fall semester of the 2012-2013 academic year. 205 women and 110 men, in a total of 315 teacher candidates participated in the research. As a result, it has been observed that the teacher candidates bear animated/expressive features the...

  16. A New Optical Survey of Supernova Remnant Candidates in M31

    CERN Document Server

    Lee, Jong Hwan

    2014-01-01

    We present a survey of optically emitting supernova remnants (SNRs) in M31 based on H$\\alpha$ and [SII] images in the Local Group Survey. Using these images, we select objects that have [SII]:H$\\alpha$ $>$ 0.4 and circular shapes. We find 76 new SNR candidates. We also inspect 234 SNR candidates presented in previous studies, finding that only 80 of them are SNR candidates according to our criteria. Combining them with the new candidates, we produce a master catalog of 156 SNR candidates in M31. We classify these SNR candidates according to two criteria: the SNR progenitor type [Type Ia and core-collapse (CC) SNRs] and the morphological type. Type Ia and CC SNR candidates make up 23% and 77%, respectively, of the total sample. Most of the CC SNR candidates are concentrated in the spiral arms, while the Type Ia SNR candidates are rather distributed over the entire galaxy, including the inner region. The CC SNR candidates are brighter in H$\\alpha$ and [SII] than the Type Ia SNR candidates. We derive a cumulativ...

  17. Production of EV71 vaccine candidates.

    Science.gov (United States)

    Chong, Pele; Hsieh, Shih-Yang; Liu, Chia-Chyi; Chou, Ai-Hsiang; Chang, Jui-Yuan; Wu, Suh-Chin; Liu, Shih-Jen; Chow, Yen-Hung; Su, Ih-Jen; Klein, Michel

    2012-12-01

    Enterovirus 71 (EV71) is now recognized as an emerging neurotropic virus in Asia and with Coxsackie virus (CV) it is the other major causative agent of hand-foot-mouth diseases (HFMD). Effective medications and/or prophylactic vaccines against HFMD are urgently needed. From a scientific (the feasibility of bioprocess, immunological responses and potency in animal challenge model) and business development (cost of goods) points of view, we in this review address and discuss the pros and cons of different EV71 vaccine candidates that have been produced and evaluated in animal models. Epitope-based synthetic peptide vaccine candidates containing residues 211-225 of VP1 formulated with Freund's adjuvant (CFA/IFA) elicited low EV71 virus neutralizing antibody responses, but were protective in the suckling mouse challenge model. Among recombinant EV71 subunits (rVP1, rVP2 and rVP3) expressed in E. coli, purified and formulated with CFA/IFA, only VP1 elicited mouse antibody responses with measurable EV71-specific virus neutralization titers. Immunization of mice with either a DNA plasmid containing VP1 gene or VP1 expressed in Salmonella typhimurium also generated neutralizing antibody responses and protected animals against a live EV71 challenge. Recombinant EV71 virus-like particles (rVLP) produced from baculovirus formulated either with CFA/IFA or alum elicited good virus neutralization titers in both mice and non-human primates, and were found to be protective in the suckling mouse EV71 challenge model. Synthetic peptides or recombinant EV71 subunit vaccines (rVP1 and rVLP) formulated in alum were found to be poorly immunogenic in rabbits. Only formalin-inactivated (FI) EV71 virions formulated in alum elicited cross-neutralizing antibodies against different EV71 genotypes in mice, rabbits and non-human primates but induced weak neutralizing responses against CAV16. From a regulatory, economic and market acceptability standpoint, FI-EV71 virion vaccines are the most

  18. Supervising PETE Candidates Using the Situational Supervision Model

    Science.gov (United States)

    Levy, Linda S.; Johnson, Lynn V.

    2012-01-01

    Physical education teacher candidates (PETCs) often, as part of their curricular requirements, engage in early field experiences that prepare them for student teaching. Matching the PETC's developmental level with the mentor's supervision style enhances this experience. The situational supervision model, based on the situational leadership model,…

  19. Effects of Critical Thinking Intervention for Early Childhood Teacher Candidates

    Science.gov (United States)

    Han, Heejeong Sophia; Brown, E. Todd

    2013-01-01

    This study is based on an intervention designed to enhance early childhood teacher candidates' critical thinking abilities. The concept, elements, standards, and traits of critical thinking were integrated into the main course contents, and the effects of the intervention were examined. The results indicated that early childhood teacher…

  20. Evaluation of candidate geomagnetic field models for IGRF-11

    DEFF Research Database (Denmark)

    Finlay, Chris; Maus, S.; Beggan, C. D.

    2010-01-01

    coefficients is also reported. Maps of differences in the vertical field intensity at Earth’s surface between the candidates and weighted mean models are presented. Candidates with anomalous aspects are identified and efforts made to pinpoint both troublesome coefficients and geographical regions where large...... vector satellite data is demonstrated; based on internal consistency DGRF-2005 has a formal root mean square vector field error over Earth’s surface of 1.0 nT. Difficulties nevertheless remain in accurately forecasting field evolution only five years into the future....

  1. Light Sensor Candidates for the Cherenkov Telescope Array

    CERN Document Server

    Knoetig, M L; Kurz, M; Hose, J; Lorenz, E; Schweizer, T; Teshima, M; Buzhan, P; Popova, E; Bolmont, J; Tavernet, J -P; Vincent, P; Shayduk, M

    2011-01-01

    We report on the characterization of candidate light sensors for use in the next-generation Imaging Atmospheric Cherenkov Telescope project called Cherenkov Telescope Array, a major astro-particle physics project of about 100 telescopes that is currently in the prototyping phase. Our goal is to develop with the manufacturers the best possible light sensors (highest photon detection efficiency, lowest crosstalk and afterpulsing). The cameras of those telescopes will be based on classical super-bi-alkali Photomultiplier tubes but also Silicon Photomultipliers are candidate light sensors. A full characterisation of selected sensors was done. We are working in close contact with several manufacturers, giving them feedback and suggesting improvements.

  2. Decomposing the Relationship Between Candidates' Facial Appearance and Electoral Success

    DEFF Research Database (Denmark)

    Laustsen, Lasse

    2014-01-01

    candidates’ faces and electoral success is challenged in two ways: (i) non-facial factors in candidate photos such as clothing and hair style as well as (ii) parties’ nomination strategies are suggested as potential confounds. This study is based on original data about all 268 candidates running in three...... facial competence also predicts electoral success over and above what can be accounted for by attractiveness. Importantly these relationships are found when seven different non-facial factors, parties’ nomination strategies and candidates’ age and gender are controlled for. This suggests that the two...

  3. A preliminary systems assessment of the Starlite Demo candidates

    Energy Technology Data Exchange (ETDEWEB)

    Bathke, C.G.

    1995-12-01

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described herein.

  4. Properties of Optically Selected Supernova Remnant Candidates in M33

    CERN Document Server

    Lee, Jong Hwan

    2014-01-01

    We present a sample of supernova remnant (SNR) candidates in M33 based on optical narrow band images in the Local Group Survey. We identify emission line objects that have enhanced [SII]:H{\\alpha} (> 0.4) and circular shapes using continuum-subtracted H{\\alpha}and [SII] images and produce a list of 199 SNR candidates, of which 79 are previously unknown. We classify them considering two types of criteria: their progenitor type (Type Ia and core-collapse (CC) SNRs) and their morphological type. Of the total sample, 170 are likely remnants of CC SNe and 29 are likely remnants of Type Ia SNe. We obtain a cumulative size distribution of the SNR candidates, showing that it follows a power law with an index,{\\alpha}= 2.38{\\pm}0.05 (17 < D < 50 pc). This indicates that most of the M33 SNR candidates found in this study are in the Sedov-Taylor phase, consistent with previous findings. The [SII]:H{\\alpha} distribution of the SNR candidates shows two peaks at [SII]:H{\\alpha} ~0.55 and ~0.8. Interestingly X-ray and...

  5. Transiting exoplanet candidates from K2 Campaigns 5 and 6

    CERN Document Server

    Pope, Benjamin J S; Aigrain, Suzanne

    2016-01-01

    We introduce a new transit search and vetting pipeline for observations from the K2 mission, and present the candidate transiting planets identified by this pipeline out of the targets in Campaigns 5 and 6. Our pipeline uses the Gaussian Process-based K2SC code to correct for the K2 pointing systematics and simultaneously model stellar variability. The systematics-corrected, variability-detrended light curves are searched for transits with the Box Least Squares method, and a period-dependent detection threshold is used to generate a preliminary candidate list. Two or three individuals vet each candidate manually to produce the final candidate list, using a set of automatically-generated transit fits and assorted diagnostic tests to inform the vetting. We detect 147 single-planet system candidates and 5 multi-planet systems, independently recovering the previously-published hot~Jupiters EPIC 212110888b, WASP-55b (EPIC 212300977b) and Qatar-2b (EPIC 212756297b). We also report the outcome of reconnaissance spec...

  6. Virus-like particles as nanovaccine candidates

    Science.gov (United States)

    Guillen, G.; Aguilar, J. C.; Dueñas, S.; Hermida, L.; Iglesias, E.; Penton, E.; Lobaina, Y.; Lopez, M.; Mussachio, A.; Falcon, V.; Alvarez, L.; Martinez, G.; Gil, L.; Valdes, I.; Izquierdo, A.; Lazo, L.; Marcos, E.; Guzman, G.; Muzio, V.; Herrera, L.

    2013-03-01

    The existing vaccines are mainly limited to the microorganisms we are able to culture and produce and/or to those whose killing is mediated by humoral response (antibody mediated). It has been more difficult to develop vaccines capable of inducing a functional cellular response needed to prevent or cure chronic diseases. New strategies should be taken into account in the improvement of cell-based immune responses in order to prevent and control the infections and eventually clear the virus. Preclinical and clinical results with vaccine candidates developed as a vaccine platform based on virus-like particles (VLPs) evidenced their ability to stimulate mucosal as well as systemic immunity. Particles based on envelope, membrane or nucleocapsid microbial proteins induce a strong immune response after nasal or parenteral administration in mice, non-human primates and humans. In addition, the immune response obtained was modulated in a Th1 sense. The VLPs were also able to immunoenhance the humoral and cellular immune responses against several viral pathogens. Studies in animals and humans with nasal and systemic formulations evidenced that it is possible to induce functional immune response against HBV, HCV, HIV and dengue virus. Invited talk at the 6th International Workshop on Advanced Materials Science and Nanotechnology, 30 October - 2 November 2012, Ha Long, Vietnam.

  7. Evaluating historical candidate genes for schizophrenia

    DEFF Research Database (Denmark)

    Farrell, M S; Werge, T; Sklar, P

    2015-01-01

    Prior to the genome-wide association era, candidate gene studies were a major approach in schizophrenia genetics. In this invited review, we consider the current status of 25 historical candidate genes for schizophrenia (for example, COMT, DISC1, DTNBP1 and NRG1). The initial study for 24 of thes...

  8. Candidate main-field models for producing the 9th generation IGRF

    Science.gov (United States)

    Mandea, Mioara

    2005-12-01

    This paper presents the various candidate models used in deriving the 9th generation IGRF. Based on notes submitted to the IAGA working group V-MOD with the Gauss coefficients, a brief description of the data used and the method of modelling for each of the candidate models is given. The six candidate models for epoch 1995.0 and the five for epoch 2000.0 are presented. Improvements gained by the new models are also discussed.

  9. Ionospheric and induced field leakage in geomagnetic field models, and derivation of candidate models for DGRF 1995 and DGRF 2000

    DEFF Research Database (Denmark)

    Olsen, Nils; Lowes, F.; Sabaka, T.J.

    2005-01-01

    As part of the 9th generation of the IGRF defined by IAGA, we proposed a candidate model for DGRF 1995 and two candidate models for DGRF 2000. These candidate models, the derivation of which is described in the present note, are based on the "Comprehensive Model, Version 4 (CM4)", and on the "Ors...

  10. Perspectives on Using Physcomitrella Patens as an Alternative Production Platform for Thapsigargin and Other Terpenoid Drug Candidates

    OpenAIRE

    Simonsen, Henrik Toft; Drew, Damian Paul; Lunde, Christina

    2009-01-01

    To overcome the potential future demand for terpenoids used as drugs, a new production platform is currently being established in our laboratory. The moss Physcomitrella has been chosen as the candidate organism for production of drug candidates based on terpenoids derived from plants, with a primary focus on the sesquiterpene lactone, thapsigargin. This drug candidate and other candidates/drugs with sesquiterpene skeleton are difficult to obtain by chemical synthesis due to their large numbe...

  11. On the Low False Positive Probabilities of Kepler Planet Candidates

    CERN Document Server

    Morton, Timothy D

    2011-01-01

    We present a framework to conservatively estimate the probability that any particular planet-like transit signal observed by the Kepler mission is in fact a planet, prior to any ground-based follow-up efforts. We use Monte Carlo methods based on stellar population synthesis and Galactic structure models, and we provide empirical analytic fits to our results that may be applied to the as-yet-unconfirmed Kepler candidates. We find that the false positive probability for candidates that pass preliminary Kepler vetting procedures is generally 20% to < 2%, assuming a continuous power law for the planet mass function with index alpha = -1.5. Since Kepler will detect many more planetary signals than can be positively confirmed with ground-based follow-up efforts in the near term, these calculations will be crucial to using the ensemble of Kepler data to determine population characteristic s of planetary systems.

  12. A Proposed Pedagogical Approach for Preparing Teacher Candidates to Incorporate Academic Language in Mathematics Classrooms

    Science.gov (United States)

    Lim, Woong; Stallings, Lynn; Kim, Dong Joong

    2015-01-01

    The purpose of this article is to present issues related to prioritizing academic language in teaching performance assessments and to propose a pedagogical approach that prepares middle grades mathematics teacher candidates to teach academic language. Based on our experience with teacher candidates and our knowledge of edTPA standards involving…

  13. Stress analysis for the candidate of lower end fitting of advanced LWR fuel using FEM

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S. S.; Moon, Y. C. [Korea University of Technology and Education, Chonan (Korea, Republic of); Kim, H. K. [Korea Nuclear Fuel Company, Taejon (Korea, Republic of)

    2002-10-01

    The geometric modeling has been conducted for the candidate of advanced LWR fuel using the three-dimensional solid modeler. Then the three-dimensional stress analysis using MSC/NASTRAN has been performed. The evaluation for the mechanical integrity of the candidate has been performed based on the stress distribution obtained from the finite elements analysis.

  14. Developing Expertise: Using Video to Hone Teacher Candidates' Classroom Observation Skills

    Science.gov (United States)

    Cuthrell, Kristen; Steadman, Sharilyn C.; Stapleton, Joy; Hodge, Elizabeth

    2016-01-01

    This article explores the impact of a video observation model developed for teacher candidates in an early experiences course. Video Grand Rounds (VGR) combines a structured observation protocol, videos, and directed debriefing to enhance teacher candidates' observations skills within nonstructured and field-based observations. A comparative…

  15. Variables that Affect Math Teacher Candidates' Intentions to Integrate Computer-Assisted Mathematics Education (CAME)

    Science.gov (United States)

    Erdogan, Ahmet

    2010-01-01

    Based on Social Cognitive Carier Theory (SCCT) (Lent, Brown, & Hackett, 1994, 2002), this study tested the effects of mathematics teacher candidates' self-efficacy in, outcome expectations from, and interest in CAME on their intentions to integrate Computer-Assisted Mathematics Education (CAME). While mathematics teacher candidates' outcome…

  16. Effects of Lesson Study on Science Teacher Candidates' Teaching Efficacies

    Science.gov (United States)

    Pektas, Murat

    2014-01-01

    The aim of this study was to investigate the effects of the lesson study process on science teacher candidates' teaching in terms of lesson plan content, pedagogy and classroom management based on expert, peer and self-evaluations. The participants of this case study consisted of 16 teacher candidates in elementary science education in their…

  17. Photon defects in noncommutative standard model candidates

    Energy Technology Data Exchange (ETDEWEB)

    Abel, S.A.; Khoze, V.V. [Durham Univ. (United Kingdom). Center for Particle Theory; Jaeckel, J.; Ringwald, A. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)

    2006-06-15

    Restrictions imposed by gauge invariance in noncommutative spaces together with the effects of ultraviolet/infrared mixing lead to strong constraints on possible candidates for a noncommutative extension of the Standard Model. We study a general class of noncommutative models consistent with these restrictions. Specifically we consider models based upon a gauge theory with the gauge group U(N{sub 1}) x U(N{sub 2}) x.. x U(N{sub m}) coupled to matter fields transforming in the (anti)-fundamental, bi-fundamental and adjoint representations. We pay particular attention to overall trace-U(1) factors of the gauge group which are affected by the ultraviolet/infrared mixing. Typically, these trace-U(1) gauge fields do not decouple sufficiently fast in the infrared, and lead to sizable Lorentz symmetry violating effects in the low-energy effective theory. In a 4-dimensional theory on a continuous space-time making these effects unobservable would require making the effects of noncommutativity tiny, M{sub NC} >> M{sub P}. This severely limits the phenomenological prospects of such models. However, adding additional universal extra dimensions the trace-U(1) factors decouple with a power law and the constraint on the noncommutativity scale is weakened considerably. Finally, we briefly mention some interesting properties of the photon that could arise if the noncommutative theory is modified at a high energy scale. (Orig.)

  18. Cattle Candidate Genes for Milk Production Traits

    OpenAIRE

    Kadlec, Tomáš

    2012-01-01

    The aim of this thesis is to make an overview of important candidate genes affecting milk yield and milk quality parameters, with an emphasis on genes associated with the quantity and quality of milk proteins and milk fat.

  19. New Zika Vaccine Candidate Provides Powerful Protection

    Science.gov (United States)

    ... https://medlineplus.gov/news/fullstory_163384.html New Zika Vaccine Candidate Provides Powerful Protection Made without live ... HealthDay News) -- A single dose of an experimental Zika vaccine protected mice and monkeys from the virus, ...

  20. Bioinformatics methods for identifying candidate disease genes

    NARCIS (Netherlands)

    Driel, M.A. van; Brunner, H.G.

    2006-01-01

    With the explosion in genomic and functional genomics information, methods for disease gene identification are rapidly evolving. Databases are now essential to the process of selecting candidate disease genes. Combining positional information with disease characteristics and functional information i

  1. Towards Treating Chemistry Teacher Candidates as Human

    Science.gov (United States)

    Lewthwaite, Brian Ellis

    2008-05-01

    This research inquiry investigates the factors influencing chemistry teacher candidates’ development during their extended practica in the second and final year of an After-Degree Bachelor of Education at a university in central Canada. A variety of data sources are used to identify the risk and protective factors impeding and contributing to the achievement of their chemistry pedagogical aspirations. Two theoretical frameworks, both having their origins in the pioneering work of Kurt Lewin, are used to conceptualize how a complex amalgam of personal attribute and environmental factors and the interplay among these factors influence teacher candidate developmental trajectories. The tenets of both Bronfenbrenner’s bioecological model and Learning Environment research provide insights into how the factors influencing teacher candidate development can be understood and systematically documented to provide a template for reflective consideration of the practicum experience for both teacher candidates and those involved in fostering the development of chemistry teacher candidates.

  2. Bioinformatics methods for identifying candidate disease genes

    Directory of Open Access Journals (Sweden)

    van Driel Marc A

    2006-06-01

    Full Text Available Abstract With the explosion in genomic and functional genomics information, methods for disease gene identification are rapidly evolving. Databases are now essential to the process of selecting candidate disease genes. Combining positional information with disease characteristics and functional information is the usual strategy by which candidate disease genes are selected. Enrichment for candidate disease genes, however, depends on the skills of the operating researcher. Over the past few years, a number of bioinformatics methods that enrich for the most likely candidate disease genes have been developed. Such in silico prioritisation methods may further improve by completion of datasets, by development of standardised ontologies across databases and species and, ultimately, by the integration of different strategies.

  3. PCNN and active contour based candidate pulmonary nodule segmentation method for CT images%基于PCNN与主动轮廓的肺CT候选结节的分割方法

    Institute of Scientific and Technical Information of China (English)

    赖均; 解梅

    2011-01-01

    In order to segment out the candidate pulmonary nodule in the CT images, considering the statistical feature of the lung field, this paper proposed an algorithm for segmentation of the juxta-pleural nodules and inner nodules of a lung.And the algorithm was consisting of the pulse coupled neuron network with four neighbor linking weights and the active contour with the prior shape energy.Experiments demonstrate that the algorithm can segment the candidate pulmonary nodules correctly and it is one kind of effective segmentation method of exchuding the false position pulmonary nodules.%为了对肺CT图像中的候选肺结节实施正确的分割,针对二维图像肺区统计特征,提出一种四邻域连接权的脉冲耦合神经网络(PCNN)结合先验形状能量函数的主动轮廓模型来分割候选肺内与近胸膜两类肺结节的算法.实验结果表明,算法能够正确地完成对候选肺结节的分割,并且它是一种能有效剔除大量假阳性结节的肺结节分割方法.

  4. Cardiac evaluation of liver transplant candidates

    Institute of Scientific and Technical Information of China (English)

    Mercedes Susan Mandell; JoAnn Lindenfeld; Mei-Yung Tsou; Michael Zimmerman

    2008-01-01

    Physicians previously thought that heart disease was rare in patients with end stage liver disease. However, recent evidence shows that the prevalence of ischemic heart disease and cardiomyopathy is increased in transplant candidates compared to most other surgical candidates. Investigators estimate that up to 26% of all liver transplant candidates have at least one critical coronary artery stenosis and that at least half of these patients will die perioperatively of cardiac complications. Cardiomyopathy also occurs in greater frequency. While all patients with advanced cardiac disease have defects in cardiac performance, a larger than expected number of patients have classical findings of dilated, restrictive and hypertropic cardiomyopathy. This may explain why up to 56% of patients suffer from hypoxemia due to pulmonary edema following transplant surgery. There is considerable controversy on how to screen transplant candidates for the presence of heart disease. Questions focus upon, which patients should be screened and what tests should be used. This review examines screening strategies for transplant candidates and details the prognostic value of common tests used to identify ischemic heart disease. We also review the physiological consequences of cardiomyopathy in transplant candidates and explore the specific syndrome of "cirrhotic cardiomyopathy".

  5. HMGA1a recognition candidate DNA sequences in humans.

    Directory of Open Access Journals (Sweden)

    Takayuki Manabe

    Full Text Available High mobility group protein A1a (HMGA1a acts as an architectural transcription factor and influences a diverse array of normal biological processes. It binds AT-rich sequences, and previous reports have demonstrated HMGA1a binding to the authentic promoters of various genes. However, the precise sequences that HMGA1a binds to remain to be clarified. Therefore, in this study, we searched for the sequences with the highest affinity for human HMGA1a using an existing SELEX method, and then compared the identified sequences with known human promoter sequences. Based on our results, we propose the sequences "-(G/A-G-(A/T-(A/T-A-T-T-T-" as HMGA1a-binding candidate sequences. Furthermore, these candidate sequences bound native human HMGA1a from SK-N-SH cells. When candidate sequences were analyzed by performing FASTAs against all known human promoter sequences, 500-900 sequences were hit by each one. Some of the extracted genes have already been proven or suggested as HMGA1a-binding promoters. The candidate sequences presented here represent important information for research into the various roles of HMGA1a, including cell differentiation, death, growth, proliferation, and the pathogenesis of cancer.

  6. Single Transit Candidates from K2: Detection and Period Estimation

    CERN Document Server

    Osborn, H P; Brown, D J A; McCormac, J; Doyle, A P; Louden, T M; Kirk, J; Spake, J J; Lam, K W F; Walker, S R; Faedi, F; Pollacco, D L

    2015-01-01

    Photometric surveys such as Kepler have the precision to identify exoplanet and eclipsing binary candidates from only a single transit. K2, with its 75d campaign duration, is ideally suited to detect significant numbers of single-eclipsing objects. Here we develop a Bayesian transit-fitting tool ("Namaste: An Mcmc Analysis of Single Transit Exoplanets") to extract orbital information from single transit events. We achieve favourable results testing this technique on known Kepler planets, and apply the technique to 7 candidates identified from a targeted search of K2 campaigns 1, 2 and 3. We find EPIC203311200 to host an excellent exoplanet candidate with a period, assuming zero eccentricity, of $540 ^{+410}_{-230}$ days and a radius of $0.51 \\pm 0.05 R_{Jup}$. We also find six further transit candidates for which more follow-up is required to determine a planetary origin. Such a technique could be used in the future with TESS, PLATO and ground-based photometric surveys such as NGTS, potentially allowing the d...

  7. A New Way to Confirm Planet Candidates

    Science.gov (United States)

    Kohler, Susanna

    2016-05-01

    What was the big deal behind the Kepler news conference yesterday? Its not just that the number of confirmed planets found by Kepler has more than doubled (though thats certainly exciting news!). Whats especially interesting is the way in which these new planets were confirmed.Number of planet discoveries by year since 1995, including previous non-Kepler discoveries (blue), previous Kepler discoveries (light blue) and the newly validated Kepler planets (orange). [NASA Ames/W. Stenzel; Princeton University/T. Morton]No Need for Follow-UpBefore Kepler, the way we confirmed planet candidates was with follow-up observations. The candidate could be validated either by directly imaging (which is rare) or obtaining a large number radial-velocity measurements of the wobble of the planets host star due to the planets orbit. But once Kepler started producing planet candidates, these approaches to validation became less feasible. A lot of Kepler candidates are small and orbit faint stars, making follow-up observations difficult or impossible.This problem is what inspired the development of whats known as probabilistic validation, an analysis technique that involves assessing the likelihood that the candidates signal is caused by various false-positive scenarios. Using this technique allows astronomers to estimate the likelihood of a candidate signal being a true planet detection; if that likelihood is high enough, the planet candidate can be confirmed without the need for follow-up observations.A breakdown of the catalog of Kepler Objects of Interest. Just over half had previously been identified as false positives or confirmed as candidates. 1284 are newly validated, and another 455 have FPP of1090%. [Morton et al. 2016]Probabilistic validation has been used in the past to confirm individual planet candidates in Kepler data, but now Timothy Morton (Princeton University) and collaborators have taken this to a new level: they developed the first code thats designed to do fully

  8. JELLYFISH GALAXY CANDIDATES AT LOW REDSHIFT

    Energy Technology Data Exchange (ETDEWEB)

    Poggianti, B. M.; Fasano, G.; Omizzolo, A.; Gullieuszik, M.; Bettoni, D.; Paccagnella, A. [INAF-Astronomical Observatory of Padova (Italy); Moretti, A.; D’Onofrio, M. [Physics and Astronomy Department, University of Padova (Italy); Jaffé, Y. L. [Department of Astronomy, Universidad de Concepción, Concepción (Chile); Vulcani, B. [Kavli Institute for the Physics and Mathematics of the universe (WPI), The University of Tokyo Institutes for Advanced Study (UTIAS), the University of Tokyo, Kashiwa, 277-8582 (Japan); Fritz, J. [Centro de Radioastronomía y Astrofísica, CRyA, UNAM, Michoacán (Mexico); Couch, W. [Australian Astronomical Observatory, North Ryde, NSW 1670 (Australia)

    2016-03-15

    Galaxies that are being stripped of their gas can sometimes be recognized from their optical appearance. Extreme examples of stripped galaxies are the so-called “jellyfish galaxies” that exhibit tentacles of debris material with a characteristic jellyfish morphology. We have conducted the first systematic search for galaxies that are being stripped of their gas at low-z (z = 0.04−0.07) in different environments, selecting galaxies with varying degrees of morphological evidence for stripping. We have visually inspected B- and V-band images and identified 344 candidates in 71 galaxy clusters of the OMEGAWINGS+WINGS sample and 75 candidates in groups and lower mass structures in the PM2GC sample. We present the atlas of stripping candidates and a first analysis of their environment and their basic properties, such as morphologies, star formation rates and galaxy stellar masses. Candidates are found in all clusters and at all clustercentric radii, and their number does not correlate with the cluster velocity dispersion σ or X-ray luminosity L{sub X}. Interestingly, convincing cases of candidates are also found in groups and lower mass halos (10{sup 11}−10{sup 14}M{sub ⊙}), although the physical mechanism at work needs to be securely identified. All the candidates are disky, have stellar masses ranging from log M/M{sub ⊙} < 9 to > 11.5 and the majority of them form stars at a rate that is on average a factor of 2 higher (2.5σ) compared to non-stripped galaxies of similar mass. The few post-starburst and passive candidates have weak stripping evidence. We conclude that disturbed morphologies suggestive of stripping phenomena are ubiquitous in clusters and could be present even in groups and low mass halos. Further studies will reveal the physics of the gas stripping and clarify the mechanisms at work.

  9. Jellyfish Galaxy Candidates at Low Redshift

    Science.gov (United States)

    Poggianti, B. M.; Fasano, G.; Omizzolo, A.; Gullieuszik, M.; Bettoni, D.; Moretti, A.; Paccagnella, A.; Jaffé, Y. L.; Vulcani, B.; Fritz, J.; Couch, W.; D'Onofrio, M.

    2016-03-01

    Galaxies that are being stripped of their gas can sometimes be recognized from their optical appearance. Extreme examples of stripped galaxies are the so-called “jellyfish galaxies” that exhibit tentacles of debris material with a characteristic jellyfish morphology. We have conducted the first systematic search for galaxies that are being stripped of their gas at low-z (z = 0.04-0.07) in different environments, selecting galaxies with varying degrees of morphological evidence for stripping. We have visually inspected B- and V-band images and identified 344 candidates in 71 galaxy clusters of the OMEGAWINGS+WINGS sample and 75 candidates in groups and lower mass structures in the PM2GC sample. We present the atlas of stripping candidates and a first analysis of their environment and their basic properties, such as morphologies, star formation rates and galaxy stellar masses. Candidates are found in all clusters and at all clustercentric radii, and their number does not correlate with the cluster velocity dispersion σ or X-ray luminosity LX. Interestingly, convincing cases of candidates are also found in groups and lower mass halos (1011-1014M⊙), although the physical mechanism at work needs to be securely identified. All the candidates are disky, have stellar masses ranging from log M/M⊙ 11.5 and the majority of them form stars at a rate that is on average a factor of 2 higher (2.5σ) compared to non-stripped galaxies of similar mass. The few post-starburst and passive candidates have weak stripping evidence. We conclude that disturbed morphologies suggestive of stripping phenomena are ubiquitous in clusters and could be present even in groups and low mass halos. Further studies will reveal the physics of the gas stripping and clarify the mechanisms at work.

  10. Identification of genes from the Treacher Collins candidate region

    Energy Technology Data Exchange (ETDEWEB)

    Dixon, M.; Dixon, J.; Edwards, S. [Univ. of California, Irvine, CA (United States)]|[Univ. of Manchester (United Kingdom)] [and others

    1994-09-01

    Treacher Collins syndrome (TCOF1) is an autosomal dominant disorder of craniofacial development. The TCOF1 locus has previously been mapped to chromosome 5q32-33. The candidate gene region has been defined as being between two flanking markers, ribosomal protein S14 (RPS14) and Annexin 6 (ANX6), by analyzing recombination events in affected individuals. It is estimated that the distance between these flanking markers is 500 kb by three separate analysis methods: (1) radiation hybrid mapping; (2) genetic linkage; and (3) YAC contig analysis. A cosmid contig which spans the candidate gene region for TCOF1 has been constructed by screening the Los Alamos National Laboratory flow-sorted chromosome 5 cosmid library. Cosmids were obtained by using a combination of probes generated from YAC end clones, Alu-PCR fragments from YACs, and asymmetric PCR fragments from both T7 and T3 cosmid ends. Exon amplifications, the selection of genomic coding sequences based upon the presence of functional splice acceptor and donor sites, was used to identify potential exon sequences. Sequences found to be conserved between species were then used to screen cDNA libraries in order to identify candidate genes. To date, four different cDNAs have been isolated from this region and are being analyzed as potential candidate genes for TCOF1. These include the genes encoding plasma glutathione peroxidase (GPX3), heparin sulfate sulfotransferase (HSST), a gene with homology to the ETS family of proteins and one which shows no homology to any known genes. Work is also in progress to identify and characterize additional cDNAs from the candidate gene region.

  11. Identification of candidate genome regions controlling disease resistance in Arachis

    Directory of Open Access Journals (Sweden)

    Pike Jodie

    2009-08-01

    Full Text Available Abstract Background Worldwide, diseases are important reducers of peanut (Arachis hypogaea yield. Sources of resistance against many diseases are available in cultivated peanut genotypes, although often not in farmer preferred varieties. Wild species generally harbor greater levels of resistance and even apparent immunity, although the linkage of agronomically un-adapted wild alleles with wild disease resistance genes is inevitable. Marker-assisted selection has the potential to facilitate the combination of both cultivated and wild resistance loci with agronomically adapted alleles. However, in peanut there is an almost complete lack of knowledge of the regions of the Arachis genome that control disease resistance. Results In this work we identified candidate genome regions that control disease resistance. For this we placed candidate disease resistance genes and QTLs against late leaf spot disease on the genetic map of the A-genome of Arachis, which is based on microsatellite markers and legume anchor markers. These marker types are transferable within the genus Arachis and to other legumes respectively, enabling this map to be aligned to other Arachis maps and to maps of other legume crops including those with sequenced genomes. In total, 34 sequence-confirmed candidate disease resistance genes and five QTLs were mapped. Conclusion Candidate genes and QTLs were distributed on all linkage groups except for the smallest, but the distribution was not even. Groupings of candidate genes and QTLs for late leaf spot resistance were apparent on the upper region of linkage group 4 and the lower region of linkage group 2, indicating that these regions are likely to control disease resistance.

  12. Evaluating historical candidate genes for schizophrenia.

    Science.gov (United States)

    Farrell, M S; Werge, T; Sklar, P; Owen, M J; Ophoff, R A; O'Donovan, M C; Corvin, A; Cichon, S; Sullivan, P F

    2015-05-01

    Prior to the genome-wide association era, candidate gene studies were a major approach in schizophrenia genetics. In this invited review, we consider the current status of 25 historical candidate genes for schizophrenia (for example, COMT, DISC1, DTNBP1 and NRG1). The initial study for 24 of these genes explicitly evaluated common variant hypotheses about schizophrenia. Our evaluation included a meta-analysis of the candidate gene literature, incorporation of the results of the largest genomic study yet published for schizophrenia, ratings from informed researchers who have published on these genes, and ratings from 24 schizophrenia geneticists. On the basis of current empirical evidence and mostly consensual assessments of informed opinion, it appears that the historical candidate gene literature did not yield clear insights into the genetic basis of schizophrenia. A likely reason why historical candidate gene studies did not achieve their primary aims is inadequate statistical power. However, the considerable efforts embodied in these early studies unquestionably set the stage for current successes in genomic approaches to schizophrenia.

  13. Extracting definition candidates from specialized corpora

    Directory of Open Access Journals (Sweden)

    Senja Pollak

    2014-07-01

    Full Text Available Human knowledge is available in different forms, including domain texts, terminological dictionaries, encyclopaediae, and recently also in computer- understandable representations of domain knowledge, such as taxonomies and ontologies. Since manual domain modeling is costly and time-consuming, researchers in human language technologies have started developing methods and tools for semi-automatic extraction of domain-specific knowledge from unstructured texts, involving tasks, such as terminology extraction, definition extraction, semantic relations extraction, or semi-automatic ontology building. This article presents a methodology for definition extraction from domain corpora, currently available for Slovene and English. Since most of the existing methods and tools are language specific and not developed for minor languages, the main contribution of the dissertation is the developed definition extraction methodology for Slovene. The proposed definition extraction methodology is based on three different approaches to extracting definition candidates. The first follows the traditional pattern-based approach, in which patterns are composed of lemmas and morphosyntactic descriptions; the second approach relies on pairs of domain terms extracted through automatic term extraction; the third approach exploits wordnet hypernym pairs. We propose an original combination of the three approaches. The developed methodology was applied to a real-case problem of modeling the language technologies domain, for which we constructed a comparable Slovene- English corpus consisting of about two million tokens. We extracted more than 3,400 definition candidates, of which over 700 (approximately 480 for Slovene and 230 for English were evaluated as definitions. The results are used as a basis for the Language Technologies Glossary.17 An additional contribution is the proposed domain-modeling pipeline—from corpus uploading and preprocessing to inspecting the

  14. Characterization for Fusion Candidate Vanadium Alloys

    Institute of Scientific and Technical Information of China (English)

    T. Muroga; T. Nagasaka; J. M. Chen; Z. Y. Xu; Q. Y. Huang; y. C. Wu

    2004-01-01

    This paper summarizes recent achievements in the characterization of candidate vanadium alloys obtained for fusion in the framework of the Japan-China Core University Program.National Institute for Fusion Science (NIFS) has a program of fabricating high-purity V-4Cr4Ti alloys. The resulting products (NIFS-HEAT-1,2), were characterized by various research groups in the world including Chinese partners. South Western Institute of Physics (SWIP) fabricated a new V-4Cr-4Ti alloy (SWIP-Heat), and carried out a comparative evaluation of hydrogen embrittlement of NIFS-HEATs and SWIP-Heat. The tensile test of hydrogen-doped alloys showed that the NIFS-HEAT maintained the ductility to relatively high hydrogen levels.The comparison of the data with those of previous studies suggested that the reduced oxygen level in the NIFS-HEATs should be responsible for the increased resistance to hydrogen embrittlement.Based on the chemical analysis data of NIFS-HEATs and SWIP-Heats, neutron-induced activation was analyzed in Institute of Plasma Physics (IPP-CAS) as a function of cooling time after the use in the fusion first wall. The results showed that the low level of Co dominates the activity up to 50 years followed by a domination of Nb or Nb and Al in the respective alloys. It was suggested that reduction of Co and Nb, both of which are thought to have been introduced via cross-contamination into the alloys from the molds used should be crucial for reducing further the activation.

  15. Interviews with candidates for president transmitted

    Directory of Open Access Journals (Sweden)

    Wilson Gomes

    2012-07-01

    Full Text Available In election years, television interviews with presidential candidates, broadcast live, i.e. without the use of editing, have become an important genre of journalistic representation in Brazilian political campaigns. These interviews are conducted in network studios by well-known Brazilian news anchors. The fact that these interviews are transmitted directly to the electorate in an unedited form is generally offered as a guarantee of a genuine, authentic portrayal of the candidates themselves. The present work proposes that live network candidate interviews, rather than a means of political presentation on television, are actually an arena in which the institution of journalism attempts to use rhetorical and argumentative means to control the candidates’ discourse without relying on the traditional advantages conferred in daily news coverage.

  16. Evaluation and selection of candidate high-level waste forms

    Energy Technology Data Exchange (ETDEWEB)

    Bernadzikowski, T. A.; Allender, J. S.; Butler, J. L.; Gordon, D. E.; Gould, Jr., T. H.; Stone, J. A.

    1982-03-01

    Seven candidate waste forms being developed under the direction of the Department of Energy's National High-Level Waste (HLW) Technology Program, were evaluated as potential media for the immobilization and geologic disposal of high-level nuclear wastes. The evaluation combined preliminary waste form evaluations conducted at DOE defense waste-sites and independent laboratories, peer review assessments, a product performance evaluation, and a processability analysis. Based on the combined results of these four inputs, two of the seven forms, borosilicate glass and a titanate based ceramic, SYNROC, were selected as the reference and alternative forms for continued development and evaluation in the National HLW Program. Both the glass and ceramic forms are viable candidates for use at each of the DOE defense waste-sites; they are also potential candidates for immobilization of commercial reprocessing wastes. This report describes the waste form screening process, and discusses each of the four major inputs considered in the selection of the two forms.

  17. New Young Star Candidates in CG4 and Sa101

    CERN Document Server

    Rebull, L M; Hoette, V; Kim, J S; Laine, S; Foster, M; Laher, R; Legassie, M; Mallory, C R; McCarron, K; Sherry, W H

    2011-01-01

    The CG4 and Sa101 regions together cover a region of ~0.5 square degree in the vicinity of a "cometary globule" that is part of the Gum Nebula. There are seven previously identified young stars in this region; we have searched for new young stars using mid- and far-infrared data (3.6 to 70 microns) from the Spitzer Space Telescope, combined with ground-based optical data and near-infrared data from the Two-Micron All-Sky Survey (2MASS). We find infrared excesses in all 6 of the previously identified young stars in our maps, and we identify 16 more candidate young stars based on apparent infrared excesses. Most (73%) of the new young stars are Class II objects. There is a tighter grouping of young stars and young star candidates in the Sa101 region, in contrast to the CG4 region, where there are fewer young stars and young star candidates, and they are more dispersed. Few likely young objects are found in the "fingers" of the dust being disturbed by the ionization front from the heart of the Gum Nebula.

  18. A novel live-attenuated vaccine candidate for mayaro Fever.

    Directory of Open Access Journals (Sweden)

    William J Weise

    2014-08-01

    Full Text Available Mayaro virus (MAYV is an emerging, mosquito-borne alphavirus that causes a dengue-like illness in many regions of South America, and which has the potential to urbanize. Because no specific treatment or vaccine is available for MAYV infection, we capitalized on an IRES-based approach to develop a live-attenuated MAYV vaccine candidate. Testing in infant, immunocompetent as well as interferon receptor-deficient mice demonstrated a high degree of attenuation, strong induction of neutralizing antibodies, and efficacy against lethal challenge. This vaccine strain was also unable to infect mosquito cells, a major safety feature for a live vaccine derived from a mosquito-borne virus. Further preclinical development of this vaccine candidate is warranted to protect against this important emerging disease.

  19. A novel live-attenuated vaccine candidate for mayaro Fever.

    Science.gov (United States)

    Weise, William J; Hermance, Meghan E; Forrester, Naomi; Adams, A Paige; Langsjoen, Rose; Gorchakov, Rodion; Wang, Eryu; Alcorn, Maria D H; Tsetsarkin, Konstantin; Weaver, Scott C

    2014-08-01

    Mayaro virus (MAYV) is an emerging, mosquito-borne alphavirus that causes a dengue-like illness in many regions of South America, and which has the potential to urbanize. Because no specific treatment or vaccine is available for MAYV infection, we capitalized on an IRES-based approach to develop a live-attenuated MAYV vaccine candidate. Testing in infant, immunocompetent as well as interferon receptor-deficient mice demonstrated a high degree of attenuation, strong induction of neutralizing antibodies, and efficacy against lethal challenge. This vaccine strain was also unable to infect mosquito cells, a major safety feature for a live vaccine derived from a mosquito-borne virus. Further preclinical development of this vaccine candidate is warranted to protect against this important emerging disease.

  20. Pedophiles and stalkers as transplant candidates: one program's experience.

    Science.gov (United States)

    Paris, Wayne; Miller, Rachel; Hille, Cheryl; Nour, Bakr; Griggs, Johnny

    2005-12-01

    Transplant assessment of pedophiles and stalkers presents a challenge for clinicians and requires the ability to separate the science from the hysteria. Although rarely seen in organ transplant clinics, the presence of psychosexual disorders can result in both criminal charges and harsh societal reactions. Clinicians must be able to assess and make informed recommendations about the suitability of the candidate and any potential risks for staff, other patients, and society at large. Six patients (5 pedophiles and 1 stalker) were assessed at our major regional multiorgan transplant program; each patient presented with unique and challenging assessment, treatment, and selection issues for the transplant team. The objectives of this article are to raise awareness of the issues associated with pedophiles and stalkers, and to provide the basis for better-informed discussions based on one program's struggles with its candidate selection and follow-up.

  1. A thermodynamic approach to the affinity optimization of drug candidates.

    Science.gov (United States)

    Freire, Ernesto

    2009-11-01

    High throughput screening and other techniques commonly used to identify lead candidates for drug development usually yield compounds with binding affinities to their intended targets in the mid-micromolar range. The affinity of these molecules needs to be improved by several orders of magnitude before they become viable drug candidates. Traditionally, this task has been accomplished by establishing structure activity relationships to guide chemical modifications and improve the binding affinity of the compounds. As the binding affinity is a function of two quantities, the binding enthalpy and the binding entropy, it is evident that a more efficient optimization would be accomplished if both quantities were considered and improved simultaneously. Here, an optimization algorithm based upon enthalpic and entropic information generated by Isothermal Titration Calorimetry is presented.

  2. Planetary transit candidates in COROT-IRa01 field

    CERN Document Server

    Carpano, S; Alonso, R; Barge, P; Aigrain, S; Almenara, J -M; Bordé, P; Bouchy, F; Carone, L; Deeg, H J; De la Reza, R; Deleuil, M; Dvorak, R; Erikson, A; Fressin, F; Fridlund, M; Gondoin, P; Guillot, T; Hatzes, A; Jorda, L; Lammer, H; Léger, A; Llebaria, A; Magain, P; Moutou, C; Ofir, A; Ollivier, M; Pacheco, E J; Pátzold, M; Pont, F; Queloz, D; Rauer, H; Régulo, C; Renner, S; Rouan, D; Samuel, B; Schneider, J; Wuchterl, G

    2009-01-01

    Context: CoRoT is a pioneering space mission devoted to the analysis of stellar variability and the photometric detection of extrasolar planets. Aims: We present the list of planetary transit candidates detected in the first field observed by CoRoT, IRa01, the initial run toward the Galactic anticenter, which lasted for 60 days. Methods: We analysed 3898 sources in the coloured bands and 5974 in the monochromatic band. Instrumental noise and stellar variability were taken into account using detrending tools before applying various transit search algorithms. Results: Fifty sources were classified as planetary transit candidates and the most reliable 40 detections were declared targets for follow-up ground-based observations. Two of these targets have so far been confirmed as planets, COROT-1b and COROT-4b, for which a complete characterization and specific studies were performed.

  3. Development of Polypeptide-based Nanoparticles for Non-viral Delivery of CD22 RNA Trans-splicing Molecule as a New Precision Medicine Candidate Against B-lineage ALL

    Directory of Open Access Journals (Sweden)

    Fatih M. Uckun

    2015-07-01

    Full Text Available CD22ΔE12 has emerged as a driver lesion in the pathogenesis of pediatric B-lineage acute lymphoblastic leukemia (ALL and a new molecular target for RNA therapeutics. Here we report a 43-gene CD22ΔE12 signature transcriptome that shows a striking representation in primary human leukemia cells from patients with relapsed BPL. Our data uniquely indicate that CD22ΔE12 is a candidate driver lesion responsible for the activation of MAPK and PI3-K pathways in aggressive forms of B-lineage ALL. We also show that the forced expression of a CD22 RNA trans-splicing molecule (RTM markedly reduces the capacity of the leukemic stem cell fraction of CD22ΔE12+ B-lineage ALL cells to engraft and cause overt leukemia in NOD/SCID mice. We have successfully complexed our rationally designed lead CD22-RTM with PVBLG-8 to prepare a non-viral nanoscale formulation of CD22ΔE12-RTM with potent anti-cancer activity against CD22ΔE12+ B-lineage leukemia and lymphoma cells. CD22-RTM nanoparticles effectively delivered the CD22-RTM cargo into B-lineage ALL cells and exhibited significant anti-leukemic activity in vitro.

  4. Candidate genes for drought tolerance and improved productivity in rice (Oryza sativa L.)

    Indian Academy of Sciences (India)

    M S Vinod; Naveen Sharma; K Manjunatha; Adnan Kanbar; N B Prakash; H E Shashidhar

    2006-03-01

    Candidate genes are sequenced genes of known biological action involved in the development or physiology of a trait. Twenty-one putative candidate genes were designed after an exhaustive search in the public databases along with an elaborate literature survey for candidate gene products and/or regulatory sequences associated with enhanced drought resistance. The downloaded sequences were then used to design primers considering the flanking sequences as well. Polymerase chain reaction (PCR) performed on 10 diverse cultivars that involved Japonica, Indica and local accessions, revealed 12 polymorphic candidate genes. Seven polymorphic candidate genes were then utilized to genotype 148 individuals of CT9993 × IR62266 doubled haploid (DH) mapping population. The segregation data were tested for deviation from the expected Mendelian ratio (1:1) using a Chi-square test (<1%). Based on this, four candidate genes were assessed to be significant and the remaining three, as non-significant. All the significant candidate genes were biased towards CT9993, the female parent in the DH mapping population. Single-marker analysis strongly associated ( < 1%) them to different traits under both well-watered and low-moisture stress conditions. Two candidate genes, EXP15 and EXP13, were found to be associated with root number and silicon content in the stem respectively, under both well-watered and low-moisture stress conditions.

  5. A double candidate survivable routing protocol for HAP network

    Science.gov (United States)

    He, Panfeng; Li, Chunyue; Ni, Shuyan

    2016-11-01

    To improve HAP network invulnerability, and at the same time considering the quasi-dynamic topology in HAP network, a simple and reliable routing protocol is proposed in the paper. The protocol firstly uses a double-candidate strategy for the next-node select to provide better robustness. Then during the maintenance stage, short hello packets instead of long routing packets are used only to check link connectivity in the quasi-dynamic HAP network. The route maintenance scheme based on short hello packets can greatly reduce link spending. Simulation results based on OPNET demonstrate the effectiveness of the proposed routing protocol.

  6. Candidal Leukoplakia on Patient with Removable Denture

    Directory of Open Access Journals (Sweden)

    Shiril Paskalis

    2013-07-01

    Full Text Available Candida infection is a common problem in patients using removable dentures, with the most frequent type is denture stomatitis. But other type of candidal infection could also happen in these patients, such as candidal leukoplakia. We reported a 61 years old female patient who complained a painful lesion under her lower removable denture. Oral examination revealed white plaque that could not be rubbed over an ulcer on the lingual part of alveolar processes under the lower removable denture plate, and also an erythematous area on palatum durum above the upper full denture. The patient was suspected to have candidal leukoplakia on the lingual part of the mandible and denture stomatitis on the palate area. The treatment consisted of nystatin oral suspension, chlorhexidine solution, multivitamins, along with denture replacement and oral health education. The entire lesion resolved within 2 months therapy. Candidal infection treatment on denture patient needs not only medication or denture replacement, but also patient compliance to achieve maximal result.

  7. Fuzzy Treatment of Candidate Outliers in Measurements

    Directory of Open Access Journals (Sweden)

    Giampaolo E. D'Errico

    2012-01-01

    Full Text Available Robustness against the possible occurrence of outlying observations is critical to the performance of a measurement process. Open questions relevant to statistical testing for candidate outliers are reviewed. A novel fuzzy logic approach is developed and exemplified in a metrology context. A simulation procedure is presented and discussed by comparing fuzzy versus probabilistic models.

  8. Candidate genes in ocular dominance plasticity

    NARCIS (Netherlands)

    M.L. Rietman; J.-P. Sommeijer; C.N. Levelt; J.A. Heimel; A.B. Brussaard; J.G.G. Borst; Y. Elgersma; N. Galjart; G.T. van der Horst; C.M. Pennartz; A.B. Smit; B.M. Spruijt; M. Verhage; C.I. de Zeeuw

    2012-01-01

    Many studies have been devoted to the identification of genes involved in experience-dependent plasticity in the visual cortex. To discover new candidate genes, we have reexamined data from one such study on ocular dominance (OD) plasticity in recombinant inbred BXD mouse strains. We have correlated

  9. Secondary Teacher Candidates' Lesson Planning Learning

    Science.gov (United States)

    Santoyo, Christina; Zhang, Shaoan

    2016-01-01

    Teacher candidates (TCs) use clinical experiences to enact concepts taught in their university courses; therefore field experiences may be the most important component of teacher preparation (Hammerness et al., 2005). TCs require support and guidance as they learn to adapt curriculum materials for effective use in the classroom (Davis, 2006). They…

  10. Teacher Candidate Portfolios: Routine or Reflective Action?

    Science.gov (United States)

    McIntyre, Christie; Dangel, Julie Rainer

    2009-01-01

    Documentation is sparse regarding outcomes associated with teacher education portfolios and the quality of the reflections contained within the portfolios. This collective case study of six teacher candidates enrolled in an elementary teacher education program at a large midwestern university explores the outcomes of developing a portfolio based…

  11. Emotional Intelligence and Beginning Teacher Candidates

    Science.gov (United States)

    Justice, Madeline; Espinoza, Sue

    2007-01-01

    According to the Bureau of Labor Statistics, Texas will need over 82,000 new teachers by 2008. Many teachers are leaving the profession within 5 years of being employed. Closing a revolving door, teacher preparation programs are discussing this phenomenon. One hundred sixty beginning teacher candidates were surveyed using the Emotional Skills…

  12. Spectroscopy of Hyades L dwarf candidates

    CERN Document Server

    Lodieu, N; Bejar, V J S

    2014-01-01

    We present the results of photometric, astrometric, and spectroscopic follow-up of L dwarf candidates identified in the Hyades cluster by Hogan et al. (2008). We obtained low-resolution optical spectroscopy with the OSIRIS spectrograph on the Gran Telescopio de Canarias for all 12 L dwarf candidates as well as new J-band imaging for a subsample of eight to confirm their proper motion. We also present mid-infrared photometry from the Wise Field Infrared Survey Explorer (WISE) for the Hyades L and T dwarf candidates and estimate their spectroscopic distances, effective temperatures, and masses. We confirm the cool nature of several L dwarf candidates and confirm astrometrically their membership, bridging the gap between the coolest M dwarfs and the two T dwarfs previously reported in the Hyades cluster. These members represent valuable spectral templates at an age of 625 Myr and slightly super solar metallicity (Fe/H=+0.13). We update the Hyades mass function across the hydrogen-burning limit and in the substel...

  13. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.;

    2012-01-01

    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing ...

  14. Towards Treating Chemistry Teacher Candidates as Human

    Science.gov (United States)

    Lewthwaite, Brian Ellis

    2008-01-01

    This research inquiry investigates the factors influencing chemistry teacher candidates' development during their extended practica in the second and final year of an After-Degree Bachelor of Education at a university in central Canada. A variety of data sources are used to identify the risk and protective factors impeding and contributing to the…

  15. Promoting Team Leadership Skills in Doctoral Candidates

    Science.gov (United States)

    Suleiman, Mahmoud; Whetton, Danny

    2014-01-01

    Doctoral programs can serve as an optimal opportunity for candidates to engage in tasks and activities to transform them and their schools. The paradigm shifts in such preparation involve moving from sitting and getting to making and taking. Most importantly, it requires building leadership skills and styles necessary to bring about desired change…

  16. Teacher Candidate Disposition: Moral Judgement or Regurgitation?

    Science.gov (United States)

    Johnson, Lisa E.

    2008-01-01

    Developing teacher candidates who are able to make moral judgements to equitably resolve classroom dilemmas, conduct student assessment and allocate resources is critical for today's diverse classrooms and should be part of fostering professional disposition. However, one challenge of incorporating dispositions in teacher education and a valid…

  17. Gallium-67 imaging in candidal esophagitis

    Energy Technology Data Exchange (ETDEWEB)

    Rundback, J.H.; Goldfarb, C.R.; Ongseng, F. (Beth Israel Medical Center, New York, NY (USA))

    1990-01-01

    Ga-67 scanning has been used to evaluate esophageal carcinoma. It has demonstrated candidal infection in other body sites and, in one previous case, in the esophagus. The authors present a case of diffuse esophageal uptake of Ga-67 in esophageal candidiasis.

  18. 76 FR 36130 - Call for Candidates

    Science.gov (United States)

    2011-06-21

    ... From the Federal Register Online via the Government Publishing Office FEDERAL ACCOUNTING STANDARDS ADVISORY BOARD Call for Candidates AGENCY: Federal Accounting Standards Advisory Board. ACTION: Request for... Accounting Standards Advisory Board (FASAB or the Board) with the requested materials in response to...

  19. 11 CFR 9003.2 - Candidate certifications.

    Science.gov (United States)

    2010-01-01

    ... excess of the aggregate payments to which they will be entitled under 11 CFR part 9004. (2) That no... funds under 11 CFR 9003.2(c)(3) shall not count against such candidate's $50,000 expenditure limitation... expenditures in excess of the limitations of 11 CFR 110.8(a), the Commission may seek civil penalties under...

  20. Candidate genes in ocular dominance plasticity

    Directory of Open Access Journals (Sweden)

    M. Liset Rietman

    2012-02-01

    Full Text Available The objective of this study was to identify new candidate genes involved in experience-dependent plasticity. To this aim, we combined previously obtained data from recombinant inbred BXD strains on ocular dominance (OD plasticity and gene expression levels in the neocortex. We validated our approach using a list of genes which alter OD plasticity when inactivated. The expression levels of one fifth of these genes correlated with the amount of OD plasticity. Moreover, the two genes with the highest relative inter-strain differences were among the correlated genes. This suggests that correlation between gene expression levels and OD plasticity is indeed likely to point to genes with a causal role in modulating or generating plasticity in the visual cortex. After this validation on known plasticity genes, we identified new candidate genes by a multi-step approach. First, a list was compiled of all genes of which the expression level in BXD strains correlate with the amount of OD plasticity. To narrow this list to the more promising candidates, we took its cross-section with a list of genes co-regulated with the sensitive period for OD plasticity and a list of genes associated with pathways implicated in OD plasticity. This analysis resulted in a list of 32 candidate genes. The list contained unproven, but not surprising, candidates, such as the genes for IGF-1, NCAM1, NOGO-A, the gamma2 subunit of the GABA(A receptor, acetylcholine esterase and the catalytic subunit of cAMP-dependent protein kinase A. This was indicative of the viability of our approach, but more interesting were the novel candidate genes: Akap7, Akt1, Camk2d, Cckbr, Cd44, Crim1, Ctdsp2, Dnajc5, Gnai1, Itpka, Mapk8, Nbea, Nfatc3, Nlk, Npy5r, Phf21a, Phip, Ppm1l, Ppp1r1b, Rbbp4, Slc1a3, Slit2, Socs2, Spock3, St8sia1, Zfp207. The possible role of some of these candidates is discussed in the article.

  1. Searches for millisecond pulsar candidates among the unidentified Fermi objects

    CERN Document Server

    Hui, C Y; Hu, C P; Lin, L C C; Li, K L; Kong, A K H; Tam, P H T; Takata, J; Cheng, K S; Jin, Ruolan; Yen, T -C; Kim, Chunglee

    2015-01-01

    Here we report the results of searching millisecond pulsar (MSP) candidates from the Fermi LAT second source catalog (2FGL). Seven unassociated $\\gamma-$ray sources in this catalog are identified as promising MSP candidates based on their $\\gamma$-ray properties. Through the X-ray analysis, we have detected possible X-ray counterparts, localized to an arcsecond accuracy. We have systematically estimated their X-ray fluxes and compared with the corresponding $\\gamma$-ray fluxes. The X-ray to $\\gamma$-ray flux ratios for 2FGL J1653.6-0159 and 2FGL J1946.4-5402 are comparable with the typical value for pulsars. For 2FGL J1625.2-0020, 2FGL J1653.6-0159 and 2FGL J1946.4-5402, their candidate X-ray counterparts are bright enough for performing a detailed spectral and temporal analysis to discriminate their thermal/non thermal nature and search for the periodic signal. We have also searched for possible optical/IR counterparts at the X-ray positions. For the optical/IR source coincident with the brightest X-ray obje...

  2. Candidate z~8-9 Galaxies from WFC3 Imaging

    CERN Document Server

    Lorenzoni, Silvio; Wilkins, Stephen; Stanway, Elizabeth; Jarvis, Matt; Caruana, Joseph

    2010-01-01

    We present a search for galaxies at 7.5based on the Lyman-break technique. We search for galaxies which have large (Y-J) colours (Y-drops) on account of the Lyman-alpha forest absorption, and with (J-H) colours inconsistent with being low-redshift contaminants. We identify 22 candidates at redshift z~8-9 over an area of ~50 square arcminutes. Previous searches for Y-drops with WFC3 have focussed only on the Hubble Ultra Deep Field (HUDF), and our larger survey (involving two other nearby deep fields and a wider area survey) has trebelled the number of robust Y-drop candidates. For the first time, we have sufficient Z~8-9 galaxies to fit a both phi* and M* of the UV Schechter luminosity function. There is evidence for evolution in this luminosity function from z=6-7 to z=8-9, in the sense that there are fewer UV-bright galaxies at z~8-9, consistent with an evolution mainly in M*. The candidate z~8-9 galaxies we detect have insufficient ionizing flux to ...

  3. Candidate genes for idiopathic epilepsy in four dog breeds

    Directory of Open Access Journals (Sweden)

    Mickelson James R

    2011-04-01

    Full Text Available Abstract Background Idiopathic epilepsy (IE is a naturally occurring and significant seizure disorder affecting all dog breeds. Because dog breeds are genetically isolated populations, it is possible that IE is attributable to common founders and is genetically homogenous within breeds. In humans, a number of mutations, the majority of which are genes encoding ion channels, neurotransmitters, or their regulatory subunits, have been discovered to cause rare, specific types of IE. It was hypothesized that there are simple genetic bases for IE in some purebred dog breeds, specifically in Vizslas, English Springer Spaniels (ESS, Greater Swiss Mountain Dogs (GSMD, and Beagles, and that the gene(s responsible may, in some cases, be the same as those already discovered in humans. Results Candidate genes known to be involved in human epilepsy, along with selected additional genes in the same gene families that are involved in murine epilepsy or are expressed in neural tissue, were examined in populations of affected and unaffected dogs. Microsatellite markers in close proximity to each candidate gene were genotyped and subjected to two-point linkage in Vizslas, and association analysis in ESS, GSMD and Beagles. Conclusions Most of these candidate genes were not significantly associated with IE in these four dog breeds, while a few genes remained inconclusive. Other genes not included in this study may still be causing monogenic IE in these breeds or, like many cases of human IE, the disease in dogs may be likewise polygenic.

  4. Sensitive radio survey of obscured quasar candidates

    Science.gov (United States)

    Alexandroff, Rachael M.; Zakamska, Nadia L.; van Velzen, Sjoert; Greene, Jenny E.; Strauss, Michael A.

    2016-12-01

    We study the radio properties of moderately obscured quasars in samples at both low (z ˜ 0.5) and high (z ˜ 2.5) redshift to understand the role of radio activity in accretion, using the Karl G. Jansky Very Large Array (VLA) at 6.0 GHz and 1.4 GHz. Our z ˜ 2.5 sample consists of optically selected obscured quasar candidates, all of which are radio-quiet, with typical radio luminosities of νLν[1.4 GHz] ≲ 1040 erg s-1. Only a single source is individually detected in our deep (rms˜10 μJy) exposures. This population would not be identified by radio-based selection methods used for distinguishing dusty star-forming galaxies and obscured active nuclei. In our pilot A-array study of z ˜ 0.5 radio-quiet quasars, we spatially resolve four of five objects on scales ˜5 kpc and find they have steep spectral indices with an average value of α = -0.75. Therefore, radio emission in these sources could be due to jet-driven or radiatively driven bubbles interacting with interstellar material on the scale of the host galaxy. Finally, we also study the additional population of ˜200 faint ( ˜ 40 μJy-40 mJy) field radio sources observed over ˜120 arcmin2 of our data. 60 per cent of these detections (excluding our original targets) are matched in the Sloan Digital Sky Survey (SDSS) and/or Wide-Field Infrared Survey Explorer (WISE) and are, in roughly equal shares, active galactic nuclei (AGN) at a broad range of redshifts, passive galaxies with no other signs of nuclear activity and infrared-bright but optically faint sources. Spectroscopically or photometrically confirmed star-forming galaxies constitute only a small minority of the matches. Such sensitive radio surveys allow us to address important questions of AGN evolution and evaluate the AGN contribution to the radio-quiet sky.

  5. Moving candidate vaccines into development from research: lessons from HIV.

    Science.gov (United States)

    Sullivan, Mark

    2009-07-01

    There is a logarithmic increase in the cost and complexity of the research and development process when transitioning a promising candidate vaccine from the laboratory into the clinic. Managing complex development programs involving people from diverse technical, cultural and geographical backgrounds is a specialised skill. It is essential that the group is clear on their objectives and how their activities affect others, that communication is open, inclusive and effective, and that the most rigorous, scientific approach based on statistical principles in compliance with regulatory requirements is used. Applying these standards to all vaccine development programs will filter out inappropriate candidates more readily and enhance the efficiency of vaccine development. The challenges of developing a new vaccine are illustrated in human immunodeficiency virus (HIV) vaccinology. Selecting vaccine candidates for HIV requires the ability to evaluate the large number of potential antigens in imperfect and non-standardised animal models. Further, using these models to evaluate questions such as dose scaling to humans, optimal route of administration, the use of adjuvants and potential formulation improvements adds variable to variable, making the interpretation of results particularly challenging. This may lead to the promotion of a poor candidate or the elimination of a good one. The absence of precise immunological correlates of protection and the prohibitive cost of confirmatory clinical trials are further significant barriers. However, there are practical steps that can be taken to standardise early vaccine evaluation, which would result in more efficient development of new vaccines for HIV and other disease areas with similarly challenging development issues (such as hepatitis C virus, influenza, Mycobacterium tuberculosis and malaria).

  6. Mapping of Candidate Genes Involved in Bud Dormancy and Flowering Time in Sweet Cherry (Prunus avium).

    Science.gov (United States)

    Castède, Sophie; Campoy, José Antonio; Le Dantec, Loïck; Quero-García, José; Barreneche, Teresa; Wenden, Bénédicte; Dirlewanger, Elisabeth

    2015-01-01

    The timing of flowering in perennial plants is crucial for their survival in temperate climates and is regulated by the duration of bud dormancy. Bud dormancy release and bud break depend on the perception of cumulative chilling during endodormancy and heat during the bud development. The objectives of this work were to identify candidate genes involved in dormancy and flowering processes in sweet cherry, their mapping in two mapping progenies 'Regina' × 'Garnet' and 'Regina' × 'Lapins', and to select those candidate genes which co-localized with quantitative trait loci (QTLs) associated with temperature requirements for bud dormancy release and flowering. Based on available data on flowering processes in various species, a list of 79 candidate genes was established. The peach and sweet cherry orthologs were identified and primers were designed to amplify sweet cherry candidate gene fragments. Based on the amplified sequences of the three parents of the mapping progenies, SNPs segregations in the progenies were identified. Thirty five candidate genes were genetically mapped in at least one of the two progenies and all were in silico mapped. Co-localization between candidate genes and QTLs associated with temperature requirements and flowering date were identified for the first time in sweet cherry. The allelic composition of the candidate genes located in the major QTL for heat requirements and flowering date located on linkage group 4 have a significant effect on these two traits indicating their potential use for breeding programs in sweet cherry to select new varieties adapted to putative future climatic conditions.

  7. Planetary Candidates Observed by \\ik V: Planet Sample from Q1-Q12 (36 Months)

    CERN Document Server

    Rowe, Jason F; Antoci, Victoria; Barclay, Thomas; Batalha, Natalie M; Borucki, William J; Burke, Christopher J; Bryson, Steven T; Caldwell, Douglas A; Campbell, Jennifer R; Catanzarite, Joseph H; Christiansen, Jessie L; Cochran, William; Gilliland, Ronald L; Girouard, Forrest R; Haas, Michael R; Helminiak, Krzysztof G; Henze, Christopher E; Hoffman, Kelsey L; Howell, Steve B; Huber, Daniel; Hunter, Roger C; Jang-Condell, Hannah; Jenkins, Jon M; Klaus, Todd C; Latham, David W; Li, Jie; Lissauer, Jack J; McCauliff, Sean D; Morris, Robert L; Mullally, F; Ofir, Aviv; Quarles, Billy; Quintana, Elisa; Sabale, Anima; Seader, Shawn; Shporer, Avi; Smith, Jeffrey C; Steffen, Jason H; Still, Martin; Tenenbaum, Peter; Thompson, Susan E; Twicken, Joseph D; Van Laerhoven, Christa; Wolfgang, Angie; Zamudio, Khadeejah A

    2015-01-01

    The Kepler mission discovered 2842 exoplanet candidates with 2 years of data. We provide updates to the Kepler planet candidate sample based upon 3 years (Q1-Q12) of data. Through a series of tests to exclude false-positives, primarily caused by eclipsing binary stars and instrumental systematics, 855 additional planetary candidates have been discovered, bringing the total number known to 3697. We provide revised transit parameters and accompanying posterior distributions based on a Markov Chain Monte Carlo algorithm for the cumulative catalogue of Kepler Objects of Interest. There are now 130 candidates in the cumulative catalogue that receive less than twice the flux the Earth receives and more than 1100 have a radius less than 1.5 Rearth. There are now a dozen candidates meeting both criteria, roughly doubling the number of candidate Earth analogs. A majority of planetary candidates have a high probability of being bonafide planets, however, there are populations of likely false-positives. We discuss and s...

  8. Most of the benefits from genomic selection can be realised by genotyping a proportion of selection candidates

    DEFF Research Database (Denmark)

    Henryon, Mark; Berg, Peer; Sørensen, Anders Christian

    2012-01-01

    We reasoned that there are diminishing marginal returns from genomic selection as the proportion of genotyped selection candidates is increased and breeding values based on a priori information are used to choose the candidates that are genotyped. We tested this premise by stochastic simulation...... of breeding schemes that resembled those used for pigs. We estimated rates of genetic gain and inbreeding realized by genomic selection in breeding schemes where candidates were phenotyped before genotyping and 0-100% of the candidates were genotyped based on predicted breeding values. Genotypings were...... allocated to male and female candidates at ratios of 100:0, 75:25, 50:50, 25:75, and 0:100. For genotyped candidates, a direct-genomic value (DGV) was sampled with reliabilities 0.10, 0.50, and 0.90. Ten sires and 300 dams with the highest breeding values after genotyping were selected at each generation...

  9. PLANETARY CANDIDATES OBSERVED BY KEPLER. III. ANALYSIS OF THE FIRST 16 MONTHS OF DATA

    Energy Technology Data Exchange (ETDEWEB)

    Batalha, Natalie M. [Department of Physics and Astronomy, San Jose State University, San Jose, CA 95192 (United States); Rowe, Jason F.; Burke, Christopher J.; Caldwell, Douglas A.; Mullally, Fergal; Thompson, Susan E. [SETI Institute/NASA Ames Research Center, Moffett Field, CA 94035 (United States); Bryson, Stephen T.; Christiansen, Jessie L. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Barclay, Thomas [Bay Area Environmental Research Institute/NASA Ames Research Center, Moffett Field, CA 94035 (United States); Brown, Timothy M. [Las Cumbres Observatory Global Telescope Network, Goleta, CA 93117 (United States); Dupree, Andrea K.; Latham, David W.; Quinn, Samuel N.; Ragozzine, Darin [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fabrycky, Daniel C.; Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95060 (United States); Ford, Eric B. [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Gilliland, Ronald L. [Center for Exoplanets and Habitable Worlds, The Pennsylvania State University, University Park, PA 16802 (United States); Isaacson, Howard; Marcy, Geoffrey W., E-mail: Natalie.Batalha@nasa.gov [Department of Astronomy, University of California Berkeley, Berkeley, CA 94720 (United States); and others

    2013-02-15

    New transiting planet candidates are identified in 16 months (2009 May-2010 September) of data from the Kepler spacecraft. Nearly 5000 periodic transit-like signals are vetted against astrophysical and instrumental false positives yielding 1108 viable new planet candidates, bringing the total count up to over 2300. Improved vetting metrics are employed, contributing to higher catalog reliability. Most notable is the noise-weighted robust averaging of multi-quarter photo-center offsets derived from difference image analysis that identifies likely background eclipsing binaries. Twenty-two months of photometry are used for the purpose of characterizing each of the candidates. Ephemerides (transit epoch, T {sub 0}, and orbital period, P) are tabulated as well as the products of light curve modeling: reduced radius (R {sub P}/R {sub *}), reduced semimajor axis (d/R {sub *}), and impact parameter (b). The largest fractional increases are seen for the smallest planet candidates (201% for candidates smaller than 2 R {sub Circled-Plus} compared to 53% for candidates larger than 2 R {sub Circled-Plus }) and those at longer orbital periods (124% for candidates outside of 50 day orbits versus 86% for candidates inside of 50 day orbits). The gains are larger than expected from increasing the observing window from 13 months (Quarters 1-5) to 16 months (Quarters 1-6) even in regions of parameter space where one would have expected the previous catalogs to be complete. Analyses of planet frequencies based on previous catalogs will be affected by such incompleteness. The fraction of all planet candidate host stars with multiple candidates has grown from 17% to 20%, and the paucity of short-period giant planets in multiple systems is still evident. The progression toward smaller planets at longer orbital periods with each new catalog release suggests that Earth-size planets in the habitable zone are forthcoming if, indeed, such planets are abundant.

  10. Diminishing Marginal Returns From Genomic Selection As More Selection Candidates Are Phenotyped

    DEFF Research Database (Denmark)

    Okeno, Tobias O; Henryon, Mark; Sørensen, Anders Christian

    We used stochastic simulation to test hypotheses that, (i) phenotyping proportion of high ranking selection candidates based on estimated breeding values (EBV) before genotyping could realize as much genetic gains as phenotyping all candidates, and (ii) there is diminishing return to selection...... as more candidates are phenotyped in genomic breeding programs. Three phenotyping criteria, namely, random (RS), EBV and true breeding value (TBV) were investigated under two schemes (across-population and within-litter) using traditional-BLUP and genomic-BLUP models. The EBV ranked above RS and realized...

  11. Planetary Candidates Observed by Kepler VI: Planet Sample from Q1-Q16 (47 Months)

    CERN Document Server

    Mullally, F; Thompson, Susan E; Rowe, Jason; Burke, Christopher; Latham, David W; Batalha, Natalie M; Bryson, Stephen T; Christiansen, Jessie; Henze, Christopher E; Ofir, Aviv; Quarles, Billy; Shporer, Avi; Van Eylen, Vincent; Van Laerhoven, Christa; Shah, Yash; Wolfgang, Angie; Chaplin, W J; Xie, Ji-Wei; Akeson, Rachel; Argabright, Vic; Bachtell, Eric; Borucki, Thomas Barclay William J; Caldwell, Douglas A; Campbell, Jennifer R; Catanzarite, Joseph H; Cochran, William D; Duren, Riley M; Fleming, Scott W; Fraquelli, Dorothy; Girouard, Forrest R; Haas, Michael R; Hełminiak, Krzysztof G; Howell, Steve B; Huber, Daniel; Larson, Kipp; Gautier, Thomas N; Jenkins, Jon; Li, Jie; Lissauer, Jack J; McArthur, Scot; Miller, Chris; Morris, Robert L; Patil-Sabale, Anima; Plavchan, Peter; Putnam, Dustin; Quintana, Elisa V; Ramirez, Solange; Aguirre, V Silva; Seader, Shawn; Smith, Jeffrey C; Steffen, Jason H; Stewart, Chris; Stober, Jeremy; Still, Martin; Tenenbaum, Peter; Troeltzsch, John; Twicken, Joseph D; Zamudio, Khadeejah A

    2015-01-01

    \\We present the sixth catalog of Kepler candidate planets based on nearly 4 years of high precision photometry. This catalog builds on the legacy of previous catalogs released by the Kepler project and includes 1493 new Kepler Objects of Interest (KOIs) of which 554 are planet candidates, and 131 of these candidates have best fit radii 50 days to provide a consistently vetted sample that can be used to improve planet occurrence rate calculations. We discuss the performance of our planet detection algorithms, and the consistency of our vetting products. The full catalog is publicly available at the NASA Exoplanet Archive.

  12. Spectroscopic follow up of Kepler planet candidates

    DEFF Research Database (Denmark)

    Latham..[], D. W.; Cochran, W. D.; Marcy, G.W.

    2010-01-01

    Spectroscopic follow-up observations play a crucial role in the confirmation and characterization of transiting planet candidates identified by Kepler. The most challenging part of this work is the determination of radial velocities with a precision approaching 1 m/s in order to derive masses from...... spectroscopic orbits. The most precious resource for this work is HIRES on Keck I, to be joined by HARPS-North on the William Herschel Telescope when that new spectrometer comes on line in two years. Because a large fraction of the planet candidates are in fact stellar systems involving eclipsing stars...... and not planets, our strategy is to start with reconnaissance spectroscopy using smaller telescopes, to sort out and reject as many of the false positives as possible before going to Keck. During the first Kepler observing season in 2009, more than 100 nights of telescope time were allocated for this work, using...

  13. Attitudes of Teacher Candidates Towards Teaching Profession

    Directory of Open Access Journals (Sweden)

    Aykut Emre BOZDOĞAN

    2007-12-01

    Full Text Available The objective of this study is to determine the attitudes of teacher candidates regarding teaching profession from the point of view of different variables. This study was taken place at Ahi Ervan University Teachers’ College in 2006-2007 year of education and 181 Applied science and Social science students participated it. In order to obtain the data of the research scanning method entitled “Determination of Attitude Towards Teaching Profession” was used which was developed by Aşkar and Erden (1987 . During the analysis of the research data SPSS 12.0 program and the necessary statistical methods were used to analize the data of the research. As a result of the research it is understood that the attitudes of teacher candidates change according to sex and factor that made them to choose the department they study.

  14. New drug candidates in tuberculosis treatment

    Directory of Open Access Journals (Sweden)

    Begüm Evranos Aksöz

    2014-12-01

    makes them quit the treatment. From these problems emerges the need for development of effective new drugs, with smaller duration of therapy, less side effects and without the problem of resistance. After a long period such as 40 years, a new drug molecule bedaquiline was approved in December 2012 by FDA while the drug was in phase II research. Bedaquiline will be used in multidrug resistant tuberculosis therapy. When the chemical structures of bedaquilline and other candidate drugs were examined, the structures such as diarylquinoline, oxazolidinone, nitroimidazole, ethylenediamine drew attention. These common structures will be directive in designing new molecules. In this review, bedaquiline and other candidate drug molecules such as sutezolide, linezolide, PA-824, delamanide, rifapentine, gatifloxacin, moxifloxacin, BTZ-043, TBA-354, CPZEN-45, DC-159a, Q201, SQ-609, SQ-641 were mentioned.

  15. Astronaut candidate Koichi Wakata (left) prepares to jump off a box during a parachute landing

    Science.gov (United States)

    1996-01-01

    1992 ASCAN TRAINING --- Astronaut candidate Koichi Wakata (left) prepares to jump off a box during a parachute landing demonstration at Vance Air Force Base. This portion of the training is designed to familiarize the trainees with the proper way to hit the ground following a parachute jump. Looking on is astronaut candidate Andrew W. S. Thomas. Wakata is one of seven international mission specialist candidates who joined 19 United States astronaut candidates, including Thomas, for the three-day parachute/survival training school at the Oklahoma Base.EDITORS NOTE: Since this photograph was taken, Wakata has been named as mission specialist for the STS-72 mission and Thomas has been named as mission specialist for the STS-77 flight.

  16. Astronaut candidate Koichi Wakata prepares to jump off a box during a parachute landing

    Science.gov (United States)

    1996-01-01

    1992 ASCAN TRAINING --- Astronaut candidate Koichi Wakata prepares to jump off a box during a parachute landing demonstration at Vance Air Force Base. This portion of the training is designed to familiarize the trainees with the proper way to hit the ground following a parachute jump. Looking on are astronaut candidates Michael L. Gernhardt (left) and Andrew W. S. Thomas (second left), along with a United States Air Force (USAF) instructor. Wakata, representing Japan's National Space Development Agency (NASDA), is one of seven international mission specialist candidates who joined 19 United States astronaut candidates, including Gernhardt and Thomas, for the three-day parachute/survival training school at the Oklahoma Base.EDITORS NOTE: Since this photograph was taken, Gernhardt, Wakata and Thomas have been named as mission specialists for the STS-69, STS-72 and STS-77 missions, respectively.

  17. Decision Analysis of Advanced Scout Helicopter Candidates

    Science.gov (United States)

    1980-01-01

    assist the ASH SSG by constructing a comprehensive ASH evaluation model utilizing multi-attribute utility assessment ( MAUA ) modeling. ~~UA is a forre...results are included as well. The output of the MAUA model is a numerical representation of the worth of each ASH candidate. These numbers are...instance of a methodology called Multi-Attribute Utility Analysis ( MAUA ). In general, MAUA is characterized by the represen- tation of outcomes in terms

  18. Sensitive Radio Survey of Obscured Quasar Candidates

    CERN Document Server

    Alexandroff, Rachael M; van Velzen, Sjoert; Greene, Jenny E; Strauss, Michael A

    2016-01-01

    We study the radio properties of moderately obscured quasars over a range of redshifts to understand the role of radio activity in accretion using the Jansky Very Large Array (JVLA) at 6.0GHz and 1.4GHz. Our z~2.5 sample consists of optically-selected obscured quasar candidates, all of which are radio-quiet, with typical radio luminosities of $\

  19. Release of uranium from candidate wasteforms

    OpenAIRE

    Collier, N.; Harrison, M.; Brogden, M,; Hanson, B

    2012-01-01

    Large volumes of depleted natural and low-enriched uranium exist in the UK waste inventory. This work reports on initial investigations of the leaching performance of candidate glass and cement encapsulation matrices containing UO3 powder as well as that of uranium oxide powders. The surface areas of UO3 powder and the monolith samples of UO3 conditioned in the glass and cement matrices were very different making leaching comparisons difficult. The results showed that for both types of monoli...

  20. Alcoholism and Alternative Splicing of Candidate Genes

    OpenAIRE

    Toshikazu Sasabe; Shoichi Ishiura

    2010-01-01

    Gene expression studies have shown that expression patterns of several genes have changed during the development of alcoholism. Gene expression is regulated not only at the level of transcription but also through alternative splicing of pre-mRNA. In this review, we discuss some of the evidence suggesting that alternative splicing of candidate genes such as DRD2 (encoding dopamine D2 receptor) may form the basis of the mechanisms underlying the pathophysiology of alcoholism. These reports sugg...

  1. ATTITUDES OF ENGLISH TEACHER CANDIDATES TOWARD ICT

    OpenAIRE

    HİSMANOGLU, Murat; HİSMANOGLU, Sibel; Hismanoglu, Murat; HISMANOGLU, Sibel

    2010-01-01

    The purpose of this study was to investigate the attitudes of English teacher candidates at formal and distance higher education contexts toward ICT and reveal whether there was a significant difference between these two groups in terms of their attitudes toward ICT. The sample of the study consisted of 175 prospective English teachers at two different higher education contexts. The participants were randomly selected among forth-year students at the ELT departments of Euopean University of L...

  2. ATTITUDES OF ENGLISH TEACHER CANDIDATES TOWARD ICT

    OpenAIRE

    Hismanoglu, Murat; HISMANOGLU, Sibel

    2011-01-01

    The purpose of this study was to investigate the attitudes of English teacher candidates at formal and distance higher education contexts toward ICT and reveal whether there was a significant difference between these two groups in terms of their attitudes toward ICT. The sample of the study consisted of 175 prospective English teachers at two different higher education contexts. The participants were randomly selected among forth-year students at the ELT departments of Euopean University of L...

  3. Searching for candidate genes for male infertility

    Institute of Scientific and Technical Information of China (English)

    B.N.Truong; E.K.Moses; J.E.Armes; D.J.Venter; H.W.G.Baker

    2003-01-01

    Aim: We describe an approach to search for candidate genes for male infertility using the two human genome databases: the public University of California at Santa Cruz (UCSC) and private Celera databases which list known and predicted gene sequences and provide related information such as gene function, tissue expression,known mutations and single nucleotide polymorphisms (SNPs). Methods and Results: To demonstrate this in silico research, the following male infertility candidate genes were selected: (1) human BOULE, mutations of which may lead to germ cell arrest at the primary spermatocyte stage, (2) mutations of casein kinase 2 alpha genes which may cause globozoospermia, (3) DMR-N9 which is possibly involved in the spermatogenic defect of myotonic dystrophy and (4) several testes expressed genes at or near the breakpoints of a balanced translocation associated with hypospermatogenesis. We indicate how information derived from the human genome databases can be used to confirm these candidate genes may be pathogenic by studying RNA expression in tissue arrays using in situ hybridization and gene sequencing. Conclusion: The paper explains the new approach to discovering genetic causes of male infertility using information about the human genome. ( Asian J Andro1 2003 Jun; 5:137-147 )

  4. Nuclear safety in EU candidate countries

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-10-01

    Nuclear safety in the candidate countries to the European Union is a major issue that needs to be addressed in the framework of the enlargement process. Therefore WENRA members considered it was their duty to offer their technical assistance to their Governments and the European Union Institutions. They decided to express their collective opinion on nuclear safety in those candidate countries having at least one nuclear power plant: Bulgaria, the Czech Republic, Hungary, Lithuania, Romania, Slovakia and Slovenia. The report is structured as follows: A foreword including background information, structure of the report and the methodology used, General conclusions of WENRA members reflecting their collective opinion, For each candidate country, an executive summary, a chapter on the status of the regulatory regime and regulatory body, and a chapter on the nuclear power plant safety status. Two annexes are added to address the generic safety characteristics and safety issues for RBMK and VVER plants. The report does not cover radiation protection and decommissioning issues, while safety aspects of spent fuel and radioactive waste management are only covered as regards on-site provisions. In order to produce this report, WENRA used different means: For the chapters on the regulatory regimes and regulatory bodies, experts from WENRA did the work. For the chapters on nuclear power plant safety status, experts from WENRA and from French and German technical support organisations did the work. Taking into account the contents of these chapters, WENRA has formulated its general conclusions in this report.

  5. Molecular candidates of MTV in air

    Science.gov (United States)

    Dam, Nico; Mirzaei, Mehrnoosh; van de Water, Willem

    2011-11-01

    In molecular tagging velocimetry (MTV), the molecules of a gas are used as flow tracers. These tracers can be produced at will by illumination with a laser which promotes molecules to a long- lived excited state, fuses N2 and N2 to NO, or makes molecules phosphoresce. A while later these tagged molecules can be visualized by laser-induced fluorescence, or by just watching them while they phosphoresce. Candidates for MTV in turbulence research must be arranged in structures narrower than the Kolmogorov scale, which remain narrow as time progresses, and must live longer than the Kolmogorov time. These requirements invalidate many candidates, candidates once deemed successful. They do so in various surprising manners that involve a combination of fluid flow and molecular dynamics. Rather than velocimetry in turbulence, MTV techniques offer a unique view on basic dispersion processes at the smallest scales of turbulence. In this way we have measured the spreading of clouds whose size is a few times the Kolmogorov length and the Batchelor dispersion of objects whose size is inside the inertial range.

  6. UNCOVERING THE NUCLEUS CANDIDATE FOR NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Günthardt, G. I.; Camperi, J. A. [Observatorio Astronómico, Universidad Nacional de Córdoba (Argentina); Agüero, M. P. [Observatorio Astronómico, Universidad Nacional de Córdoba, and CONICET (Argentina); Díaz, R. J.; Gomez, P. L.; Schirmer, M. [Gemini Observatory, AURA (United States); Bosch, G., E-mail: gunth@oac.uncor.edu, E-mail: camperi@oac.uncor.edu, E-mail: mpaguero@oac.uncor.edu, E-mail: rdiaz@gemini.edu, E-mail: pgomez@gemini.edu, E-mail: mschirmer@gemini.edu, E-mail: guille@fcaglp.unlp.edu.ar [Instituto de Astrofísica de La Plata (CONICET-UNLP) (Argentina)

    2015-11-15

    NGC 253 is the nearest spiral galaxy with a nuclear starburst that becomes the best candidate for studying the relationship between starburst and active galactic nucleus activity. However, this central region is veiled by large amounts of dust, and it has been so far unclear which is the true dynamical nucleus to the point that there is no strong evidence that the galaxy harbors a supermassive black hole co-evolving with the starburst as was supposed earlier. Near-infrared (NIR) spectroscopy, especially NIR emission line analysis, could be advantageous in shedding light on the true nucleus identity. Using Flamingos-2 at Gemini South we have taken deep K-band spectra along the major axis of the central structure and through the brightest infrared source. In this work, we present evidence showing that the brightest NIR and mid-infrared source in the central region, already known as radio source TH7 and so far considered just a large stellar supercluster, in fact presents various symptoms of a genuine galactic nucleus. Therefore, it should be considered a valid nucleus candidate. Mentioning some distinctive aspects, it is the most massive compact infrared object in the central region, located at 2.″0 of the symmetry center of the galactic bar, as measured in the K-band emission. Moreover, our data indicate that this object is surrounded by a large circumnuclear stellar disk and it is also located at the rotation center of the large molecular gas disk of NGC 253. Furthermore, a kinematic residual appears in the H{sub 2} rotation curve with a sinusoidal shape consistent with an outflow centered in the candidate nucleus position. The maximum outflow velocity is located about 14 pc from TH7, which is consistent with the radius of a shell detected around the nucleus candidate, observed at 18.3 μm (Qa) and 12.8 μm ([Ne ii]) with T-ReCS. Also, the Brγ emission line profile shows a pronounced blueshift and this emission line also has the highest equivalent width at this

  7. Hypervelocity star candidates in the SEGUE G and K dwarf sample

    Energy Technology Data Exchange (ETDEWEB)

    Palladino, Lauren E.; Holley-Bockelmann, Kelly [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Schlesinger, Katharine J. [Research School of Astronomy and Astrophysics, The Australian National University, Weston, ACT 2611 (Australia); Allende Prieto, Carlos [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Beers, Timothy C. [National Optical Astronomy Observatory, Tucson, AZ 85719 (United States); Lee, Young Sun [Department of Astronomy, New Mexico State University, Las Cruces, NM 88003 (United States); Schneider, Donald P., E-mail: lauren.e.palladino.1@vanderbilt.edu, E-mail: k.holley@vanderbilt.edu [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)

    2014-01-01

    We present 20 candidate hypervelocity stars from the Sloan Extension for Galactic Understanding and Exploration (SEGUE) G and K dwarf samples. Previous searches for hypervelocity stars have only focused on large radial velocities; in this study, we also use proper motions to select the candidates. We determine the hypervelocity likelihood of each candidate by means of Monte Carlo simulations, considering the significant errors often associated with high proper motion stars. We find that nearly half of the candidates exceed their escape velocities with at least 98% probability. Every candidate also has less than a 25% chance of being a high-velocity fluke within the SEGUE sample. Based on orbits calculated using the observed six-dimensional positions and velocities, few, if any, of these candidates originate from the Galactic center. If these candidates are truly hypervelocity stars, they were not ejected by interactions with the Milky Way's supermassive black hole. This calls for a more serious examination of alternative hypervelocity-star ejection scenarios.

  8. ARIEL: an ESA M4 mission candidate

    Science.gov (United States)

    Puig, L.; Pilbratt, G. L.; Heske, A.; Escudero Sanz, I.; Crouzet, P.-E.

    2016-07-01

    The Atmospheric Remote sensing Infrared Exoplanet Large survey (ARIEL) mission is an M-class mission candidate within the science program Cosmic Vision of the European Space Agency (ESA). It was selected in June 2015 as one of three candidates to enter an assessment phase (phase 0/A). This process involves the definition of science and mission requirements as well as a preliminary model payload, and an internal Concurrent Design Facility (CDF) study providing the input to parallel industrial studies (in progress since 2016). After this process, the three candidates will be reviewed and in mid-2017 one of them will be selected as the M4 mission for launch in 2026. ARIEL is a survey-type mission dedicated to the characterisation of exoplanetary atmospheres. Using the differential technique of transit spectroscopy, ARIEL will obtain transmission and/or emission spectra of the atmospheres of a large and diverse sample of known exoplanets (~500) covering a wide range of masses, densities, equilibrium temperatures, orbital properties and host-star characteristics. This will include hot Jupiters to warm Super-Earths, orbiting M5 to F0 stars. This paper describes critical requirements, and reports on the results of the Concurrent Design Facility (CDF) study that was conducted in June / July 2015, providing a description of the resulting spacecraft design. It will employ a 0.7 m x 1.1 m off-axis three mirror telescope, feeding four photometric channels in the VNIR range (0.5-1.95 μm) and an IR spectrometer covering 1.95-7.8 μm.

  9. Blend Analysis of HATNet Transit Candidates

    Directory of Open Access Journals (Sweden)

    Bakos G.Á.

    2011-02-01

    Full Text Available Candidate transiting planet systems discovered by wide-field groundbased surveys must go through an intensive follow-up procedure to distinguish the true transiting planets from the much more common false positives. Especially pernicious are configurations of three or more stars which produce radial velocity and light curves that are similar to those of single stars transited by a planet. In this contribution we describe the methods used by the HATNet team to reject these blends, giving a few illustrative examples.

  10. Avalanche Effect in Improperly Initialized CAESAR Candidates

    Directory of Open Access Journals (Sweden)

    Martin Ukrop

    2016-12-01

    Full Text Available Cryptoprimitives rely on thorough theoretical background, but often lack basic usability features making them prone to unintentional misuse by developers. We argue that this is true even for the state-of-the-art designs. Analyzing 52 candidates of the current CAESAR competition has shown none of them have an avalanche effect in authentication tag strong enough to work properly when partially misconfigured. Although not directly decreasing their security profile, this hints at their security usability being less than perfect. Paper details available at crcs.cz/papers/memics2016

  11. Alcoholism and alternative splicing of candidate genes.

    Science.gov (United States)

    Sasabe, Toshikazu; Ishiura, Shoichi

    2010-04-01

    Gene expression studies have shown that expression patterns of several genes have changed during the development of alcoholism. Gene expression is regulated not only at the level of transcription but also through alternative splicing of pre-mRNA. In this review, we discuss some of the evidence suggesting that alternative splicing of candidate genes such as DRD2 (encoding dopamine D2 receptor) may form the basis of the mechanisms underlying the pathophysiology of alcoholism. These reports suggest that aberrant expression of splice variants affects alcohol sensitivities, and alcohol consumption also regulates alternative splicing. Thus, investigations of alternative splicing are essential for understanding the molecular events underlying the development of alcoholism.

  12. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.

    2012-01-01

    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing...... masses of the brown dwarf companions are 0.02 ± 0.01 M⊙ and 0.019 ± 0.002 M⊙ for MOA-2011-BLG-104/OGLE-2011-BLG-0172 and MOA-2011-BLG-149, respectively, and both companions are orbiting low-mass M dwarf host stars. More microlensing brown dwarfs are expected to be detected as the number of lensing events...

  13. Reducing stigma and discrimination: Candidate interventions

    Directory of Open Access Journals (Sweden)

    Kassam Aliya

    2008-04-01

    Full Text Available Abstract This paper proposes that stigma in relation to people with mental illness can be understood as a combination of problems of knowledge (ignorance, attitudes (prejudice and behaviour (discrimination. From a literature review, a series of candidate interventions are identified which may be effective in reducing stigmatisation and discrimination at the following levels: individuals with mental illness and their family members; the workplace; and local, national and international. The strongest evidence for effective interventions at present is for (i direct social contact with people with mental illness at the individual level, and (ii social marketing at the population level.

  14. Geoscience Training for NASA Astronaut Candidates

    Science.gov (United States)

    Young, K. E.; Evans, C. A.; Bleacher, J. E.; Graff, T. G.; Zeigler, R.

    2017-01-01

    After being selected to the astronaut office, crewmembers go through an initial two year training flow, astronaut candidacy, where they learn the basic skills necessary for spaceflight. While the bulk of astronaut candidate training currently centers on the multiple subjects required for ISS operations (EVA skills, Russian language, ISS systems, etc.), training also includes geoscience training designed to train crewmembers in Earth observations, teach astronauts about other planetary systems, and provide field training designed to investigate field operations and boost team skills. This training goes back to Apollo training and has evolved to support ISS operations and future exploration missions.

  15. Genome-Wide Association Study with Sequence Variants Identifies Candidate Genes for Mastitis Resistance in Dairy Cattle

    DEFF Research Database (Denmark)

    Sahana, Goutam; Guldbrandtsen, Bernt; Bendixen, Christian;

    Effect Predictor (VEP) vers. 2.6 using ENSEMBL vers. 67 databases. Candidate polymorphisms affecting clinical mastitis were selected based on their association with the traits and functional annotations. A strong positional candidate gene for mastitis resistance on chromosome-6 is the NPFFR2 which...

  16. The CHAOS-3 geomagnetic field model and candidates for the 11th generation IGRF

    Science.gov (United States)

    Olsen, N.; Mandea, M.; Sabaka, T. J.; Tøffner-Clausen, L.

    2010-10-01

    As a part of the 11th generation IGRF defined by IAGA, we propose a candidate model for the DGRF 2005, a candidate model for IGRF 2010 and a candidate model for the mean secular variation between 2010 and 2015. These candidate models, the derivation of which is described in the following, are based on the latest model in the CHAOS model series, called "CHAOS-3". This model is derived from more than 10 years of satellite and ground observatory data. Maximum spherical harmonic degree of the static field is n = 60. The core field time changes are expressed by spherical harmonic expansion coefficients up to n = 20, described by order 6 splines (with 6-month knot spacing) spanning the time interval 1997.0-2010.0. The third time derivative of the squared magnetic field intensity is regularized at the core-mantle boundary. No spatial regularization is applied.

  17. Corrosion mechanisms of candidate structural materials for supercritical water-cooled reactor

    Institute of Scientific and Technical Information of China (English)

    Lefu ZHANG; Fawen ZHU; Rui TANG

    2009-01-01

    Nickel-based alloys, austenitic stainless steel, ferritic/martensitic heat-resistant steels, and oxide dispersion strengthened steel are presently considered to be the candidate structural or fuel-cladding materials for supercritical water-cooled reactor (SCWR), one of the promising generation IV reactor for large-scale electric power production. However, corrosion and stress corrosion cracking of these candidate alloys still remain to be a major problem in the selection of nuclear fuel cladding and other structural materials, such as water rod. Survey of literature and experimental results reveal that the general corrosion mechanism of those candidate materials exhibits quite complicated mechanism in high-temperature and high-pressure supercritical water. Formation of a stable protective oxide film is the key to the best corrosion-resistant alloys. This paper focuses on the mechanism of corrosion oxide film breakdown for SCWR candidate materials.

  18. ADAM33, a new candidate for psoriasis susceptibility.

    Directory of Open Access Journals (Sweden)

    Fabienne Lesueur

    Full Text Available Psoriasis is a chronic skin disorder with multifactorial etiology. In a recent study, we reported results of a genome-wide scan on 46 French extended families presenting with plaque psoriasis. In addition to unambiguous linkage to the major susceptibility locus PSORS1 on Chromosome 6p21, we provided evidence for a susceptibility locus on Chromosome 20p13. To follow up this novel psoriasis susceptibility locus we used a family-based association test (FBAT for an association scan over the 17 Mb candidate region. A total of 85 uncorrelated SNP markers located in 65 genes of the region were initially investigated in the same set of large families used for the genome wide search, which consisted of 295 nuclear families. When positive association was obtained for a SNP, candidate genes nearby were explored more in detail using a denser set of SNPs. Thus, the gene ADAM33 was found to be significantly associated with psoriasis in this family set (The best association was on a 3-SNP haplotype P = 0.00004, based on 1,000,000 permutations. This association was independent of PSORS1. ADAM33 has been previously associated with asthma, which demonstrates that immune system diseases may be controlled by common susceptibility genes with general effects on dermal inflammation and immunity. The identification of ADAM33 as a psoriasis susceptibility gene identified by positional cloning in an outbred population should provide insights into the pathogenesis and natural history of this common disease.

  19. No Evidence for Association between Amelogenesis Imperfecta and Candidate Genes

    Directory of Open Access Journals (Sweden)

    M Ghandehari Motlagh

    2009-03-01

    Full Text Available "nBackground: Amelogenesis imperfecta (AI is an inherited tooth disorder. Despite the fact that up to now, several gene muta­tions in MMP20, ENAM, AMELX and KLK4 genes have been reported to be associated with AI, many other genes sug­gested to be involved. The main objective of this study was to find the mutations in three major candidate genes including MMP20, ENAM and KLK4 responsible for AI from three Iranian families with generalized hypoplastic phenotype in all teeth. "nMethods: All exon/intron boundaries of subjected genes were amplified by polymerase chain reaction and subjected to direct sequencing."nResults: One polymorphisms was identified in KLK4 exon 2, in one family a homozygous mutation was found in the third base of codon 22 for serine (TCG>TCT, but not in other families. Although these base substitutions have been occurred in the signaling domain, they do not seem to influence the activity of KLK4 protein."nConclusion: Our results might support the further evidence for genetic heterogeneity; at least, in some AI cases are not caused by a gene in these reported candidate genes.

  20. A Bioinformatics Filtering Strategy for Identifying Radiation Response Biomarker Candidates

    Science.gov (United States)

    Oh, Jung Hun; Wong, Harry P.; Wang, Xiaowei; Deasy, Joseph O.

    2012-01-01

    The number of biomarker candidates is often much larger than the number of clinical patient data points available, which motivates the use of a rational candidate variable filtering methodology. The goal of this paper is to apply such a bioinformatics filtering process to isolate a modest number (<10) of key interacting genes and their associated single nucleotide polymorphisms involved in radiation response, and to ultimately serve as a basis for using clinical datasets to identify new biomarkers. In step 1, we surveyed the literature on genetic and protein correlates to radiation response, in vivo or in vitro, across cellular, animal, and human studies. In step 2, we analyzed two publicly available microarray datasets and identified genes in which mRNA expression changed in response to radiation. Combining results from Step 1 and Step 2, we identified 20 genes that were common to all three sources. As a final step, a curated database of protein interactions was used to generate the most statistically reliable protein interaction network among any subset of the 20 genes resulting from Steps 1 and 2, resulting in identification of a small, tightly interacting network with 7 out of 20 input genes. We further ranked the genes in terms of likely importance, based on their location within the network using a graph-based scoring function. The resulting core interacting network provides an attractive set of genes likely to be important to radiation response. PMID:22768051

  1. A bioinformatics filtering strategy for identifying radiation response biomarker candidates.

    Directory of Open Access Journals (Sweden)

    Jung Hun Oh

    Full Text Available The number of biomarker candidates is often much larger than the number of clinical patient data points available, which motivates the use of a rational candidate variable filtering methodology. The goal of this paper is to apply such a bioinformatics filtering process to isolate a modest number (<10 of key interacting genes and their associated single nucleotide polymorphisms involved in radiation response, and to ultimately serve as a basis for using clinical datasets to identify new biomarkers. In step 1, we surveyed the literature on genetic and protein correlates to radiation response, in vivo or in vitro, across cellular, animal, and human studies. In step 2, we analyzed two publicly available microarray datasets and identified genes in which mRNA expression changed in response to radiation. Combining results from Step 1 and Step 2, we identified 20 genes that were common to all three sources. As a final step, a curated database of protein interactions was used to generate the most statistically reliable protein interaction network among any subset of the 20 genes resulting from Steps 1 and 2, resulting in identification of a small, tightly interacting network with 7 out of 20 input genes. We further ranked the genes in terms of likely importance, based on their location within the network using a graph-based scoring function. The resulting core interacting network provides an attractive set of genes likely to be important to radiation response.

  2. Top Zika Vaccine Candidate Moves Closer to Field Testing

    Science.gov (United States)

    ... https://medlineplus.gov/news/fullstory_161274.html Top Zika Vaccine Candidate Moves Closer to Field Testing DNA- ... MONDAY, Oct. 3, 2016 (HealthDay News) -- The leading Zika vaccine candidate should be ready for field testing ...

  3. Phenol sulfotransferases: Candidate genes for Batten disease

    Energy Technology Data Exchange (ETDEWEB)

    Dooley, T.P.; Probst, P.; Obermoeller, R.D. [M.D. Anderson Cancer Center, Houston, TX (United States)] [and others

    1995-06-05

    Batten disease (juvenile-onset neuronal ceroid lipofuscinosis; JNCL) is an autosomal recessive neurodegenerative disorder, characterized by the cytosomal accumulation of autofluorescent protolipopigments in neurons and other cell types. The Batten disease gene (CLN3) has not yet been identified, but has been mapped to a small region of human chromosome area 16p12.1-p11.2. We recently reported the fortuitous discovery that the cytosolic phenol sulfotransferase gene (STP) is located within this same interval of chromosome 16p. Since phenol sulfotransferase is expressed in neurons, can sulfate lipophilic phenolic compounds, and is mapped near CLN3, STP is considered as a candidate gene for Batten disease. YAC and cosmid cloning results have further substantiated the close proximity of STP and a highly related sulfotransferase (STM), encoding the catecholamine-preferring enzyme, to the CLN3 region of chromosome 16p. In this report, we summarize some of the recent progress in the identification of two phenol sulfotransferase genes (STP and STM) as positional candidate genes for Batten disease. 42 refs., 1 tab.

  4. Nonclinical Development of BCG Replacement Vaccine Candidates

    Directory of Open Access Journals (Sweden)

    Bernd Eisele

    2013-04-01

    Full Text Available The failure of current Mycobacterium bovis bacille Calmette–Guérin (BCG vaccines, given to neonates to protect against adult tuberculosis and the risk of using these live vaccines in HIV-infected infants, has emphasized the need for generating new, more efficacious and safer replacement vaccines. With the availability of genetic techniques for constructing recombinant BCG (rBCG strains containing well-defined gene deletions or insertions, new vaccine candidates are under evaluation at both the preclinical and clinical stages of development. Since most BCG vaccines in use today were evaluated in clinical trials decades ago and are produced by outdated processes, the development of new BCG vaccines offers a number of advantages that include a modern well-defined manufacturing process along with state-of-the-art evaluation of safety and efficacy in target populations. We provide a description of the preclinical development of two novel rBCGs, VPM1002 that was constructed by adding a modified hly gene coding for the protein listeriolysin O (LLO from Listeria monocytogenes and AERAS-422, which carries a modified pfoA gene coding for the protein perfringolysin O (PFO from Clostridium perfringens, and three genes from Mycobacterium tuberculosis. Novel approaches like these should be helpful in generating stable and effective rBCG vaccine candidates that can be better characterized than traditional BCG vaccines.

  5. Theoretical Comparison Between Candidates for Dark Matter

    Science.gov (United States)

    McKeough, James; Hira, Ajit; Valdez, Alexandra

    2017-01-01

    Since the generally-accepted view among astrophysicists is that the matter component of the universe is mostly dark matter, the search for dark matter particles continues unabated. The Large Underground Xenon (LUX) improvements, aided by advanced computer simulations at the U.S. Department of Energy's Lawrence Berkeley National Laboratory's (Berkeley Lab) National Energy Research Scientific Computing Center (NERSC) and Brown University's Center for Computation and Visualization (CCV), can potentially eliminate some particle models of dark matter. Generally, the proposed candidates can be put in three categories: baryonic dark matter, hot dark matter, and cold dark matter. The Lightest Supersymmetric Particle(LSP) of supersymmetric models is a dark matter candidate, and is classified as a Weakly Interacting Massive Particle (WIMP). Similar to the cosmic microwave background radiation left over from the Big Bang, there is a background of low-energy neutrinos in our Universe. According to some researchers, these may be the explanation for the dark matter. One advantage of the Neutrino Model is that they are known to exist. Dark matter made from neutrinos is termed ``hot dark matter''. We formulate a novel empirical function for the average density profile of cosmic voids, identified via the watershed technique in ΛCDM N-body simulations. This function adequately treats both void size and redshift, and describes the scale radius and the central density of voids. We started with a five-parameter model. Our research is mainly on LSP and Neutrino models.

  6. Vaccine candidates for leishmaniasis: a review.

    Science.gov (United States)

    Nagill, Rajeev; Kaur, Sukhbir

    2011-10-01

    Leishmaniasis is a diverse group of clinical syndromes caused by protozoan parasites of the genus Leishmania. The clinical manifestation of the disease varies from self-limiting cutaneous lesions to progressive visceral disease. It is estimated that 350 million people are at risk in 88 countries, with a global incidence of 1-1.5 million cases of cutaneous and 500,000 cases of visceral leishmaniasis. The key control measures mainly rely on early case detection and chemotherapy which has been hampered by the toxicity of drugs, side-effects and by the emergence of drug resistance in parasites. Control of reservoir host and vector is difficult due to operational difficulties and frequent relapses in the host. Therefore, the development of effective and affordable vaccine against leishmaniasis is highly desirable. Although considerable progress has been made over the last decade in understanding immune mechanisms underlying potential candidate antigens, including killed, live attenuated parasites, crude parasites, pure or recombinant Leishmania proteins or DNA encoding leishmanial proteins, as well as immunomodulators from sand fly saliva, very few candidate vaccines have progressed beyond the experimental stage. As such there is no vaccine against any form of human leishmaniasis. In recent years, however, much interest has been stimulated towards vaccination against leishmaniasis focused mainly on cutaneous leishmaniasis with fewer attempts against visceral leishmaniasis.

  7. Serological profile of candidates for corneal donation

    Directory of Open Access Journals (Sweden)

    Adroaldo Lunardelli

    2014-10-01

    Full Text Available Objetive: The purpose of this study is to map the serological profile of candidates to corneal donation at Irmandade Santa Casa de Misericórdia de Porto Alegre, identifying the percentage of disposal by serology and the marker involved. Methods: There have been analised – retrospectively – the results of serology of all corneal donors, made between the period of 1st january 2006 and 31st december 2012. Data analised were related to age, gender and the results of serology pertinent to viral markers (HBsAg, anti-HBc, anti-HCV and anti-HIV, these, determined by immunosorbent tests (ELISA. Results: In the period of the study, there were 2476 corneal donors at the institution, with a major incidence on the male gender, on an average of 58.7 years old. 23% of retention because of serological unfitness was also identified, that is, 570 samples were non-negative to any of the used tests. The marker anti- HBc was the most prevalent on the studied population, followed by the Hepatitis C virus (HCV and by the Human Immunodeficiency Virus (HIV. Conclusion: From the data found through this study, it is essential to have the participation of an efficient service on the serological evaluation of the candidates to corneal donation, once the security of the receptor must be taken into consideration in a population of donors with 23% of unfitness prevalence, in which the most prevalent marker is the one of Hepatits B.

  8. Elemental Abundances of Solar Sibling Candidates

    Science.gov (United States)

    Ramírez, I.; Bajkova, A. T.; Bobylev, V. V.; Roederer, I. U.; Lambert, D. L.; Endl, M.; Cochran, W. D.; MacQueen, P. J.; Wittenmyer, R. A.

    2014-06-01

    Dynamical information along with survey data on metallicity and in some cases age have been used recently by some authors to search for candidates of stars that were born in the cluster where the Sun formed. We have acquired high-resolution, high signal-to-noise ratio spectra for 30 of these objects to determine, using detailed elemental abundance analysis, if they could be true solar siblings. Only two of the candidates are found to have solar chemical composition. Updated modeling of the stars' past orbits in a realistic Galactic potential reveals that one of them, HD 162826, satisfies both chemical and dynamical conditions for being a sibling of the Sun. Measurements of rare-element abundances for this star further confirm its solar composition, with the only possible exception of Sm. Analysis of long-term high-precision radial velocity data rules out the presence of hot Jupiters and confirms that this star is not in a binary system. We find that chemical tagging does not necessarily benefit from studying as many elements as possible but instead from identifying and carefully measuring the abundances of those elements that show large star-to-star scatter at a given metallicity. Future searches employing data products from ongoing massive astrometric and spectroscopic surveys can be optimized by acknowledging this fact.

  9. Elemental Abundances of Solar Sibling Candidates

    CERN Document Server

    Ramirez, I; Bobylev, V V; Roederer, I U; Lambert, D L; Endl, M; Cochran, W D; MacQueen, P J; Wittenmyer, R A

    2014-01-01

    Dynamical information along with survey data on metallicity and in some cases age have been used recently by some authors to search for candidates of stars that were born in the cluster where the Sun formed. We have acquired high resolution, high signal-to-noise ratio spectra for 30 of these objects to determine, using detailed elemental abundance analysis, if they could be true solar siblings. Only two of the candidates are found to have solar chemical composition. Updated modeling of the stars' past orbits in a realistic Galactic potential reveals that one of them, HD162826, satisfies both chemical and dynamical conditions for being a sibling of the Sun. Measurements of rare-element abundances for this star further confirm its solar composition, with the only possible exception of Sm. Analysis of long-term high-precision radial velocity data rules out the presence of hot Jupiters and confirms that this star is not in a binary system. We find that chemical tagging does not necessarily benefit from studying a...

  10. Advanced Vaccine Candidates for Lassa Fever

    Directory of Open Access Journals (Sweden)

    Igor S. Lukashevich

    2012-10-01

    Full Text Available Lassa virus (LASV is the most prominent human pathogen of the Arenaviridae. The virus is transmitted to humans by a rodent reservoir, Mastomys natalensis, and is capable of causing lethal Lassa Fever (LF. LASV has the highest human impact of any of the viral hemorrhagic fevers (with the exception of Dengue Fever with an estimated several hundred thousand infections annually, resulting in thousands of deaths in Western Africa. The sizeable disease burden, numerous imported cases of LF in non-endemic countries, and the possibility that LASV can be used as an agent of biological warfare make a strong case for vaccine development. Presently there is no licensed vaccine against LF or approved treatment. Recently, several promising vaccine candidates have been developed which can potentially target different groups at risk. The purpose of this manuscript is to review the LASV pathogenesis and immune mechanisms involved in protection. The current status of pre-clinical development of the advanced vaccine candidates that have been tested in non-human primates will be discussed. Major scientific, manufacturing, and regulatory challenges will also be considered.

  11. Advanced vaccine candidates for Lassa fever.

    Science.gov (United States)

    Lukashevich, Igor S

    2012-10-29

    Lassa virus (LASV) is the most prominent human pathogen of the Arenaviridae. The virus is transmitted to humans by a rodent reservoir, Mastomys natalensis, and is capable of causing lethal Lassa Fever (LF). LASV has the highest human impact of any of the viral hemorrhagic fevers (with the exception of Dengue Fever) with an estimated several hundred thousand infections annually, resulting in thousands of deaths in Western Africa. The sizeable disease burden, numerous imported cases of LF in non-endemic countries, and the possibility that LASV can be used as an agent of biological warfare make a strong case for vaccine development. Presently there is no licensed vaccine against LF or approved treatment. Recently, several promising vaccine candidates have been developed which can potentially target different groups at risk. The purpose of this manuscript is to review the LASV pathogenesis and immune mechanisms involved in protection. The current status of pre-clinical development of the advanced vaccine candidates that have been tested in non-human primates will be discussed. Major scientific, manufacturing, and regulatory challenges will also be considered.

  12. Uncovering the nucleus candidate for NGC 253

    CERN Document Server

    Günthardt, G I; Camperi, J A; Díaz, R J; Gomez, P L; Bosch, G; Schirmer, M

    2015-01-01

    NGC253 is the nearest spiral galaxy with a nuclear starburst which becomes the best candidate to study the relationship between starburst and AGN activity. However, this central region is veiled by large amounts of dust, and it has been so far unclear which is the true dynamical nucleus. The near infrared spectroscopy could be advantageous in order to shed light on the true nucleus identity. Using Flamingos-2 at Gemini South we have taken deep K-band spectra along the major axis and through the brightest infrared source. We present evidence showing that the brightest near infrared and mid infrared source in the central region, already known as radio source TH7 and so far considered just a stellar supercluster, in fact, presents various symptoms of a genuine galactic nucleus. Therefore, it should be considered a valid nucleus candidate. It is the most massive compact infrared object in the central region, located at 2.0" of the symmetry center of the galactic bar. Moreover, our data indicate that this object i...

  13. Elemental abundances of solar sibling candidates

    Energy Technology Data Exchange (ETDEWEB)

    Ramírez, I.; Lambert, D. L.; Endl, M.; Cochran, W. D.; MacQueen, P. J. [McDonald Observatory and Department of Astronomy, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, Texas 78712-1205 (United States); Bajkova, A. T.; Bobylev, V. V. [Central (Pulkovo) Astronomical Observatory of RAS, 65/1, Pulkovskoye Chaussee, St. Petersburg 196140 (Russian Federation); Roederer, I. U. [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI 48109 (United States); Wittenmyer, R. A. [School of Physics, UNSW Australia, Sydney 2052 (Australia)

    2014-06-01

    Dynamical information along with survey data on metallicity and in some cases age have been used recently by some authors to search for candidates of stars that were born in the cluster where the Sun formed. We have acquired high-resolution, high signal-to-noise ratio spectra for 30 of these objects to determine, using detailed elemental abundance analysis, if they could be true solar siblings. Only two of the candidates are found to have solar chemical composition. Updated modeling of the stars' past orbits in a realistic Galactic potential reveals that one of them, HD 162826, satisfies both chemical and dynamical conditions for being a sibling of the Sun. Measurements of rare-element abundances for this star further confirm its solar composition, with the only possible exception of Sm. Analysis of long-term high-precision radial velocity data rules out the presence of hot Jupiters and confirms that this star is not in a binary system. We find that chemical tagging does not necessarily benefit from studying as many elements as possible but instead from identifying and carefully measuring the abundances of those elements that show large star-to-star scatter at a given metallicity. Future searches employing data products from ongoing massive astrometric and spectroscopic surveys can be optimized by acknowledging this fact.

  14. Political Candidate Campaign Advertising: A Selected Review of the Literature.

    Science.gov (United States)

    Hellweg, Susan A.

    This paper provides a selected review of political candidate campaign advertising studies from the political science, mass communication, advertising, and political communication literature. The paper examines the literature in terms of research pertaining to (1) candidate advertising content (commercials for male versus female candidates and for…

  15. Views on Values Education: From Teacher Candidates to Experienced Teachers

    Science.gov (United States)

    Iscan, Canay Demirhan

    2015-01-01

    This study aimed to identify the views of experienced class teachers and class teacher candidates on values education. It conducted standard open-ended interviews with experienced class teachers and teacher candidates. The study group comprised 9 experienced class teachers from different socio-economic levels and 9 teacher candidates with…

  16. Encouraging Discussion between Teacher Candidates and Families with Exceptional Children

    Science.gov (United States)

    Williams, Emily

    2012-01-01

    The Families as Faculty experience assists universities to better prepare candidates for service as classroom teachers. Upon entering their practica and student teaching, many teacher candidates have had no to limited contact with exceptional students. Often candidates are unaware of the realities of having a student with disabilities in their…

  17. Mirror Images: Teacher Candidates' Perceptions of Disposition Development

    Science.gov (United States)

    Bercaw, Lynne A.; Summers, Deborah G.; Colby, Susan A.; Payne, Maggie

    2012-01-01

    The complexity of disposition development for teacher candidates continues to be discussed and debated in teacher education. This study compares two programs and the different ways each approaches the disposition development of their respective candidates. More than 200 candidates from two institutions were surveyed on how and where they perceived…

  18. Identity Functions and Empathetic Tendencies of Teacher Candidates

    Science.gov (United States)

    Ay, Alpaslan; Kadi, Aysegul

    2016-01-01

    Objective of this research is to investigate identity functions and empathetic tendencies of teacher candidates. Sample consists of 232 teacher candidates in social studies teacher education. Survey model is preferred to investigate the difference between identity functions and empathetic tendencies of teacher candidates. And also correlational…

  19. Candidate eco-friendly gas mixtures for MPGDs

    CERN Document Server

    Saviano, Giovanna

    2015-01-01

    Modern gas detectors for the detection of elementary particles, and MPGDs in particular, require F-based gases for optimal performance. Recent regulations demand the use of environmentally unfriendly F-based gases to be limited or banned. This work investigates the properties of potential eco-friendly gas candidate replacements. The aim is to discuss some of the important properties of gases for MPGDs, to list and summarize basic properties of eco-friendly refrigerants from the literature available, to discuss their properties for materials compatibility and safe use, and to make a prediction on selected parameters (i.e., ionization potentials, ionization pairs, etc) crucial for the performance of gas detectors considered by making use of both known parametrizations and quantum chemistry simulation codes.

  20. Computational identification of candidate nucleotide cyclases in higher plants

    KAUST Repository

    Wong, Aloysius Tze

    2013-09-03

    In higher plants guanylyl cyclases (GCs) and adenylyl cyclases (ACs) cannot be identified using BLAST homology searches based on annotated cyclic nucleotide cyclases (CNCs) of prokaryotes, lower eukaryotes, or animals. The reason is that CNCs are often part of complex multifunctional proteins with different domain organizations and biological functions that are not conserved in higher plants. For this reason, we have developed CNC search strategies based on functionally conserved amino acids in the catalytic center of annotated and/or experimentally confirmed CNCs. Here we detail this method which has led to the identification of >25 novel candidate CNCs in Arabidopsis thaliana, several of which have been experimentally confirmed in vitro and in vivo. We foresee that the application of this method can be used to identify many more members of the growing family of CNCs in higher plants. © Springer Science+Business Media New York 2013.

  1. Candidate genes for obesity-susceptibility show enriched association within a large genome-wide association study for BMI

    Science.gov (United States)

    Vimaleswaran, Karani S.; Tachmazidou, Ioanna; Zhao, Jing Hua; Hirschhorn, Joel N.; Dudbridge, Frank; Loos, Ruth J.F.

    2012-01-01

    Before the advent of genome-wide association studies (GWASs), hundreds of candidate genes for obesity-susceptibility had been identified through a variety of approaches. We examined whether those obesity candidate genes are enriched for associations with body mass index (BMI) compared with non-candidate genes by using data from a large-scale GWAS. A thorough literature search identified 547 candidate genes for obesity-susceptibility based on evidence from animal studies, Mendelian syndromes, linkage studies, genetic association studies and expression studies. Genomic regions were defined to include the genes ±10 kb of flanking sequence around candidate and non-candidate genes. We used summary statistics publicly available from the discovery stage of the genome-wide meta-analysis for BMI performed by the genetic investigation of anthropometric traits consortium in 123 564 individuals. Hypergeometric, rank tail-strength and gene-set enrichment analysis tests were used to test for the enrichment of association in candidate compared with non-candidate genes. The hypergeometric test of enrichment was not significant at the 5% P-value quantile (P = 0.35), but was nominally significant at the 25% quantile (P = 0.015). The rank tail-strength and gene-set enrichment tests were nominally significant for the full set of genes and borderline significant for the subset without SNPs at P < 10−7. Taken together, the observed evidence for enrichment suggests that the candidate gene approach retains some value. However, the degree of enrichment is small despite the extensive number of candidate genes and the large sample size. Studies that focus on candidate genes have only slightly increased chances of detecting associations, and are likely to miss many true effects in non-candidate genes, at least for obesity-related traits. PMID:22791748

  2. Towards a values-based person specification for recruitment of compassionate nursing and midwifery candidates: a study of registered and student nurses' and midwives' perceptions of prerequisite attributes and key skills.

    Science.gov (United States)

    Waugh, Anne; Smith, Dave; Horsburgh, Dorothy; Gray, Morag

    2014-09-01

    Selection and retention of preregistration nursing and midwifery students are issues that exercise educators, universities and commissioning bodies both nationally and internationally. It has recently become an expectation that a values-based approach is used within recruitment and selection activities in the UK. The desirability of a person specification to support transparent recruitment and selection is well recognised. An online survey of registered and student nurses and midwives found consensus around the desirability of several personal attributes and key skills. There was consensus in the top seven ranked attributes which were honesty and trustworthiness, communication skills, being a good listener, patience and tactfulness, sensitivity and compassion, the ability to seek and act on guidance and being a good team worker; this was between registered and unregistered nurses and midwives and also between participants representing all fields of nursing and midwifery practice. Some of the responses from Practice Education Facilitators (PEFs) (n=5) and senior managers (n=15) differed from those of other registrants surveyed. The attribute 'Able to draw on knowledge and experience' was considered more important by PEFs and 'Observant and able to act on your own initiative within your level of responsibility' and 'Able to draw on knowledge and experience' were ranked more highly by senior managers.

  3. Arabidopsis genes involved in acyl lipid metabolism. A 2003 census of the candidates, a study of the distribution of expressed sequence tags in organs, and a web-based database.

    Science.gov (United States)

    Beisson, Frédéric; Koo, Abraham J K; Ruuska, Sari; Schwender, Jörg; Pollard, Mike; Thelen, Jay J; Paddock, Troy; Salas, Joaquín J; Savage, Linda; Milcamps, Anne; Mhaske, Vandana B; Cho, Younghee; Ohlrogge, John B

    2003-06-01

    The genome of Arabidopsis has been searched for sequences of genes involved in acyl lipid metabolism. Over 600 encoded proteins have been identified, cataloged, and classified according to predicted function, subcellular location, and alternative splicing. At least one-third of these proteins were previously annotated as "unknown function" or with functions unrelated to acyl lipid metabolism; therefore, this study has improved the annotation of over 200 genes. In particular, annotation of the lipolytic enzyme group (at least 110 members total) has been improved by the critical examination of the biochemical literature and the sequences of the numerous proteins annotated as "lipases." In addition, expressed sequence tag (EST) data have been surveyed, and more than 3,700 ESTs associated with the genes were cataloged. Statistical analysis of the number of ESTs associated with specific cDNA libraries has allowed calculation of probabilities of differential expression between different organs. More than 130 genes have been identified with a statistical probability > 0.95 of preferential expression in seed, leaf, root, or flower. All the data are available as a Web-based database, the Arabidopsis Lipid Gene database (http://www.plantbiology.msu.edu/lipids/genesurvey/index.htm). The combination of the data of the Lipid Gene Catalog and the EST analysis can be used to gain insights into differential expression of gene family members and sets of pathway-specific genes, which in turn will guide studies to understand specific functions of individual genes.

  4. A direct molecular link between the autism candidate gene RORa and the schizophrenia candidate MIR137

    Science.gov (United States)

    Devanna, Paolo; Vernes, Sonja C.

    2014-02-01

    Retinoic acid-related orphan receptor alpha gene (RORa) and the microRNA MIR137 have both recently been identified as novel candidate genes for neuropsychiatric disorders. RORa encodes a ligand-dependent orphan nuclear receptor that acts as a transcriptional regulator and miR-137 is a brain enriched small non-coding RNA that interacts with gene transcripts to control protein levels. Given the mounting evidence for RORa in autism spectrum disorders (ASD) and MIR137 in schizophrenia and ASD, we investigated if there was a functional biological relationship between these two genes. Herein, we demonstrate that miR-137 targets the 3'UTR of RORa in a site specific manner. We also provide further support for MIR137 as an autism candidate by showing that a large number of previously implicated autism genes are also putatively targeted by miR-137. This work supports the role of MIR137 as an ASD candidate and demonstrates a direct biological link between these previously unrelated autism candidate genes.

  5. Novel approaches to identify protective malaria vaccine candidates

    Directory of Open Access Journals (Sweden)

    Wan Ni eChia

    2014-11-01

    Full Text Available Efforts to develop vaccines against malaria have been the focus of substantial research activities for decades. Several categories of candidate vaccines are currently being developed for protection against malaria, based on antigens corresponding to the pre-erythrocytic, blood-stage or sexual stages of the parasite. Long lasting sterile protection from Plasmodium falciparum sporozoite challenge has been observed in human following vaccination with whole parasite formulations, clearly demonstrating that a protective immune response targeting predominantly the pre-erythrocytic stages can develop against malaria. However, most of vaccine candidates currently being investigated, which are mostly subunits vaccines, have not been able to induce substantial (>50% protection thus far. This is due to the fact that the antigens responsible for protection against the different parasite stages are still yet to be known and relevant correlates of protection have remained elusive. For a vaccine to be developed in a timely manner, novel approaches are required. In this article, we review the novel approaches that have been developed to identify the antigens for the development of an effective malaria vaccine.

  6. Engineering of glucosinolate biosynthesis: candidate gene identification and validation.

    Science.gov (United States)

    Møldrup, Morten E; Salomonsen, Bo; Halkier, Barbara A

    2012-01-01

    The diverse biological roles of glucosinolates as plant defense metabolites and anticancer compounds have spurred a strong interest in their biosynthetic pathways. Since the completion of the Arabidopsis genome, functional genomics approaches have enabled significant progress on the elucidation of glucosinolate biosynthesis, although in planta validation of candidate gene function often is hampered by time-consuming generation of knockout and overexpression lines in Arabidopsis. To better exploit the increasing amount of data available from genomic sequencing, microarray database and RNAseq, time-efficient methods for identification and validation of candidate genes are needed. This chapter covers the methodology we are using for gene discovery in glucosinolate engineering, namely, guilt-by-association-based in silico methods and fast proof-of-function screens by transient expression in Nicotiana benthamiana. Moreover, the lessons learned in the rapid, transient tobacco system are readily translated to our robust, versatile yeast expression platform, where additional genes critical for large-scale microbial production of glucosinolates can be identified. We anticipate that the methodology presented here will be beneficial to elucidate and engineer other plant biosynthetic pathways.

  7. ELECTIONS PENSION FUND CANDIDATE NR 4

    CERN Document Server

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : MYERS First Name : Stephen I have been at CERN since 1972, and was elected member of the Governing Board for the first time in 1998. The Governing Board then nominated me to the Investments Committee where I have been a member since the beginning of 1999. Since then I have actively participated in redefining and transforming the investment portfolio in order to improve the overall return and where possible reduce the risk. The portfolio has recently been greatly improved and now allows much simpler more transparent monitoring of our investment. I have also actively participated and hopefully made useful contributions in discussions conc...

  8. ELECTIONS PENSION FUND 4th candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : MYERS First Name : Stephen I have been at CERN since 1972, and was elected member of the Governing Board for the first time in 1998. The Governing Board then nominated me to the Investments Committee where I have been a member since the beginning of 1999. Since then I have actively participated in redefining and transforming the investment portfolio in order to improve the overall return and where possible reduce the risk. The portfolio has recently been greatly improved and now allows much simpler more transparent monitoring of our investment. I have also actively participated and hopefully made useful contributions in discussions conc...

  9. Alcoholism and Alternative Splicing of Candidate Genes

    Directory of Open Access Journals (Sweden)

    Toshikazu Sasabe

    2010-03-01

    Full Text Available Gene expression studies have shown that expression patterns of several genes have changed during the development of alcoholism. Gene expression is regulated not only at the level of transcription but also through alternative splicing of pre-mRNA. In this review, we discuss some of the evidence suggesting that alternative splicing of candidate genes such as DRD2 (encoding dopamine D2 receptor may form the basis of the mechanisms underlying the pathophysiology of alcoholism. These reports suggest that aberrant expression of splice variants affects alcohol sensitivities, and alcohol consumption also regulates alternative splicing. Thus, investigations of alternative splicing are essential for understanding the molecular events underlying the development of alcoholism.

  10. Halopentacenes: Promising Candidates for Organic Semiconductors

    Institute of Scientific and Technical Information of China (English)

    DU Gong-He; REN Zhao-Yu; GUO Ping; ZHENG Ji-Ming

    2009-01-01

    We introduce polar substituents such as F, Cl, Br into pentacene to enhance the dissolubility in common organic solvents while retaining the high charge-carrier mobilities of pentacene. Geometric structures, dipole moments,frontier molecule orbits, ionization potentials and electron affinities, as well as reorganization energies of those molecules, and of pentacene for comparison, are successively calculated by density functional theory. The results indicate that halopentacenes have rather small reorganization energies (< 0.2 eV), and when the substituents are in position 2 or positions 2 and 9, they are polarity molecules. Thus we conjecture that they can easily be dissolved in common organic solvents, and are promising candidates for organic semiconductors.

  11. ELECTIONS PENSION FUND CANDIDATE NR 3

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : HAUVILLER First Name : Claude Dear colleague of CERN and ESO, For the first time, I am standing and requesting your support to become a member of the Governing Board of our Pension Fund. CERN staff member since 1974, I have already carried elective mandates: I have been Delegate to the Staff Council and Member of the Senior Staff Consultative Committee (the Nine). For the majority of us, our Pension Fund is our only social provident scheme and source of retirement income; I believe I can usefully contribute to its successful management and help ensure its balance. Our Fund reaches its majority: soon, there will be more beneficiaries tha...

  12. ELECTIONS PENSION FUND 3rd candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : Hauviller First Name : Claude Dear colleague of CERN and ESO, For the first time, I am standing and requesting your support to become a member of the Governing Board of our Pension Fund. CERN staff member since 1974, I have already carried elective mandates: I have been Delegate to the Staff Council and Member of the Senior Staff Consultative Committee (the Nine). For the majority of us, our Pension Fund is our only social provident scheme and source of retirement income; I believe I can usefully contribute to its successful management and help ensure its balance. Our Fund reaches its majority: soon, there will be more beneficiaries tha...

  13. New potential AChE inhibitor candidates.

    Science.gov (United States)

    de Paula, A A N; Martins, J B L; dos Santos, M L; Nascente, L de C; Romeiro, L A S; Areas, T F M A; Vieira, K S T; Gambôa, N F; Castro, N G; Gargano, R

    2009-09-01

    We have theoretically studied new potential candidates of acetylcholinesterase (AChE) inhibitors designed from cardanol, a non-isoprenoid phenolic lipid of cashew Anacardium occidentale nut-shell liquid. The electronic structure calculations of fifteen molecule derivatives from cardanol were performed using B3LYP level with 6-31G, 6-31G(d), and 6-311+G(2d,p) basis functions. For this study we used the following groups: methyl, acetyl, N,N-dimethylcarbamoyl, N,N-dimethylamine, N,N-diethylamine, piperidine, pyrrolidine, and N,N-methylbenzylamine. Among the proposed compounds we identified that the structures with substitution by N,N-dimethycarbamoyl, N,N-dimethylamine, and pyrrolidine groups were better correlated to rivastigmine, and represent possible AChE inhibitors against Alzheimer disease.

  14. VizieR Online Data Catalog: Radial velocities of 76 M31 candidate clusters (Galleti+, 2006)

    Science.gov (United States)

    Galleti, S.; Federici, L.; Bellazzini, M.; Buzzoni, A.; Fusi Pecci, F.

    2006-06-01

    We present the first results of a large spectroscopic survey of globular clusters and candidate globular clusters in the nearby M31 galaxy. The survey is aimed at the classification of known candidate M31 clusters and at the study of their kinematic properties. We obtained low-resolution spectroscopy for 133 targets, including 76 yet-to-be-confirmed candidate clusters (i.e. with no previous spectroscopic information), 55 already-confirmed genuine M31 clusters, and 2 uncertain candidates. Our observations allowed a reliable estimate of the target radial velocity, within a typical accuracy of ~+/-20Km/s. The observed candidates have been robustly classified according to their radial velocity and shape parameters that allowed us to confidently discriminate between point sources and extended objects even from low-spatial-resolution imagery. In our set of 76 candidate clusters we found: 42 newly-confirmed bona-fide M31 clusters, 12 background galaxies, 17 foreground Galactic stars, 2 HII regions belonging to M31 and 3 unclassified (possibly M31 clusters or foreground stars) objects. The classification of a few other candidates not included in our survey has been also reassessed on various observational bases. All the sources of radial velocity estimates for M31 known globular clusters available in the literature have been compared and checked, and a homogeneous general list has been obtained for 349 confirmed clusters with radial velocity. Our results suggest that a significant number of genuine clusters (~>100) is still hidden among the plethora of known candidates proposed by various authors. Hence our knowledge of the globular cluster system of the M31 galaxy is still far from complete even in terms of simple membership. (1 data file).

  15. Reducing Excessive Amounts of Data: Multiple Web Queries for Generation of Pun Candidates

    Directory of Open Access Journals (Sweden)

    Pawel Dybala

    2011-01-01

    Full Text Available Humor processing is still a less studied issue, both in NLP and AI. In this paper we contribute to this field. In our previous research we showed that adding a simple pun generator to a chatterbot can significantly improve its performance. The pun generator we used generated only puns based on words (not phrases. In this paper we introduce the next stage of the system's development—an algorithm allowing generation of phrasal pun candidates. We show that by using only the Internet (without any hand-made humor-oriented lexicons, it is possible to generate puns based on complex phrases. As the output list is often excessively long, we also propose a method for reducing the number of candidates by comparing two web-query-based rankings. The evaluation experiment showed that the system achieved an accuracy of 72.5% for finding proper candidates in general, and the reduction method allowed us to significantly shorten the candidates list. The parameters of the reduction algorithm are variable, so that the balance between the number of candidates and the quality of output can be manipulated according to needs.

  16. Mapping of Candidate Genes Involved in Bud Dormancy and Flowering Time in Sweet Cherry (Prunus avium.

    Directory of Open Access Journals (Sweden)

    Sophie Castède

    Full Text Available The timing of flowering in perennial plants is crucial for their survival in temperate climates and is regulated by the duration of bud dormancy. Bud dormancy release and bud break depend on the perception of cumulative chilling during endodormancy and heat during the bud development. The objectives of this work were to identify candidate genes involved in dormancy and flowering processes in sweet cherry, their mapping in two mapping progenies 'Regina' × 'Garnet' and 'Regina' × 'Lapins', and to select those candidate genes which co-localized with quantitative trait loci (QTLs associated with temperature requirements for bud dormancy release and flowering. Based on available data on flowering processes in various species, a list of 79 candidate genes was established. The peach and sweet cherry orthologs were identified and primers were designed to amplify sweet cherry candidate gene fragments. Based on the amplified sequences of the three parents of the mapping progenies, SNPs segregations in the progenies were identified. Thirty five candidate genes were genetically mapped in at least one of the two progenies and all were in silico mapped. Co-localization between candidate genes and QTLs associated with temperature requirements and flowering date were identified for the first time in sweet cherry. The allelic composition of the candidate genes located in the major QTL for heat requirements and flowering date located on linkage group 4 have a significant effect on these two traits indicating their potential use for breeding programs in sweet cherry to select new varieties adapted to putative future climatic conditions.

  17. Tagging Blast Resistance Gene Pi 1 in Rice (Oryza sativa) Using Candidate Resistance Genes

    Institute of Scientific and Technical Information of China (English)

    LI Ai-hong; WU Jian-li; XU Xin-ping; Menchu BERNADO; DAI Zheng-yuan; ZHUANG Jie-yun; CHEN Zong-xiang; ZHENG Kang-le; LI Bao-jian; Hei LEUNG; ZHANG Hong-xi; PAN Xue-biao

    2004-01-01

    An F3 population derived from C101LAC/CO39 containing 90 lines was analyzed for blast resistance with 48 candidate genes developed from resistance gene analogs (RGA) and suppression subtractive library. Genetic analysis confirmed that blast resistance of the population was controlled by a single gene Pi 1. One of the candidate genes, R10 was identified as associated with the blast resistance gene on the long arm of chromosome 11 and mapped using a DH population derived from Azucena/IR64.A pair of PCR based primers was designed based on the sequence of R10 for marker-aided selection of the blast resistance gene.The recombination frequency between Pi 1 and the marker was estimated as 1.28%. It suggested that strategy of employing candidate genes is useful for gene identification and mapping. A new RFLP marker and the corresponding PCR marker for tagging of Pi 1 were provided.

  18. Candidate gene markers for sperm quality and fertility in bulls

    Directory of Open Access Journals (Sweden)

    Chinmoy Mishra

    2013-10-01

    Full Text Available Fertility is one of the primary traits of reproduction in bulls. Decrease in fertility is a multifactorial condition and is verydifficult to diagnose. Among various causes genetic abnormality holds a major share. By identifying various genes that haveeffects on fertility the genetic cause behind subferility can be explored and also other non genetic factors can be identified.Advancement of molecular genetic tools now easily enables us to explore individual genes in animals. Identification of thesegenes will eventually lead to genome assembly and development of novel tools for analysing complex genetic traits. Thispaper gives a brief idea about the candidate genes for bull fertility, including genes encoding hormones and their receptors,proteins of the seminal plasma, proteins involved in spermatozoa-ovum binding and genes influencing sexual development.The chromosomal location and gene structure are described, based on the bovine genome assembly.

  19. Candidate driver genes in microsatellite-unstable colorectal cancer

    DEFF Research Database (Denmark)

    Alhopuro, Pia; Sammalkorpi, Heli; Niittymäki, Iina;

    2012-01-01

    . Here, we evaluated somatic mutations in microsatellite repeats of 790 genes chosen based on reduced expression in MSI CRC and existence of a coding mononucleotide repeat of 6–10 bp in length. All the repeats were initially sequenced in 30 primary MSI CRC samples and whenever frameshift mutations were...... types (A/T and C/G, 6–10 bp). Along with several know target genes, including TGFBR2, ACVR2, and MSH3, six novel candidate driver genes emerged that harbored significantly more mutations than identical control repeats. The mutation frequencies in 100 MSI CRC samples were 51% in G8 of GLYR1, 47% in T9...... genes that when mutated are likely to contribute to MSI CRC development....

  20. Candidate gene copy number analysis by PCR and multicapillary electrophoresis.

    Science.gov (United States)

    Szantai, Eszter; Elek, Zsuzsanna; Guttman, András; Sasvari-Szekely, Maria

    2009-04-01

    Genetic polymorphisms are often considered as risk factors of complex diseases serving as valuable and easily detectable biomarkers, also stable during the whole lifespan. A novel type of genetic polymorphism has been identified just recently, referred to as gene copy number variation (CNV) or copy number polymorphism. CNV of glycogen synthase kinase 3 beta and its adjacent gene, Nr1i2 (pregnane X receptor isoform), has been reported to associate with bipolar depression. In our study we introduced multicapillary electrophoresis for gene copy number analysis as an affordable alternative to real-time PCR quantification with TaqMan gene probes. Our results show the reliability of the developed method based on conventional PCR followed by separation of products by multicapillary electrophoresis with quantitative evaluation. This method can be readily implemented for the analysis of candidate gene CNVs in high throughput clinical laboratories and also in personalized medicine care of depression-related risk factors.

  1. Maximized ExoEarth Candidate Yields for Starshades

    CERN Document Server

    Stark, Christopher C; Lisman, Doug; Cady, Eric; Savransky, Dmitry; Roberge, Aki; Mandell, Avi M

    2016-01-01

    The design and scale of a future mission to directly image and characterize potentially Earth-like planets will be impacted, to some degree, by the expected yield of such planets. Recent efforts to increase the estimated yields, by creating observation plans optimized for the detection and characterization of Earth-twins, have focused solely on coronagraphic instruments; starshade-based missions could benefit from a similar analysis. Here we explore how to prioritize observations for a starshade given the limiting resources of both fuel and time, present analytic expressions to estimate fuel use, and provide efficient numerical techniques for maximizing the yield of starshades. We implemented these techniques to create an approximate design reference mission code for starshades and used this code to investigate how exoEarth candidate yield responds to changes in mission, instrument, and astrophysical parameters for missions with a single starshade. We find that a starshade mission operates most efficiently so...

  2. Two new high energy gamma-ray blazar candidates

    CERN Document Server

    Campana, R; Bernieri, E; Massaro, E

    2016-01-01

    We report the detection of two new gamma-ray sources in the Fermi-LAT sky (Pass 8) at energies higher than 20 GeV, and confirmed at lower energies, using a source detection tool based on the Minimum Spanning Tree algorithm. One of these sources, at a Galactic latitude of about -4{\\deg}, is a new discovery, while the other was previously reported above 50 GeV in the 2FHL catalogue. We searched for archival multi-wavelength data of possible counterparts and found interesting candidates. Both objects are radio sources and their WISE infrared colours are typical of blazars. While for the former source no optical spectra are available, for the latter a puzzling optical spectrum corresponding to a white dwarf star is found in the 6dF database. We discuss the spectral energy distributions of both sources and possible interpretations.

  3. Transforming fragments into candidates: small becomes big in medicinal chemistry.

    Science.gov (United States)

    de Kloe, Gerdien E; Bailey, David; Leurs, Rob; de Esch, Iwan J P

    2009-07-01

    Fragment-based drug discovery (FBDD) represents a logical and efficient approach to lead discovery and optimisation. It can draw on structural, biophysical and biochemical data, incorporating a wide range of inputs, from precise mode-of-binding information on specific fragments to wider ranging pharmacophoric screening surveys using traditional HTS approaches. It is truly an enabling technology for the imaginative medicinal chemist. In this review, we analyse a representative set of 23 published FBDD studies that describe how low molecular weight fragments are being identified and efficiently transformed into higher molecular weight drug candidates. FBDD is now becoming warmly endorsed by industry as well as academia and the focus on small interacting molecules is making a big scientific impact.

  4. Development of gold based solder candidates for flip chip assembly

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Hattel, Jesper Henri

    2009-01-01

    Flip chip technology is now rapidly replacing the traditional wire bonding interconnection technology in the first level packaging applications due to the miniaturization drive in the microelectronics industry. Flip chip assembly currently involves the use of high lead containing solders for inte......Flip chip technology is now rapidly replacing the traditional wire bonding interconnection technology in the first level packaging applications due to the miniaturization drive in the microelectronics industry. Flip chip assembly currently involves the use of high lead containing solders...

  5. Corrosion susceptibility study of candidate pin materials for ALTC (Active Lithium/Thionyl Chloride) batteries

    Science.gov (United States)

    Bovard, Francine S.; Cieslak, Wendy R.

    1987-09-01

    The corrosion susceptibilities of eight alternate battery pin material candidates for ALTC (Active Lithium/Thionyl Chloride) batteries in 1.5M LiAlCl4/SOCl2 electrolyte have been investigated using ampule exposure and electrochemical tests. The thermal expansion coefficients of these candidate materials are expected to match Sandia-developed Li-corrosion resistant glasses. The corrosion resistances of the candidate materials, which included three stainless steels (15-5 PH, 17-4 PH, and 446), three Fe-Ni glass sealing alloys (Kovar, Alloy 52, and Niromet 426), a Ni-based alloy (Hastelloy B-2) and a zirconium-based alloy (Zircaloy), were compared to the reference materials Ni and 316L SS. All of the candidate materials showed some evidence of corrosion and, therefore, did not perform as well as the reference materials. The Hastelloy B-2 and Zircaloy are clearly unacceptable materials for this application. Of the remaining alternate materials, the 446 SS and Alloy 52 are the most promising candidates.

  6. Candidate gene prioritization by network analysis of differential expression using machine learning approaches

    Directory of Open Access Journals (Sweden)

    Nitsch Daniela

    2010-09-01

    Full Text Available Abstract Background Discovering novel disease genes is still challenging for diseases for which no prior knowledge - such as known disease genes or disease-related pathways - is available. Performing genetic studies frequently results in large lists of candidate genes of which only few can be followed up for further investigation. We have recently developed a computational method for constitutional genetic disorders that identifies the most promising candidate genes by replacing prior knowledge by experimental data of differential gene expression between affected and healthy individuals. To improve the performance of our prioritization strategy, we have extended our previous work by applying different machine learning approaches that identify promising candidate genes by determining whether a gene is surrounded by highly differentially expressed genes in a functional association or protein-protein interaction network. Results We have proposed three strategies scoring disease candidate genes relying on network-based machine learning approaches, such as kernel ridge regression, heat kernel, and Arnoldi kernel approximation. For comparison purposes, a local measure based on the expression of the direct neighbors is also computed. We have benchmarked these strategies on 40 publicly available knockout experiments in mice, and performance was assessed against results obtained using a standard procedure in genetics that ranks candidate genes based solely on their differential expression levels (Simple Expression Ranking. Our results showed that our four strategies could outperform this standard procedure and that the best results were obtained using the Heat Kernel Diffusion Ranking leading to an average ranking position of 8 out of 100 genes, an AUC value of 92.3% and an error reduction of 52.8% relative to the standard procedure approach which ranked the knockout gene on average at position 17 with an AUC value of 83.7%. Conclusion In this study we

  7. SHIELD: Observations of Three Candidate Interacting Systems

    Science.gov (United States)

    Ruvolo, Elizabeth; Miazzo, Masao; Cannon, John M.; McNichols, Andrew; Teich, Yaron; Adams, Elizabeth A.; Giovanelli, Riccardo; Haynes, Martha P.; McQuinn, Kristen B.; Salzer, John Joseph; Skillman, Evan D.; Dolphin, Andrew E.; Elson, Edward C.; Haurberg, Nathalie C.; Huang, Shan; Janowiecki, Steven; Jozsa, Gyula; Leisman, Luke; Ott, Juergen; Papastergis, Emmanouil; Rhode, Katherine L.; Saintonge, Amelie; Van Sistine, Angela; Warren, Steven R.

    2017-01-01

    Abstract:The “Survey of HI in Extremely Low-mass Dwarfs” (SHIELD) is a multiwavelength study of local volume low-mass galaxies. Using the now-complete Arecibo Legacy Fast ALFA (ALFALFA) source catalog, 82 systems are identified that meet distance, line width, and HI flux criteria for being gas-rich, low-mass galaxies. These systems harbor neutral gas reservoirs smaller than 3x10^7 M_sun, thus populating the faint end of the HI mass function with statistical confidence for the first time. In a companion poster, we present new Karl G. Jansky Very Large Array D-configuration HI spectral line observations of 32 previously unobserved galaxies. Three galaxies in that study have been discovered to lie in close angular proximity to more massive galaxies. Here we present VLA HI imaging of these candidate interacting systems. We compare the neutral gas morphology and kinematics with optical images from SDSS. We discuss the frequency of low-mass galaxies undergoing tidal interaction in the complete SHIELD sample.Support for this work was provided by NSF grant 1211683 to JMC at Macalester College.

  8. Galactic worms. I - Catalog of worm candidates

    Science.gov (United States)

    Koo, Bon-Chul; Heiles, Carl; Reach, William T.

    1992-01-01

    A catalog of candidates for the Galactic worms that are possibly the walls surrounding the superbubbles is compiled; 118 isolated structures that appear both in H I and in IR (60 and 100 microns). Fifty-two are possibly associated with H II regions. It is found that the 100-micron emissivity increases systematically toward the Galactic interior, which is consistent with the increase of the general interstellar radiation field. The 100-micron emissivity of the structures associated with the H II regions is larger than that of the structures without associated H II regions. The 60-100-micron ratio is large, 0.28 +/- 0.03, which may indicate that the grains associated with the atomic gas have a relatively large population of small grains. Thirty-five structures appear in the 408-MHz continuum. The IR and the radio continuum properties suggest that the 408-MHz continuum emission in those structures is very likely thermal. The implications of these results on the ionization of gas far from the Galactic plane are discussed.

  9. ELECTIONS PENSION FUND CANDIDATE NO 1

    CERN Document Server

    2000-01-01

    This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name: MAURINFirst Name:Guy I have been a member of the personnel since 1967 and as early as 1972 I was involved, in my capacity as President of the Staff Association, in the improvement of the Pension Fund benefits. As for most of us the Pension Fund is the only social provident scheme to which we belong, it is important to ensure that it is well managed and in balance. As a member of the Governing Board since 1974 and Vice-Chairman of this Board since 1977, I have continued to pursue these objectives.One of the main responsibilities of the Governing Board is our asset investment policy. The Investment Committee, of which I am Chairman, must have an overall view of the management of our 4 billion Swiss francs and seek the best yield with minimum risk. The investment structure must continuously be adapted...

  10. ELECTIONS PENSION FUND CANDIDATE NO 2

    CERN Multimedia

    2000-01-01

    This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund.   Candidate: Name: RANJARDFirst Name: Florence Having been a member of the Governing Board of the Pension Fund since 1983 as Guy Maurin’s alternate, I am standing for a further 3-year term of office. Over the past few years work has concentrated essentially on following items: Monitoring of the work of the fund managers and their performances. The three-yearly study of the Fund’s actuarial situation. The pension guarantees ­ second phase. The Fund is approaching its maturity: the level of benefits exceeds contributions. In this context it has to strike a suitable balance between management of the risk from a dynamic investment policy, while a prudent policy avoiding any significant loss of its capital. These will be my concerns within the Governing Board of the Pension Fund if you...

  11. ELECTIONS PENSION FUND 5th candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate :  Name : Sonnemann  First Name : Florian Since my arrival at CERN in 1997 I have worked in the accelerator and administrative sectors. I have recently been elected as member of the Staff Council and of the Executive Committee of the Staff Association in which I am actively following matters concerning the Pension Fund. My candidature for the Governing Board of the CERN Pension Fund is mainly motivated to add my part in ensuring a solid financial situation of the Pension Fund. The Pension Fund is our only social security system. I wish to play a role in ensuring that the pensions will remain a secure revenue for all staff membe...

  12. ELECTIONS PENSION FUND CANDIDATE NR 5

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate :  Name : Sonnemann  First Name : Florian Since my arrival at CERN in 1997 I have worked in the accelerator and administrative sectors. I have recently been elected as member of the Staff Council and of the Executive Committee of the Staff Association in which I am actively following matters concerning the Pension Fund. My candidature for the Governing Board of the CERN Pension Fund is mainly motivated to add my part in ensuring a solid financial situation of the Pension Fund. The Pension Fund is our only social security system. I wish to play a role in ensuring that the pensions will remain a secure revenue for all staff membe...

  13. ELECTIONS PENSION FUND CANDIDATE NR 1

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : CHIAVERI First Name : Enrico I have been a CERN staff member since 1973 and have always been interested in our working conditions. As a member of the Executive Committee of the Staff Association I participated from 1980 to 1984 in the Working Group on Pensions mandated by the CERN Council. This commitment led to my becoming a member of the Governing Board of the Pension Fund in 1983, since when I have taken an active part in various commissions and working groups (Real Estate Asset Management Committee, Working Group on Actuarial Matters etc.); in so doing I have gained a thorough knowledge of different areas of the Pension Fund. Since ...

  14. Algal Lectins as Potential HIV Microbicide Candidates

    Directory of Open Access Journals (Sweden)

    Dominique Schols

    2012-07-01

    Full Text Available The development and use of topical microbicides potentially offers an additional strategy to reduce the spread of the Human Immunodeficiency Virus (HIV. Carbohydrate-binding agents (CBAs that show specificity for high mannose carbohydrates on the surface of the heavily glycosylated envelope of HIV are endowed with potent anti-HIV activity. In fact, a number of algal lectins such as cyanovirin-N, microvirin, microcystis viridis lectin, scytovirin, Oscillatoria agardhii agglutinin and griffithsin are considered as potential microbicide candidates to prevent the sexual transmission of HIV through topical applications. They not only inhibit infection of cells by cell-free virus but they can also efficiently prevent virus transmission from virus-infected cells to uninfected CD4+ target T-lymphocytes and DC-SIGN-directed capture of HIV-1 and transmission to CD4+ T lymphocytes. This review focuses on the structural properties and carbohydrate specificity of these algal lectins, their antiviral activity against HIV and several other enveloped viruses, their safety profile and viral resistance patterns.

  15. Cerebrospinal fluid biomarker candidates for parkinsonian disorders

    Directory of Open Access Journals (Sweden)

    Radu eConstantinescu

    2013-01-01

    Full Text Available The parkinsonian disorders are a large group of neurodegenerative diseases including idiopathic Parkinson's disease (PD and atypical parkinsonian disorders, such as multiple system atrophy, progressive supranuclear palsy, corticobasal degeneration, and dementia with Lewy bodies. The etiology of these disorders is not known although it is considered to be a combination of genetic and environmental factors. One of the greatest obstacles for developing efficacious disease-modifying treatment strategies is the lack of biomarkers. Reliable biomarkers are needed for early and accurate diagnosis, to measure disease progression and response to therapy. In this review several of the most promising cerebrospinal biomarker candidates are discussed. Alpha synuclein seems to be intimately involved in the pathogenesis of synucleinopathies and its levels can be measured in the cerebrospinal fluid and in plasma. In a similar way, tau protein accumulation seems to be involved in the pathogenesis of tauopathies. Urate, a potent antioxidant, seems to be associated to the risk of developing PD and with its progression. Neurofilament light chain levels are increased in atypical parkinsonian disorders compared with PD and healthy controls. The new "omics" techniques are potent tools offering new insights in the patho-etiology of these disorders. Some of the difficulties encountered in developing biomarkers are discussed together with future perspectives.

  16. ELECTIONS PENSION FUND CANDIDATE NR 2

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : FRANDSEN First Name : Poul Kjaer  I have been member of the staff since 1974, and member of staff council for more than 12 years, and my main motivation has been to work for improving the social conditions of the CERN staff. A very important pillar of this is a sound and healthy pension fund. A capitalised scheme has been and still is the best choice for assuring the benefits for the CERN staff, present and future, this social system being part of the whole necessary to attract the best staff to the future High Energy Physics in Europe. However, even the hypothetic close down of the Organisation should allow the benefits to exi...

  17. ELECTIONS PENSION FUND 2nd candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : FRANDSEN First Name : Poul Kjaer  I have been member of the staff since 1974, and member of staff council for more than 12 years, and my main motivation has been to work for improving the social conditions of the CERN staff. A very important pillar of this is a sound and healthy pension fund. A capitalised scheme has been and still is the best choice for assuring the benefits for the CERN staff, present and future, this social system being part of the whole necessary to attract the best staff to the future High Energy Physics in Europe. However, even the hypothetic close down of the Organisation should allow the benefits to exi...

  18. The FK Comae candidate UX Librae

    Science.gov (United States)

    Bopp, B. W.; Goodrich, B. D.; Africano, J. L.; Noah, P. V.; Meredith, R. J.; Palmer, L. H.; Quigley, R. J.

    1984-01-01

    New optical spectroscopic and photometric data are presented for the active chromosphere FK Com candidate UZ Lib. The star is shown to have an extremely large photometric amplitude in V of 0.35 mag, and its rotation period is established as 4.75 + or - 0.01 days. The optical spectrum is that of an early K giant, broadened by a rotation velocity of approximately 65 km/s. H-alpha is visible as a very broad emission feature, with a profile resembling that seen in FK Com. The emission intensity and profile are variable over the rotation period, with the strongest emission present at photometric minimum, in accord with dark starspot models. The photospheric absorption line profiles show variable asymmetries and distortions which are interpreted as due to the effects of the dark starspot rotating across the line of sight. New radial velocity measures are combined with published data to demonstrate the UZ Lib is a member of a binary system in synchronous rotation with a secondary of mass approximately 0.5 solar masses. This information is considered in light of the conflicting models for the origin of the optical and spectral variability of the FK Com stars, as well as their uncertain evolutionary status.

  19. Fifty Years of Pulsar Candidate Selection: From simple filters to a new principled real-time classification approach

    Science.gov (United States)

    Lyon, R. J.; Stappers, B. W.; Cooper, S.; Brooke, J. M.; Knowles, J. D.

    2016-06-01

    Improving survey specifications are causing an exponential rise in pulsar candidate numbers and data volumes. We study the candidate filters used to mitigate these problems during the past fifty years. We find that some existing methods such as applying constraints on the total number of candidates collected per observation, may have detrimental effects on the success of pulsar searches. Those methods immune to such effects are found to be ill-equipped to deal with the problems associated with increasing data volumes and candidate numbers, motivating the development of new approaches. We therefore present a new method designed for on-line operation. It selects promising candidates using a purpose-built tree-based machine learning classifier, the Gaussian Hellinger Very Fast Decision Tree (GH-VFDT), and a new set of features for describing candidates. The features have been chosen so as to i) maximise the separation between candidates arising from noise and those of probable astrophysical origin, and ii) be as survey-independent as possible. Using these features our new approach can process millions of candidates in seconds (˜1 million every 15 seconds), with high levels of pulsar recall (90%+). This technique is therefore applicable to the large volumes of data expected to be produced by the Square Kilometre Array (SKA). Use of this approach has assisted in the discovery of 20 new pulsars in data obtained during the LOFAR Tied-Array All-Sky Survey (LOTAAS).

  20. A method of searching for supernova candidates from massive galaxy spectra

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    This paper presents a novel spectroscopic method for searching for supernova candidates from massive galaxy spectra,which is expected to be applied to the Large Sky Area Multi-Object Fiber Spectroscopic Telescope (LAMOST).This method includes mainly five steps.The first step is spectral preprocessing,including removing spectral noise using wavelet transform,spectral de-redshift,etc.The second step is decomposition of galactic spectra;we can get the galaxy component and supernova component and calculate the Supernova Statistical Characterization Vector (SNSCV) of each galaxy spectrum.The third step is to decrease samples in all the galaxy spectral datasets according to SNSCV of each spectrum,and to use the LOF (Local Outlier Factor)-based outlier detection algorithm to obtain the preliminary selected spectral data.The fourth step is template matching by cross-correlation,according to the matched results we get the secondary selected spectral data.Finally,we choose the final supernova candidates manually through checking the spectral features characteristic of a supernova.By the spectroscopic method proposed in this paper,thirty-six supernova candidates have been detected in a dataset including 294843 galaxy spectra from the Sloan Digital Sky Survey Data Release 7.Nine of these objects are detected first and the other twenty-seven have been reported in other publications (fifteen of which are detected and reported first by us).The twenty-four new super-nova candidates include twenty Ia type supernova candidates,three Ic type supernova candidates and one II type supernova candidate.

  1. A Catalog of Kepler Habitable Zone Exoplanet Candidates

    Science.gov (United States)

    Kane, Stephen R.; Hill, Michelle L.; Kasting, James F.; Kopparapu, Ravi Kumar; Quintana, Elisa V.; Barclay, Thomas; Batalha, Natalie M.; Borucki, William J.; Ciardi, David R.; Haghighipour, Nader; Hinkel, Natalie R.; Kaltenegger, Lisa; Selsis, Franck; Torres, Guillermo

    2016-10-01

    The NASA Kepler mission ha s discovered thousands of new planetary candidates, many of which have been confirmed through follow-up observations. A primary goal of the mission is to determine the occurrence rate of terrestrial-size planets within the Habitable Zone (HZ) of their host stars. Here we provide a list of HZ exoplanet candidates from the Kepler Q1–Q17 Data Release 24 data-vetting process. This work was undertaken as part of the Kepler HZ Working Group. We use a variety of criteria regarding HZ boundaries and planetary sizes to produce complete lists of HZ candidates, including a catalog of 104 candidates within the optimistic HZ and 20 candidates with radii less than two Earth radii within the conservative HZ. We cross-match our HZ candidates with the stellar properties and confirmed planet properties from Data Release 25 to provide robust stellar parameters and candidate dispositions. We also include false-positive probabilities recently calculated by Morton et al. for each of the candidates within our catalogs to aid in their validation. Finally, we performed dynamical analysis simulations for multi-planet systems that contain candidates with radii less than two Earth radii as a step toward validation of those systems.

  2. Proposal of a candidate international conventional reference measurement procedure for free thyroxine in serum.

    NARCIS (Netherlands)

    Thienpont, L.M.; Beastall, G.H.; Christofides, N.D.; Faix, J.D.; Ieiri, T.; Jarrige, V.; Miller, W.G.; Miller, R.; Nelson, J.C.; Ronin, C.; Ross, H.A.; Rottmann, M.; Thijssen, J.H.; Toussaint, B.

    2007-01-01

    In the present paper the IFCC WG-STFT recommends and provides the rationale to establish metrological traceability of serum free thyroxine (FT4) measurements to a candidate international conventional reference measurement procedure. It is proposed that this procedure be based on equilibrium dialysis

  3. Candidate fire blight resistance genes in Malus identified with the use of genomic tools and approaches

    Science.gov (United States)

    The goal of this research is to utilize current advances in Rosaceae genomics to identify DNA markers for use in marker-assisted selection of durable resistance to fire blight. Candidate fire blight resistance genes were selected and ranked based upon differential expression after inoculation with ...

  4. RCT photometry and HCT spectroscopy of blazar candidates in the Kepler field of view

    Science.gov (United States)

    Carini, Michael T.; Goyal, A.; Jose, J.

    2014-01-01

    The results of photometric and spectroscopic monitoring of 9 blazar candidates in the Kepler field of view are presented. These sources were identified as blazar candidates based on their position in the so-called WISE blazar strip. Finding charts and comparison sequences were created using the NOMAD database. R band photometric monitoring was begun in spring 2013 with the Robotically Controlled Telescope(RCT), and spectroscopic observations of 7 of the sources were obtained with the Himalayan Chandra Telescope (HCT) in September, 2013. Light curves for all 9 sources and preliminary spectroscopic classifications for the 7 sources with spectra will be presented.

  5. VALFAST: Secure Probabilistic Validation of Hundreds of Kepler Planet Candidates

    Science.gov (United States)

    Morton, Tim; Petigura, E.; Johnson, J. A.; Howard, A.; Marcy, G. W.; Baranec, C.; Law, N. M.; Riddle, R. L.; Ciardi, D. R.; Robo-AO Team

    2014-01-01

    The scope, scale, and tremendous success of the Kepler mission has necessitated the rapid development of probabilistic validation as a new conceptual framework for analyzing transiting planet candidate signals. While several planet validation methods have been independently developed and presented in the literature, none has yet come close to addressing the entire Kepler survey. I present the results of applying VALFAST---a planet validation code based on the methodology described in Morton (2012)---to every Kepler Object of Interest. VALFAST is unique in its combination of detail, completeness, and speed. Using the transit light curve shape, realistic population simulations, and (optionally) diverse follow-up observations, it calculates the probability that a transit candidate signal is the result of a true transiting planet or any of a number of astrophysical false positive scenarios, all in just a few minutes on a laptop computer. In addition to efficiently validating the planetary nature of hundreds of new KOIs, this broad application of VALFAST also demonstrates its ability to reliably identify likely false positives. This extensive validation effort is also the first to incorporate data from all of the largest Kepler follow-up observing efforts: the CKS survey of ~1000 KOIs with Keck/HIRES, the Robo-AO survey of >1700 KOIs, and high-resolution images obtained through the Kepler Follow-up Observing Program. In addition to enabling the core science that the Kepler mission was designed for, this methodology will be critical to obtain statistical results from future surveys such as TESS and PLATO.

  6. Neurological soft signs as a candidate for endophenotype of schizophrenia

    Directory of Open Access Journals (Sweden)

    Kałużyńska, Olga

    2014-02-01

    Full Text Available A concept of an endophenotype, also termed as an internal endophenotype, is used in genetic studies on psychiatric disorders. Neurological soft signs are also considered candidates for endophenotypes of schizophrenia. Neurological soft signs are, objectively measured, non-localizing abnormalities, not related to impairment of a specific brain region, reflecting improper corical-subcorical and intercortical connections. This paper presents the main domains of NSS, methods of measurement of NSS, their neuroanatomical substrate, association of NSS with schizophrenia symptoms the and analysis of the literature in order to check whether NSS meet the criteria of the phenotype. A marker can be considered a phenotype if it meets the following criteria: 1 association with a disease in a population, 2 heritability, 3 state-independence, 4 familial association (the endophenotype is more prevalent in the affected individuals, their affected and non-affected family members in comparison to the normal population, 5 co-segregation ( the endophenotype is more prevalent among ill family members of ill probands compared with healthy relatives. Currently, there is an ample evidence that the NSS, especially these representing impaired motor coordination, meet certain criteria of an endophenotype. However, there are still several unresolved questions concerning NSS: studies on relatives of schizophrenic patients included small groups of subjects, many of the studies included individuals with schizophrenia, as well as schizophrenia spectrum disorders, the available date-base of twins (schizophrenia-concordant and schizophrenia non-concordant is not sufficiently large, there are too few studies evaluating the relationship of NSS and individual genes, there are no objective and quantitative methods of measurement of NSS. Therefore, NSS still represent only candidates for an endophenotype of schizophrenia. Finding correlations of selected NSS with other endophenotypes

  7. Screening for keratoconus suspects among candidates for refractive surgery.

    Science.gov (United States)

    McMonnies, Charles W

    2014-11-01

    This review examines methods for estimating the risk of post-surgical ectasia in candidates for refractive surgery by establishing a diagnosis of keratoconus suspect as a contraindication for proceeding with surgery. Notwithstanding the desirability of achieving 100 per cent sensitivity, any associated reduction in specificity and increased numbers of false positives might deny some candidates the opportunity to proceed with refractive surgery. The introduction of a model for the risk of ectasia involving both pre- and post-surgical findings has been followed by a plethora of attempts to achieve the same purpose based on topographic and/or tomographic evaluation before surgery. The desirability of being able to depend on objective assessment using one type of instrument needs to be weighed against the possibility that subjective assessments may contribute significantly to screening success. For example, consideration of ethnicity, family history of keratoconus, a history of atopy or ocular allergies in particular, a history of significant exposure to corneal trauma associated with abnormal rubbing habits or with vocational, leisure or geographically increased exposure to ultraviolet radiation or with contact lens wear trauma or a history of significant exposure to activities which elevate intraocular pressure may improve screening success. To the extent that these factors could contribute to increased risk of the development of keratoconus, they may be useful in estimating the risk of post-surgical ectasia. If any combination of these factors helps to explain the development of keratoconus in normal or even thicker than normal corneas, they may have more significance for those corneas, which have been thinned surgically.

  8. Extremely metal-poor star candidates in the SDSS

    Institute of Scientific and Technical Information of China (English)

    Si-Yao Xu; Hua-Wei Zhang; Xiao-Wei Liu

    2013-01-01

    For a sample of metal-poor stars (-3.3 ≤ [Fe/H] ≤-2.2) that have highresolution spectroscopic abundance determinations,we have measured equivalent widths of the Ca Ⅱ K,Mg Ⅰ b and near-infrared Ca Ⅱ triplet lines using low-resolution spectra from the Sloan Digital Sky Survey (SDSS),calculated effective temperatures from (g-z)o color,deduced stellar surface gravities by fitting stellar isochrones,and determined metallicities based on the aforementioned quantities.Metallicities thus derived from the Ca Ⅱ K line are in much better agreement with the results determined from high-resolution spectra than the values given in the SDSS Data Release 7.The metallicities derived from the Mg Ⅰ b lines have a large dispersion owing to the large measurement errors,whereas those deduced from the Ca Ⅱ triplet lines are too high due to both non-local thermodynamical equilibrium (NLTE) effects and measurement errors.Abundances after correction for the NLTE effect for the Mg Ⅰ b lines and Ca Ⅱ triplet lines are also presented.Following this method,we have identified six candidates of ultra-metal-poor stars with [Fe/H] ~-4.0 from a sample of 166 metal-poor star candidates.One of them,SDSS J102915+172927,was recently confirmed to be an ultra-metal-poor ([Fe/H] <-4.0) star with the lowest metallicity ever measured.Follow-up high-resolution spectroscopy for the other five ultra-metal-poor stars in our sample will therefore be of great interest.

  9. Adaptations to climate in candidate genes for common metabolic disorders.

    Directory of Open Access Journals (Sweden)

    Angela M Hancock

    2008-02-01

    Full Text Available Evolutionary pressures due to variation in climate play an important role in shaping phenotypic variation among and within species and have been shown to influence variation in phenotypes such as body shape and size among humans. Genes involved in energy metabolism are likely to be central to heat and cold tolerance. To test the hypothesis that climate shaped variation in metabolism genes in humans, we used a bioinformatics approach based on network theory to select 82 candidate genes for common metabolic disorders. We genotyped 873 tag SNPs in these genes in 54 worldwide populations (including the 52 in the Human Genome Diversity Project panel and found correlations with climate variables using rank correlation analysis and a newly developed method termed Bayesian geographic analysis. In addition, we genotyped 210 carefully matched control SNPs to provide an empirical null distribution for spatial patterns of allele frequency due to population history alone. For nearly all climate variables, we found an excess of genic SNPs in the tail of the distributions of the test statistics compared to the control SNPs, implying that metabolic genes as a group show signals of spatially varying selection. Among our strongest signals were several SNPs (e.g., LEPR R109K, FABP2 A54T that had previously been associated with phenotypes directly related to cold tolerance. Since variation in climate may be correlated with other aspects of environmental variation, it is possible that some of the signals that we detected reflect selective pressures other than climate. Nevertheless, our results are consistent with the idea that climate has been an important selective pressure acting on candidate genes for common metabolic disorders.

  10. Selection of Lactic Acid Bacteria as Probiotic Candidate for Chicken

    Directory of Open Access Journals (Sweden)

    F. Hamida

    2015-08-01

    Full Text Available Lactic acid bacteria (LAB regarded as safe microorganisms; they can naturally live in gastrointestinal tract, so appropriately used as a probiotic for chicken. This study aimed to select six isolates of LAB (E1223, E3, E4, E5, E7, and E8 to obtain the isolates potentially as probiotic candidate for chicken. The six isolates were derived from spontaneous fermented corn obtained from Laboratory of Animal Biotechnology and Biomedical, PPSHB, Bogor Agricultural University, Indonesia. LAB isolates were tested their susceptibility to antibiotics (bambermycin, erythromycin, chloramphenicol, and tetracycline then were examined in vitro for their tolerance to gastrointestinal pH (2, 3, 4, and 7.2 and 0.5% bile salt condition, antimicrobial activity against Salmonella enteritidis and Enterococcus casseliflavus, and ability to adhere to chicken ileal cells. The results showed the isolates E5, E7, and E8 were sensitive to tetracycline and chloramphenicol, they could survive at pH 2, 3, 4, and 7.2, could survive at 0.5% bile salts, produced antimicrobial activity, and able to adhere to ileal cells (9.40±0.00 Log CFU/cm2 of E8 and were significantly (P<0.05 higher than those of control (5.30±0.14 Log CFU/cm2. In conclusion, this study showed that isolate E8 had better potential compared to isolates E5 and E7 in most in vitro assays as a probiotic candidate for chicken. E5, E7, and E8 were closely related with Pediococcus pentosaceus based on 16S rRNA gene.

  11. Competition for attachment of aquaculture candidate probiotic and pathogenic bacteria on fish intestinal mucus.

    Science.gov (United States)

    Vine, N G; Leukes, W D; Kaiser, H; Daya, S; Baxter, J; Hecht, T

    2004-06-01

    Probiotics for aquaculture are generally only selected by their ability to produce antimicrobial metabolites; however, attachment to intestinal mucus is important in order to remain within the gut of its host. Five candidate probiotics (AP1-AP5), isolated from the clownfish, Amphiprion percula (Lacepéde), were examined for their ability to attach to fish intestinal mucus and compete with two pathogens, Aeromonas hydrophila and Vibrio alginolyticus. Two different radioactive isotopes were used to quantify competition between pathogens and probionts. Attachment of the pathogens was enhanced by the presence of the candidate probiotics. However, the addition of the candidate probiotics after the pathogens resulted in reduced pathogen attachment. Only AP5 caused lower attachment success of V. alginolyticus when added before the pathogen. When AP5 was added first, the average attachment change was 41% compared with 72% when added after V. alginolyticus, suggesting that the probiotic is displaced but that enhanced attachment of the pathogen does not occur. Conversely, when V. alginolyticus was added first, followed by AP5, attachment change was 37% while AP5 had 92% attachment change when added second. This implies that the pathogen was displaced by the candidate probiotic and therefore it appeared that, based on the ability of probiont AP5 to attach to mucus, the growth of the pathogen in the digestive tract might be suppressed by the candidate probiont's presence.

  12. EXAMINING TEACHER CANDIDATES' SKILLS OF USING SCIENCE KNOWLEDGE IN THEIR DECISION MAKING PROCESS

    Directory of Open Access Journals (Sweden)

    Mutlu Pınar DEMİRCİ GÜLER

    2014-06-01

    Full Text Available This study aims to examine how teacher candidates studying at science and elementary teaching departments transfer their knowledge gained in the biology, ecology and science teaching courses to their decision making process. The study was conducted with the participation of 168 teacher candidates, 94 of whom study at the Science Teaching Department and 74 study at the Elementary Teaching Department of Education Faculty at Ahi Evran University. The data were gathered through written feedback provided by the teacher candidates at the end of in-class application conducted using multi-voting technique that is one of the decision making technique and in the discussion part of the application, open fishbowl technique that is one of the group discussion techniques. The feedback provided by the candidates was analysed using content analysis and the descriptive findings were discussed with reference to the literature. The findings revealed that teacher candidates used their science knowledge effectively in decision making, perceived the continuity of life as equal to the continuity of humanity, and thought that the ozone layer, drinking water, animals and infertility were essential for the continuity of life. Based on the findings of the study, it can be suggested that students' decision making process should be examined by fictionalizing scenarios considering their cognitive and affective levels, and teaching techniques enhancing the participation of the whole class should be included in the teaching process.

  13. Functional validation of GWAS gene candidates for abnormal liver function during zebrafish liver development

    Directory of Open Access Journals (Sweden)

    Leah Y. Liu

    2013-09-01

    Genome-wide association studies (GWAS have revealed numerous associations between many phenotypes and gene candidates. Frequently, however, further elucidation of gene function has not been achieved. A recent GWAS identified 69 candidate genes associated with elevated liver enzyme concentrations, which are clinical markers of liver disease. To investigate the role of these genes in liver homeostasis, we narrowed down this list to 12 genes based on zebrafish orthology, zebrafish liver expression and disease correlation. To assess the function of gene candidates during liver development, we assayed hepatic progenitors at 48 hours post fertilization (hpf and hepatocytes at 72 hpf using in situ hybridization following morpholino knockdown in zebrafish embryos. Knockdown of three genes (pnpla3, pklr and mapk10 decreased expression of hepatic progenitor cells, whereas knockdown of eight genes (pnpla3, cpn1, trib1, fads2, slc2a2, pklr, mapk10 and samm50 decreased cell-specific hepatocyte expression. We then induced liver injury in zebrafish embryos using acetaminophen exposure and observed changes in liver toxicity incidence in morphants. Prioritization of GWAS candidates and morpholino knockdown expedites the study of newly identified genes impacting liver development and represents a feasible method for initial assessment of candidate genes to instruct further mechanistic analyses. Our analysis can be extended to GWAS for additional disease-associated phenotypes.

  14. ‘Don’t Leave Before You Understand’: Supporting Master’s Candidates in Business Studies

    Directory of Open Access Journals (Sweden)

    Christine Winberg

    2015-06-01

    Full Text Available Postgraduate studies in business faculties pose particular challenges to candidates who have come from practically-oriented undergraduate programmes, particularly those that adopt a ‘technical-rational’ approach towards the improvement of business practices or organisational efficiency. Research studies in the applied business fields usually expect that the candidate will take a more sociological approach, or be able to work within socio-historical or political frameworks (Hordern, 2014. Candidates who are enrolled for postgraduate business studies have to negotiate this complex transition. The focus of this paper is how candidates acquire the necessary academic and social practices for theorising their research, for conducting research activities and writing up their research findings in Masters level applied business studies. We selected candidates who had experienced difficulties throughout their Masters studies and who had successfully completed, or who were close to completion, despite initial difficulty for narrative interviews. The interview data were analysed with a view to establishing the practices that supported successful transition from practice-based undergraduate business degrees to postgraduate studies in the field. This paper concludes with suggestions for supervisory practices that have the potential to support successful postgraduate research in applied business studies. 

  15. Eliciting, Identifying, Interpreting, and Responding to Students' Ideas: Teacher Candidates' Growth in Formative Assessment Practices

    Science.gov (United States)

    Gotwals, Amelia Wenk; Birmingham, Daniel

    2016-06-01

    With the goal of helping teacher candidates become well-started beginners, it is important that methods courses in teacher education programs focus on high-leverage practices. Using responsive teaching practices, specifically eliciting, identifying, interpreting, and responding to students' science ideas (i.e., formative assessment), can be used to support all students in learning science successfully. This study follows seven secondary science teacher candidates in a yearlong practice-based methods course. Course assignments (i.e., plans for and reflections on teaching) as well as teaching videos were analyzed using a recursive qualitative approach. In this paper, we present themes and patterns in teacher candidates' abilities to elicit, identify, interpret, and respond to students' ideas. Specifically, we found that those teacher candidates who grew in the ways in which they elicited students' ideas from fall to spring were also those who were able to adopt a more balanced reflection approach (considering both teacher and student moves). However, we found that even the teacher candidates who grew in these practices did not move toward seeing students' ideas as nuanced; rather, they saw students' ideas in a dichotomous fashion: right or wrong. We discuss implications for teacher preparation, specifically for how to promote productive reflection and tools for better understanding students' ideas.

  16. A Systematic Approach to Identify Candidate Transcription Factors that Control Cell Identity

    Directory of Open Access Journals (Sweden)

    Ana C. D’Alessio

    2015-11-01

    Full Text Available Hundreds of transcription factors (TFs are expressed in each cell type, but cell identity can be induced through the activity of just a small number of core TFs. Systematic identification of these core TFs for a wide variety of cell types is currently lacking and would establish a foundation for understanding the transcriptional control of cell identity in development, disease, and cell-based therapy. Here, we describe a computational approach that generates an atlas of candidate core TFs for a broad spectrum of human cells. The potential impact of the atlas was demonstrated via cellular reprogramming efforts where candidate core TFs proved capable of converting human fibroblasts to retinal pigment epithelial-like cells. These results suggest that candidate core TFs from the atlas will prove a useful starting point for studying transcriptional control of cell identity and reprogramming in many human cell types.

  17. Architecture of Kepler's Multi-transiting Systems: II. New investigations with twice as many candidates

    CERN Document Server

    Fabrycky, Daniel C; Ragozzine, Darin; Rowe, Jason F; Agol, Eric; Barclay, Thomas; Batalha, Natalie; Borucki, William; Ciardi, David R; Ford, Eric B; Geary, John C; Holman, Matthew J; Jenkins, Jon M; Li, Jie; Morehead, Robert C; Shporer, Avi; Smith, Jeffrey C; Steffen, Jason H; Still, Martin

    2012-01-01

    Having discovered 885 planet candidates in 361 multiple-planet systems, Kepler has made transits a powerful method for studying the statistics of planetary systems. The orbits of only two pairs of planets in these candidate systems are apparently unstable. This indicates that a high percentage of the candidate systems are truly planets orbiting the same star, motivating physical investigations of the population. Pairs of planets in this sample are typically not in orbital resonances. However, pairs with orbital period ratios within a few percent of a first-order resonance (e.g. 2:1, 3:2) prefer orbital spacings just wide of the resonance and avoid spacings just narrow of the resonance. Finally, we investigate mutual inclinations based on transit duration ratios. We infer that the inner planets of pairs tend to have a smaller impact parameter than their outer companions, suggesting these planetary systems are typically coplanar to within a few degrees.

  18. Testing of Candidate Icons to Identify Acetaminophen-Containing Medicines

    Directory of Open Access Journals (Sweden)

    Saul Shiffman

    2016-01-01

    Full Text Available Adding icons on labels of acetaminophen-containing medicines could help users identify the active ingredient and avoid concomitant use of multiple medicines containing acetaminophen. We evaluated five icons for communication effectiveness. Adults (n = 300 were randomized to view a prescription container label or over-the-counter labels with either one or two icons. Participants saw two icon candidates, and reported their interpretation; experts judged whether these reflected critical confusions that might cause harm. Participants rated how effectively each icon communicated key messages. Icons based on abbreviations of “acetaminophen” (“Ac”, “Ace”, “Acm” were rated less confusing and more effective in communicating the active ingredient than icons based on “APAP” or an abstract symbol. Icons did not result in critical confusion when seen on a readable medicine label. Icon implementation on prescription labels was more effective at communicating the warning against concomitant use than implementation on over-the-counter (OTC labels. Adding an icon to a second location on OTC labels did not consistently enhance this communication, but reduced rated effectiveness of acetaminophen ingredient communication among participants with limited health literacy. The abbreviation-based icons seem most suitable for labeling acetaminophen-containing medications to enable users to identify acetaminophen-containing products.

  19. Primary-Grade Teacher Candidates' Views on Museum Education

    Science.gov (United States)

    Tas, Ayse Mentis

    2012-01-01

    This study identifies the primary-grade teacher candidates' views on museum education. The research is a descriptive research that used survey model. The study group is made up of 209 primary-grade teacher candidates who were seniors in the Primary-Grade Teaching Program. They were all attending Konya University's Faculty of Education. A survey…

  20. Investigating Academic Achievements and Critical Thinking Dispositions of Teacher Candidates

    Science.gov (United States)

    Karagöl, Ibrahim; Bekmezci, Sinan

    2015-01-01

    The aim of this study is to examine the relationship between academic achievements and critical thinking dispositions of teacher candidates in Faculty of Education and to find out whether critical thinking dispositions and academic achievements scores of teacher candidates differ according to different variables. The population consists of the…

  1. Chemical Literacy Levels of Science and Mathematics Teacher Candidates

    Science.gov (United States)

    Celik, Suat

    2014-01-01

    The goal of this study was to investigate Turkish science and mathematics teacher candidates' levels of attainment in chemical literacy. These candidates had all studied the new Turkish chemistry curriculum in high school. The sample of the study consisted of 112 students, who were first-year students in the Department of Secondary Science…

  2. Five kepler target stars that show multiple transiting exoplanet candidates

    DEFF Research Database (Denmark)

    Steffen..[], Jason H.; Batalha, N. M.; Broucki, W J.;

    2010-01-01

    We present and discuss five candidate exoplanetary systems identified with the Kepler spacecraft. These five systems show transits from multiple exoplanet candidates. Should these objects prove to be planetary in nature, then these five systems open new opportunities for the field of exoplanets...

  3. 11 CFR 106.1 - Allocation of expenses between candidates.

    Science.gov (United States)

    2010-01-01

    ... broadcast communication, the attribution shall be determined by the proportion of space or time devoted to... non-Federal candidates, and that is made by a political committee with separate Federal and non...) An authorized expenditure made by a candidate or political committee on behalf of another...

  4. Social Studies Teacher Candidates' Views on Historical Thinking Skills

    Science.gov (United States)

    Ozmen, Cengiz

    2015-01-01

    Current study aimed to present Social Studies teacher candidates' views on historical thinking skills. Study was conducted using qualitative design and working group was composed of a total of 121 teacher candidates (62 females and 59 males) attending Social Studies Teaching Department of Karadeniz Technical University and Adiyaman University…

  5. 11 CFR 100.152 - Fundraising costs for Presidential candidates.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Fundraising costs for Presidential candidates... U.S.C. 431) Exceptions to Expenditures § 100.152 Fundraising costs for Presidential candidates. (a... the solicitation of contributions means any cost reasonably related to fundraising activity,...

  6. Opinions of Counselor Candidates Regarding Counseling Skills Training

    Science.gov (United States)

    Aladag, Mine; Yaka, Baris; Koç, Ismet

    2014-01-01

    The aim of this study is to contribute to the enhancement of the quality of counseling skills training and counselor education through the medium of understanding the opinions of counselor candidates regarding counseling skills training. The research group consisted of 67 counselor candidates who voluntarily participated in the study. The research…

  7. Writing Instruction for Teacher Candidates: Strengthening a Weak Curricular Area

    Science.gov (United States)

    Grisham, Dana L.; Wolsey, Thomas Devere

    2011-01-01

    In this case study, two teacher educators in literacy examined teacher candidates' (N = 24) learning of writing instruction across a three-course sequence of literacy methods. Data collected included a survey of candidates' knowledge of writing instruction, their formal observations of writing lessons in their student-teaching placements, a…

  8. Assessing Student Teaching Experiences: Teacher Candidates' Perceptions of Preparedness

    Science.gov (United States)

    Lee, Joohi; Tice, Kathleen; Collins, Denise; Brown, Amber; Smith, Cleta; Fox, Jill

    2012-01-01

    The purpose of this study is to investigate the effectiveness of student teaching experiences by measuring teacher candidates' perceptions of their preparedness. The participants were 130 teacher candidates who had completed their student teaching as part of a program preparing them to teach children in pre-K through grade 4. Teacher candidates…

  9. Fostering the Development of Chemistry Teacher Candidates: A Bioecological Approach

    Science.gov (United States)

    Lewthwaite, Brian; Wiebe, Rick

    2012-01-01

    This ongoing research inquiry investigates through the analysis of teacher candidate experiences the factors influencing two groups of chemistry teacher candidates' development during their extended practica in their second and final year of an after-degree bachelor of education at a university in central Canada. The tenets of Bronfenbrenner's…

  10. DAZLA: an important candidate gene in male subfertility?

    NARCIS (Netherlands)

    Golde, R.J.T. van; Tuerlings, J.H.A.M.; Kremer, J.A.M.; Braat, D.D.M.; Schoute, F.; Hoefsloot, L.H.

    2001-01-01

    PURPOSE: To study the role of the autosomal candidate gene DAZLA (Deleted in AZoospermia Like Autosome) in male subfertility. METHODS: We reviewed clinical data of subfertile men with oligozoospermia or azoospermia, mostly candidates for intracytoplasmic sperm injection (ICSI). Mutation detection wa

  11. Facebook Connection Styles among Physical Education Teacher Candidates

    Science.gov (United States)

    Erdogdu, Murat

    2016-01-01

    The purpose of this study is to determine the Facebook connection styles of physical education (PE) teacher candidates. The participants were composed of 626 (age = 21.21 ± 2.024) physical education teacher candidates from the departments of Physical Education and Sports. They teach in five different universities. It was done in 2014-2015 academic…

  12. Developing Benchmarks to Measure Teacher Candidates' Performance

    Science.gov (United States)

    Frazier, Laura Corbin; Brown-Hobbs, Stacy; Palmer, Barbara Martin

    2013-01-01

    This paper traces the development of teacher candidate benchmarks at one liberal arts institution. Begun as a classroom assessment activity over ten years ago, the benchmarks, through collaboration with professional development school partners, now serve as a primary measure of teacher candidates' performance in the final phases of the…

  13. Reranking candidate gene models with cross-species comparison for improved gene prediction

    Directory of Open Access Journals (Sweden)

    Pereira Fernando CN

    2008-10-01

    Full Text Available Abstract Background Most gene finders score candidate gene models with state-based methods, typically HMMs, by combining local properties (coding potential, splice donor and acceptor patterns, etc. Competing models with similar state-based scores may be distinguishable with additional information. In particular, functional and comparative genomics datasets may help to select among competing models of comparable probability by exploiting features likely to be associated with the correct gene models, such as conserved exon/intron structure or protein sequence features. Results We have investigated the utility of a simple post-processing step for selecting among a set of alternative gene models, using global scoring rules to rerank competing models for more accurate prediction. For each gene locus, we first generate the K best candidate gene models using the gene finder Evigan, and then rerank these models using comparisons with putative orthologous genes from closely-related species. Candidate gene models with lower scores in the original gene finder may be selected if they exhibit strong similarity to probable orthologs in coding sequence, splice site location, or signal peptide occurrence. Experiments on Drosophila melanogaster demonstrate that reranking based on cross-species comparison outperforms the best gene models identified by Evigan alone, and also outperforms the comparative gene finders GeneWise and Augustus+. Conclusion Reranking gene models with cross-species comparison improves gene prediction accuracy. This straightforward method can be readily adapted to incorporate additional lines of evidence, as it requires only a ranked source of candidate gene models.

  14. NOAA/NGDC candidate models for the 11th generation International Geomagnetic Reference Field and the concurrent release of the 6th generation POMME magnetic model

    OpenAIRE

    2010-01-01

    The International Geomagnetic Reference Field (IGRF) is updated every five years based on candidate model submissions by research institutions worldwide. In the call for the 11th generation of IGRF, candidates were requested for the definitive main field in 2005, the predicted main field in 2010, and the predicted secular variation from 2010 to 2015. The NOAA/NGDC candidate models for IGRF-11 were produced from parent models parameterized in the same way as the 6th generation of our Pomme mag...

  15. Almost All of Kepler's Multiple Planet Candidates are Planets

    CERN Document Server

    Lissauer, Jack J; Rowe, Jason F; Bryson, Stephen T; Adams, Elisabeth; Buchhave, Lars A; Ciardi, David R; Cochran, William D; Fabrycky, Daniel C; Ford, Eric B; Fressin, Francois; Geary, John; Gilliland, Ronald L; Holman, Matthew J; Howell, Steve B; Jenkins, Jon M; Kinemuchi, Karen; Koch, David G; Morehead, Robert C; Ragozzine, Darin; Seader, Shawn E; Tanenbaum, Peter G; Torres, Guillermo; Twicken, Joseph D

    2012-01-01

    We present a statistical analysis that demonstrates that the overwhelming majority of Kepler candidate multiple transiting systems (multis) indeed represent true, physically-associated transiting planets. Binary stars provide the primary source of false positives among Kepler planet candidates, implying that false positives should be nearly randomly-distributed among Kepler targets. In contrast, true transiting planets would appear clustered around a smaller number of Kepler targets if detectable planets tend to come in systems and/or if the orbital planes of planets encircling the same star are correlated. There are more than one hundred times as many Kepler planet candidates in multi-candidate systems as would be predicted from a random distribution of candidates, implying that the vast majority are true planets. Most of these multis are multiple planet systems orbiting the Kepler target star, but there are likely cases where (a) the planetary system orbits a fainter star, and the planets are thus significa...

  16. Environmental Assessment: West Coast Basing of C-17 Aircraft

    Science.gov (United States)

    2003-06-01

    below 500 feet. Found scattered in vernal pools, northwest corner of the Base. Amphibians California tiger salamander Ambystoma ...Polites mardon Candidate Endangered Taylor (Whulge) checkerspot Euphydryas editha taylori Candidate Candidate Plants White-top aster Aster curtus

  17. Fifty Years of Pulsar Candidate Selection: From simple filters to a new principled real-time classification approach

    CERN Document Server

    Lyon, R J; Cooper, S; Brooke, J M; Knowles, J D

    2016-01-01

    Improving survey specifications are causing an exponential rise in pulsar candidate numbers and data volumes. We study the candidate filters used to mitigate these problems during the past fifty years. We find that some existing methods such as applying constraints on the total number of candidates collected per observation, may have detrimental effects on the success of pulsar searches. Those methods immune to such effects are found to be ill-equipped to deal with the problems associated with increasing data volumes and candidate numbers, motivating the development of new approaches. We therefore present a new method designed for on-line operation. It selects promising candidates using a purpose-built tree-based machine learning classifier, the Gaussian Hellinger Very Fast Decision Tree (GH-VFDT), and a new set of features for describing candidates. The features have been chosen so as to i) maximise the separation between candidates arising from noise and those of probable astrophysical origin, and ii) be as...

  18. 病例对照设计为基础的候选基因关联研究中交互作用的统计方法进展%Progress of statistical methods for testing interactions in candidate gene association studies based on case-control design

    Institute of Scientific and Technical Information of China (English)

    金如锋

    2011-01-01

    候选基因关联研究中基因-基因、基因-环境交互作用的统计分析有利于揭示疾病的发生机制.本文针对病例对照设计的候选基因关联研究,综述交互作用的统计方法及其进展.交互作用的统计方法包括参数法和非参数法.参数法中最常用的为Logistic回归模型,非参数法主要是数据挖掘方法.有4类数据挖掘方法可用于候选基因关联研究,包括降维法、基于树的方法、模式识别法和贝叶斯法.本文对最常用且可靠的几种数据挖掘方法(多因子降维法、分类回归树、随机森林、贝叶斯上位效应关联图谱)的原理、分析过程和优缺点予以比较.参数法和非参数法分析交互作用时各有优缺点;低维数据的分析可采用参数法和非参数法,高维数据的分析则主要采用非参数法.随着基因分型技术的发展,可检测的SNP规模逐渐增大,使得非参数方法的应用越来越广.%Testing for gene-gene and gene-environment interactions in candidate gene association studies will help to reveal possible mechanisms underlying diseases. This article summarized the progress of statistical methods for testing interactions in candidate gene association studies based on case-control design. Parametric and non-parametric methods can be used to detect the interactions. Logistic regression is the most frequently used parametric method,and data mining techniques offer a variety of alternative non-parametric methods. Data mining techniques that can be applied in association studies consist of dimension reduction, tree-based approach, pattern recognition and Bayesian methods. Among alternative non-parametric methods we concentrated on the four methods which have become popular and are reliable for detection of interactions, including multifactor dimensionality reduction (MDR),classification and regression tree (CART), random forest, and Bayesian epistasis association mapping (BEAM). The principles

  19. A Catalog of Kepler Habitable Zone Exoplanet Candidates

    CERN Document Server

    Kane, Stephen R; Kasting, James F; Kopparapu, Ravi Kumar; Quintana, Elisa V; Barclay, Thomas; Batalha, Natalie M; Borucki, William J; Ciardi, David R; Haghighipour, Nader; Hinkel, Natalie R; Kaltenegger, Lisa; Selsis, Franck; Torres, Guillermo

    2016-01-01

    The NASA Kepler mission has discovered thousands of new planetary candidates, many of which have been confirmed through follow-up observations. A primary goal of the mission is to determine the occurrance rate of terrestrial-size planets within the Habitable Zone (HZ) of their host stars. Here we provide a list of HZ exoplanet candidates from the Kepler Data Release 24 Q1-Q17 data vetting process. This work was undertaken as part of the Kepler Habitable Zone Working Group. We use a variety of criteria regarding HZ boundaries and planetary sizes to produce complete lists of HZ candidates, including a catalog of 104 candidates within the optimistic HZ and 20 candidates with radii less than two Earth radii within the conservative HZ. We cross-match our HZ candidates with the Data Release 25 stellar properties and confirmed planet properties to provide robust stellar parameters and candidate dispositions. We also include false positive probabilities recently calculated by Morton et al. (2016) for each of the cand...

  20. XForms 1.1 candidate recommendation

    NARCIS (Netherlands)

    Boyer, J.M.

    2007-01-01

    XForms is an XML application that represents the next generation of forms for the Web. XForms is not a free-standing document type, but is intended to be integrated into other markup languages, such as XHTML, ODF or SVG. An XForms-based web form gathers and processes XML data using an architecture t

  1. Bimodal Networks as Candidates for Electroactive Polymers

    DEFF Research Database (Denmark)

    Bahrt, Frederikke; Daugaard, Anders Egede; Bejenariu, Anca Gabriela;

    An alternative network formulation method was adopted in order to obtain a different type of silicone based elastomeric systems - the so-called bimodal networks - using two vinyl-terminated polydimethyl siloxanes (PDMS) of different molecular weight, a labelled crosslinker (3 or 4-functional), an...

  2. Planet Hunters VI: The First Kepler Seven Planet Candidate System and 13 Other Planet Candidates from the Kepler Archival Data

    CERN Document Server

    Schmitt, Joseph R; Fischer, Debra A; Jek, Kian J; Moriarty, John C; Boyajian, Tabetha S; Schwamb, Megan E; Lintott, Chris; Smith, Arfon M; Parrish, Michael; Schawinski, Kevin; Lynn, Stuart; Simpson, Robert; Omohundro, Mark; Winarski, Troy; Goodman, Samuel J; Jebson, Tony; Lacourse, Daryll

    2013-01-01

    We report the discovery of 14 new transiting planet candidates in the Kepler field from the Planet Hunters citizen science program. None of these candidates overlap with Kepler Objects of Interest (KOIs), and five of the candidates were missed by the Kepler Transit Planet Search (TPS) algorithm. The new candidates have periods ranging from 124-904 days, eight residing in their host star's habitable zone (HZ) and two (now) in multiple planet systems. We report the discovery of one more addition to the six planet candidate system around KOI-351, marking the first seven planet candidate system from Kepler. Additionally, KOI-351 bears some resemblance to our own solar system, with the inner five planets ranging from Earth to mini-Neptune radii and the outer planets being gas giants; however, this system is very compact, with all seven planet candidates orbiting $\\lesssim 1$ AU from their host star. We perform a numerical integration of the orbits and show that the system remains stable for over 100 million years....

  3. AN EVALUATION OF THE VIEWS OF TEACHER CANDIDATES ON THE DEVELOPMENT OF A CONSTRUCTIVIST LEARNING BASED CURRICULUM YAPILANDIRMACI ÖĞRENME TEMELLİ BİR ÖĞRETİM PROGRAMININ OLUŞTURULMASINA İLİŞKİN ÖĞRETMEN ADAYLARININ GÖRÜŞLERİNİN DEĞERLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Etem YEŞİLYURT

    2011-12-01

    Full Text Available The aim of this qualitative study is to evaluate the views of teachercandidates on the development of a constructivist learning basedcurriculum. In line with this main purpose, the views of teachercandidates on the identification of objectives, development of content,organization of learning situations and implementation of testingsituations were evaluated in the study. The study group comprised 39teacher candidates attending the last year of the Class TeacherEducation program of Fırat University Education Faculty during the2009-2010 academic year. Data obtained by semi-structured interviewforms were analyzed by using the content analysis method on NVivo 8qualitative data analysis software. The findings of the study showed thatteacher candidates were knowledgeable about the identification ofconstructivist learning based curriculum objectives, development of content, organization of learning situations and implementation of testingsituations. Nitel araştırma yöntemi kullanılarak yapılan bu çalışmanın amacı,yapılandırmacı öğrenme temelli bir öğretim programının oluşturulmasınailişkin öğretmen adaylarının görüşlerini değerlendirmektir. Bu genelamaç doğrultusunda hedeflerin nasıl belirlenmesi, içeriğin nasıloluşturulması, eğitim durumlarının nasıl düzenlenmesi ve sınamadurumlarının nasıl yapılması gerektiğine yönelik öğretmen adaylarınıngörüşlerinin değerlendirilmesi çalışma kapsamında ele alınmıştır.Araştırmanın çalışma grubunu, 2009–2010 akademik yılında FıratÜniversitesi Eğitim Fakültesi Sınıf Öğretmenliği programı son sınıftaöğrenim gören 39 öğretmen adayı oluşturmaktadır. Yarı yapılandırılmışgörüşme formuyla elde edilen veriler NVivo 8 nitel veri analizi programıkullanılarak içerik analizi yöntemiyle çözümlenmiştir. Araştırmadan eldeedilen bulgulara bakıldığında, yapılandırmacı öğrenme temelli bir

  4. Identification of Schistosoma mansoni candidate antigens for diagnosis of schistosomiasis

    Directory of Open Access Journals (Sweden)

    Gardenia Braz Figueiredo Carvalho

    2011-11-01

    Full Text Available The development of a more sensitive diagnostic test for schistosomiasis is needed to overcome the limitations of the use of stool examination in low endemic areas. Using parasite antigens in enzyme linked immunosorbent assay is a promising strategy, however a more rational selection of parasite antigens is necessary. In this study we performed in silico analysis of the Schistosoma mansoni genome, using SchistoDB database and bioinformatic tools for screening immunogenic antigens. Based on evidence of expression in all parasite life stage within the definitive host, extracellular or plasmatic membrane localization, low similarity to human and other helminthic proteins and presence of predicted B cell epitopes, six candidates were selected: a glycosylphosphatidylinositol-anchored 200 kDa protein, two putative cytochrome oxidase subunits, two expressed proteins and one hypothetical protein. The recognition in unidimensional and bidimensional Western blot of protein with similar molecular weight and isoelectric point to the selected antigens by sera from S. mansoni infected mice indicate a good correlation between these two approaches in selecting immunogenic proteins.

  5. Gamma-Ray Spectral States of Galactic Black Hole Candidates

    CERN Document Server

    Grove, J E; Kroeger, R A; McNaron-Brown, K; Skibo, J G; Phlips, B F

    1998-01-01

    OSSE has observed seven transient black hole candidates: GRO J0422+32, GX339-4, GRS 1716-249, GRS 1009-45, 4U 1543-47, GRO J1655-40, and GRS 1915+105. Two gamma-ray spectral states are evident and, based on a limited number of contemporaneous X-ray and gamma-ray observations, these states appear to be correlated with X-ray states. The former three objects show hard spectra below 100 keV (photon number indices Gamma < 2) that are exponentially cut off with folding energy ~100 keV, a spectral form that is consistent with thermal Comptonization. This "breaking gamma-ray state" is the high-energy extension of the X-ray low, hard state. In this state, the majority of the luminosity is above the X-ray band, carried by photons of energy ~100 keV. The latter four objects exhibit a "power-law gamma-ray state" with a relatively soft spectral index (Gamma ~ 2.5-3) and no evidence for a spectral break. For GRO J1655-40, the lower limit on the break energy is 690 keV. GRS 1716-249 exhibits both spectral states, with th...

  6. Photometry of some neglected bright cataclysmic variables and candidates

    CERN Document Server

    Bruch, Albert

    2016-01-01

    As part of an effort to better characterize bright cataclysmic variables (CVs) which have received little attention in the past light curves of four confirmed systems (CZ Aql, BO Cet, V380 Oph and EF Tuc) and one candidate (Lib 3) are analyzed. For none of these stars time resolved photometry has been published previously. While no variability was found in the case of Lib 3, which thus cannot be confirmed as a CV, the light curves of all other targets are dominated by strong flickering. Modulations on hourly time scales superimposed on the flickering can probably be related to orbital variations in BO Cet and V380 Oph, but not in CZ Aql and EF Tuc. Variations on the time scale of 10 minutes in CZ Aql, while not yet constituting convincing evidence, together with previous suspicions of a magnetically channeled accretion flow may point at an intermediate polar nature of this star. Some properties of the flickering are quantified in an effort to enlarge the data base for future comparative flickering studies in ...

  7. Humans Need Not Apply: Robotization of Kepler Planet Candidate Vetting

    Science.gov (United States)

    Coughlin, Jeffrey; Mullally, Fergal; Thompson, Susan E.; Kepler Team

    2015-01-01

    Until now, the vast majority of Kepler planet candidate vetting has been performed by a dedicated team of humans. While human expertise has been invaluable in understanding the nuances of Kepler data, human vetting is very time-consuming and can be inconsistent. Over 20,000 threshold crossing events have been produced by the latest pipeline run on all 17 quarters of Kepler mission data, and many more artificial planet transits have been injected to estimate completeness. Given these large numbers, human vetting is no longer feasible on a reasonable time-scale, and would be difficult to characterize. We have created automated vetting programs known as "robovetters" that are specifically designed to mimic the decision-making process employed by the humans. They analyze both the light curve and pixel-level data in order to produce specific reasons for identifying false positives. We present benchmark tests on the Q1-Q16 Kepler planet catalog, which was vetted by humans, and present preliminary robovetter results based on a recent transit-search of the newly reprocessed Q1-Q17 data set.

  8. A Candidate M31/M32 Intergalactic Microlensing Event

    CERN Document Server

    Paulin-Henriksson, S; Bouquet, A; Carr, B J; Creze, M; Evans, N W; Giraud-Héraud, Yannick; Gould, A; Hewett, P C; Kaplan, J; Kerins, E; Le Du, Y; Melchior, A L; Smartt, S J; Valls-Gabaud, D

    2002-01-01

    We report the discovery of a microlensing candidate projected 2'54" from the center of M32, on the side closest to M31. The blue color (R-I= 0.00 +/- 0.14) of the source argues strongly that it lies in the disk of M31, while the proximity of the line of sight to M32 implies that this galaxy is the most likely host of the lens. If this interpretation is correct, it would confirm previous arguments that M32 lies in front of M31. We estimate that of order one such event or less should be present in the POINT-AGAPE data base. If more events are discovered in this direction in a dedicated experiment, they could be used to measure the mass function of M32 up to an unknown scale factor. By combining microlensing observations of a binary-lens event with a measurement of the M31-M32 relative proper motion using the astrometric satellites SIM or GAIA, it will be possible to measure the physical separation of M31 and M32, the last of the six phase-space coordinates needed to assign M32 an orbit.

  9. Long-term Spectroscopic Monitoring of LBVs and LBV Candidates

    CERN Document Server

    Lobel, A; Torres, K; Gorlova, N

    2010-01-01

    We present results of a long-term spectroscopic monitoring program (since mid 2009) of Luminous Blue Variables with the new HERMES echelle spectrograph on the 1.2 m Mercator telescope at La Palma (Spain). We investigate high-resolution (R=80,000) optical spectra of two LBVs, P Cyg and HD 168607, the LBV candidates MWC 930 and HD 168625, and the LBV binary MWC 314. In P Cyg we observe flux changes in the violet wings of the Balmer H{\\alpha}, H{\\beta}, and He I lines between May and Sep 2009. The changes around 200 km/s to 300 km/s are caused by variable opacity at the base of the supersonic wind from the blue supergiant. We observe in MWC 314 broad double-peaked metal emission lines with invariable radial velocities over time. On the other hand, we measure in the photospheric S II {\\lambda}5647 absorption line, with lower excitation energy of ~14 eV, an increase of the heliocentric radial velocity centroid from 37 km/s to 70 km/s between 5 and 10 Sep 2009 (and 43 km/s on 6 Apr 2010). The increase of radial vel...

  10. Lap Shear Testing of Candidate Radiator Panel Adhesives

    Science.gov (United States)

    Ellis, David; Briggs, Maxwell; McGowan, Randy

    2013-01-01

    During testing of a subscale radiator section used to develop manufacturing techniques for a full-scale radiator panel, the adhesive bonds between the titanium heat pipes and the aluminum face sheets failed during installation and operation. Analysis revealed that the thermal expansion mismatch between the two metals resulted in relatively large shear stresses being developed even when operating the radiator at moderate temperatures. Lap shear testing of the adhesive used in the original joints demonstrated that the two-part epoxy adhesive fell far short of the strength required. A literature review resulted in several candidate adhesives being selected for lap shear joint testing at room temperature and 398 K, the nominal radiator operating temperature. The results showed that two-part epoxies cured at room and elevated temperatures generally did not perform well. Epoxy film adhesives cured at elevated temperatures, on the other hand, did very well with most being sufficiently strong to cause yielding in the titanium sheet used for the joints. The use of an epoxy primer generally improved the strength of the joint. Based upon these results, a new adhesive was selected for the second subscale radiator section.

  11. Tyrosine aminotransferase from Leishmania infantum: A new drug target candidate

    Directory of Open Access Journals (Sweden)

    Miguel Angel Moreno

    2014-12-01

    Full Text Available Leishmania infantum is the etiological agent of zoonotic visceral leishmaniasis in the Mediterranean basin. The disease is fatal without treatment, which has been based on antimonial pentavalents for more than 60 years. Due to resistances, relapses and toxicity to current treatment, the development of new drugs is required. The structure of the L. infantum tyrosine aminotransferase (LiTAT has been recently solved showing important differences with the mammalian orthologue. The characterization of LiTAT is reported herein. This enzyme is cytoplasmic and is over-expressed in the more infective stages and nitric oxide resistant parasites. Unlike the mammalian TAT, LiTAT is able to use ketomethiobutyrate as co-substrate. The pharmacophore model of LiTAT with this specific co-substrate is described herein. This may allow the identification of new inhibitors present in the databases. All the data obtained support that LiTAT is a good target candidate for the development of new anti-leishmanial drugs.

  12. Factors influencing Turkish teacher candidates' elective course preferences

    Directory of Open Access Journals (Sweden)

    Duygu Uçgun

    2012-10-01

    Full Text Available By the Academic Year of 2006-2007, new curriculum has been begun to be applied in the Faculties of Education. When it is evaluated in terms of Turkish Language Teacher Training Departments, it is seen that the most attractive changes are the abolition of Side Branch application, the increase in the number of the courses which will contribute to teacher candidates’ profession and the enrichment in the content. In the curriculum are 5 elective courses beside necessary ones. The aim of this study is to determine what and how much effects the Turkish Language Teacher Candidates as they decide on the courses mentioned above. In the study, based on scanning method, of which subject is consists of 2nd, 3rd and 4th year students from Turkish Language Teacher Training Department, The Faculty of Education of Nigde University Likert-type Scale with four grades which was improved by Tezcan and Gumus (2008 has been used as data collection tool. According to the finding acquired from the study the factors effecting Turkish Language Teacher Candidates’ preferences about elective courses have been determined and ideas which are going to contribute to determination of elective courses and effective process of them have been suggested.

  13. Campaigning on the Internet: 2008 Presidential General Election Candidate Webpage

    Directory of Open Access Journals (Sweden)

    William L. Benoit

    2016-12-01

    Full Text Available The Internet is becoming an increasingly important component of political campaigns. This study employed content analysis to apply Functional Theory and Issue Ownership Theory to Obama’s and McCain’s presidential candidate webpages in the 2008 campaign. Acclaims (92% were more common than attacks (98%; defenses did not occur in this sample. Policy (82% was addressed more than character (18%. When discussing policy, these candidates addressed future plans most frequently, followed by general goals and then past deeds; on character, candidates discussed ideals, then personal qualities, and then leadership ability. This study shows that as candidates use the Internet to reach voters, their webpages conform to theoretical expectations.

  14. Spectroscopy of candidate electromagnetic counterparts to gravitational wave sources

    CERN Document Server

    Steele, Iain A; Piascik, Andrzej S

    2016-01-01

    A programme of worldwide, multi-wavelength electromagnetic follow-up of sources detected by gravitational wave detectors is in place. Following the discovery of GW150914 and GW151226, wide field imaging of their sky localisations identified a number of candidate optical counterparts which were then spectrally classified. The majority of candidates were found to be supernovae at redshift ranges similar to the GW events and were thereby ruled out as a genuine counterpart. Other candidates ruled out include AGN and solar system objects. Given the GW sources were black hole binary mergers, the lack of an identified electromagnetic counterpart is not surprising. However the observations show that is it is possible to organise and execute a campaign that can eliminate the majority of potential counterparts. Finally we note the existence of a "classification gap" with a significant fraction of candidates going unclassified.

  15. 11 CFR 100.148 - Volunteer activity for candidate.

    Science.gov (United States)

    2010-01-01

    ..., magazines, billboards, direct mail or similar types of general public communication or political advertising... developed by the candidate. But see 11 CFR 100.24, 104.17(a), and part 300, subparts D and E for...

  16. 11 CFR 100.88 - Volunteer activity for candidates.

    Science.gov (United States)

    2010-01-01

    ..., billboards, direct mail or similar types of general public communication or political advertising. (b) The... developed by the candidate. But see 11 CFR 100.24, 104.17(a), and part 300, subparts D and E for...

  17. Radiative Neutrino Mass via Both Minimal Dark Matter Candidates

    CERN Document Server

    Ahriche, Amine; Nasri, Salah; Picek, Ivica

    2016-01-01

    We identify a minimal model achieving one-loop radiative neutrino masses due to couplings with dark matter. Interestingly the model contains both the quintuplet fermion and the septuplet scalar identified as minimal dark matter candidates by Cirelli, Fornengo and Strumia - it gives radiative neutrino mass due to both minimal dark matter candidates. The model is related to those proposed in a recent work (dubbed minimal R$\

  18. PLANET HUNTERS. VIII. CHARACTERIZATION OF 41 LONG-PERIOD EXOPLANET CANDIDATES FROM KEPLER ARCHIVAL DATA

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Ji; Fischer, Debra A.; Picard, Alyssa; Schmitt, Joseph R.; Boyajian, Tabetha S. [Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Barclay, Thomas [NASA Ames Research Center, M/S 244-30, Moffett Field, CA 94035 (United States); Ma, Bo [Department of Astronomy, University of Florida, 211 Bryant Space Science Center, Gainesville, FL 32611-2055 (United States); Bowler, Brendan P.; Riddle, Reed [California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91101 (United States); Jek, Kian J.; LaCourse, Daryll; Simister, Dean Joseph; Grégoire, Boscher; Babin, Sean P.; Poile, Trevor; Jacobs, Thomas Lee; Baranec, Christoph [Institute for Astronomy, University of Hawai‘i at Mānoa, Hilo, HI 96720-2700 (United States); Law, Nicholas M. [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599-3255 (United States); Lintott, Chris [Oxford Astrophysics, Denys Wilkinson Building, Keble Road, Oxford OX1 3RH (United Kingdom); Schawinski, Kevin [Institute for Astronomy, Department of Physics, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland); and others

    2015-12-20

    The census of exoplanets is incomplete for orbital distances larger than 1 AU. Here, we present 41 long-period planet candidates in 38 systems identified by Planet Hunters based on Kepler archival data (Q0–Q17). Among them, 17 exhibit only one transit, 14 have two visible transits, and 10 have more than three visible transits. For planet candidates with only one visible transit, we estimate their orbital periods based on transit duration and host star properties. The majority of the planet candidates in this work (75%) have orbital periods that correspond to distances of 1–3 AU from their host stars. We conduct follow-up imaging and spectroscopic observations to validate and characterize planet host stars. In total, we obtain adaptive optics images for 33 stars to search for possible blending sources. Six stars have stellar companions within 4″. We obtain high-resolution spectra for 6 stars to determine their physical properties. Stellar properties for other stars are obtained from the NASA Exoplanet Archive and the Kepler Stellar Catalog by Huber et al. We validate 7 planet candidates that have planet confidence over 0.997 (3σ level). These validated planets include 3 single-transit planets (KIC-3558849b, KIC-5951458b, and KIC-8540376c), 3 planets with double transits (KIC-8540376b, KIC-9663113b, and KIC-10525077b), and 1 planet with four transits (KIC-5437945b). This work provides assessment regarding the existence of planets at wide separations and the associated false positive rate for transiting observation (17%–33%). More than half of the long-period planets with at least three transits in this paper exhibit transit timing variations up to 41 hr, which suggest additional components that dynamically interact with the transiting planet candidates. The nature of these components can be determined by follow-up radial velocity and transit observations.

  19. Resolved Companions of Cepheids: Testing the Candidates with X-Ray Observations

    Science.gov (United States)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.

    2016-04-01

    We have made XMM-Newton observations of 14 Galactic Cepheids that have candidate resolved (≥5″) companion stars based on our earlier HST Wide Field Camera 3 (WFC3) imaging survey. Main-sequence stars that are young enough to be physical companions of Cepheids are expected to be strong X-ray producers in contrast to field stars. XMM-Newton exposures were set to detect essentially all companions hotter than spectral type M0 (corresponding to 0.5 M⊙). The large majority of our candidate companions were not detected in X-rays, and hence are not confirmed as young companions. One resolved candidate (S Nor #4) was unambiguously detected, but the Cepheid is a member of a populous cluster. For this reason, it is likely that S Nor #4 is a cluster member rather than a gravitationally bound companion. Two further Cepheids (S Mus and R Cru) have X-ray emission that might be produced by either the Cepheid or the candidate resolved companion. A subsequent Chandra observation of S Mus shows that the X-rays are at the location of the Cepheid/spectroscopic binary. R Cru and also V659 Cen (also X-ray bright) have possible companions closer than 5″ (the limit for this study) which are the likely sources of X-rays. One final X-ray detection (V473 Lyr) has no known optical companion, so the prime suspect is the Cepheid itself. It is a unique Cepheid with a variable amplitude. The 14 stars that we observed with XMM constitute 36% of the 39 Cepheids found to have candidate companions in our HST/WFC3 optical survey. No young probable binary companions were found with separations of ≥5″ or 4000 au. Based on observations obtained with XMM-Newton, an ESA science mission with instruments and contributions directly funded by ESA Member States and the USA (NASA).

  20. Interviewing job candidates: behavioral techniques and tips.

    Science.gov (United States)

    Bowen, Missy; Leger, Tina L

    2013-01-01

    There are three areas to consider with recruitment and retention: position alignment, department alignment, and cultural alignment. Behavioral interviewing is the preferable technique because it focuses on experience, behavior, knowledge, skills, and abilities that are job related. Questions are also based on the belief that past behavior and performance predicts future behavior and performance. The hiring manager is an agent of the employer and may be held personally liable in a lawsuit alleging discrimination.Therefore, it is important to understand laws and their impact on the organization and hiring decisions.

  1. Resolved Companions of Cepheids: Testing the Candidates with X-Ray Observations

    CERN Document Server

    Evans, Nancy Remage; Wolk, Scott; Karovska, Margarita; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E; Schaefer, Gail H; Mason, Brian D

    2016-01-01

    We have made {\\it XMM-Newton\\/} observations of 14 Galactic Cepheids that have candidate resolved ($\\geq$5$\\arcsec$) companion stars based on our earlier {\\it HST\\/} WFC3 imaging survey. Main-sequence stars that are young enough to be physical companions of Cepheids are expected to be strong X-ray producers in contrast to field stars. {\\it XMM-Newton\\/} exposures were set to detect essentially all companions hotter than spectral type M0 (corresponding to 0.5 $ M_\\odot$.) The large majority of our candidate companions were not detected in X-rays, and hence are not confirmed as young companions. One resolved candidate (S~Nor \\#4) was unambiguously detected, but the Cepheid is a member of a populous cluster. For this reason, it is likely that S~Nor \\#4 is a cluster member rather than a gravitationally bound companion. Two further Cepheids (S~Mus and R~Cru) have X-ray emission that might be produced by either the Cepheid or the candidate resolved companion. A subsequent {\\it Chandra} observation of S Mus shows th...

  2. Planetary Candidates Observed by Kepler IV: Planet Sample From Q1-Q8 (22 Months)

    CERN Document Server

    Burke, Christopher J; Mullally, F; Rowe, Jason F; Christiansen, Jessie L; Thompson, Susan E; Coughlin, Jeffrey L; Haas, Michael R; Batalha, Natalie M; Caldwell, Douglas A; Jenkins, Jon M; Still, Martin; Barclay, Thomas; Borucki, William J; Chaplin, William J; Ciardi, David R; Clarke, Bruce D; Cochran, William D; Demory, Brice-Olivier; Esquerdo, Gilbert A; Gautier, Thomas N; Gilliland, Ronald L; Girouard, Forrest R; Havel, Mathieu; Henze, Christopher E; Howell, Steve B; Huber, Daniel; Latham, David W; Li, Jie; Morehead, Robert C; Morton, Timothy D; Pepper, Joshua; Quintana, Elisa; Ragozzine, Darin; Seader, Shawn E; Shah, Yash; Shporer, Avi; Tenenbaum, Peter; Twicken, Joseph D; Wolfgang, Angie

    2013-01-01

    We provide updates to the Kepler planet candidate sample based upon nearly two years of high-precision photometry (i.e., Q1-Q8). From an initial list of nearly 13,400 Threshold Crossing Events (TCEs), 480 new host stars are identified from their flux time series as consistent with hosting transiting planets. Potential transit signals are subjected to further analysis using the pixel-level data, which allows background eclipsing binaries to be identified through small image position shifts during transit. We also re-evaluate Kepler Objects of Interest (KOI) 1-1609, which were identified early in the mission, using substantially more data to test for background false positives and to find additional multiple systems. Combining the new and previous KOI samples, we provide updated parameters for 2,738 Kepler planet candidates distributed across 2,017 host stars. From the combined Kepler planet candidates, 472 are new from the Q1-Q8 data examined in this study. The new Kepler planet candidates represent ~40% of th...

  3. Drug repurposing: a systematic approach to evaluate candidate oral neuroprotective interventions for secondary progressive multiple sclerosis.

    Directory of Open Access Journals (Sweden)

    Hanna M Vesterinen

    Full Text Available To develop and implement an evidence based framework to select, from drugs already licenced, candidate oral neuroprotective drugs to be tested in secondary progressive multiple sclerosis.Systematic review of clinical studies of oral putative neuroprotective therapies in MS and four other neurodegenerative diseases with shared pathological features, followed by systematic review and meta-analyses of the in vivo experimental data for those interventions. We presented summary data to an international multi-disciplinary committee, which assessed each drug in turn using pre-specified criteria including consideration of mechanism of action.We identified a short list of fifty-two candidate interventions. After review of all clinical and pre-clinical evidence we identified ibudilast, riluzole, amiloride, pirfenidone, fluoxetine, oxcarbazepine, and the polyunsaturated fatty-acid class (Linoleic Acid, Lipoic acid; Omega-3 fatty acid, Max EPA oil as lead candidates for clinical evaluation.We demonstrate a standardised and systematic approach to candidate identification for drug rescue and repurposing trials that can be applied widely to neurodegenerative disorders.

  4. Presidential laugh lines. Candidate display behavior and audience laughter in the 2008 primary debates.

    Science.gov (United States)

    Stewart, Patrick A

    2010-09-01

    Political humor has long been used by candidates to mobilize supporters by enhancing status or denigrating the opposition. Research concerning laughter provides insight into the building of social bonds; however, little research has focused on the nonverbal cues displayed by the individual making humorous comments. This study first investigates whether there is a relationship between facial display behavior and the presence and strength of laughter. Next, the analysis explores whether specific candidate displays during a humorous comment depend on the target of the comment. This paper analyzes the use of humor by Republican and Democratic candidates during ten 2008 presidential primary debates. Data analyzed here employs laughter as an indicator of a successful humorous comment and documents candidate display behavior in the seconds immediately preceding and during each laughter event. Findings suggest specific facial displays play an important communication role. Different types of smiles, whether felt, false, or fear-based, are related to who laughs as well as how intensely the audience is judged to laugh.

  5. New planetary and EB candidates from Campaigns 1-6 of the K2 mission

    CERN Document Server

    Barros, S C C; Deleuil, M

    2016-01-01

    With only two functional reaction wheels, Kepler cannot maintain stable pointing at its original target field and entered a new mode of observation called K2. Our method is based on many years of experience in planet hunting for the CoRoT mission. Due to the unstable pointing, K2 light curves present systematics that are correlated with the target position in the CCD. Therefore, our pipeline also includes a decorrelation of this systematic noise. Our pipeline is optimised for bright stars for which spectroscopic follow-up is possible. We achieve a maximum precision on 6 hours of 6 ppm. The decorrelated light curves are searched for transits with an adapted version of the CoRoT alarm pipeline. We present 172 planetary candidates and 327 eclipsing binary candidates from campaigns 1, 2, 3, 4, 5 and 6 of K2. Both the planetary candidates and eclipsing binary candidates lists are made public to promote follow-up studies. The light curves will also be available to the community.

  6. New planetary and eclipsing binary candidates from campaigns 1-6 of the K2 mission

    Science.gov (United States)

    Barros, S. C. C.; Demangeon, O.; Deleuil, M.

    2016-10-01

    Context. With only two functional reaction wheels, Kepler cannot maintain stable pointing at its original target field and has entered a new mode of observation called K2. Aims: We describe a new pipeline to reduce K2 pixel files into light curves that are later searched for transit like features. Methods: Our method is based on many years of experience in planet hunting for the CoRoT mission. Owing to the unstable pointing, K2 light curves present systematics that are correlated with the target position in the charge coupled device (CCD). Therefore, our pipeline also includes a decorrelation of this systematic noise. Our pipeline is optimised for bright stars for which spectroscopic follow-up is possible. We achieve a maximum precision on 6 hours of 6 ppm. The decorrelated light curves are searched for transits with an adapted version of the CoRoT alarm pipeline. Results: We present 172 planetary candidates and 327 eclipsing binary candidates from campaigns 1, 2, 3, 4, 5, and 6 of K2. Both the planetary candidates and eclipsing binary candidates lists are made public to promote follow-up studies. The light curves will also be available to the community. Full Tables A.1 and A.2 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/594/A100

  7. Syndrome to gene (S2G): in-silico identification of candidate genes for human diseases.

    Science.gov (United States)

    Gefen, Avitan; Cohen, Raphael; Birk, Ohad S

    2010-03-01

    The identification of genomic loci associated with human genetic syndromes has been significantly facilitated through the generation of high density SNP arrays. However, optimal selection of candidate genes from within such loci is still a tedious labor-intensive bottleneck. Syndrome to Gene (S2G) is based on novel algorithms which allow an efficient search for candidate genes in a genomic locus, using known genes whose defects cause phenotypically similar syndromes. S2G (http://fohs.bgu.ac.il/s2g/index.html) includes two components: a phenotype Online Mendelian Inheritance in Man (OMIM)-based search engine that alleviates many of the problems in the existing OMIM search engine (negation phrases, overlapping terms, etc.). The second component is a gene prioritizing engine that uses a novel algorithm to integrate information from 18 databases. When the detailed phenotype of a syndrome is inserted to the web-based software, S2G offers a complete improved search of the OMIM database for similar syndromes. The software then prioritizes a list of genes from within a genomic locus, based on their association with genes whose defects are known to underlie similar clinical syndromes. We demonstrate that in all 30 cases of novel disease genes identified in the past year, the disease gene was within the top 20% of candidate genes predicted by S2G, and in most cases--within the top 10%. Thus, S2G provides clinicians with an efficient tool for diagnosis and researchers with a candidate gene prediction tool based on phenotypic data and a wide range of gene data resources. S2G can also serve in studies of polygenic diseases, and in finding interacting molecules for any gene of choice.

  8. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    Energy Technology Data Exchange (ETDEWEB)

    Bullen, D.B.; Gdowski, G.E. (Science and Engineering Associates, Inc., Pleasanton, CA (USA)); Weiss, H. (Lawrence Livermore National Lab., CA (USA))

    1988-06-01

    Three copper-based alloys, CDA 102 (oxygen-free copper), CDA 613 (Cu-7Al), and CDA 715 (Cu-30Ni), are being considered along with three austenitic candidates as possible materials for fabrication of containers for disposal of high-level radioactive waste. The waste will include spent fuel assemblies from reactors as well as high-level reprocessing wastes in borosilicate glass and will be sent to the prospective repository at Yucca Mountain, Nevada, for disposal. The containers must maintain mechanical integrity for 50 yr after emplacement to allow for retrieval of waste during the preclosure phase of repository operation. Containment is required to be substantially complete for up to 300 to 1000 yr. During the early period, the containers will be exposed to high temperatures and high gamma radiation fields from the decay of high-level waste. The final closure joint will be critical to the integrity of the containers. This volume surveys the available data on the metallurgy of the copper-based candidate alloys and the welding techniques employed to join these materials. The focus of this volume is on the methods applicable to remote-handling procedures in a hot-cell environment with limited possibility of postweld heat treatment. The three copper-based candidates are ranked on the basis of the various closure techniques. On the basis of considerations regarding welding, the following ranking is proposed for the copper-based alloys: CDA 715 (best) > CDA 102 > CDA 613 (worst). 49 refs., 15 figs., 1 tab.

  9. 22 CFR 11.11 - Mid-level Foreign Service officer career candidate appointments.

    Science.gov (United States)

    2010-04-01

    ... affirmative factor in the selection of candidates for appointment as Foreign Service officer career candidates..., experience, and skills needed by the Foreign Service at the mid-level. (3) Age. All career candidate... terminated and the candidate so informed. (10) Foreign language requirement. All candidates who pass the...

  10. X-Linked Candidate Genes for a Ciliopathy-Like Disorder.

    Science.gov (United States)

    Pavey, Ashleigh R; Vilboux, Thierry; Babcock, Holly E; Ahronovich, Margot; Solomon, Benjamin D

    2016-04-01

    The ability to interrogate the genome via chromosomal microarray and sequencing-based technologies has accelerated the ability to rapidly and accurately define etiologies as well as new candidate genes related to genetic conditions. We describe a male patient with a lethal presentation of a multiple congenital anomaly syndrome that appeared consistent with a ciliopathy phenotype. The patient was found to have a novel maternally inherited 1.9-Mb X chromosome deletion including 4 known genes. Presently, the biological functions of these genes are not well delineated. However, at least one of these genes may be a promising candidate gene for this pattern of anomalies based on the function of related genes and information from publicly available copy number variant databases of control and affected individuals. These genes would bear further scrutiny in larger cohorts of patients with similar phenotypes.

  11. Robo-AO Kepler Planetary Candidate Survey. III. Adaptive Optics Imaging of 1629 Kepler Exoplanet Candidate Host Stars

    Science.gov (United States)

    Ziegler, Carl; Law, Nicholas M.; Morton, Tim; Baranec, Christoph; Riddle, Reed; Atkinson, Dani; Baker, Anna; Roberts, Sarah; Ciardi, David R.

    2017-02-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging to search for blended nearby stars, which may be physically associated companions and/or responsible for transit false positives. In this paper, we present the results of our search for stars nearby 1629 Kepler planet candidate hosts. With survey sensitivity to objects as close as ∼0.″15, and magnitude differences Δm ≤slant 6, we find 223 stars in the vicinity of 206 target KOIs; 209 of these nearby stars have not been previously imaged in high resolution. We measure an overall nearby-star probability for Kepler planet candidates of 12.6 % +/- 0.9 % at separations between 0.″15 and 4.″0. Particularly interesting KOI systems are discussed, including 26 stars with detected companions that host rocky, habitable zone candidates and five new candidate planet-hosting quadruple star systems. We explore the broad correlations between planetary systems and stellar binarity, using the combined data set of Baranec et al. and this paper. Our previous 2σ result of a low detected nearby star fraction of KOIs hosting close-in giant planets is less apparent in this larger data set. We also find a significant correlation between detected nearby star fraction and KOI number, suggesting possible variation between early and late Kepler data releases.

  12. Robo-AO Kepler Planetary Candidate Survey III: Adaptive Optics Imaging of 1629 Kepler Exoplanet Candidate Host Stars

    CERN Document Server

    Ziegler, Carl; Morton, Tim; Baranec, Christoph; Riddle, Reed; Atkinson, Dani; Baker, Anna; Roberts, Sarah; Ciardi, David R

    2016-01-01

    The Robo-AO \\textit{Kepler} Planetary Candidate Survey is observing every \\textit{Kepler} planet candidate host star with laser adaptive optics imaging to search for blended nearby stars, which may be physically associated companions and/or responsible for transit false positives. We present in this paper the results of our search for stars nearby 1629 \\textit{Kepler} planet candidate hosts. With survey sensitivity to objects as close as $\\sim$0.15" and magnitude differences $\\Delta$m$\\le$6, we find 223 stars in the vicinity of 206 target KOIs; 209 of these nearby stars have not previously been imaged in high resolution. We measure an overall nearby-star probability for \\textit{Kepler} planet candidates of 12.6\\%$\\pm$0.9\\% out to a separation of 4.0". Particularly interesting KOI systems are discussed, including 23 stars with detected companions which host rocky, habitable zone candidates, and five new candidate planet-hosting quadruple star systems. We explore the broad correlations between planetary systems...

  13. How Black Are Black Hole Candidates?

    CERN Document Server

    Robertson, S L; Robertson, Stanley L.; Leiter, Darryl J.

    2002-01-01

    In previous work we found that many of the spectral properties of x-ray binaries, including both galactic black hole candiates (GBHC) and neutron stars, were consistent with the existence of intrinsically magnetized central objects. Here we review and extend the observational evidence for the existence of intrinsically magnetized GBHC and show that their existence is consistent with a new class of solutions of the Einstein field equations of General Relativity. These solutions are based on a strict adherence to the Principle of Equivalence, which prevents the time-like geodesics of physical matter from becoming null on trapped surfaces of infinite red shift. The new solutions emerge from the fact that the structure and radiation transfer properties of the energy-momentum tensor on the right hand side of the Einstein field equations must have a form that is consistent with this Principle of Equivalence requirement. In this context, we show that the Einstein field equations allow the existence of highly red shi...

  14. A Natural Vaccine Candidate Strain Against Cholera

    Institute of Scientific and Technical Information of China (English)

    LIUYAN-QING; QIGUO-MING; 等

    1995-01-01

    El Tor Vibrio cholerae(EVC)strains may be classified into two kinds-epidemigenic(EEVC)strains and non-epidemigenic(NEEVC)strains-based on a phage-biotyping system.A large number of EEVC strains have been screened for toxigenic and putative colonization attributes.One such naturally occurring strain(designated IEM101)has been found which is devoid of genes encoding cholera toxin(CT),accessory cholera enterotoxin(ACE),zonula occludens toxin(ZOT),but possesses RS1 sequences and toixn-coregulated pilus A gene(tcpA)although tcpA is poorly expressed.It expresses type B pili but does not posses type C pili.It is an El Tor Ogawa strain and does not cause fluid accumulation in rabbit ileal loop tests.Active immunization of rabbits with strain IEM101 elicited good protection against challenge with virulent strains of V.cholerae Ol.Oral administration cased no side effects in 15 human volunteers.colonized the gut for four to ten days and elicited good immune responses.

  15. Photoaffinity Probe Candidates for Gamma-aminobutyric Acid (GABAA)-Gated Chloride Channel

    Institute of Scientific and Technical Information of China (English)

    Shang Zhong LIU; Qing Xiao LI

    2004-01-01

    New photoaffinity ligand candidates were synthesized based on 5-t-butyl-2-(4- (substituted-ethynyl)phenyl)-1, 3-dithiane for the noncompetitive blocker site on the gamma- aminobutyric acid -gated chloride channel. Their half-maximal inhibition concentrations ranged from 4 to 32 nmol/L as measured by 4'-ethynyl-4-n-[2,3-3H2]-propylbicycloorthobenzoate (3H EBOB) assay.

  16. New supernova candidates from the SDSS-DR7 spectral survey

    Institute of Scientific and Technical Information of China (English)

    Liang-Ping Tu; A-Li Luo; Fu-Chao Wu; Chao Wu; Yong-Heng Zhao

    2009-01-01

    This letter presents 25 supernova candidates discovered from SDSS-DR7 by using our dedicated method, called Sample Decrease. Ten of them have been confirmed by other research groups, while the remaining 15, including 14 Type Ia and one Type Ⅱ, are first discovered based on Supernova Identification analysis. The results demonstrate that our method is reliable. The description of the method and some detailed spectral analysis procedures are also presented.

  17. Third chromosome candidate genes for conspecific sperm precedence between D. simulans and D. mauritiana

    Directory of Open Access Journals (Sweden)

    Brouwers Barb

    2010-04-01

    Full Text Available Abstract Background Male - female incompatibilities can be critical in keeping species as separate and discrete units. Premating incompatibilities and postzygotic hybrid sterility/inviability have been widely studied as isolating barriers between species. In recent years, a number of studies have brought attention to postmating prezygotic barriers arising from male - male competition and male - female interactions. Yet little is known about the genetic basis of postmating prezygotic isolation barriers between species. Results Using D. simulans lines with mapped introgressions of D. mauritiana into their third chromosome, we find at least two D. mauritiana introgressions causing male breakdown in competitive paternity success. Eighty one genes within the mapped introgressed regions were identified as broad-sense candidates on the basis of male reproductive tract expression and male-related function. The list of candidates was narrowed down to five genes based on differences in male reproductive tract expression between D. simulans and D. mauritiana. Another ten genes were confirmed as candidates using evidence of adaptive gene coding sequence diversification in the D. simulans and/or D. mauritiana lineage. Our results show a complex genetic basis for conspecific sperm precedence, with evidence of gene interactions between at least two third chromosome loci. Pleiotropy is also evident from correlation between conspecific sperm precedence and female induced fecundity and the identification of candidate genes that might exert an effect through genetic conflict and immunity. Conclusions We identified at least two loci responsible for conspecific sperm precedence. A third of candidate genes within these two loci are located in the 89B cytogenetic position, highlighting a possible major role for this chromosome position during the evolution of species specific adaptations to postmating prezygotic reproductive challenges.

  18. Safety Lead Optimization and Candidate Identification: Integrating New Technologies into Decision-Making.

    Science.gov (United States)

    Dambach, Donna M; Misner, Dinah; Brock, Mathew; Fullerton, Aaron; Proctor, William; Maher, Jonathan; Lee, Dong; Ford, Kevin; Diaz, Dolores

    2016-04-18

    Discovery toxicology focuses on the identification of the most promising drug candidates through the development and implementation of lead optimization strategies and hypothesis-driven investigation of issues that enable rational and informed decision-making. The major goals are to [a] identify and progress the drug candidate with the best overall drug safety profile for a therapeutic area, [b] remove the most toxic drugs from the portfolio prior to entry into humans to reduce clinical attrition due to toxicity, and [c] establish a well-characterized hazard and translational risk profile to enable clinical trial designs. This is accomplished through a framework that balances the multiple considerations to identify a drug candidate with the overall best drug characteristics and provides a cogent understanding of mechanisms of toxicity. The framework components include establishing a target candidate profile for each program that defines the qualities of a successful candidate based on the intended therapeutic area, including the risk tolerance for liabilities; evaluating potential liabilities that may result from engaging the therapeutic target (pharmacology-mediated or on-target) and that are chemical structure-mediated (off-target); and characterizing identified liabilities. Lead optimization and investigation relies upon the integrated use of a variety of technologies and models (in silico, in vitro, and in vivo) that have achieved a sufficient level of qualification or validation to provide confidence in their use. We describe the strategic applications of various nonclinical models (established and new) for a holistic and integrated risk assessment that is used for rational decision-making. While this review focuses on strategies for small molecules, the overall concepts, approaches, and technologies are generally applicable to biotherapeutics.

  19. Multiplicity and properties of Kepler planet candidates: High spatial imaging and RV studies*

    Directory of Open Access Journals (Sweden)

    Aceituno J.

    2013-04-01

    Full Text Available The Kepler space telescope is discovering thousands of new planet candidates. However, a follow up program is needed in order to reject false candidates and to fully characterize the bona-fide exoplanets. Our main aims are: 1./ Detect and analyze close companions inside the typical Kepler PSF to study if they are the responsible of the dim in the Kepler light curves, 2./ Study the change in the stellar and planetary parameters due to the presence of an unresolved object, 3./ Help to validate those Kepler Objects of Interest that do not present any object inside the Kepler PSF and 4./ Study the multiplicity rate in planet host candidates. Such a large sample of observed planet host candidates allows us to do statistics about the presence of close (visual or bounded companions to the harboring star. We present here Lucky Imaging observations for a total amount of 98 Kepler Objects of Interest. This technique is based on the acquisition of thousands of very short exposure time images. Then, a selection and combination of a small amount of the best quality frames provides a high resolution image with objects having a 0.1 arcsec PSF. We applied this technique to carry out observations in the Sloan i and Sloan z filters of our Kepler candidates. We find blended objects inside the Kepler PSF for a significant percentage of KOIs. On one hand, only 58.2% of the hosts do not present any object within 6 arcsec. On the other hand, we have found 19 companions closer than 3 arcsec in 17 KOIs. According to their magnitudes and i − z color, 8 of them could be physically bounded to the host star. We are also collecting high-spectral resolution spectroscopuy in order to derive the planet properties.

  20. RESOLVED COMPANIONS OF CEPHEIDS: TESTING THE CANDIDATES WITH X-RAY OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden St., Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Ave., Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H. [The CHARA Array of Georgia State University, Mount Wilson, California 91023 (United States); Mason, Brian D., E-mail: nevans@cfa.harvard.edu, E-mail: heb11@psu.edu, E-mail: schaefer@chara-array.org [US Naval Observatory, 3450 Massachusetts Ave., NW, Washington, DC 20392-5420 (United States)

    2016-04-15

    We have made XMM-Newton observations of 14 Galactic Cepheids that have candidate resolved (≥5″) companion stars based on our earlier HST Wide Field Camera 3 (WFC3) imaging survey. Main-sequence stars that are young enough to be physical companions of Cepheids are expected to be strong X-ray producers in contrast to field stars. XMM-Newton exposures were set to detect essentially all companions hotter than spectral type M0 (corresponding to 0.5 M{sub ⊙}). The large majority of our candidate companions were not detected in X-rays, and hence are not confirmed as young companions. One resolved candidate (S Nor #4) was unambiguously detected, but the Cepheid is a member of a populous cluster. For this reason, it is likely that S Nor #4 is a cluster member rather than a gravitationally bound companion. Two further Cepheids (S Mus and R Cru) have X-ray emission that might be produced by either the Cepheid or the candidate resolved companion. A subsequent Chandra observation of S Mus shows that the X-rays are at the location of the Cepheid/spectroscopic binary. R Cru and also V659 Cen (also X-ray bright) have possible companions closer than 5″ (the limit for this study) which are the likely sources of X-rays. One final X-ray detection (V473 Lyr) has no known optical companion, so the prime suspect is the Cepheid itself. It is a unique Cepheid with a variable amplitude. The 14 stars that we observed with XMM constitute 36% of the 39 Cepheids found to have candidate companions in our HST/WFC3 optical survey. No young probable binary companions were found with separations of ≥5″ or 4000 au.

  1. Searching for Gamma-Ray Blazar Candidates Among the Unidentified INTEGRAL Sources

    Energy Technology Data Exchange (ETDEWEB)

    Massaro, F.; /SLAC; Paggi, A.; D' Abrusco, R.; /Harvard-Smithsonian Ctr. Astrophys.; Tosti, G.; /Perugia U.

    2012-04-02

    The identification of low-energy counterparts for {gamma}-ray sources is one of the biggest challenge in modern {gamma}-ray astronomy. Recently, we developed and successfully applied a new association method to recognize {gamma}-ray blazar candidates that could be possible counterparts for the unidentified {gamma}-ray sources above 100 MeV in the second Fermi Large Area Telescope (LAT) catalog (2FGL). This method is based on the Infrared (IR) colors of the recent Wide-Field Infrared Survey Explorer (WISE) all-sky survey. In this letter we applied our new association method to the case of unidentified INTEGRAL sources (UISs) listed in the fourth soft gamma-ray source catalog (4IC). Only 86 UISs out of the 113 can be analyzed, due to the sky coverage of the WISE Preliminary data release. Among these 86 UISs, we found that 18 appear to have a {gamma}-ray blazar candidate within their positional error region. Finally, we analyzed the Swift archival data available for 10 out these 18 {gamma}-ray blazar candidates, and we found that 7 out of 10 are clearly detected in soft X-rays and/or in the optical-ultraviolet band. We cannot confirm the associations between the UISs and the selected {gamma}-ray blazar candidates due to the discrepancies between the INTEGRAL and the soft X-ray spectra. However, the discovery of the soft X-ray counterparts for the selected {gamma}-ray blazar candidates adds an important clue to help understand their origin and to confirm their blazar nature.

  2. An updated survey of globular clusters in M 31. I. Classification and radial velocity for 76 candidate clusters

    Science.gov (United States)

    Galleti, S.; Federici, L.; Bellazzini, M.; Buzzoni, A.; Fusi Pecci, F.

    2006-09-01

    Aims.We present the first results of a large spectroscopic survey of globular clusters and candidate globular clusters in the nearby M 31 galaxy. The survey is aimed at the classification of known candidate M 31 clusters and at the study of their kinematic properties. Methods: .We obtained low-resolution spectroscopy (λ/Δλ ≃ 800-1300) for 133 targets, including 76 yet-to-be-confirmed candidate clusters (i.e. with no previous spectroscopic information), 55 already-confirmed genuine M 31 clusters, and 2 uncertain candidates. Our observations allowed a reliable estimate of the target radial velocity, within a typical accuracy of ~± 20 km s-1. The observed candidates have been robustly classified according to their radial velocity and shape parameters that allowed us to confidently discriminate between point sources and extended objects even from low-spatial-resolution imagery. Results: .In our set of 76 candidate clusters we found: 42 newly-confirmed bona-fide M 31 clusters, 12 background galaxies, 17 foreground Galactic stars, 2 Hii regions belonging to M 31 and 3 unclassified (possibly M 31 clusters or foreground stars) objects. The classification of a few other candidates not included in our survey has been also reassessed on various observational bases. All the sources of radial velocity estimates for M 31 known globular clusters available in the literature have been compared and checked, and a homogeneous general list has been obtained for 349 confirmed clusters with radial velocity. Conclusions: .Our results suggest that a significant number of genuine clusters (≳100) is still hidden among the plethora of known candidates proposed by various authors. Hence our knowledge of the globular cluster system of the M 31 galaxy is still far from complete even in terms of simple membership.

  3. Corrosion of Candidate High Temperature Alloys in Supercritical Carbon Dioxide

    Science.gov (United States)

    Parks, Curtis J.

    The corrosion resistance of three candidate alloys is tested in supercritical carbon dioxide (S-CO2) at different levels of temperature and pressure for up to 3000 hours. The purpose of the testing is to evaluate the compatibility of different engineering alloys in S-CO2 for use in a S-CO 2 Brayton cycle. The three alloys used are austenitic stainless steel 316, iron-nickel-base superalloy 718, and nickel-base superalloy 738. Each alloy is exposed to four combinations of temperature and pressure, consisting of either 550°C or 700°C at either 15 or 25 MPa for up to 1500 hours. At each temperature, an additional sample set is tested for 3000 hours and experienced an increase in pressure from 15 MPa to 25 MPa after 1500 hours of testing. All three alloys are successful in producing a protective oxide layer at the lower temperature of 550°C based on the logarithmic weight gain trends. At the higher temperature of 700°C, 316SS exhibits unfavourable linear weight gain trends at both pressures of 15 and 25 MPa. In comparison, IN-718 and IN-738 performs similarly in producing a protective oxide layer illustrated through a power weight gain relation. The effect of pressure is most pronounced at the operating temperature of 700°C, where the higher pressure of 25 MPa results in an increased rate of oxide formation. SEM analysis exposes a thin film oxide for both IN-718 and IN-738 but severe intergranular corrosion is exhibited by IN-738. Based on the testing conducted, both alloys show favourable characteristics for use in S-CO 2 conditions up to 700°C, but further testing is required to characterize the effect of the intergranular corrosion on the stability of oxide in IN-738. 316SS provided favourable results for use in temperatures of 550°C, but the protective oxide deteriorated at an operating temperature of 700°C.

  4. Transit Timing Observations from Kepler: VI. Transit Timing Variation Candidates in the First Seventeen Months from Polynomial Models

    CERN Document Server

    Ford, Eric B; Rowe, Jason F; Steffen, Jason H; Barclay, Thomas; Batalha, Natalie M; Borucki, William J; Bryson, Stephen T; Caldwell, Douglas A; Fabrycky, Daniel C; Gautier, Thomas N; Holman, Matthew J; Ibrahim, Khadeejah A; Kjeldsen, Hans; Kinemuchi, Karen; Koch, David G; Lissauer, Jack J; Still, Martin; Tenenbaum, Peter; Uddin, Kamal; Welsh, William

    2012-01-01

    Transit timing variations provide a powerful tool for confirming and characterizing transiting planets, as well as detecting non-transiting planets. We report the results an updated TTV analysis for 822 planet candidates (Borucki et al. 2011; Batalha et al. 2012) based on transit times measured during the first seventeen months of Kepler observations (Rowe et al 2012). We present 35 TTV candidates (4.1% of suitable data sets) based on long-term trends and 153 mostly weaker TTV candidates (18% of suitable data sets) based on excess scatter of TTV measurements about a linear ephemeris. We anticipate that several of these planet candidates could be confirmed and perhaps characterized with more detailed TTV analyses using publicly available Kepler observations. For many others, Kepler has observed a long-term TTV trend, but an extended Kepler mission will be required to characterize the system via TTVs. We find that the occurence rate of planet candidates that show TTVs is significantly increased (~60%-76%) for p...

  5. Revised selection criteria for candidate restriction enzymes in genome walking.

    Science.gov (United States)

    Taheri, Ali; Robinson, Stephen J; Parkin, Isobel; Gruber, Margaret Y

    2012-01-01

    A new method to improve the efficiency of flanking sequence identification by genome walking was developed based on an expanded, sequential list of criteria for selecting candidate enzymes, plus several other optimization steps. These criteria include: step (1) initially choosing the most appropriate restriction enzyme according to the average fragment size produced by each enzyme determined using in silico digestion of genomic DNA, step (2) evaluating the in silico frequency of fragment size distribution between individual chromosomes, step (3) selecting those enzymes that generate fragments with the majority between 100 bp and 3,000 bp, step (4) weighing the advantages and disadvantages of blunt-end sites vs. cohesive-end sites, step (5) elimination of methylation sensitive enzymes with methylation-insensitive isoschizomers, and step (6) elimination of enzymes with recognition sites within the binary vector sequence (T-DNA and plasmid backbone). Step (7) includes the selection of a second restriction enzyme with highest number of recognition sites within regions not covered by the first restriction enzyme. Step (8) considers primer and adapter sequence optimization, selecting the best adapter-primer pairs according to their hairpin/dimers and secondary structure. In step (9), the efficiency of genomic library development was improved by column-filtration of digested DNA to remove restriction enzyme and phosphatase enzyme, and most important, to remove small genomic fragments (enzymes, NsiI and NdeI, fit these criteria for the Arabidopsis thaliana genome. Their efficiency was assessed using 54 T(3) lines from an Arabidopsis SK enhancer population. Over 70% success rate was achieved in amplifying the flanking sequences of these lines. This strategy was also tested with Brachypodium distachyon to demonstrate its applicability to other larger genomes.

  6. Molecular Diversity of Vaccine Candidates in Leptospira spp.

    Directory of Open Access Journals (Sweden)

    Patricia Hernández-Rodríguez

    2015-09-01

    Full Text Available The aim of this study was to determine the molecular diversity of OmpL1, LipL32, LipL41, LigA and LigB proteins and that of the genes that encode them using bioinformatic analysis in different pathogenic strains of Leptospira spp. based on the information available in databases. The amino acid sequences of OmpL1, LipL32, LipL41, LigA and LigB proteins were used, as well as the genes encoding them in strains of Leptospira spp. reported at The National Center for Biotechnology Information (NCBI. The analysis of proteins and genes were performed using the Protein, Nucleotide and Gene resources from the NCBI. The alignment of the consensus sequences was performed using the PSI-BLAST and BLASTn tools. The coverage percentage of the selected sequences of the ompL1, lipL32, lipL41, ligA and ligB genes in pathogenic strains of Leptospira spp. is 100% for ompL1, lipL32 and lipL41, 75% for ligA and 99% for ligB with identity percentages of 85, 98, 88, 90 and 80% respectively; the coverage percentage of the selected protein sequences is 100, 77, 99, 100 and 100% with identity percentages of 90, 99, 92, 63 and 60% respectively, indicating that genes and proteins, except LigA and LigB proteins, are highly conserved in various pathogenic serovars of Leptospira spp. According to these results, it is recommended that further analysis of these proteins be made in order to determine the feasibility of its use as vaccine candidates.

  7. DENSE CLUMPS AND CANDIDATES FOR MOLECULAR OUTFLOWS IN W40

    Energy Technology Data Exchange (ETDEWEB)

    Shimoikura, Tomomi; Dobashi, Kazuhito [Department of Astronomy and Earth Sciences, Tokyo Gakugei University, Koganei, Tokyo 184-8501 (Japan); Nakamura, Fumitaka; Hara, Chihomi; Kawabe, Ryohei [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Tanaka, Tomohiro [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Shimajiri, Yoshito [Laboratoire AIM, CEA/DSM-CNRS-Université Paris Diderot, IRFU/Service d’Astrophysique, CEA Saclay, F-91191 Gif-sur-Yvette (France); Sugitani, Kouji, E-mail: ikura@u-gakugei.ac.jp [Graduate School of Natural Sciences, Nagoya City University, Mizuho-ku, Nagoya 467-8501 (Japan)

    2015-06-20

    We report the results of the {sup 12}CO (J = 3−2) and HCO{sup +} (J = 4−3) observations of the W40 H ii region with the Atacama Submillimeter Telescope Experiment (ASTE) 10 m telescope (HPBW ≃ 22″) to search for molecular outflows and dense clumps. We found that the velocity field in the region is highly complex, consisting of at least four distinct velocity components at V{sub LSR} ≃ 3, 5, 7, and 10 km s{sup −1}. The ∼7 km s{sup −1} component represents the systemic velocity of cold gas surrounding the entire region, and causes heavy absorption in the {sup 12}CO spectra over the velocity range 6 ≲ V{sub LSR} ≲ 9 km s{sup −1}. The ∼5 and ∼10 km s{sup −1} components exhibit high {sup 12}CO temperature (≳40 K) and are found mostly around the H ii region, suggesting that these components are likely to be tracing dense gas interacting with the expanding shell around the H ii region. Based on the {sup 12}CO data, we identified 13 regions of high velocity gas, which we interpret as candidate outflow lobes. Using the HCO{sup +} data, we also identified six clumps and estimated their physical parameters. On the basis of the ASTE data and near-infrared images from 2MASS, we present an updated three-dimensional model of this region. In order to investigate molecular outflows in W40, the SiO (J = 1−0, v = 0) emission line and some other emission lines at 40 GHz were also observed with the 45 m telescope at the Nobeyama Radio Observatory, but they were not detected at the present sensitivity.

  8. Glycosaminoglycan derivatives: promising candidates for the design of functional biomaterials.

    Science.gov (United States)

    Scharnweber, Dieter; Hübner, Linda; Rother, Sandra; Hempel, Ute; Anderegg, Ulf; Samsonov, Sergey A; Pisabarro, M Teresa; Hofbauer, Lorenz; Schnabelrauch, Matthias; Franz, Sandra; Simon, Jan; Hintze, Vera

    2015-09-01

    Numerous biological processes (tissue formation, remodelling and healing) are strongly influenced by the cellular microenvironment. Glycosaminoglycans (GAGs) are important components of the native extracellular matrix (ECM) able to interact with biological mediator proteins. They can be chemically functionalized and thereby modified in their interaction profiles. Thus, they are promising candidates for functional biomaterials to control healing processes in particular in health-compromised patients. Biophysical studies show that the interaction profiles between mediator proteins and GAGs are strongly influenced by (i) sulphation degree, (ii) sulphation pattern, and (iii) composition and structure of the carbohydrate backbone. Hyaluronan derivatives demonstrate a higher binding strength in their interaction with biological mediators than chondroitin sulphate for a comparable sulphation degree. Furthermore sulphated GAG derivatives alter the interaction profile of mediator proteins with their cell receptors or solute native interaction partners. These results are in line with biological effects on cells relevant for wound healing processes. This is valid for solute GAGs as well as those incorporated in collagen-based artificial ECM (aECMs). Prominent effects are (i) anti-inflammatory, immunomodulatory properties towards macrophages/dendritic cells, (ii) enhanced osteogenic differentiation of human mesenchymal stromal cells, (iii) altered differentiation of fibroblasts to myofibroblasts, (iv) reduced osteoclast activity and (v) improved osseointegration of dental implants in minipigs. The findings of our consortium Transregio 67 contribute to an improved understanding of structure-function relationships of GAG derivatives in their interaction with mediator proteins and cells. This will enable the design of bioinspired, functional biomaterials to selectively control and promote bone and skin regeneration.

  9. On security arguments of the second round SHA-3 candidates

    DEFF Research Database (Denmark)

    Andreeva, Elena; Bogdanov, Andrey; Mennink, Bart;

    2012-01-01

    In 2007, the US National Institute for Standards and Technology (NIST) announced a call for the design of a new cryptographic hash algorithm in response to vulnerabilities like differential attacks identified in existing hash functions, such as MD5 and SHA-1. NIST received many submissions, 51...... of which got accepted to the first round. 14 candidates were left in the second round, out of which five candidates have been recently chosen for the final round. An important criterion in the selection process is the SHA-3 hash function security. We identify two important classes of security arguments...... for the new designs: (1) the possible reductions of the hash function security to the security of its underlying building blocks and (2) arguments against differential attack on building blocks. In this paper, we compare the state of the art provable security reductions for the second round candidates...

  10. Five Kepler target stars that show multiple transiting exoplanet candidates

    CERN Document Server

    Steffen, Jason H; Borucki, William J; Buchhave, Lars A; Caldwell, Douglas A; Cochran, William D; Endl, Michael; Fabrycky, Daniel C; Fressin, François; Ford, Eric B; Fortney, Jonathan J; Haas, Michael J; Holman, Matthew J; Isaacson, Howard; Jenkins, Jon M; Koch, David; Latham, David W; Lissauer, Jack J; Moorhead, Althea V; Morehead, Robert C; Marcy, Geoffrey; MacQueen, Phillip J; Quinn, Samuel N; Ragozzine, Darin; Rowe, Jason F; Sasselov, Dimitar D; Seager, Sara; Torres, Guillermo; Welsh, William F

    2010-01-01

    We present and discuss five candidate exoplanetary systems identified with the Kepler spacecraft. These five systems show transits from multiple exoplanet candidates. Should these objects prove to be planetary in nature, then these five systems open new opportunities for the field of exoplanets and provide new insights into the formation and dynamical evolution of planetary systems. We discuss the methods used to identify multiple transiting objects from the Kepler photometry as well as the false-positive rejection methods that have been applied to these data. One system shows transits from three distinct objects while the remaining four systems show transits from two objects. Three systems have planet candidates that are near mean motion commensurabilities - two near 2:1 and one just outside 5:2. We discuss the implications that multitransiting systems have on the distribution of orbital inclinations in planetary systems, and hence their dynamical histories; as well as their likely masses and chemical compos...

  11. A Census of Star-Forming Galaxies in the z~9-10 Universe based on HST+Spitzer Observations Over 19 CLASH clusters: Three Candidate z~9-10 Galaxies and Improved Constraints on the Star Formation Rate Density at z~9.2

    CERN Document Server

    Bouwens, R; Zitrin, A; Coe, D; Franx, M; Zheng, W; Smit, R; Host, O; Postman, M; Moustakas, L; Labbe, I; Carrasco, M; Molino, A; Donahue, M; Kelson, D D; Meneghetti, M; Jha, S; Benitez, N; Lemze, D; Umetsu, K; Broadhurst, T; Moustakas, J; Rosati, P; Bartelmann, M; Ford, H; Graves, G; Grillo, C; Infante, L; Jiminez-Teja, Y; Jouvel, S; Lahav, O; Maoz, D; Medezinski, E; Melchior, P; Merten, J; Nonino, M; Ogaz, S; Seitz, S

    2012-01-01

    We utilise a two-color Lyman-break selection criterion to search for z~9-10 galaxies over the first 19 clusters in the CLASH program. Key to this search are deep observations in five near-IR passbands to 1.6 microns, allowing us good constraints on the position of the Lyman break to z~10. A systematic search yields three z~9-10 candidates in total above a 6 sigma detection limit. While we have already reported on the most robust of these candidates, two new z~9 candidates (H~26.2-26.9) are also revealed in our expanded search. The observed H-IRAC colors for the sources are sufficiently blue to strongly favor redshifts of z>~9 for these sources. A careful assessment of various sources of contamination suggests 8 than seen at lower redshifts. Compared to similar evolutionary findings from the HUDF, our result is much more insensitive to large-scale structure uncertainties, given our many independent sightlines on the high-redshift universe.

  12. Affinity ultrafiltration of DNA topoisomerases-targeted compounds determined with HPLC/ESI-MS for drug candidate screening

    Institute of Scientific and Technical Information of China (English)

    张虹; 潘远江

    2004-01-01

    A method of screening assay is demonstrated. The approach is based on the affinity of antitumor candidates for topoisomerases. In this method, antitumor candidates are fished out using topoisomerases as targets. Traditional analysis of complex compounds typically encounters signal suppression due to the relatively low concentrations, but enzyme-affinity screening for the active compounds can effectively concentrate the desired analysts into a small volume of high concen-tration. Active compounds are separated from non-affinity compounds by ultrafiltration. The molecules-enzymes complexes that are retained on the filter are subsequently separated by acidification to obtain the topoisomerases-affinity compounds for analysis on High Performance Liquid Chromatography coupled with electrospray ionization mass spectrometric detec-tion (ESI-MS). This enzyme-affinity based screening assay provides a highly specific and efficient method that can directly screen, identify, and acquire drug candidates thus improving the accuracy and speed of high-throughput screening activities.

  13. Affinity ultrafiltration of DNA topoisomerases-targeted compounds determined with HPLC/ESI-MS for drug candidate screening

    Institute of Scientific and Technical Information of China (English)

    张虹; 潘远江

    2004-01-01

    A method of screening assay is demonstrated. The approach is based on the affinity ofantitumor candidates for topoisomerases. In this method, antitumor candidates are fished out using topoisomerases as targets. Traditional analysis of complex compounds typically encounters signal suppression due to the relatively low concentrations, but enzyme-affinity screening for the active compounds can effectively concentrate the desired analysts into a small volume of high concentration. Active compounds are separated from non-affinity compounds by ultrafiltration. The molecules-enzymes complexes that are retained on the filter are subsequently separated by acidification to obtain the topoisomerases-affinity compounds for analysis on High Performance Liquid Chromatography coupled with electrospray ionization mass spectrometric detection (ESI-MS). This enzyme-affinity based screening assay provides a highly specific and efficient method that can directly screen, identify, and acquire drug candidates thus improving the accuracy and speed of high-throughput screening activities.

  14. Former Head of CNOOC Named as Candidate for Governor

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    @@ The Central Committee of the Chinese Communist Party has appointed Wei Liucheng, Former President of CNOOC and Former Chairman and CEO of CNOOC Limited, as Deputy Secretary of Hainan Provincial Committee and named him as the candidate for Governor of Hainan Province. At a conference of Hainan Provincial Committee of the Party held on October 8, at which the organization department of the Communist Party of China announced nomination of Wei as the deputy Party secretary of Hainan, which is the second highest position in the provincial government. Wei was also chosen as a candidate for the governor of the island province.

  15. Practical Large Scale Syntheses of New Drug Candidates

    Institute of Scientific and Technical Information of China (English)

    Hui-Yin Li

    2001-01-01

    @@ This presentation will be focus on Practical large scale syntheses of lead compounds and drug candidates from three major therapeutic areas from DuPont Pharmaceuticals Research Laboratory: 1). DMP777-a selective, non-toxic, orally active human elastase inhibitor; 2). DMP754-a potent glycoprotein IIb/IIIa antagonist; 3). R-Wafarin-the pure enantiomeric form of wafarin. The key technology used for preparation these drug candidates is asymmetric hydrogenation under very mild reaction conditions, which produced very high quality final products at large scale (>99% de, >99 A% and >99 wt%). Some practical and GMP aspects of process development will be also discussed.

  16. Facial discrimination of political candidates and voting behavior

    Directory of Open Access Journals (Sweden)

    Alina Duduciuc

    2012-04-01

    Full Text Available After a review of psychosociological research concerning the sources of prejudices and discriminations, this article brings into discussion the cognitive approach of perceiving the other as being „otherwise” than the members of the in-group. We will discuss the situations, structural and personal factors as being some determining ones for discriminant behavior. Within the lines of cognitive paradigm, we ask how the individual does discriminate, by perceptive processes, between candidates which are considered attractive, which go together with the expectations of the electorate concerning the physical aspects and candidates who are „less desirable”.

  17. On Intrinsic Magnetic Moments In Black Hole Candidates

    CERN Document Server

    Robertson, S L; Robertson, Stanley L.; Leiter, Darryl J.

    2003-01-01

    In previous work we found that many of the spectral properties of low mass x-ray binaries, including galactic black hole candidates could be explained by a magnetic propeller model that requires an intrinsically magnetized central object. Here we describe how the Einstein field equations of General Relativity and equipartition magnetic fields permit the existence of highly red shifted, extremely long lived, collapsing, radiating objects. We examine the properties of these collapsed objects and discuss characteristics that might lead to their confirmation as the source of black hole candidate phenomena.

  18. Practical Large Scale Syntheses of New Drug Candidates

    Institute of Scientific and Technical Information of China (English)

    Hui-Yin; Li

    2001-01-01

    This presentation will be focus on Practical large scale syntheses of lead compounds and drug candidates from three major therapeutic areas from DuPont Pharmaceuticals Research Laboratory: 1). DMP777-a selective, non-toxic, orally active human elastase inhibitor; 2). DMP754-a potent glycoprotein IIb/IIIa antagonist; 3). R-Wafarin-the pure enantiomeric form of wafarin. The key technology used for preparation these drug candidates is asymmetric hydrogenation under very mild reaction conditions, which produced very high quality final products at large scale (>99% de, >99 A% and >99 wt%). Some practical and GMP aspects of process development will be also discussed.……

  19. Planet Hunters. VIII. Characterization of 41 Long-Period Exoplanet Candidates from Kepler Archival Data

    CERN Document Server

    Wang, Ji; Barclay, Thomas; Picard, Alyssa; Ma, Bo; Bowler, Brendan P; Schmitt, Joseph R; Boyajian, Tabetha S; Jek, Kian J; LaCourse, Daryll; Baranec, Christoph; Riddle, Reed; Law, Nicholas M; Lintott, Chris; Schawinski, Kevin; Simister, Dean Joseph; Gregoire, Boscher; Babin, Sean P; Poile, Trevor; Jacobs, Thomas Lee; Jebson, Tony; Omohundro, Mark R; Schwengeler, Hans Martin; Sejpka, Johann; Terentev, Ivan A; Gagliano, Robert; Paakkonen, Jari-Pekka; Berge, Hans Kristian Otnes; Winarski, Troy; Green, Gerald R; Schmitt, Allan R

    2015-01-01

    The census of exoplanets is incomplete for orbital distances larger than 1 AU. Here, we present 41 long-period planet candidates in 38 systems identified by Planet Hunters based on Kepler archival data (Q0-Q17). Among them, 17 exhibit only one transit, 14 have two visible transits and 10 have more than three visible transits. For planet candidates with only one visible transit, we estimate their orbital periods based on transit duration and host star properties. The majority of the planet candidates in this work (75%) have orbital periods that correspond to distances of 1-3 AU from their host stars. We conduct follow-up imaging and spectroscopic observations to validate and characterize planet host stars. In total, we obtain adaptive optics images for 33 stars to search for possible blending sources. Six stars have stellar companions within 4". We obtain high-resolution spectra for 6 stars to determine their physical properties. Stellar properties for other stars are obtained from the NASA Exoplanet Archive a...

  20. Molecular genetic gene-environment studies using candidate genes in schizophrenia: a systematic review.

    Science.gov (United States)

    Modinos, Gemma; Iyegbe, Conrad; Prata, Diana; Rivera, Margarita; Kempton, Matthew J; Valmaggia, Lucia R; Sham, Pak C; van Os, Jim; McGuire, Philip

    2013-11-01

    The relatively high heritability of schizophrenia suggests that genetic factors play an important role in the etiology of the disorder. On the other hand, a number of environmental factors significantly influence its incidence. As few direct genetic effects have been demonstrated, and there is considerable inter-individual heterogeneity in the response to the known environmental factors, interactions between genetic and environmental factors may be important in determining whether an individual develops the disorder. To date, a considerable number of studies of gene-environment interactions (G×E) in schizophrenia have employed a hypothesis-based molecular genetic approach using candidate genes, which have led to a range of different findings. This systematic review aims to summarize the results from molecular genetic candidate studies and to review challenges and opportunities of this approach in psychosis research. Finally, we discuss the potential of future prospects, such as new studies that combine hypothesis-based molecular genetic candidate approaches with agnostic genome-wide association studies in determining schizophrenia risk.

  1. The BGS magnetic field candidate models for the 10th generation IGRF

    Science.gov (United States)

    Lesur, Vincent; Macmillan, Susan; Thomson, Alan

    2005-12-01

    In this paper we describe the derivation of the BGS candidate models for the 10th generation International Geomagnetic Reference Field. Our data set comprised quiet night-time data from the Èrsted and Champ satellites spanning 1999.2-2004.6 and observatory hourly means spanning 1999.0-2004.0. To improve the secular variation estimates for 2005.0-2010.0, predictions based on application of linear prediction filters to long series of observatory annual means were also used. These data were fitted by a spherical harmonic "parent" model with an internal field of maximum degree 36, a quadratic dependence on time up to degree 8, a linear dependence on time up to degree 12, an external field of maximum degree 2 with linear dependence on time, annual and semi-annual variations, and Dst dependence for degree 1 terms. Additionally for the external field, non-zonal degree 1 coefficients in the Geocentric Equatorial Inertial reference frame with annual variations and dependence on the Interplanetary Magnetic Field Y-component are included. The candidate models were then based, for the main field, on an extrapolation to 2005.0 of the truncated parent model, and for the secular variation, on its extrapolation to 2007.5. This latter set of coefficients was then used to generate a synthetic data set at the Earth's surface and this set was augmented with long term linear predictions of observatory annual means, to produce the final candidate secular variation model at 2007.5.

  2. Candidate gene association studies in syndromic and non-syndromic cleft lip and palate

    Energy Technology Data Exchange (ETDEWEB)

    Daack-Hirsch, S.; Basart, A.; Frischmeyer, P. [Univ. of Iowa, IA (United States)] [and others

    1994-09-01

    Using ongoing case ascertainment through a birth defects registry, we have collected 219 nuclear families with non-syndromic cleft lip and/or palate and 111 families with a collection of syndromic forms. Syndromic cases include 24 with recognized forms and 72 with unrecognized syndromes. Candidate gene studies as well as genome-wide searches for evidence of microdeletions and isodisomy are currently being carried out. Candidate gene association studies, to date, have made use of PCR-based polymorphisms for TGFA, MSX1, CLPG13 (a CA repeat associated with a human homologue of a locus that results in craniofacial dysmorphogenesis in the mouse) and an STRP found in a Van der Woude syndrome microdeletion. Control tetranucleotide repeats, which insure that population-based differences are not responsible for any observed associations, are also tested. Studies of the syndromic cases have included the same list of candidate genes searching for evidence of microdeletions and a genome-wide search using tri- and tetranucleotide polymorphic markers to search for isodisomy or structural rearrangements. Significant associations have previously been identified for TGFA, and, in this report, identified for MSX1 and nonsyndromic cleft palate only (p = 0.04, uncorrected). Preliminary results of the genome-wide scan for isodisomy has returned no true positives and there has been no evidence for microdeletion cases.

  3. Multiple Leader Candidate and Competitive Position Allocation for Robust Formation against Member Robot Faults.

    Science.gov (United States)

    Kwon, Ji-Wook; Kim, Jin Hyo; Seo, Jiwon

    2015-05-06

    This paper proposes a Multiple Leader Candidate (MLC) structure and a Competitive Position Allocation (CPA) algorithm which can be applicable for various applications including environmental sensing. Unlike previous formation structures such as virtual-leader and actual-leader structures with position allocation including a rigid allocation and an optimization based allocation, the formation employing the proposed MLC structure and CPA algorithm is robust against the fault (or disappearance) of the member robots and reduces the entire cost. In the MLC structure, a leader of the entire system is chosen among leader candidate robots. The CPA algorithm is the decentralized position allocation algorithm that assigns the robots to the vertex of the formation via the competition of the adjacent robots. The numerical simulations and experimental results are included to show the feasibility and the performance of the multiple robot system employing the proposed MLC structure and the CPA algorithm.

  4. Vote Choice, Ideology, and Social Dominance Orientation Influence Preferences for Lower Pitched Voices in Political Candidates

    DEFF Research Database (Denmark)

    Laustsen, Lasse; Petersen, Michael Bang; A. Klofstad, Casey

    2015-01-01

    Humans are equipped with a psychological system of followership that evolved to regulate choices of leaders based partly on would-be leaders’ physiological features. One such feature is voice pitch, which is determined by the physiology of the throat. Recent studies find that political candidates...... in modern elections with lower-pitched voices are generally more successful. As lower-pitched voices are perceived as stronger and more dominant, these findings have been taken to indicate a general preference for dispositional abilities in leaders to protect and prevail in conflicts. Here we extend upon...... these findings by demonstrating that conservatives and Republicans tend to view the world as much more competitive and threatening than liberals and Democrats. We utilize two existing data sources to show that political candidates with lower-pitched voices are preferred more among conservative Republicans than...

  5. Reconsidering Tree Fruit as Candidate Crops Through the Use of Rapid Cycle Crop Breeding Technologies

    Science.gov (United States)

    Graham, Gary Thomas

    2014-01-01

    Tree fruit, although desirable from a crew nutrition and menu diversity perspective, have long been dismissed as candidate crops based on their long juvenile phase, large architecture, low short-term harvest index, and dormancy requirements. Recent developments in Rapid Cycle Crop Breeding (RCCB) have overcome these historical limitations, opening the door to a new era in candidate crop research. Researchers at the United States Department of Agriculture (USDA) have developed FT-construct (Flowering Locus T) dwarf plum lines that have a very short juvenile phase, vine-like architecture, and no obligate dormancy period. In a collaborative research effort, NASA and the USDA are evaluating the performance of these FT-lines under controlled environment conditions relevant to spaceflight.

  6. A transcription map of the 6p22.3 reading disability locus identifying candidate genes

    Directory of Open Access Journals (Sweden)

    Gruen Jeffrey R

    2003-06-01

    Full Text Available Abstract Background Reading disability (RD is a common syndrome with a large genetic component. Chromosome 6 has been identified in several linkage studies as playing a significant role. A more recent study identified a peak of transmission disequilibrium to marker JA04 (G72384 on chromosome 6p22.3, suggesting that a gene is located near this marker. Results In silico cloning was used to identify possible candidate genes located near the JA04 marker. The 2 million base pairs of sequence surrounding JA04 was downloaded and searched against the dbEST database to identify ESTs. In total, 623 ESTs from 80 different tissues were identified and assembled into 153 putative coding regions from 19 genes and 2 pseudogenes encoded near JA04. The identified genes were tested for their tissue specific expression by RT-PCR. Conclusions In total, five possible candidate genes for RD and other diseases mapping to this region were identified.

  7. Survival of patients identified as candidates for intestinal transplantation: a 3-year prospective follow-up

    DEFF Research Database (Denmark)

    Pironi, L.; Forbes, A.; Joly, F.

    2008-01-01

    BACKGROUND & AIMS: The US Medicare indications for intestinal transplantation are based on failure of home parenteral nutrition. The American Society of Transplantation also includes patients at high risk of death from their primary disease or with high morbidity intestinal failure. A 3-year...... prospective study evaluated the appropriateness of these indications. METHODS: Survival on home parenteral nutrition or after transplantation was analyzed in 153 (97 adult, 56 pediatric) candidates for transplantation and 320 (262 adult, 58 pediatric) noncandidates, enrolled through a European multicenter......%-100%), and 100% in parenteral nutrition failure, high-risk primary disease, and high-morbidity intestinal failure, respectively (P = .034). Fifteen candidates underwent transplantation. Six died, including all 3 of those who were in hospital, and 25% of those who were at home at time of transplantation (P = .086...

  8. 2WHSP: A catalog of HE and VHE gamma-ray blazars and blazar candidates

    CERN Document Server

    Chang, Yu-Ling; Giommi, Paolo; Padovani, Paolo

    2016-01-01

    Aims. High Synchrotron Peaked blazars (HSPs) dominate the -ray sky at energies larger than a few GeV; however, only a few hundred blazars of this type have been catalogued so far. In this paper we present the 2WHSP sample, the largest and most complete list of HSP blazars available to date, which is an expansion of the 1WHSP catalog of gamma-ray source candidates off the Galactic plane. Methods. We cross-matched a number of multi-wavelength surveys (in the radio, infrared and X-ray bands) and applied selection criteria based on the radio to IR and IR to X-ray spectral slopes. To ensure the selection of genuine HSPs we examined the SED of each candidate and estimated the peak frequency of its synchrotron emission ($\

  9. Using Kepler Candidates to Examine the Properties of Habitable Zone Exoplanets

    CERN Document Server

    Adams, Arthur D

    2016-01-01

    An analysis of the currently known exoplanets in the habitable zones (HZs) of their host stars is of interest in both the wake of the NASA Kepler mission and with prospects for expanding the known planet population through future ground- and space-based projects. In this paper we compare the empirical distributions of the properties of stellar systems with transiting planets to those with transiting HZ planets. This comparison includes two categories: confirmed/validated transiting planet systems, and Kepler planet and candidate planet systems. These two categories allow us to present quantitative analyses on both a conservative dataset of known planets and a more optimistic and numerous sample of Kepler candidates. Both are subject to similar instrumental and detection biases, and vetted against false positive detections. We examine whether the HZ distributions vary from the overall distributions in the Kepler sample with respect to planetary radius as well as stellar mass, effective temperature, and metalli...

  10. Candidates for Long Lived High-K Ground States in Superheavy Nuclei

    CERN Document Server

    Jachimowicz, P; Skalski, J

    2015-01-01

    On the basis of systematic calculations for 1364 heavy and superheavy nuclei, including odd-systems, we have found a few candidates for high-K ground states in superheavy nuclei. The macroscopic-microscopic model based on the deformed Woods-Saxon single particle potential which we use offers a reasonable description of SH systems, including known: nuclear masses, $Q_{\\alpha}$-values, fission barriers, ground state deformations, super- and hyper-deformed minima in the heaviest nuclei. %For odd and odd-odd systems, both ways of including pairing correlations, % blocking and the quasi-particle method, have been applied. Exceptionally untypical high-K intruder contents of the g.s. found for some nuclei accompanied by a sizable excitation of the parent configuration in daughter suggest a dramatic hindrance of the $\\alpha$-decay. Multidimensional hyper-cube configuration - constrained calculations of the Potential Energy Surfaces (PES's) for one especially promising candidate, $^{272}$ Mt, shows a $\\backsimeq$ 6 Me...

  11. Quantitative trait loci mapping reveals candidate pathways regulating cell cycle duration in Plasmodium falciparum

    Directory of Open Access Journals (Sweden)

    Siwo Geoffrey

    2010-10-01

    Full Text Available Abstract Background Elevated parasite biomass in the human red blood cells can lead to increased malaria morbidity. The genes and mechanisms regulating growth and development of Plasmodium falciparum through its erythrocytic cycle are not well understood. We previously showed that strains HB3 and Dd2 diverge in their proliferation rates, and here use quantitative trait loci mapping in 34 progeny from a cross between these parent clones along with integrative bioinformatics to identify genetic loci and candidate genes that control divergences in cell cycle duration. Results Genetic mapping of cell cycle duration revealed a four-locus genetic model, including a major genetic effect on chromosome 12, which accounts for 75% of the inherited phenotype variation. These QTL span 165 genes, the majority of which have no predicted function based on homology. We present a method to systematically prioritize candidate genes using the extensive sequence and transcriptional information available for the parent lines. Putative functions were assigned to the prioritized genes based on protein interaction networks and expression eQTL from our earlier study. DNA metabolism or antigenic variation functional categories were enriched among our prioritized candidate genes. Genes were then analyzed to determine if they interact with cyclins or other proteins known to be involved in the regulation of cell cycle. Conclusions We show that the divergent proliferation rate between a drug resistant and drug sensitive parent clone is under genetic regulation and is segregating as a complex trait in 34 progeny. We map a major locus along with additional secondary effects, and use the wealth of genome data to identify key candidate genes. Of particular interest are a nucleosome assembly protein (PFL0185c, a Zinc finger transcription factor (PFL0465c both on chromosome 12 and a ribosomal protein L7Ae-related on chromosome 4 (PFD0960c.

  12. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J.C.; Van Konynenburg, R.A.; McCright, R.D. (Lawrence Livermore National Lab., CA (USA)); Bullen, D.B. (Science and Engineering Associates, Inc., Pleasanton, CA (USA))

    1988-04-01

    Three iron- to nickel-based austenitic alloys (Types 304L and 316L stainless steels and Alloy 825) are being considered as candidate materials for the fabrication of high-level radioactive-waste containers. Waste will include fuel assemblies from reactors as well as high-level waste in borosilicate glass forms, and will be sent to the prospective repository at Yucca Mountain, Nevada. The decay of radionuclides in the repository will result in the generation of substantial heat and in fluences of gamma radiation. Container materials may undergo any of several modes of degradation in this environment, including atmospheric oxidation; uniform aqueous phase corrosion; pitting; crevice corrosion; sensitization and intergranular stress corrosion cracking (IGSCC); and transgranular stress corrosion cracking (TGSCC). This report is an analysis of data relevant to the pitting, crevice corrosion, and stress corrosion cracking (SCC) of the three austenitic candidate alloys. The candidates are compared in terms of their susceptibilities to these forms of corrosion. Although all three candidates have demonstrated pitting and crevice corrosion in chloride-containing environments, Alloy 825 has the greatest resistance to these types of localized corrosion (LC); such resistance is important because pits can penetrate the metal and serve as crack initiation sites. Both Types 304L and 316L stainless steels are susceptible to SCC in acidic chloride media. In contrast, SCC has not been documented in Alloy 825 under comparable conditions. Gamma radiation has been found to enhance SCC in Types 304 and 304L stainless steels, but it has no detectable effect on the resistance of Alloy 825 to SCC. Furthermore, while the effects of microbiologically induced corrosion have been observed for 300-series stainless steels, nickel-based alloys such as Alloy 825 seem to be immune to such problems. 211 refs., 49 figs., 10 tabs.

  13. Finding and characterizing candidate targets for the Asteroid Redirect Mission (ARM)

    Science.gov (United States)

    Chodas, P.

    2014-07-01

    suitable for missions launching no earlier than June 2019; the maximum asteroid return masses for these range from 45 to 800 tons according to the orbit. Unfortunately, many of the currently known candidates have not had their sizes, masses and spin rates adequately constrained in order to provide confidence that they are within the capability of the ARM vehicle to return. Still, three candidates have been characterized well enough, two by the Spitzer Space Telescope, 2009 BD and 2011 MD, and one by radar, 2013 EC_{20}. 2009 BD was not actually detected by Spitzer, indicating it was smaller than expected, about 4 meters; similarly, 2013 EC_{20} turned out to be smaller than desired, less than 3 meters. A fourth candidate, 2008 HU_4, should be characterized with radar in 2016 when it passes near the Earth. In general, physical characterization of these very small asteroids is best performed immediately after discovery, while they are still very near the Earth. Radar is important for characterizing size and rotation state, while long-arc high-precision astrometry can help characterize mass through estimation of the area-to-mass ratio. Rapid-response characterization for an ARM candidate was successfully demonstrated last year for 2013 EC_{20}, mentioned earlier. More candidates for the small-asteroid concept are expected: new potential candidates should be detected at the rate of 3 to 5 per year, based on extrapolations from past discovery rates. For the large-asteroid ARM concept, there is an additional characterization challenge: the surface of the asteroid must be observed with enough resolution that the presence of ˜3-meter boulders can be either directly seen or inferred from high-SNR radar. The maximum size and mass of the returnable boulders depends on the asteroid orbit in much the same way as for the other concept. Asteroid Itokawa is a strong candidate because it has already been well characterized by the Japanese Hayabusa spacecraft. The future targets of the

  14. Análise das habilidades cognitivas requeridas dos candidatos ao cargo de contador na Administração Pública Federal, utilizando-se indicadores fundamentados na visão da Taxonomia de Bloom Analysis of cognitive skills required from candidate accountants in the brazilian Federal Public Administration, using indicators based on Bloom's Taxonomy

    Directory of Open Access Journals (Sweden)

    Jorge José Barros de Santana Junior

    2008-04-01

    Full Text Available O presente estudo objetiva detectar, através dos seis níveis de conhecimento da Taxonomia de Bloom, qual a tendência das habilidades cognitivas requeridas, quando da demanda por profissionais contadores pela Administração Direta e Indireta da União, utilizando-se da análise das questões de algumas recentes provas de concursos (1999 a 2006, o que evidenciará um perfil de desempenho intelectual delineado por esse setor público. A partir dessa análise, busca-se fazer uma reflexão sobre os caminhos a serem percorridos, para que o profissional contador possa atingir as demandas de desempenho intelectual exigidas pelo atual cenário de desenvolvimento tecnológico e econômico mundial. O artigo foi desenvolvido utilizando-se do método indutivo, mediante pesquisas bibliográficas e documentais, além de técnicas de investigação estatística. Aborda-se o histórico das últimas mudanças ocorridas no mercado profissional, em especial do setor público, e o entendimento dos fundamentos da Taxonomia de Bloom, apresentando como proposta alguns indicadores de aprendizagem mais voltados para uma realidade atual. O resultado da pesquisa demonstrou que não se está exigindo dos candidatos ao cargo de contador (ou com especialidade em contabilidade os mais altos indicadores de habilidades cognitivas. Verifica-se, portanto, a necessidade de mudanças efetivas nos rumos dessa profissão, para que se possa garantir o espaço almejado para todos aqueles que optaram em trabalhar e desenvolver as Ciências Contábeis.This study aims to detect, by means of the six knowledge levels in Bloom´s Taxonomy, tendencies in the cognitive abilities required when professional accountants are demanded by the Brazilian Direct and Indirect Administration, using the analysis of questions posed during some recent selection exams (1999 to 2006, to evidence the intellectual performance profile outlined by the public sector. Based on this analysis, attempts are made to

  15. Operational support and analysis a guide for ITIL exam candidates

    CERN Document Server

    Sansbury, John

    2014-01-01

    This user-friendly book aims to assist candidates pass the ITIL® OSA Intermediate examination. It references material from the core ITIL texts and gives practical guidance. This new edition includes the latest ITIL guidance as well as additional insights from the author's own experience of developing effective solutions. An ITIL® licensed product.

  16. Integrated spectral study of reddened globular clusters and candidates

    Science.gov (United States)

    Bica, E.; Claria, J. J.; Piatti, A. E.; Bonatto, C.

    1998-09-01

    This paper presents integrated spectra in the range 6700 - 9500 Angstroms for 20 Galactic globular clusters (and candidates) in the bulge and 5 others projected on the Galactic disk (|l|>30mbox {^{\\circ}}\\ and |b|Complejo Astronómico El Leoncito (CASLEO), Argentina, and European Southern Observatory (ESO), Chile.

  17. Investigation of Teacher Candidates' Learning Styles and Critical Thinking Dispositions

    Directory of Open Access Journals (Sweden)

    Sibel Açışlı

    2015-06-01

    Full Text Available In this study teacher candidates’ learning styles and critical thinking dispositions were investigated. The study group is composed of 938 students attending class teaching and science teaching departments of Artvin Çoruh, Karadeniz Technical, and Recep Tayyip Erdoğan Universities. Colb Learning Styles Inventory and California Critical Thinking Disposition Inventory (CCTDI were used as a means of data-collection. The data were analysed with SPSS 17, and it was detected that there are some differences between the learning styles and critical thinking dispositions of teacher candidates in terms of the variables. It was also observed that 40,9 % of students have "assimilator", 31,2 % of students have "diverger", 15,9 % of students have "converger" , and 11,9 % of students have "accommodator" learning style. The teacher candidates got the highest score from the "being analytical" subscale. As for teacher candidates critical thinking dispositions according to the class levels, a statistically meaningful difference was seen for those attending the final classes only in "open-mindedness" subscale. Upon the analysis of whether teacher candidates critical thinking dispositions differ according to school type variable, a meaningful difference was detected at the subscales of curiosity and seeking for truth while a meaningful difference was not found at the subscales of being analytical, being systematical, and self-confidence.

  18. Primary School Teacher Candidates' Geometric Habits of Mind

    Science.gov (United States)

    Köse, Nilu¨fer Y.; Tanisli, Dilek

    2014-01-01

    Geometric habits of mind are productive ways of thinking that support learning and using geometric concepts. Identifying primary school teacher candidates' geometric habits of mind is important as they affect the development of their future students' geometric thinking. Therefore, this study attempts to determine primary school teachers' geometric…

  19. Direct Dark Matter Searches: Fits to WIMP Candidates

    OpenAIRE

    Gelmini, Graciela B.

    2011-01-01

    After a brief introduction to dark matter in general and to WIMPs as candidates, we review recent results of direct dark matter searches. We concentrate on older and more recent hints pointing to light WIMP's with mass below 10 GeV.

  20. Supporting Clinical Practice Candidates in Learning Community Development

    Science.gov (United States)

    DeJarnette, Nancy K.; Sudeck, Maria

    2015-01-01

    The purpose of this qualitative research study was to monitor pre-service teacher candidates' progression and implementation of the learning community philosophy along with classroom management strategies. The study took place during their final semester of clinical practice. Data were collected from self-reports, surveys, university supervisor…

  1. IT Service Management A guide for ITIL Foundation Exam candidates

    CERN Document Server

    Brewster, Ernest; Lawes, Aidan; Sansbury, John

    2012-01-01

    ITIL® is a framework for IT service management and provides best management practice to meet ISO/IEC 20k. This guide introduces ITIL to Foundation Exam candidates and offers a practical understanding of IT service management. The new edition is fully updated and contains several additional processes. An ITIL® licensed product.

  2. Are Teacher and Principal Candidates Prepared to Address Student Cyberbullying?

    Science.gov (United States)

    Styron, Ronald A., Jr.; Bonner, Jessica L.; Styron, Jennifer L.; Bridgeforth, James; Martin, Cecelia

    2016-01-01

    The purpose of this study was to examine the preparation of teacher and principal candidates to address problems created in K-12 settings as a result of cyberbullying. Participants included teacher and principal preparation students. Findings indicated that respondents were familiar with the most common forms of cyberbullying and its impact on…

  3. Documenting Teacher Candidates' Professional Growth through Performance Evaluation

    Science.gov (United States)

    Brown, Elizabeth Levine; Suh, Jennifer; Parsons, Seth A.; Parker, Audra K.; Ramirez, Erin M.

    2015-01-01

    In the United States, colleges of education are responding to demands for increased accountability. The purpose of this article is to describe one teacher education program's implementation of a performance evaluation tool during final internship that measures teacher candidates' development across four domains: Planning and Preparation,…

  4. First microlensing candidates from the MEGA survey of M 31

    NARCIS (Netherlands)

    de Jong, JTA; Kuijken, K; Crotts, APS; Sackett, PD; Sutherland, WJ; Uglesich, RR; Baltz, EA; Cseresnjes, P; Gyuk, G; Widrow, LM

    2004-01-01

    We present the first M 31 candidate microlensing events from the Microlensing Exploration of the Galaxy and Andromeda (MEGA) survey. MEGA uses several telescopes to detect microlensing towards the nearby Andromeda galaxy, M 3 1, in order to establish whether massive compact objects are a significant

  5. Teacher Candidates' Perceptions of Scientists: Images and Attributes

    Science.gov (United States)

    McCarthy, Deborah

    2015-01-01

    The masculine image of scientists as elderly men wearing white coats and glasses, working alone in the laboratory has been documented since the 1950s. Because it is important that teacher candidates have a scientifically literate image of scientists due to the impact they have on their future students, this investigation is salient. This study…

  6. NIR Flare of the AGN Candidate PMNJ0107+0333

    Science.gov (United States)

    Carrasco, L.; Miramon, J.; Recillas, E.; Porras, A.; Chavushyan, V.; Mayya, D. Y.

    2016-12-01

    We report on the new NIR flare of the AGN candidate PMNJ0107+0333, cross identified with the X-ray source 1RXS J010729.5+033341. On November 13th,2016 (MJD 2457705.699), we found the source with the following flux in the NIR band: H = 14.657 +/- 0.05.

  7. Candidate new rotavirus species in sheltered dogs, Hungary.

    Science.gov (United States)

    Mihalov-Kovács, Eszter; Gellért, Ákos; Marton, Szilvia; Farkas, Szilvia L; Fehér, Enikő; Oldal, Miklós; Jakab, Ferenc; Martella, Vito; Bányai, Krisztián

    2015-04-01

    We identified unusual rotavirus strains in fecal specimens from sheltered dogs in Hungary by viral metagenomics. The novel rotavirus species displayed limited genome sequence homology to representatives of the 8 rotavirus species, A-H, and qualifies as a candidate new rotavirus species that we tentatively named Rotavirus I.

  8. Nonequilibrium Candidate Monte Carlo Simulations with Configurational Freezing Schemes.

    Science.gov (United States)

    Giovannelli, Edoardo; Gellini, Cristina; Pietraperzia, Giangaetano; Cardini, Gianni; Chelli, Riccardo

    2014-10-14

    Nonequilibrium Candidate Monte Carlo simulation [Nilmeier et al., Proc. Natl. Acad. Sci. U.S.A. 2011, 108, E1009-E1018] is a tool devised to design Monte Carlo moves with high acceptance probabilities that connect uncorrelated configurations. Such moves are generated through nonequilibrium driven dynamics, producing candidate configurations accepted with a Monte Carlo-like criterion that preserves the equilibrium distribution. The probability of accepting a candidate configuration as the next sample in the Markov chain basically depends on the work performed on the system during the nonequilibrium trajectory and increases with decreasing such a work. It is thus strategically relevant to find ways of producing nonequilibrium moves with low work, namely moves where dissipation is as low as possible. This is the goal of our methodology, in which we combine Nonequilibrium Candidate Monte Carlo with Configurational Freezing schemes developed by Nicolini et al. (J. Chem. Theory Comput. 2011, 7, 582-593). The idea is to limit the configurational sampling to particles of a well-established region of the simulation sample, namely the region where dissipation occurs, while leaving fixed the other particles. This allows to make the system relaxation faster around the region perturbed by the finite-time switching move and hence to reduce the dissipated work, eventually enhancing the probability of accepting the generated move. Our combined approach enhances significantly configurational sampling, as shown by the case of a bistable dimer immersed in a dense fluid.

  9. Evaluation of Candidate Teachers Related to the Weblog Writing Process

    Science.gov (United States)

    Çelik, Tugba; Demirgünes, Sercan

    2016-01-01

    Weblogs offer a new writing and reading environment. Most people in the education process may improve their writing skills and achieve new perspectives related to writing via weblogs. In this study the changes that weblog writing process created in undergraduates'/candidate teachers' minds regarding writing are revealed. The weblog writing process…

  10. Candidate optical counterparts of MAXI J1543-564

    NARCIS (Netherlands)

    Russell, D.M.; Lewis, F.; Roche, P.; Altamirano, D.

    2011-01-01

    We report on optical observations of the field of the black hole candidate X-ray binary MAXI J1543-564 (ATel #3330, #3331, #3334, #3336, #3341, #3355) with the 2-m Faulkes Telescope South (located at Siding Spring, Australia). Three images were acquired in SDSS i'-band on 2011 May 11th, 14th and 15t

  11. Single Integrated Air Picture (SIAP) Block 1 Candidate Systems

    Science.gov (United States)

    2007-11-02

    to produce joint warfighting capability. Since there was no process for the Single Integrated Air Picture System Engineering Task Force ( SIAP SE TF...to inherit or leverage, the SIAP SE TF had to build a process to identify candidate systems that will be impacted by the SIAP Block I upgrade.

  12. A kinematical selection of glueball candidates in central production

    CERN Document Server

    Barberis, D; Binon, Freddy G; Carney, J N; Close, Francis Edwin; Danielsen, K M; Dolgopolov, A V; Donskov, S V; Earl, B C; Evans, D; French, Bernard R; Inaba, S; Inyakin, A V; Jacholkowski, A; Jacobsen, T; Khaustov, G V; Kinashi, T; Kinson, J B; Kirk, A; Klempt, W; Kobayashi, M; Kondashov, A A; Kulchitskii, Yu A; Lednev, A A; Lenti, V; Maljukov, S; Martinengo, P; Minashvili, I A; Myklebost, K; Nakagawa, T; Norman, K L; Olsen, J M; Peigneux, J P; Polovnikov, S A; Polyakov, V A; Prokoshkin, Yu D; Romanovsky, V I; Rotscheidt, Herbert; Rumyantsev, V; Rusakovitch, N A; Sadovsky, S A; Samoylenko, V D; Semenov, A A; Sené, M; Sené, R; Shagin, P M; Shimizu, H M; Singovsky, A V; Soloviev, A S; Stassinaki, M; Stroot, Jean-Pierre; Sugonyaev, V P; Takamatsu, K; Tchlatchidze, G A; Tsuru, T; Vasileiadis, G; Venables, M; Villalobos Baillie, O; Votruba, M F; Yasu, Y

    1997-01-01

    A study of central meson production as a function of the difference in transverse momentum ($dP_T$) of the exchanged particles shows that undisputed $q \\overline q$ mesons are suppressed at small $dP_T$ whereas the glueball candidates are enhanced.

  13. Quotas and intersectionality: ethnicity and gender in candidate selection

    NARCIS (Netherlands)

    Celis, K.; Erzeel, S.; Mügge, L.; Damstra, A.

    2014-01-01

    Gender equality is not fully realised when it is restricted to ethnic majority men and women. This article examines how gender quotas as a form of equality policy affect ethnic minority groups, in particular, the gender balance among ethnic minority candidates for political office. Our analysis focu

  14. 11 CFR 9003.1 - Candidate and committee agreements.

    Science.gov (United States)

    2010-01-01

    ....1(b)(1). Upon request, documentation explaining the computer system's software capabilities shall be provided, and such personnel as are necessary to explain the operation of the computer system's software... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate and committee agreements....

  15. 11 CFR 9033.1 - Candidate and committee agreements.

    Science.gov (United States)

    2010-01-01

    ... operation of the computer system's software and the computerized information prepared or maintained by the... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate and committee agreements. 9033.1 Section 9033.1 Federal Elections FEDERAL ELECTION COMMISSION PRESIDENTIAL ELECTION CAMPAIGN...

  16. How political candidates use Twitter and the impact on votes

    NARCIS (Netherlands)

    Kruikemeier, S.

    2014-01-01

    This study investigates the content characteristics of Twitter during an election campaign, and the relationship between candidates’ style of online campaigning (i.e., politically personalized and interactive communication) and electoral support for those candidates. Thereby, it provides a better un

  17. THE 3 MU-M SPECTRA OF CANDIDATE CARBON STARS

    NARCIS (Netherlands)

    GROENEWEGEN, MAT; DEJONG, T; GEBALLE, TR

    1994-01-01

    We have searched for the 3.1 mum absorption feature, a well-known characteristic of optical carbon stars, in a sample of sixteen candidate carbon stars, most of which have very red colors and some of which have no optical counterparts. The sample was selected on the basis of similarity of LRS spectr

  18. X-ray spectroscopy of a recoiling SMBH candidate

    Science.gov (United States)

    Predehl, Peter

    2008-09-01

    Recent numerical relativity simulations of coalescencing supermassive black hole (SMBH) binaries predict that SMBHs can receive kicks with velocities up to several thousand km/s due to anisotropic emission of gravitational waves. We have recently found the best candidate todate for such a recoiling SMBH (Komossa et al. 2008). We apply for a 25 ks ACIS-S exposure of this exceptional source.

  19. Faculty Meeting: A Simulation for Secondary Teacher Candidates.

    Science.gov (United States)

    Hildebrand, Janet E.

    1981-01-01

    Describes a one-hour simulation used in methods courses at the University of Texas at Austin, to provide secondary teacher candidates with insights into the administrative functioning of a school and their future roles as department and school staff members. (SJL)

  20. Teacher Candidates' Attitudes to Using Oral History in History Education

    Science.gov (United States)

    Demircioglu, Ebru

    2016-01-01

    The aim of this research is to determine the views of history teacher candidates towards an oral history project carried out in the Special Teaching Method Course of the history pedagogy program of the Fatih Faculty of Education (FFE) at Karadeniz Technical University in Turkey. An open-ended questionnaire and semi-structured interview were the…