WorldWideScience

Sample records for au-ge based candidate

  1. Au-Ge based Candidate Alloys for High-Temperature Lead-Free Solder Alternatives

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Hattel, Jesper Henri

    2009-01-01

    and reactivity of these alloying elements, characteristics of their intermetallic compounds (IMCs) and the distribution of phases. The primary strengthening mechanism in the case of Au-Ge-In and Au-Ge-Sn combinations was determined to be the classic solute atom strengthening. The Au-Ge-Sb combination...... was primarily strengthened by the refined (Ge) dispersed phase. The distribution of phases played a relatively more crucial role in determining the ductility of the bulk solder alloy. In the present work it was found that among the low melting point metals, the addition of Sb to the Au-Ge eutectic would...

  2. Development of Au-Ge based candidate alloys as an alternative to high-lead content solders

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Hattel, Jesper Henri

    2010-01-01

    in the case of the Au-Ge-In candidate alloy. The microhardness measurement is well correlated with the solubility and reactivity of these alloying elements, characteristics of their intermetallic compounds (IMCs) and the distribution of phases. The primary strengthening mechanism in the case of Au....... The distribution of phases played a relatively more crucial role in determining the ductility of the bulk solder alloy. The findings of this work are: the addition of Sb to the Au-Ge eutectic would not only decrease its melting point but would also improve its ductility substantially and the lattice strains...

  3. A Corrosion Investigation of Solder Candidates for High-Temperature Applications

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Ambat, Rajan;

    2009-01-01

    , corrosion investigation was carried out on potential ternary lead-free candidate alloys based on these binary alloys for high temperature applications. These promising ternary candidate alloys were determined by the CALPHAD approach based on the solidification criterion and the nature of the phases...... predicted in the bulk solder. This work reveals that the Au-Sn based candidate alloys close to the eutectic composition (20 wt. % Sn) are more corrosion resistant than the Au-Ge based ones....

  4. Wetting and Soldering Behavior of Eutectic Au-Ge Alloy on Cu and Ni Substrates

    Science.gov (United States)

    Leinenbach, C.; Valenza, F.; Giuranno, D.; Elsener, H. R.; Jin, S.; Novakovic, R.

    2011-07-01

    Au-Ge-based alloys are interesting as novel high-temperature lead-free solders because of their low melting point, good thermal and electrical conductivity, and high corrosion resistance. In the present work, the wetting and soldering behavior of the eutectic Au-28Ge (at.%) alloy on Cu and Ni substrates have been investigated. Good wetting on both substrates with final contact angles of 13° to 14° was observed. In addition, solder joints with bond shear strength of 30 MPa to 35 MPa could be produced under controlled conditions. Cu substrates exhibit pronounced dissolution into the Au-Ge filler metal. On Ni substrates, the NiGe intermetallic compound was formed at the filler/substrate interface, which prevents dissolution of Ni into the solder. Using thin filler metal foils (25 μm), complete consumption of Ge in the reaction at the Ni interface was observed, leading to the formation of an almost pure Au layer in the soldering zone.

  5. Generation of AuGe nanocomposites by co-sparking technique and their photoluminescence properties

    Energy Technology Data Exchange (ETDEWEB)

    Kala, Shubhra, E-mail: shubkala@gmail.com [National Physical Laboratory (India); Theissmann, Ralf; Kruis, Frank Einar [University of Duisburg-Essen, Institute for Nanostructures and Technology, Faculty of Engineering Science, and CENIDE (Center for Nanointegration Duisburg-Essen) (Germany)

    2013-09-15

    The feasibility of spark discharge technique for preparing metal-semiconductor nanocomposites is demonstrated. In the AuGe system, Au shows only 10{sup -3} atomic percent solid solubility in Ge, whereas 3.1 at.% Ge is soluble in Au. During the co-sparking, Au is used as anode material; the cathode is composed of Ge. The relative atomic percent of Au and Ge in the initially generated mixture can be changed by changing the charging current to the capacitor used to trigger the sparking. Depending upon the atomic ratio of Au and Ge in the initial mixture, AuGe agglomerates form AuGe composite nanoparticles on subsequent sintering, in which AuGe alloy nanoparticles are found dispersed in a Ge matrix. The size of the dispersed AuGe alloy nanoparticles depend on the relative atomic concentration of Au and Ge in the initial mixture as well as on the sintering temperature. AuGe alloy nanoparticles dispersed in the Ge matrix are observed to exhibit an intense photoluminescence between 550 and 600 nm.

  6. On the temperature dependence of the mass spectra of AuGe and AuGeSi liquid metal alloy ion sources

    Energy Technology Data Exchange (ETDEWEB)

    Bischoff, L [Research Center Rossendorf Inc., Institute of Ion Beam Physics and Materials Research, PO Box 51 01 19, D-01314, Dresden (Germany); Pilz, W [Research Center Rossendorf Inc., Institute of Ion Beam Physics and Materials Research, PO Box 51 01 19, D-01314, Dresden (Germany); Ganetsos, Th [TEI of Lamia, Department of Electronics, 35100, Lamia (Greece); Akhmadaliev, Ch [Research Center Rossendorf Inc., Institute of Ion Beam Physics and Materials Research, PO Box 51 01 19, D-01314, Dresden (Germany); Aidinis, C J [University of Athens, Department of Physics, Panepistimiopolis, Zographos, GR-15784, Athens (Greece); Londos, C A [University of Athens, Department of Physics, Panepistimiopolis, Zographos, GR-15784, Athens (Greece)

    2005-01-01

    This reports on an extensive study of the characteristics of AuGe and AuGeSi liquid metal alloy ion sources as a model system for new semiconductor compatible FIB sources. Such characteristics include ion beam mass spectra. A careful investigation has been undertaken where the emitter temperature is the main variable parameter. This work concerns the temperature dependence of the mass spectra of two needle-type liquid metal alloy ion sources (LMAISs), namely Au{sub 77}Ge{sub 14}Si{sub 9} (T{sub m} = 364 deg. C) and Au{sub 73}Ge{sub 27} (T{sub m} = 365 deg. C). The sources are important for producing SiGe implanted layers. The experimental results, in conjunction with existing theories, strongly points towards the co-existence of two mechanisms for the emission of doubly-charged monomer ions: direct filed-evaporation and post-ionisation.

  7. Structural and phonon transmission study of Ge-Au-Ge eutectically bonded interfaces

    International Nuclear Information System (INIS)

    This thesis presents a structural analysis and phonon transparency investigation of the Ge-Au-Ge eutectic bond interface. Interface development was intended to maximize the interfacial ballistic phonon transparency to enhance the detection of the dark matter candidate WIMPs. The process which was developed provides an interface which produces minimal stress, low amounts of impurities, and insures Ge lattice continuity through the interface. For initial Au thicknesses of greater than 1,000 angstrom Au per substrate side, eutectic epitaxial growth resulted in a Au dendritic structure with 95% cross sectional and 90% planar Au interfacial area coverages. In sections in which Ge bridged the interface, lattice continuity across the interface was apparent. Epitaxial solidification of the eutectic interface with initial Au thicknesses < 500 A per substrate side produced Au agglomerations thereby reducing the Au planar interfacial area coverage to as little as 30%. The mechanism for Au coalescence was attributed to lateral diffusion of Ge and Au in the liquid phase during solidification. Phonon transmission studies were performed on eutectic interfaces with initial Au thicknesses of 1,000 angstrom, 500 angstrom, and 300 angstrom per substrate side. Phonon imaging of eutectically bonded samples with initial Au thicknesses of 300 angstrom/side revealed reproducible interfacial percent phonon transmissions from 60% to 70%. Line scan phonon imaging verified the results. Phonon propagation TOF spectra distinctly showed the predominant phonon propagation mode was ballistic. This was substantiated by phonon focusing effects apparent in the phonon imaging data. The degree of interface transparency to phonons and resulting phonon propagation modes correlate with the structure of the interface following eutectic solidification. Structural studies of samples with initial Au thickness of 1,000 angstrom/side appear to correspond with the phonon transmission study

  8. Structural and phonon transmission study of Ge-Au-Ge eutectically bonded interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Knowlton, W.B. [Univ. of California, Berkeley, CA (United States). Dept. of Materials Science and Mineral Engineering]|[Lawrence Berkeley Lab., CA (United States). Materials Sciences Div.

    1995-07-01

    This thesis presents a structural analysis and phonon transparency investigation of the Ge-Au-Ge eutectic bond interface. Interface development was intended to maximize the interfacial ballistic phonon transparency to enhance the detection of the dark matter candidate WIMPs. The process which was developed provides an interface which produces minimal stress, low amounts of impurities, and insures Ge lattice continuity through the interface. For initial Au thicknesses of greater than 1,000 {angstrom} Au per substrate side, eutectic epitaxial growth resulted in a Au dendritic structure with 95% cross sectional and 90% planar Au interfacial area coverages. In sections in which Ge bridged the interface, lattice continuity across the interface was apparent. Epitaxial solidification of the eutectic interface with initial Au thicknesses < 500 A per substrate side produced Au agglomerations thereby reducing the Au planar interfacial area coverage to as little as 30%. The mechanism for Au coalescence was attributed to lateral diffusion of Ge and Au in the liquid phase during solidification. Phonon transmission studies were performed on eutectic interfaces with initial Au thicknesses of 1,000 {angstrom}, 500 {angstrom}, and 300 {angstrom} per substrate side. Phonon imaging of eutectically bonded samples with initial Au thicknesses of 300 {angstrom}/side revealed reproducible interfacial percent phonon transmissions from 60% to 70%. Line scan phonon imaging verified the results. Phonon propagation TOF spectra distinctly showed the predominant phonon propagation mode was ballistic. This was substantiated by phonon focusing effects apparent in the phonon imaging data. The degree of interface transparency to phonons and resulting phonon propagation modes correlate with the structure of the interface following eutectic solidification. Structural studies of samples with initial Au thickness of 1,000 {angstrom}/side appear to correspond with the phonon transmission study.

  9. Metastable crystalline AuGe catalysts formed during isothermal germanium nanowire growth.

    Science.gov (United States)

    Gamalski, A D; Tersoff, J; Sharma, R; Ducati, C; Hofmann, S

    2012-06-22

    We observe the formation of metastable AuGe phases without quenching, during strictly isothermal nucleation and growth of Ge nanowires, using video-rate lattice-resolved environmental transmission electron microscopy. We explain the unexpected formation of these phases through a novel pathway involving changes in composition rather than temperature. The metastable catalyst has important implications for nanowire growth, and more broadly, the isothermal process provides both a new approach to growing and studying metastable phases, and a new perspective on their formation.

  10. Indium flux-growth of Eu{sub 2}AuGe{sub 3} : a new germanide with an AlB{sub 2} superstructure.

    Energy Technology Data Exchange (ETDEWEB)

    Sebastian, C. P.; Malliakas, C. D.; Chondroudi, M.; Schellenberg, I.; Rayaprol, S.; Hoffmann, R.-D.; Pottgen, R.; Kanatzidis, M. G. (Materials Science Division); (Northwestern Univ.); (Westfalische Wilhelms-Univ. Munster); (UGC-DAE Consortium for Scientific Research)

    2010-01-01

    The germanide Eu{sub 2}AuGe{sub 3} was obtained as large single crystals in high yield from a reaction of the elements in liquid indium. At room temperature Eu{sub 2}AuGe{sub 3} crystallizes with the Ca{sub 2}AgSi{sub 3} type, space group Fmmm, an ordered variant of the AlB{sub 2} type: a = 857.7(4), b = 1485.5(10), c = 900.2(4) pm. The gold and germanium atoms build up slightly distorted graphite-like layers which consist of Ge{sub 6} and Au{sub 2}Ge{sub 4} hexagons, leading to two different hexagonal-prismatic coordination environments for the europium atoms. Magnetic susceptibility data showed Curie?Weiss law behavior above 50 K and antiferromagnetic ordering at 11 K. The experimentally measured magnetic moment indicates divalent europium. The compound exhibits a distinct magnetic anisotropy based on single crystal measurements and at 5 K it shows a metamagnetic transition at 10 kOe. Electrical conductivity measurements show metallic behavior. The structural transition at 130 K observed in the single crystal data was very well supported by the conductivity measurements. {sup 151}Eu Moessbauer spectroscopic data show an isomer shift of ?11.24 mm/s at 77 K, supporting the divalent character of europium. In the magnetically ordered regime one observes superposition of two signals with hyperfine fields of 26.0 (89%) and 3.5 (11%) T, respectively, indicating differently ordered domains.

  11. Temperature-induced assembly of semiconductor nanocrystals into fractal architectures and thermoelectric power properties in Au/Ge bilayer films

    Energy Technology Data Exchange (ETDEWEB)

    Li Quanbao; Wang Jian; Jiao Zheng [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Wu Minghong, E-mail: mhwu@staff.shu.edu.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Shek, Chan-Hung; Lawrence Wu, C.M.; Lai, Joseph K.L. [Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong); Chen Zhiwen, E-mail: cnzwchen@yahoo.com.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong)

    2011-08-15

    Highlights: > Ge fractal architectures were achieved by temperature-induced assembly. > The appearance of fractal architectures influences the thermoelectric power. > But it has little effect on the resistivity. > The values of the superlocalization exponent were within 1.22 {<=} {xi} {<=} 1.29. > It was higher than expected for two-dimension fractal system. - Abstract: Fractal architectures of semiconductor nanocrystals were successfully achieved by temperature-induced assembly of semiconductor nanocrystals in gold/germanium (Au/Ge) bilayer films. New assessment strategies of fractal architectures are of fundamental importance in the development of micro/nano-devices. Temperature-dependent properties including resistivity and thermoelectric power (TEP) of Au/Ge bilayer films with self-similar fractal patterns were investigated in detail. Experimental results indicated that the microstructure of Au film plays an important role in the characteristics of Au/Ge bilayer films after annealing and the crystallization processes of amorphous Ge accompany by fractal formation of Ge nanocrystals via temperature-induced assembly. The appearance of fractal architectures has significantly influence on the TEP but little effect on the resistivity of the annealed bilayer film. By analysis of the data, we found that the values of superlocalization exponent are within 1.22 {<=} {xi} {<=} 1.29, which are higher than expected for two-dimension fractal systems. The results provided possible evidence for the superlocalization on fractal architectures in Au/Ge bilayer films. The TEP measurements are considered a more effective method than the conductivity for investigating superlocalization in a percolating system.

  12. Insights into fractal feature evolution from Au/Ge thin films after annealing

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Z.W.; Zhang, S.Y.; Tan, S.; Hou, J.G. [Structure Research Laboratory, University of Science and Technology of China, Hefei, 230026, Anhui (China); Wu, Z.Q. [Fundamental Physics Center, University of Science and Technology of China, Hefei, 230026, Anhui (China)

    2004-03-01

    We report a perplexing behavior of fractal shape transition that results from a change in the annealing temperature and time or the film thickness ratio. We find that a compact-to-open fractal shape transition can be induced by increasing the annealing temperature and time or decreasing the thickness ratio of the Au and Ge films. This behavior is not completely consistent with what is predicted by theories based on diffusion-limited aggregation and previous experimental observations. In this new system, we find that fractal shape transitions are truly dominated by the random-successive nucleation and growth mechanism. (orig.)

  13. Frictional Behavior of Fe-based Cladding Candidates for PWR

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young-Ho; Kim, Hyung-Kyu [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Byun, Thak Sang [Oak Ridge National Lab., Oak Ridge (United States)

    2014-10-15

    After the recent nuclear disaster at Fukushima Daiichi reactors, there is a growing consensus on the development of new fuel systems (i.e., accident-tolerant fuel, ATF) that have high safety margins under design-basis accident (DBA) and beyond design-basis accident (BDBA). A common objective of various developing candidates is to archive the outstanding corrosion-resistance under severe accidents such as DBA and DBDA conditions for decreasing hydrogen production and increasing coping time to respond to severe accidents. ATF could be defined as new fuel/cladding system with enhanced accident tolerant to loss of active cooling in the core for a considerably longer time period under severe accidents while maintaining or improving the fuel performance during normal operations. This means that, in normal operating conditions, new fuel systems should be applicable to current operating PWRs for suppressing various degradation mechanisms of current fuel assembly without excessive design changes. When considering that one of the major degradation mechanisms of PWR fuel assemblies is a grid-to-rod fretting (GTRF), it is necessary to examine the tribological behavior of various ATF candidates at initial development stage. In this study, friction and reciprocating wear behavior of two kinds of Fe-based ATF candidates were examined with a reciprocating wear tests at room temperature (RT) air and water. The objective is to examine the compatibilities of these Fe-based alloys against current Zr-based alloy properties, which is used as major structural materials of PWR fuel assemblies. The reciprocating wear behaviors of Fe-based accident-tolerant fuel cladding candidates against current Zr-based alloy has been studied using a reciprocating sliding wear tester in room temperature air and water. Frictional behavior and wear depth were used for evaluating the applicability and compatibilities of Fe-based candidates without significant design changes of PWR fuel assemblies

  14. Speeding disease gene discovery by sequence based candidate prioritization

    Directory of Open Access Journals (Sweden)

    Porteous David J

    2005-03-01

    Full Text Available Abstract Background Regions of interest identified through genetic linkage studies regularly exceed 30 centimorgans in size and can contain hundreds of genes. Traditionally this number is reduced by matching functional annotation to knowledge of the disease or phenotype in question. However, here we show that disease genes share patterns of sequence-based features that can provide a good basis for automatic prioritization of candidates by machine learning. Results We examined a variety of sequence-based features and found that for many of them there are significant differences between the sets of genes known to be involved in human hereditary disease and those not known to be involved in disease. We have created an automatic classifier called PROSPECTR based on those features using the alternating decision tree algorithm which ranks genes in the order of likelihood of involvement in disease. On average, PROSPECTR enriches lists for disease genes two-fold 77% of the time, five-fold 37% of the time and twenty-fold 11% of the time. Conclusion PROSPECTR is a simple and effective way to identify genes involved in Mendelian and oligogenic disorders. It performs markedly better than the single existing sequence-based classifier on novel data. PROSPECTR could save investigators looking at large regions of interest time and effort by prioritizing positional candidate genes for mutation detection and case-control association studies.

  15. A computer vision based candidate for functional balance test.

    Science.gov (United States)

    Nalci, Alican; Khodamoradi, Alireza; Balkan, Ozgur; Nahab, Fatta; Garudadri, Harinath

    2015-08-01

    Balance in humans is a motor skill based on complex multimodal sensing, processing and control. Ability to maintain balance in activities of daily living (ADL) is compromised due to aging, diseases, injuries and environmental factors. Center for Disease Control and Prevention (CDC) estimate of the costs of falls among older adults was $34 billion in 2013 and is expected to reach $54.9 billion in 2020. In this paper, we present a brief review of balance impairments followed by subjective and objective tools currently used in clinical settings for human balance assessment. We propose a novel computer vision (CV) based approach as a candidate for functional balance test. The test will take less than a minute to administer and expected to be objective, repeatable and highly discriminative in quantifying ability to maintain posture and balance. We present an informal study with preliminary data from 10 healthy volunteers, and compare performance with a balance assessment system called BTrackS Balance Assessment Board. Our results show high degree of correlation with BTrackS. The proposed system promises to be a good candidate for objective functional balance tests and warrants further investigations to assess validity in clinical settings, including acute care, long term care and assisted living care facilities. Our long term goals include non-intrusive approaches to assess balance competence during ADL in independent living environments.

  16. Trinocular stereo vision method based on mesh candidates

    Science.gov (United States)

    Liu, Bin; Xu, Gang; Li, Haibin

    2010-10-01

    One of the most interesting goals of machine vision is 3D structure recovery of the scenes. This recovery has many applications, such as object recognition, reverse engineering, automatic cartography, autonomous robot navigation, etc. To meet the demand of measuring the complex prototypes in reverse engineering, a trinocular stereo vision method based on mesh candidates was proposed. After calibration of the cameras, the joint field of view can be defined in the world coordinate system. Mesh grid is established along the coordinate axes, and the mesh nodes are considered as potential depth data of the object surface. By similarity measure of the correspondence pairs which are projected from a certain group of candidates, the depth data can be obtained readily. With mesh nodes optimization, the interval between the neighboring nodes in depth direction could be designed reasonably. The potential ambiguity can be eliminated efficiently in correspondence matching with the constraint of a third camera. The cameras can be treated as two independent pairs, left-right and left-centre. Due to multiple peaks of the correlation values, the binocular method may not satisfy the accuracy of the measurement. Another image pair is involved if the confidence coefficient is less than the preset threshold. The depth is determined by the highest sum of correlation of both camera pairs. The measurement system was simulated using 3DS MAX and Matlab software for reconstructing the surface of the object. The experimental result proved that the trinocular vision system has good performance in depth measurement.

  17. New Candidates for Plant-Based Repellents Against Aedes aegypti.

    Science.gov (United States)

    Misni, Norashiqin; Nor, Zurainee Mohamed; Ahmad, Rohani

    2016-06-01

    Based on an ethnobotanical study on use for plant species against mosquito bites in the Kota Tinggi District, Johor State, Malaysia, 3 plants selected for study, Citrus aurantifolia (leaves), Citrus grandis (fruit peel), and Alpinia galanga (rhizome), were extracted using hydrodistillation to produce essential oils. These essential oils were then formulated as a lotion using a microencapsulation process and then tested for their repellent effect against Aedes aegypti. N,N-diethyl-m-toluamide (deet) was also prepared in the same formulation and tested for repellency as controls. Four commercial plant-based repellent (KAPS(®), MozAway(®), BioZ Natural(®), and Mosiquard(®)) also were incorporated in the bioassay for comparison purposes. Bioassays revealed that at 20% concentration all repellent formulations demonstrated complete protection for 2 h and >90% for 4 h post-application. The A. galanga-based formulation provided the greatest level of protection (98.91%), which extended for 4 h post-application and was not significantly different from deet at similar concentration. When compared with commercial plant-based repellents (KAPS(®), MozAway(®), and BioZ Natural(®)), the 3 lotion formulations showed significantly better protection against Ae. aegypti bites, providing >90% protection for 4 h. In conclusion, our 3 plant-based lotion formulations provided acceptable levels of protection against host-seeking Ae. aegypti and should be developed. PMID:27280349

  18. Development of gold based solder candidates for flip chip assembly

    DEFF Research Database (Denmark)

    Chidambaram, Vivek; Hald, John; Hattel, Jesper Henri

    2009-01-01

    Flip chip technology is now rapidly replacing the traditional wire bonding interconnection technology in the first level packaging applications due to the miniaturization drive in the microelectronics industry. Flip chip assembly currently involves the use of high lead containing solders...... for interconnecting the chip to a carrier in certain applications due to the unique properties of lead. Despite of all the beneficial attributes of lead, its potential environmental impact when the products are discarded to land fills has resulted in various legislatives to eliminate lead from the electronic products...... based on its notorious legacy as a major health hazard across the spectrum of human generations and cultures. Flip chip assembly is also now increasingly being used for the high-performance (H-P) systems. These H-P systems perform mission-critical operations and are expected to experience virtually...

  19. Calibration of the Gaia RVS from ground-based observations of candidate standard stars

    OpenAIRE

    Chemin, L.; Soubiran, C.; Crifo, Françoise; Jasniewicz, Gérard; Katz, David; Hestroffer, Daniel; Udry, Stéphane

    2011-01-01

    International audience The Radial Velocity Spectrometer (RVS) on board of Gaia will perform a large spectroscopic survey to determine the radial velocities of some 1.5 × 10^8 stars. We present the status of ground-based observations of a sample of 1420 candidate standard stars designed to calibrate the RVS. Each candidate star has to be observed several times before Gaia launch (and at least once during the mission) to ensure that its radial velocity remains stable during the whole mission...

  20. Calibration of the Gaia Radial Velocity Spectrometer from ground-based observations of candidate standard stars

    OpenAIRE

    Chemin, L.; Soubiran, C.; Crifo, F.; Jasniewicz, G.; Katz, D.; Hestroffer, D.; Udry, S.

    2011-01-01

    The Radial Velocity Spectrometer (RVS) on board of Gaia will perform a large spectroscopic survey to determine the radial velocities of some 1.5x10^8 stars. We present the status of ground-based observations of a sample of 1420 candidate standard stars designed to calibrate the RVS. Each candidate star has to be observed several times before Gaia launch (and at least once during the mission) to ensure that its radial velocity remains stable during the whole mission. Observations are performed...

  1. A three-dimensional measurement method based on mesh candidates assisted with structured light

    Science.gov (United States)

    Xu, Gang; Zhang, Wenming; Li, Haibin; Liu, Bin

    2009-07-01

    Rendering three-dimensional information of a scene from optical measurement is very important for a wide variety of applications such as robot navigation, rapid prototyping, medical imaging, industrial inspection, etc. In this paper, a new 3D measurement method based on mesh candidate with structured light illuminating is proposed. The vision sensor consists of two CCD cameras and a DLP projector. The measurement system combines the technology of binocular stereo vision and structured light, so as to simplify the process of acquiring depth information using mesh candidates. The measurement method is based on mesh candidates which represent the potential depth in the three dimensional scene. First the mesh grid was created along the direction of axes in world coordinate system, and the nodes were considered as depth candidates on the surface of object. Then each group of the mesh nodes varying along z axis were mapped to the captured image planes of both cameras. At last, according to the similarity measure of the corresponding pixel pairs, the depth of the object surface can be obtained. The matching process is between the pixels in both camera planes corresponding to the spatial mesh candidates. Aided by the structured light pattern, the accuracy of measurement system improved. Appending the periodic sawtooth pattern on the scene by structured light made measurement easier, while the computational cost did not increased since the projector had no need to be calibrated. The 3DS MAX and Matlab software were used to simulate measurement system and reconstruct the surface of the object. After the positioned cameras have been calibrated using Matlab calibration toolbox, the projector is used to project structured light pattern on the scene. Indicated by experimental results, the mesh-candidate-based method is obviously superior in computation and accuracy. Compared with traditional methods based on image matching, our method has several advantages: (1) the complex

  2. Intelligent computing budget allocation for on-road tra jectory planning based on candidate curves

    Institute of Scientific and Technical Information of China (English)

    Xiao-xin FU; Yong-heng JIANG; De-xian HUANG; Jing-chun WANG; Kai-sheng HUANG

    2016-01-01

    In this paper, on-road trajectory planning is solved by introducing intelligent computing budget allocation (ICBA) into a candidate-curve-based planning algorithm, namely, ordinal-optimization-based differential evolution (OODE). The proposed algorithm is named IOODE with‘I’ representing ICBA. OODE plans the trajectory in two parts: trajectory curve and acceleration profi le. The best trajectory curve is picked from a set of candidate curves, where each curve is evaluated by solving a subproblem with the differential evolution (DE) algorithm. The more iterations DE performs, the more accurate the evaluation will become. Thus, we intelligently allocate the iterations to individual curves so as to reduce the total number of iterations performed. Meanwhile, the selected best curve is ensured to be one of the truly top curves with a high enough probability. Simulation results show that IOODE is 20% faster than OODE while maintaining the same performance in terms of solution quality. The computing budget allocation framework presented in this paper can also be used to enhance the efficiency of other candidate-curve-based planning methods.

  3. Candidate Smoke Region Segmentation of Fire Video Based on Rough Set Theory

    Directory of Open Access Journals (Sweden)

    Yaqin Zhao

    2015-01-01

    Full Text Available Candidate smoke region segmentation is the key link of smoke video detection; an effective and prompt method of candidate smoke region segmentation plays a significant role in a smoke recognition system. However, the interference of heavy fog and smoke-color moving objects greatly degrades the recognition accuracy. In this paper, a novel method of candidate smoke region segmentation based on rough set theory is presented. First, Kalman filtering is used to update video background in order to exclude the interference of static smoke-color objects, such as blue sky. Second, in RGB color space smoke regions are segmented by defining the upper approximation, lower approximation, and roughness of smoke-color distribution. Finally, in HSV color space small smoke regions are merged by the definition of equivalence relation so as to distinguish smoke images from heavy fog images in terms of V component value variety from center to edge of smoke region. The experimental results on smoke region segmentation demonstrated the effectiveness and usefulness of the proposed scheme.

  4. Calibration of the Gaia Radial Velocity Spectrometer from ground-based observations of candidate standard stars

    CERN Document Server

    Chemin, L; Crifo, F; Jasniewicz, G; Katz, D; Hestroffer, D; Udry, S

    2011-01-01

    The Radial Velocity Spectrometer (RVS) on board of Gaia will perform a large spectroscopic survey to determine the radial velocities of some 1.5x10^8 stars. We present the status of ground-based observations of a sample of 1420 candidate standard stars designed to calibrate the RVS. Each candidate star has to be observed several times before Gaia launch (and at least once during the mission) to ensure that its radial velocity remains stable during the whole mission. Observations are performed with the high-resolution spectrographs SOPHIE, NARVAL and CORALIE, completed with archival data of the ELODIE and HARPS instruments. The analysis shows that about 7% of the current catalogue exhibits variations larger than the adopted threshold of 300 m/s. Consequently, those stars should be rejected as reference targets, due to the expected accuracy of the Gaia RVS. Emphasis is also put here on our observations of bright asteroids to calibrate the ground-based velocities by a direct comparison with celestial mechanics. ...

  5. Site candidates for ground-based telescope devoted to space debris searching

    Science.gov (United States)

    Jiang, Hu; Hu, Haiying; Shen, Xue-min

    2015-12-01

    The demands for space debris scanning have been increasingly urgent in recent decade. The more space activities, the more urgent demands for space debris information. China has laid out space debris scanning from ground-based observation facilities. According to the latitudinal boundaries of China, north latitudes of 20deg, 30deg, 40deg, 50deg, 60deg are considered to be candidates for telescope sites. Space debris distribution is simulated under the assumption that telescopes are stationed in north latitudes of 20deg, 30deg, 40deg, 50deg, 60deg respectively. According to space debris simulations, it is recommended that the telescope dedicated to space debris scanning should be deployed in lower latitudes in order to achieve a better performance in detecting space debrises for China observing users.

  6. Handwritten Japanese Address Recognition Technique Based on Improved Phased Search of Candidate Rectangle Lattice

    Directory of Open Access Journals (Sweden)

    Hidehisa NAKAYAMA

    2004-08-01

    Full Text Available In the field of handwritten Japanese address recognition, it is common to recognize place-name strings from place-name images. However, in practice, it is necessary to recognize the place-name strings from address images. Therefore, we have proposed the post-processing system, which checks the list of the place-name strings in two-stages for recognizing the place-name images. In this paper, we propose a new technique based on phased search of candidate rectangle lattice, and improve the technique with the detection of key-characters for final output. Applying our proposal to the IPTP 1840 image data of address strings, the results of experiments clearly show the efficiency of our system in handwritten Japanese address recognition.

  7. Solid particle erosion of steels and nickel based alloys candidates for USC steam turbine blading

    Energy Technology Data Exchange (ETDEWEB)

    Cernuschi, Federico; Guardamagna, Cristina; Lorenzoni, Lorenzo [ERSE SpA, Milan (Italy); Robba, Davide [CESI, Milan (Italy)

    2010-07-01

    The main objective of COST536 Action is to develop highly efficient steam power plant with low emissions, from innovative alloy development to validation of component integrity. In this perspective, to improve the operating efficiency, materials capable of withstanding higher operating temperatures are required. For the manufacturing of components for steam power plants with higher efficiency steels and nickel-based alloys with improved oxidation resistance and creep strength at temperature as high as 650 C - 700 C have to be developed. Candidate alloys for manufacturing high pressure steam turbine diaphragms, buckets, radial seals and control valves should exhibit, among other properties, a good resistance at the erosion phenomena induced by hard solid particles. Ferric oxide (magnetite) scales cause SPE by exfoliating from boiler tubes and steam pipes (mainly super-heaters and re-heaters) and being transported within the steam flow to the turbine. In order to comparatively study the erosion behaviour of different materials in relatively short times, an accelerated experimental simulation of the erosion phenomena must be carried out. Among different techniques to induce erosion on material targets, the use of an air jet tester is well recognised to be one of the most valid and reliable. In this work the results of SPE comparative tests performed at high temperatures (550 C, 600 C and 650 C) at different impaction angles on some steels and nickel based alloys samples are reported. (orig.)

  8. A PROJECT-BASED LEARNING PACKAGE FOR PH. D CANDIDATES AT HIT

    Institute of Scientific and Technical Information of China (English)

    ZhaoYuqin

    2004-01-01

    Project-based learning is to involve students in a project-like learning program to achieve the required purposes of language learning, It is a new pedagogical approach composed of a series of tasks, requiring students to use various languages and other skills to accomplish respectively. It is to provide students with opportunities to learn the language in a simulated authentic communicative situation when they are using the language. A project-based learning program was desigued for the Ph. D.candidates at HIT, named “simulating an international conference”. It involves the students in the whole process of organizing and participating an international conference. In the simulated context, students have opportunities to learn and practice English while they are using English to fulfill some tasks. Meanwhile, students are able to practice other skills, such as using information technologies, word editing and publishing. More importantly, students need to collaborate and cooperate with each other. The abilities to use English as a communicative tool for international communication, to use information technologies and to be able to cooperate with other sare the aims of education in the 21st century.

  9. Cell-Based Assay Design for High-Content Screening of Drug Candidates.

    Science.gov (United States)

    Nierode, Gregory; Kwon, Paul S; Dordick, Jonathan S; Kwon, Seok-Joon

    2016-02-01

    To reduce attrition in drug development, it is crucial to consider the development and implementation of translational phenotypic assays as well as decipher diverse molecular mechanisms of action for new molecular entities. High-throughput fluorescence and confocal microscopes with advanced analysis software have simplified the simultaneous identification and quantification of various cellular processes through what is now referred to as highcontent screening (HCS). HCS permits automated identification of modifiers of accessible and biologically relevant targets and can thus be used to detect gene interactions or identify toxic pathways of drug candidates to improve drug discovery and development processes. In this review, we summarize several HCS-compatible, biochemical, and molecular biology-driven assays, including immunohistochemistry, RNAi, reporter gene assay, CRISPR-Cas9 system, and protein-protein interactions to assess a variety of cellular processes, including proliferation, morphological changes, protein expression, localization, post-translational modifications, and protein-protein interactions. These cell-based assay methods can be applied to not only 2D cell culture but also 3D cell culture systems in a high-throughput manner. PMID:26428732

  10. Trust Based Algorithm for Candidate Node Selection in Hybrid MANET-DTN

    Directory of Open Access Journals (Sweden)

    Jan Papaj

    2014-01-01

    Full Text Available The hybrid MANET - DTN is a mobile network that enables transport of the data between groups of the disconnected mobile nodes. The network provides benefits of the Mobile Ad-Hoc Networks (MANET and Delay Tolerant Network (DTN. The main problem of the MANET occurs if the communication path is broken or disconnected for some short time period. On the other side, DTN allows sending data in the disconnected environment with respect to higher tolerance to delay. Hybrid MANET - DTN provides optimal solution for emergency situation in order to transport information. Moreover, the security is the critical factor because the data are transported by mobile devices. In this paper, we investigate the issue of secure candidate node selection for transportation of the data in a disconnected environment for hybrid MANET- DTN. To achieve the secure selection of the reliable mobile nodes, the trust algorithm is introduced. The algorithm enables select reliable nodes based on collecting routing information. This algorithm is implemented to the simulator OPNET modeler.

  11. Novel chikungunya vaccine candidate with an IRES-based attenuation and host range alteration mechanism.

    Directory of Open Access Journals (Sweden)

    Kenneth Plante

    2011-07-01

    Full Text Available Chikungunya virus (CHIKV is a reemerging mosquito-borne pathogen that has recently caused devastating urban epidemics of severe and sometimes chronic arthralgia. As with most other mosquito-borne viral diseases, control relies on reducing mosquito populations and their contact with people, which has been ineffective in most locations. Therefore, vaccines remain the best strategy to prevent most vector-borne diseases. Ideally, vaccines for diseases of resource-limited countries should combine low cost and single dose efficacy, yet induce rapid and long-lived immunity with negligible risk of serious adverse reactions. To develop such a vaccine to protect against chikungunya fever, we employed a rational attenuation mechanism that also prevents the infection of mosquito vectors. The internal ribosome entry site (IRES from encephalomyocarditis virus replaced the subgenomic promoter in a cDNA CHIKV clone, thus altering the levels and host-specific mechanism of structural protein gene expression. Testing in both normal outbred and interferon response-defective mice indicated that the new vaccine candidate is highly attenuated, immunogenic and efficacious after a single dose. Furthermore, it is incapable of replicating in mosquito cells or infecting mosquitoes in vivo. This IRES-based attenuation platform technology may be useful for the predictable attenuation of any alphavirus.

  12. Detection of the early keratoconus based on corneal biomechanical properties in the refractive surgery candidates

    Directory of Open Access Journals (Sweden)

    Zofia Pniakowska

    2016-01-01

    Full Text Available Context: Subclinical keratoconus is contraindication to refractive surgery. The currently used methods of preoperative screening do not always allow differentiating between healthy eyes and those with subclinical keratoconus. Aim: To evaluate biomechanical parameters of the cornea, waveform score (WS, and intraocular pressure (IOP as potentially useful adjuncts to the diagnostic algorithm for precise detection of the early keratoconus stages and selection of refractive surgery candidates. Settings and Design: Department of Ophthalmology and prospective cross-sectional study. Patients and Methods: Patients enrolled in the study were diagnosed with refractive disorders. We assessed parameters of corneal biomechanics such as corneal hysteresis (CH, corneal resistance factor (CRF, Goldman-correlated IOP (IOPg, corneal compensated IOP, WS, and keratoconus match index (KMI. They were classified into one of three groups based on the predefined KMI range: Group 1 (from 0.352 to 0.757 – 45 eyes, Group 2 (from −0.08 to 0.313 – 52 eyes, and Group 0 - control group (from 0.761 to 1.642 – 80 eyes. Results: In both study groups, IOPg, CRF, and CH were decreased when compared to control (P < 0.0001. In control group, there was positive correlation between CH and KMI (P < 0.05, with no correlations in any of the two study groups. CRF correlated positively with KMI in control (P < 0.0001 and in Group 2 (P < 0.05. Conclusions: CH and CRF, together with WS and IOPg, consist a clinically useful adjunct to detect subclinical keratoconus in patients referred for refractive surgery when based on KMI staging.

  13. Modular construction of quaternary hemiaminal-based inhibitor candidates and their in cellulo assessment with HIV-1 protease.

    Science.gov (United States)

    Gros, Guillaume; Martinez, Lorena; Gimenez, Anna Servat; Adler, Paula; Maurin, Philippe; Wolkowicz, Roland; Falson, Pierre; Hasserodt, Jens

    2013-09-01

    Non-peptidomimetic drug-like protease inhibitors have potential for circumventing drug resistance. We developed a much-improved synthetic route to our previously reported inhibitor candidate displaying an unusual quaternized hemi-aminal. This functional group forms from a linear precursor upon passage into physiological media. Seven variants were prepared and tested in cellulo with our HIV-1 fusion-protein technology that result in an eGFP-based fluorescent readout. Three candidates showed inhibition potency above 20μM and toxicity at higher concentrations, making them attractive targets for further refinement. Importantly, our class of original inhibitor candidates is not recognized by two major multidrug resistance pumps, quite in contrast to most clinically applied HIV-1 protease inhibitors.

  14. A cell wall protein-based vaccine candidate induce protective immune response against Sporothrix schenckii infection.

    Science.gov (United States)

    Portuondo, Deivys Leandro; Batista-Duharte, Alexander; Ferreira, Lucas Souza; Martínez, Damiana Téllez; Polesi, Marisa Campos; Duarte, Roberta Aparecida; de Paula E Silva, Ana Carolina Alves; Marcos, Caroline Maria; Almeida, Ana Marisa Fusco de; Carlos, Iracilda Zeppone

    2016-02-01

    Sporotrichosis is a subcutaneous mycosis caused by several closely related thermo-dimorphic fungi of the Sporothrix schenckii species complex, affecting humans and other mammals. In the last few years, new strategies have been proposed for controlling sporotrichosis owning to concerns about its growing incidence in humans, cats, and dogs in Brazil, as well as the toxicity and limited efficacy of conventional antifungal drugs. In this study, we assessed the immunogenicity and protective properties of two aluminum hydroxide (AH)-adsorbed S. schenckii cell wall protein (ssCWP)-based vaccine formulations in a mouse model of systemic S. schenckii infection. Fractioning by SDS-PAGE revealed nine protein bands, two of which were functionally characterized: a 44kDa peptide hydrolase and a 47kDa enolase, which was predicted to be an adhesin. Sera from immunized mice recognized the 47kDa enolase and another unidentified 71kDa protein, whereas serum from S. schenckii-infected mice recognized both these proteins plus another unidentified 9.4kDa protein. Furthermore, opsonization with the anti-ssCWP sera led to markedly increased phagocytosis and was able to strongly inhibit the fungus' adhesion to fibroblasts. Immunization with the higher-dose AH-adjuvanted formulation led to increased ex vivo release of IL-12, IFN-γ, IL-4, and IL-17, whereas only IL-12 and IFN-γ were induced by the higher-dose non-adjuvanted formulation. Lastly, passive transference of the higher-dose AH-adjuvanted formulation's anti-ssCWP serum was able to afford in vivo protection in a subsequent challenge with S. schenckii, becoming a viable vaccine candidate for further testing.

  15. A New Strategy Based on Smrho Protein Loaded Chitosan Nanoparticles as a Candidate Oral Vaccine against Schistosomiasis

    OpenAIRE

    Oliveira, Carolina R.; Rezende, Cíntia M. F.; Silva, Marina R.; Ana Paula Pêgo; Olga Borges; Alfredo M. Goes

    2012-01-01

    BACKGROUND: Schistosomiasis is one of the most important neglected tropical diseases and an effective control is unlikely in the absence of improved sanitation and vaccination. A new approach of oral vaccination with alginate coated chitosan nanoparticles appears interesting because their great stability and the ease of target accessibility, besides of chitosan and alginate immunostimulatory properties. Here we propose a candidate vaccine based on the combination of chitosan-based nanoparticl...

  16. Fully Pipelined Parallel Architecture for Candidate Block and Pixel-Subsampling-Based Motion Estimation

    Directory of Open Access Journals (Sweden)

    Reeba Korah

    2008-01-01

    Full Text Available This paper presents a low power and high speed architecture for motion estimation with Candidate Block and Pixel Subsampling (CBPS Algorithm. Coarse-to-fine search approach is employed to find the motion vector so that the local minima problem is totally eliminated. Pixel subsampling is performed in the selected candidate blocks which significantly reduces computational cost with low quality degradation. The architecture developed is a fully pipelined parallel design with 9 processing elements. Two different methods are deployed to reduce the power consumption, parallel and pipelined implementation and parallel accessing to memory. For processing 30 CIF frames per second our architecture requires a clock frequency of 4.5 MHz.

  17. Genetic relationships of some Citrus genotypes based on the candidate iron chlorosis genes

    OpenAIRE

    KAÇAR, Yıldız AKA; Özhan ŞİMŞEK; DÖNMEZ, Dicle; BONCUK, Melda; YEŞİLOĞLU, Turgut; Ollitrault, Patrick

    2014-01-01

    Iron is one of the most important elements in plant mineral nutrition. Fe deficiency is a critical abiotic stress factor for Mediterranean citriculture; the development of marker-assisted selection for this trait would greatly enhance rootstock breeding. In this study, DNA sequencing and single-stranded conformation polymorphism (SSCP) analyses were performed to determine the allelic diversity of genes associated with tolerance to iron chlorosis in citrus. Two candidate iron chlorosis toleran...

  18. Characterization nanoparticles-based vaccines and vaccine candidates: a Transmission Electron Microscopy study

    Directory of Open Access Journals (Sweden)

    I. Menéndez I

    2016-05-01

    Full Text Available Transmission Electron Microscopy (TEM is a valuable tool for the biotech industry. This paper summarizes some of the contributions of MET in the characterization of the recombinant antigens are part of vaccines or vaccine candidates obtained in the CIGB. It mentions the use of complementary techniques MET (Negative staining, and immunoelectron that enhance visualization and ultrastructural characterization of the recombinant proteins obtained by Genetic Engineering.

  19. Identification of Novel Potential Vaccine Candidates against Tuberculosis Based on Reverse Vaccinology

    Directory of Open Access Journals (Sweden)

    Gloria P. Monterrubio-López

    2015-01-01

    Full Text Available Tuberculosis (TB is a chronic infectious disease, considered as the second leading cause of death worldwide, caused by Mycobacterium tuberculosis. The limited efficacy of the bacillus Calmette-Guérin (BCG vaccine against pulmonary TB and the emergence of multidrug-resistant TB warrants the need for more efficacious vaccines. Reverse vaccinology uses the entire proteome of a pathogen to select the best vaccine antigens by in silico approaches. M. tuberculosis H37Rv proteome was analyzed with NERVE (New Enhanced Reverse Vaccinology Environment prediction software to identify potential vaccine targets; these 331 proteins were further analyzed with VaxiJen for the determination of their antigenicity value. Only candidates with values ≥0.5 of antigenicity and 50% of adhesin probability and without homology with human proteins or transmembrane regions were selected, resulting in 73 antigens. These proteins were grouped by families in seven groups and analyzed by amino acid sequence alignments, selecting 16 representative proteins. For each candidate, a search of the literature and protein analysis with different bioinformatics tools, as well as a simulation of the immune response, was conducted. Finally, we selected six novel vaccine candidates, EsxL, PE26, PPE65, PE_PGRS49, PBP1, and Erp, from M. tuberculosis that can be used to improve or design new TB vaccines.

  20. Identification of Novel Potential Vaccine Candidates against Tuberculosis Based on Reverse Vaccinology.

    Science.gov (United States)

    Monterrubio-López, Gloria P; González-Y-Merchand, Jorge A; Ribas-Aparicio, Rosa María

    2015-01-01

    Tuberculosis (TB) is a chronic infectious disease, considered as the second leading cause of death worldwide, caused by Mycobacterium tuberculosis. The limited efficacy of the bacillus Calmette-Guérin (BCG) vaccine against pulmonary TB and the emergence of multidrug-resistant TB warrants the need for more efficacious vaccines. Reverse vaccinology uses the entire proteome of a pathogen to select the best vaccine antigens by in silico approaches. M. tuberculosis H37Rv proteome was analyzed with NERVE (New Enhanced Reverse Vaccinology Environment) prediction software to identify potential vaccine targets; these 331 proteins were further analyzed with VaxiJen for the determination of their antigenicity value. Only candidates with values ≥0.5 of antigenicity and 50% of adhesin probability and without homology with human proteins or transmembrane regions were selected, resulting in 73 antigens. These proteins were grouped by families in seven groups and analyzed by amino acid sequence alignments, selecting 16 representative proteins. For each candidate, a search of the literature and protein analysis with different bioinformatics tools, as well as a simulation of the immune response, was conducted. Finally, we selected six novel vaccine candidates, EsxL, PE26, PPE65, PE_PGRS49, PBP1, and Erp, from M. tuberculosis that can be used to improve or design new TB vaccines.

  1. Phylogeography, Salinity Adaptations and Metabolic Potential of the Candidate Division KB1 Bacteria Based on a Partial Single Cell Genome.

    Science.gov (United States)

    Nigro, Lisa M; Hyde, Andrew S; MacGregor, Barbara J; Teske, Andreas

    2016-01-01

    Deep-sea hypersaline anoxic basins and other hypersaline environments contain abundant and diverse microbial life that has adapted to these extreme conditions. The bacterial Candidate Division KB1 represents one of several uncultured groups that have been consistently observed in hypersaline microbial diversity studies. Here we report the phylogeography of KB1, its phylogenetic relationships to Candidate Division OP1 Bacteria, and its potential metabolic and osmotic stress adaptations based on a partial single cell amplified genome of KB1 from Orca Basin, the largest hypersaline seafloor brine basin in the Gulf of Mexico. Our results are consistent with the hypothesis - previously developed based on (14)C incorporation experiments with mixed-species enrichments from Mediterranean seafloor brines - that KB1 has adapted its proteins to elevated intracellular salinity, but at the same time KB1 apparently imports glycine betaine; this compatible solute is potentially not limited to osmoregulation but could also serve as a carbon and energy source. PMID:27597842

  2. Prime candidate earth targets for the post-launch radiometric calibration of space-based optical imaging instruments

    Science.gov (United States)

    Teillet, P.M.; Barsi, J.A.; Chander, G.; Thome, K.J.

    2007-01-01

    This paper provides a comprehensive list of prime candidate terrestrial targets for consideration as benchmark sites for the post-launch radiometric calibration of space-based instruments. The key characteristics of suitable sites are outlined primarily with respect to selection criteria, spatial uniformity, and temporal stability. The establishment and utilization of such benchmark sites is considered an important element of the radiometric traceability of satellite image data products for use in the accurate monitoring of environmental change.

  3. Double layer structure-based virtual screening reveals 3'-Hydroxy-A-Naphthoflavone as novel inhibitor candidate of human acetylcholinesterase

    Science.gov (United States)

    Ichsan, Mochammad; Pangastuti, Ardini; Habibi, Mohammad Wildan; Juliana, Kartika

    2016-03-01

    One of the most effective target for Alzheimer's disease's (AD) treatment is the inhibition of human acetylcholinesterase (hAChE) eventhough it has many side effects. So that, this study was aimed to discover a new candidate of hAChE's inhibitor that has more negative binding affinity than existing drugs. hAChE's 3D model used in this study has a good quality according to its number of residues in most favoured regions (92%), three bad contacts, >50 ERRAT's score (85,870) and successfully passed the VERIFY 3D threshold (>80%). Based on the first layer of SBVS againts more than 12.180.630 ligands, we discovered 11.806 hits and then we found 359 hits from the second layer of SBVS. Based on our previous steps, we found that 3'-Hydroxy-a-Naphthoflavone was the only one candidate, that directly interacted with Trp286 via hydrogen bond and hydrophobic interactions and also has the most negative binding affinity (-10,6 kcal/mol) and also has more negative than existing hAChE's inhibitors, such as tacrine, donepezil, etc. 3'-Hydroxy-a-Naphthoflavone is the best candidate of hAChE's inhibitor based on its binding affinity (-10,6 kcal/mol) that is more negative than existing hAChE's inhibitors, such as tacrine, donepezil, etc.

  4. Establishing a Th17 based mouse model for preclinical assessment of the toxicity of candidate microbicides

    Institute of Scientific and Technical Information of China (English)

    LI Liang-zhu; YANG Yu; YUAN Song-hua; WAN Yan-min; QIU Chao; FENG Yan-ling; XU Jian-qing; ZHANG Xiao-yan

    2010-01-01

    one mouse (score: 8), which were significantly associated with both inflammatory cytokines IL-17A and IL-6 and anti-inflammatory cytokines IL-4 and IL-10. Interestingly, IL-17A showed significant positive association with inflammatory cytokine TNF-α (r=0.739; P <0.05), anti-inflammatory cytokines IL-10 (r=0.804; P <0.01) and IL-4 (r=0.668; P <0.05).Conclusions Our data demonstrate that a panel of cytokines (IL-17A, IL-6, IL-4 and IL-10) could be used as surrogate biomarkers to predict the histopathological damage. Th17 may play a central role in orchestrating inflammatory cytokine responses. This Th17 based mouse model is cost-effective and suitable to assess the toxicity of candidate microbicides in preclinical studies.

  5. A PSF-based approach to Kepler/K2 data. II. Exoplanet candidates in Praesepe (M 44)

    CERN Document Server

    Libralato, M; Bedin, L R; Borsato, L; Granata, V; Malavolta, L; Piotto, G; Ochner, P; Cunial, A; Nascimbeni, V

    2016-01-01

    In this work we keep pushing K2 data to a high photometric precision, close to that of the Kepler main mission, using a PSF-based, neighbour-subtraction technique, which also overcome the dilution effects in crowded environments. We analyse the open cluster M 44 (NGC 2632), observed during the K2 Campaign 5, and extract light curves of stars imaged on module 14, where most of the cluster lies. We present two candidate exoplanets hosted by cluster members and five by field stars. As a by-product of our investigation, we find 1680 eclipsing binaries and variable stars, 1071 of which are new discoveries. Among them, we report the presence of a heartbeat binary star. Together with this work, we release to the community a catalogue with the variable stars and the candidate exoplanets found, as well as all our raw and detrended light curves.

  6. Candidate evaluation system: Documentation of the data base design and application software for the prototype expert support system

    Energy Technology Data Exchange (ETDEWEB)

    Arnold, H.G.; Loffman, R.S.; Sexton, F.L.; Rush, R.M.

    1988-06-01

    The US Department of the Army established the Candidate Evaluation Prototype Project, Project Management Office to analyze the current procedure for filing Army civilian jobs and to develop improved automated procedures to meet this need. The Army Civilian Personnel Center (now the Civilian Information Directorate) tasked The Oak Ridge National Laboratory (ORNL) to provide technical support, research, and development to the Project Management Office and deliver a prototype of a Candidate Evaluation System that would run on the minicomputer hardware and software being delivered to personnel offices located throughout the world. This report discusses the background of the project, including constraints and requirements; describes the data base design and program code developed to implement the prototype; documents known limitations of the prototype; and contains recommendations to be considered in future development. The objective of this report is to document the prototype software system for use by Army programmers/analysts who will maintain or further develop the prototype software.

  7. A PSF-based approach to Kepler/K2 data. II. Exoplanet candidates in Praesepe (M 44)

    Science.gov (United States)

    Libralato, M.; Nardiello, D.; Bedin, L. R.; Borsato, L.; Granata, V.; Malavolta, L.; Piotto, G.; Ochner, P.; Cunial, A.; Nascimbeni, V.

    2016-08-01

    In this work we keep pushing K2 data to a high photometric precision, close to that of the Kepler main mission, using a PSF-based, neighbour-subtraction technique, which also overcome the dilution effects in crowded environments. We analyse the open cluster M 44 (NGC 2632), observed during the K2 Campaign 5, and extract light curves of stars imaged on module 14, where most of the cluster lies. We present two candidate exoplanets hosted by cluster members and five by field stars. As a by-product of our investigation, we find 1680 eclipsing binaries and variable stars, 1071 of which are new discoveries. Among them, we report the presence of a heartbeat binary star. Together with this work, we release to the community a catalogue with the variable stars and the candidate exoplanets found, as well as all our raw and detrended light curves.

  8. Globular clusters hosting intermediate-mass black-holes: no mass-segregation based candidates

    CERN Document Server

    Pasquato, Mario; Sohn, Bong Won; Lee, Young-Wook

    2016-01-01

    Recently, both stellar mass-segregation and binary-fractions were uniformly measured on relatively large samples of Galactic Globular Clusters (GCs). Simulations show that both sizeable binary-star populations and Intermediate-Mass Black Holes (IMBHs) quench mass-segregation in relaxed GCs. Thus mass-segregation in GCs with a reliable binary-fraction measurement is a valuable probe to constrain IMBHs. In this paper we combine mass-segregation and binary-fraction measurements from the literature to build a sample of 33 GCs (with measured core-binary fractions), and a sample of 43 GCs (with a binary fraction measurement in the area between the core radius and the half-mass radius). Within both samples we try to identify IMBH-host candidates. These should have relatively low mass-segregation, a low binary fraction (< 5%), and short (< 1 Gyr) relaxation time. Considering the core binary fraction sample, no suitable candidates emerge. If the binary fraction between the core and the half-mass radius is consid...

  9. Investigations into the Antibacterial Activity of the Silver-Based Antibiotic Drug Candidate SBC3

    Directory of Open Access Journals (Sweden)

    Matthias Tacke

    2012-11-01

    Full Text Available The synthesis of N-heterocyclic carbene (NHC silver(I acetate complexes with varying lipophilic benzyl-substituents at the 1 and 3 positions starting from 4,5-diphenylimidazole, opened a new class of antibiotic drug candidates. These NHC-silver(I acetate derivatives exhibit interesting structural motifs in the solid state and proved to be soluble and stable in biological media. The leading candidate, SBC3, which was known to exhibit good antibacterial activity in preliminary Kirby-Bauer tests, was tested quantitatively using minimum inhibitory concentrations. NHC-silver(I acetate complexes were found to have MIC values ranging from 20 to 3.13 μg/mL for a variety of Gram-positive, Gram-negative and mycobacteria tested. These values represent good antibiotic activities against potential pathogens when compared to clinically approved antibiotics. Most striking is the fact that SBC3 is active against methicillin-resistant Staphylococcus aureus with a MIC value of 12.5 μg/mL.

  10. Imputation-based analysis of association studies: candidate regions and quantitative traits.

    Directory of Open Access Journals (Sweden)

    Bertrand Servin

    2007-07-01

    Full Text Available We introduce a new framework for the analysis of association studies, designed to allow untyped variants to be more effectively and directly tested for association with a phenotype. The idea is to combine knowledge on patterns of correlation among SNPs (e.g., from the International HapMap project or resequencing data in a candidate region of interest with genotype data at tag SNPs collected on a phenotyped study sample, to estimate ("impute" unmeasured genotypes, and then assess association between the phenotype and these estimated genotypes. Compared with standard single-SNP tests, this approach results in increased power to detect association, even in cases in which the causal variant is typed, with the greatest gain occurring when multiple causal variants are present. It also provides more interpretable explanations for observed associations, including assessing, for each SNP, the strength of the evidence that it (rather than another correlated SNP is causal. Although we focus on association studies with quantitative phenotype and a relatively restricted region (e.g., a candidate gene, the framework is applicable and computationally practical for whole genome association studies. Methods described here are implemented in a software package, Bim-Bam, available from the Stephens Lab website http://stephenslab.uchicago.edu/software.html.

  11. Globular Clusters Hosting Intermediate-Mass Black Holes: No Mass-Segregation Based Candidates

    Science.gov (United States)

    Pasquato, Mario; Miocchi, Paolo; Won, Sohn Bong; Lee, Young-Wook

    2016-06-01

    Recently, both stellar mass segregation and binary fractions were uniformly measured on relatively large samples of Galactic globular clusters (GCs). Simulations show that both sizable binary-star populations and intermediate-mass black holes (IMBHs) quench mass segregation in relaxed GCs. Thus mass segregation in GCs with a reliable binary-fraction measurement is a valuable probe to constrain IMBHs. In this paper we combine mass-segregation and binary-fraction measurements from the literature to build a sample of 33 GCs (with measured core binary fractions), and a sample of 43 GCs (with binary-fraction measurements in the area between the core radius and the half-mass radius). Within both samples we try to identify IMBH-host candidates. These should have relatively low mass segregation, a low binary fraction (segregated (and show a larger binary fraction), confirming the theoretical expectation that the energy sources responsible for the large core are also quenching mass segregation.

  12. Old and Unemployable? How Age‐Based Stereotypes Affect Willingness to Hire Job Candidates

    Science.gov (United States)

    Swift, Hannah J.; Drury, Lisbeth

    2016-01-01

    Across the world, people are required, or want, to work until an increasingly old age. But how might prospective employers view job applicants who have skills and qualities that they associate with older adults? This article draws on social role theory, age stereotypes and research on hiring biases, and reports three studies using age‐diverse North American participants. These studies reveal that: (1) positive older age stereotype characteristics are viewed less favorably as criteria for job hire, (2) even when the job role is low‐status, a younger stereotype profile tends to be preferred, and (3) an older stereotype profile is only considered hirable when the role is explicitly cast as subordinate to that of a candidate with a younger age profile. Implications for age‐positive selection procedures and ways to reduce the impact of implicit age biases are discussed. PMID:27635102

  13. Candidate lesion-based criteria for defining a positive sacroiliac joint MRI in two cohorts of patients with axial spondyloarthritis

    DEFF Research Database (Denmark)

    Weber, Ulrich; Østergaard, Mikkel; Lambert, Robert G W;

    2015-01-01

    OBJECTIVE: To determine candidate lesion-based criteria for a positive sacroiliac joint (SIJ) MRI based on bone marrow oedema (BMO) and/or erosion in non-radiographic axial spondyloarthritis (nr-axSpA); to compare the performance of lesion-based criteria with global evaluation by expert readers...... clinical examination, pelvic radiography and laboratory values as having nr-axSpA (n=51), ankylosing spondylitis (n=34) or non-specific back pain (n=72). Four blinded readers assessed SIJ MRI, recording the presence/absence of SpA by concomitant global evaluation of T1-weighted spin echo (T1SE) and short τ...... inversion recovery (STIR) scans and, thereafter, whether BMO and/or erosion were present/absent in each SIJ quadrant of each MRI slice. We derived candidate lesion-based criteria based on the number of SIJ quadrants with BMO and/or erosion and calculated mean sensitivity and specificity for SpA. RESULTS...

  14. The (w)hole survey: An unbiased sample study of transition disk candidates based on Spitzer catalogs

    Science.gov (United States)

    van der Marel, N.; Verhaar, B. W.; van Terwisga, S.; Merín, B.; Herczeg, G.; Ligterink, N. F. W.; van Dishoeck, E. F.

    2016-08-01

    Understanding disk evolution and dissipation is essential for studies of planet formation. Transition disks, i.e., disks with large dust cavities and gaps, are promising candidates of active evolution. About two dozen candidates, selected by their spectral energy distribution (SED), have been confirmed to have dust cavities through millimeter interferometric imaging, but this sample is biased toward the brightest disks. The Spitzer surveys of nearby low-mass star-forming regions have resulted in more than 4000 young stellar objects. Using color criteria, we selected a sample of ~150 candidates and an additional 40 candidates and known transition disks from the literature. The Spitzer data were complemented by new observations at longer wavelengths, including new JCMT and APEX submillimeter photometry, and WISE and Herschel-PACS mid- and far-infrared photometry. Furthermore, optical spectroscopy was obtained and stellar types were derived for 85% of the sample, including information from the literature. The SEDs were fit to a grid of RADMC-3D disk models with a limited number of parameters: disk mass, inner disk mass, scale height and flaring, and disk cavity radius, where the latter is the main parameter of interest. About 72% of our targets possibly have dust cavities based on the SED. The derived cavity sizes are consistent with imaging/modeling results in the literature, where available. Trends are found with Ldisk over L∗ ratio and stellar mass and a possible connection with exoplanet orbital radii. A comparison with a previous study where color observables are used reveals large overlap between their category of planet-forming disks and our transition disks with cavities. A large number of the new transition disk candidates are suitable for follow-up observations with ALMA. Full Tables 4, 5, A.1-A.3, C.1, and D.1 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc

  15. Improving low-level plasma protein mass spectrometry-based detection for candidate biomarker discovery and validation

    Energy Technology Data Exchange (ETDEWEB)

    Page, Jason S.; Kelly, Ryan T.; Camp, David G.; Smith, Richard D.

    2008-09-01

    Methods. To improve the detection of low abundance protein candidate biomarker discovery and validation, particularly in complex biological fluids such as blood plasma, increased sensitivity is desired using mass spectrometry (MS)-based instrumentation. A key current limitation on the sensitivity of electrospray ionization (ESI) MS is due to the fact that many sample molecules in solution are never ionized, and the vast majority of the ions that are created are lost during transmission from atmospheric pressure to the low pressure region of the mass analyzer. Two key technologies, multi-nanoelectrospray emitters and the electrodynamic ion funnel have recently been developed and refined at Pacific Northwest National Laboratory (PNNL) to greatly improve the ionization and transmission efficiency of ESI MS based analyses. Multi-emitter based ESI enables the flow from a single source (typically a liquid chromatography [LC] column) to be divided among an array of emitters (Figure 1). The flow rate delivered to each emitter is thus reduced, allowing the well-documented benefits of nanoelectrospray 1 for both sensitivity and quantitation to be realized for higher flow rate separations. To complement the increased ionization efficiency afforded by multi-ESI, tandem electrodynamic ion funnels have also been developed at PNNL, and shown to greatly improve ion transmission efficiency in the ion source interface.2, 3 These technologies have been integrated into a triple quadrupole mass spectrometer for multiple reaction monitoring (MRM) of probable biomarker candidates in blood plasma and show promise for the identification of new species even at low level concentrations.

  16. Identification of candidate target genes of pituitary adenomas based on the DNA microarray.

    Science.gov (United States)

    Zhou, Wei; Ma, Chun-Xiao; Xing, Ya-Zhou; Yan, Zhao-Yue

    2016-03-01

    The present study aimed to explore molecular mechanisms involved in pituitary adenomas (PAs) and to discover target genes for their treatment. The gene expression profile GSE4488 was downloaded from the Gene Expression Omnibus database. Differentially expressed genes (DEGs) were identified using the Limma package and analyzed by two‑dimensional hierarchical clustering. Gene ontology (GO) and pathway enrichment analyses were performed in order to investigate the functions of DEGs. Subsequently, the protein‑protein interaction (PPI) network was constructed using Cytoscape software. DEGs were then mapped to the connectivity map database to identify molecular agents associated with the underlying mechanisms of PAs. A total of 340 upregulated and 49 downregulated DEGs in PA samples compared with those in normal controls were identified. Hierarchical clustering analysis showed that DEGs were highly differentially expressed, indicating their aptness for distinguishing PA samples from normal controls. Significant gene ontology terms were positive regulation of immune system-associated processes for downregulated DEGs and skeletal system development for upregulated DEGs. Pathways significantly enriched by DEGs included extracellular matrix (ECM)‑receptor interaction, the Hedgehog (Hh) signaling pathway and neuroactive ligand‑receptor interaction. The PPI network was constructed with 117 nodes, 123 edges and CD44 and Gli2 as hub nodes. Furthermore, depudecin, a small molecule drug, was identified to be mechanistically associated with PA. The genes CD44 and Gli2 have important roles in the progression of PAs via ECM‑receptor interaction and the Hh signaling pathway and are therefore potential target genes of PA. In addition, depudecin may be a candidate drug for the treatment of PAs. PMID:26782791

  17. Phylogeography, salinity adaptations and metabolic potential of the Candidate Division KB1 Bacteria based on a partial single cell genome.

    Directory of Open Access Journals (Sweden)

    Lisa M Nigro

    2016-08-01

    Full Text Available Deep-sea hypersaline anoxic basins (DHABs and other hypersaline environments contain abundant and diverse microbial life that has adapted to these extreme conditions. The bacterial Candidate Division KB1 represents one of several uncultured groups that has been consistently observed in hypersaline microbial diversity studies. Here we report the phylogeography of KB1, its phylogenetic relationships to Candidate Division OP1 Bacteria, and its potential metabolic and osmotic stress adaptations based on a partial single cell amplified genome (SAG of KB1 from Orca Basin, the largest hypersaline seafloor brine basin in the Gulf of Mexico. Our results are consistent with the hypothesis – previously developed based on 14C incorporation experiments with mixed-species enrichments from Mediterranean seafloor brines - that KB1 has adapted its proteins to elevated intracellular salinity, but at the same time KB1 apparently imports glycine betaine; this compatible solute is potentially not limited to osmoregulation but could also serve as a carbon and energy source.

  18. Recognition-Based Pedagogy: Teacher Candidates' Experience of Deficit

    Science.gov (United States)

    Parkison, Paul T.; DaoJensen, Thuy

    2014-01-01

    This study seeks to introduce what we call "recognition-based pedagogy" as a conceptual frame through which teachers and instructors can collaboratively develop educative experiences with students. Recognition-based pedagogy connects the theories of critical pedagogy, identity politics, and the politics of recognition with the educative…

  19. Thermally induced degradation pathways of three different antibody-based drug development candidates.

    Science.gov (United States)

    Fincke, Anja; Winter, Jonas; Bunte, Thomas; Olbrich, Carsten

    2014-10-01

    Protein-based medicinal products are prone to undergo a variety of chemical and physical degradation pathways. One of the most important exogenous stress condition to consider during manufacturing, transport and storage processes is temperature, because antibody-based therapeutics are only stable in a limited temperature range. In this study, three different formats of antibody-based molecules (IgG1, a bispecific scFv and a fab fragment) were exposed to thermal stress conditions occurring during transport and storage. For evaluation, an analytical platform was developed for the detection and characterization of relevant degradation pathways of different antibody-based therapeutics. The effect of thermal stress conditions on the stability of the three antibody-based formats was therefore investigated using visual inspection, different spectroscopic measurements, dynamic light scattering (DLS), differential scanning calorimetry (DSC), electrophoresis, asymmetric flow field-flow fractionation (AF4) and surface plasmon resonance technology (SPR). In summary, thermal stress led to heterogeneous chemical and physical degradation pathways of all three antibody-based formats used. In addition, identical exogenous stress conditions resulted in different kinds and levels of aggregates and fragmentation products. This knowledge is fundamental for a systematic and successful stabilization of protein-based therapeutics by the use of formulation additives.

  20. Evaluation of Candidate Measures for Home-Based Screening of Sleep Disordered Breathing in Taiwanese Bus Drivers

    Directory of Open Access Journals (Sweden)

    Hua Ting

    2014-05-01

    Full Text Available Background: Sleepiness-at-the-wheel has been identified as a major cause of highway accidents. The aim of our study is identifying the candidate measures for home-based screening of sleep disordered breathing in Taiwanese bus drivers, instead of polysomnography. Methods: Overnight polysomnography accompanied with simultaneous measurements of alternative screening devices (pulse oximetry, ApneaLink, and Actigraphy, heart rate variability, wake-up systolic blood pressure and questionnaires were completed by 151 eligible participants who were long-haul bus drivers with a duty period of more than 12 h a day and duty shifting. Results: 63.6% of professional bus drivers were diagnosed as having sleep disordered breathing and had a higher body mass index, neck circumference, systolic blood pressure, arousal index and desaturation index than those professional bus drivers without evidence of sleep disordered breathing. Simple home-based candidate measures: (1 Pulse oximetry, oxygen-desaturation indices by ≥3% and 4% (r = 0.87~0.92; (2 Pulse oximetry, pulse-rising indices by ≥7% and 8% from a baseline (r = 0.61~0.89; and (3 ApneaLink airflow detection, apnea-hypopnea indices (r = 0.70~0.70, based on recording-time or Actigraphy-corrected total sleep time were all significantly correlated with, and had high agreement with, corresponding polysomnographic apnea-hypopnea indices [(1 94.5%~96.6%, (2 93.8%~97.2%, (3 91.1%~91.3%, respectively]. Conversely, no validities of SDB screening were found in the multi-variables apnea prediction questionnaire, Epworth Sleepiness Scale, night-sleep heart rate variability, wake-up systolic blood pressure and anthropometric variables. Conclusions: The indices of pulse oximetry and apnea flow detection are eligible criteria for home-based screening of sleep disordered breathing, specifically for professional drivers.

  1. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    Energy Technology Data Exchange (ETDEWEB)

    Li-Puma, Antonella, E-mail: antonella.lipuma@cea.fr [CEA, DEN, Saclay, DM2S, SERMA, F-91191 Gif-sur-Yvette (France); Richou, Marianne; Magaud, Philippe; Missirlian, Marc [CEA, IRFM, F-13108 Saint Paul Lez Durance (France); Visca, Eliseo [Associazione EURATOM-ENEA sulla Fusione, C.R. Frascati, IT-00044 Frascati (Italy); Ridolfini, Vincenzo Pericoli [EFDA-CSU Garching, PPPT department, D-85748 Garching bei München (Germany)

    2013-10-15

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities.

  2. Potential and limits of water cooled divertor concepts based on monoblock design as possible candidates for a DEMO reactor

    International Nuclear Information System (INIS)

    In this paper water-cooled divertor concepts based on tungsten monoblock design identified in previous studies as candidate for fusion power plant have been reviewed to assess their potential and limits as possible candidates for a DEMO concept deliverable in a short to medium term (“conservative baseline design”). The rationale and technology development assumptions that have led to their selection are revisited taking into account present factual information on reactor parameters, materials properties and manufacturing technologies. For that purpose, main parameters impacting the divertor design are identified and their relevance discussed. The state of the art knowledge on materials and relevant manufacturing techniques is reviewed. Particular attention is paid to material properties change after irradiation; phenomenon thresholds (if any) and possible operating ranges are identified (in terms of temperature and damage dose). The suitability of various proposed heat sink/structural and sacrificial layer materials, as proposed in the past, are re-assessed (e.g. with regard to the possibility of reducing peak heat flux and/or neutron radiation damages). As a result, potential and limits of various proposed concepts are highlighted, ranges in which they could operate (if any) defined and possible improvements are proposed. Identified missing point in materials database and/or manufacturing techniques knowledge that should be uppermost investigated in future R and D activities are reported. This work has been carried out in the frame of EFDA PPPT Work Programme activities

  3. Problem-Based Learning in the Educational Psychology Classroom: Bahraini Teacher Candidates' Experience

    Science.gov (United States)

    Razzak, Nina Abdul

    2012-01-01

    There was a concern from faculty at Bahrain Teachers' College that undergraduate Bahraini students lack the necessary competencies needed for success in educational contexts that are conducive to active, student-centered learning. It was decided that the students be introduced to a problem-based learning (PBL) strategy in one of their educational…

  4. Amplicon-based metagenomics identified candidate organisms in soils that caused yield decline in strawberry.

    Science.gov (United States)

    Xu, Xiangming; Passey, Thomas; Wei, Feng; Saville, Robert; Harrison, Richard J

    2015-01-01

    A phenomenon of yield decline due to weak plant growth in strawberry was recently observed in non-chemo-fumigated soils, which was not associated with the soil fungal pathogen Verticillium dahliae, the main target of fumigation. Amplicon-based metagenomics was used to profile soil microbiota in order to identify microbial organisms that may have caused the yield decline. A total of 36 soil samples were obtained in 2013 and 2014 from four sites for metagenomic studies; two of the four sites had a yield-decline problem, the other two did not. More than 2000 fungal or bacterial operational taxonomy units (OTUs) were found in these samples. Relative abundance of individual OTUs was statistically compared for differences between samples from sites with or without yield decline. A total of 721 individual comparisons were statistically significant - involving 366 unique bacterial and 44 unique fungal OTUs. Based on further selection criteria, we focused on 34 bacterial and 17 fungal OTUs and found that yield decline resulted probably from one or more of the following four factors: (1) low abundance of Bacillus and Pseudomonas populations, which are well known for their ability of supressing pathogen development and/or promoting plant growth; (2) lack of the nematophagous fungus (Paecilomyces species); (3) a high level of two non-specific fungal root rot pathogens; and (4) wet soil conditions. This study demonstrated the usefulness of an amplicon-based metagenomics approach to profile soil microbiota and to detect differential abundance in microbes. PMID:26504572

  5. Conservation analysis of dengue virust-cell epitope-based vaccine candidates using peptide block entropy

    DEFF Research Database (Denmark)

    Olsen, Lars Rønn; Zhang, Guang Lan; Keskin, Derin B.;

    2011-01-01

    Broad coverage of the pathogen population is particularly important when designing CD8+ T-cell epitope vaccines against viral pathogens. Traditional approaches are based on combinations of highly conserved T-cell epitopes. Peptide block entropy analysis is a novel approach for assembling sets....... In contrast, the benchmark study by Khan et al. (2008) resulted in 165 conserved 9-mer peptides. Many of the conserved blocks are located consecutively in the proteins. Connecting these blocks resulted in 78 conserved regions. Of the 1551 blocks of 9-mer peptides 110 comprised predicted HLA binder sets...

  6. Amplicon-based metagenomics identified candidate organisms in soils that caused yield decline in strawberry

    OpenAIRE

    Xiangming Xu; Thomas Passey; Feng Wei; Robert Saville; Harrison, Richard J.

    2015-01-01

    A phenomenon of yield decline due to weak plant growth in strawberry was recently observed in non-chemo-fumigated soils, which was not associated with the soil fungal pathogen Verticillium dahliae, the main target of fumigation. Amplicon-based metagenomics was used to profile soil microbiota in order to identify microbial organisms that may have caused the yield decline. A total of 36 soil samples were obtained in 2013 and 2014 from four sites for metagenomic studies; two of the four sites ha...

  7. Discovery and characterization of antibody variants using mass spectrometry-based comparative analysis for biosimilar candidates of monoclonal antibody drugs.

    Science.gov (United States)

    Li, Wenhua; Yang, Bin; Zhou, Dongmei; Xu, Jun; Ke, Zhi; Suen, Wen-Chen

    2016-07-01

    Liquid chromatography mass spectrometry (LC-MS) is the most commonly used technique for the characterization of antibody variants. MAb-X and mAb-Y are two approved IgG1 subtype monoclonal antibody drugs recombinantly produced in Chinese hamster ovary (CHO) cells. We report here that two unexpected and rare antibody variants have been discovered during cell culture process development of biosimilars for these two approved drugs through intact mass analysis. We then used comprehensive mass spectrometry-based comparative analysis including reduced light, heavy chains, and domain-specific mass as well as peptide mapping analysis to fully characterize the observed antibody variants. The "middle-up" mass comparative analysis demonstrated that the antibody variant from mAb-X biosimilar candidate was caused by mass variation of antibody crystalline fragment (Fc), whereas a different variant with mass variation in antibody antigen-binding fragment (Fab) from mAb-Y biosimilar candidate was identified. Endoproteinase Lys-C digested peptide mapping and tandem mass spectrometry analysis further revealed that a leucine to glutamine change in N-terminal 402 site of heavy chain was responsible for the generation of mAb-X antibody variant. Lys-C and trypsin coupled non-reduced and reduced peptide mapping comparative analysis showed that the formation of the light-heavy interchain trisulfide bond resulted in the mAb-Y antibody variant. These two cases confirmed that mass spectrometry-based comparative analysis plays a critical role for the characterization of monoclonal antibody variants, and biosimilar developers should start with a comprehensive structural assessment and comparative analysis to decrease the risk of the process development for biosimilars. PMID:27214604

  8. Study of pose and expression variant face recognition based on Candide-3 model%基于Candide-3模型的姿态表情人脸识别研究

    Institute of Scientific and Technical Information of China (English)

    杜杏菁; 白廷柱; 何玉青

    2012-01-01

    针对姿态表情严重影响人脸识别准确率的问题,基于Candide-3模型的简化,提出了形状表情关键点拟合的人脸几何结构重建和基于三角网格模型的纹理映射的方法,该方法确定关键特征点,根据人脸的几何结构信息确定姿态角,提取Candide-3模型形状表情对应点,调整模型参数,进行几何结构重建;对几何结构中每个三角网格模型进行纹理影射,得到逼真的特定人脸模型.实验结果表明,该方法提高了人脸重建速度,达到减弱姿态表情对人脸识别影响的目的.%For pose and expressions seriously affecting to the accuracy of face recognition, based on the Candide-3 model, a method of pose and expression key points fitting to reconstruct face geometry and texture mapping based on Triangular mesh model are proposed. First the eyes, nose, mouth feature points are determined according to the face geometry information, then the pose angle are determined, facial expressions corresponding points are extracted with Candide-3 model , the model parameters are adjusted to make structural reconstruction, then texture mapping of each triangle mesh in the geometry are completed to obtain specific 3D face reconstruction model. Experiment shows that the method improve the speed of 3D face reconstruction and the effect of pose and expression variant to face recognition is reduced.

  9. A malaria diagnostic tool based on computer vision screening and visualization of Plasmodium falciparum candidate areas in digitized blood smears.

    Directory of Open Access Journals (Sweden)

    Nina Linder

    Full Text Available INTRODUCTION: Microscopy is the gold standard for diagnosis of malaria, however, manual evaluation of blood films is highly dependent on skilled personnel in a time-consuming, error-prone and repetitive process. In this study we propose a method using computer vision detection and visualization of only the diagnostically most relevant sample regions in digitized blood smears. METHODS: Giemsa-stained thin blood films with P. falciparum ring-stage trophozoites (n = 27 and uninfected controls (n = 20 were digitally scanned with an oil immersion objective (0.1 µm/pixel to capture approximately 50,000 erythrocytes per sample. Parasite candidate regions were identified based on color and object size, followed by extraction of image features (local binary patterns, local contrast and Scale-invariant feature transform descriptors used as input to a support vector machine classifier. The classifier was trained on digital slides from ten patients and validated on six samples. RESULTS: The diagnostic accuracy was tested on 31 samples (19 infected and 12 controls. From each digitized area of a blood smear, a panel with the 128 most probable parasite candidate regions was generated. Two expert microscopists were asked to visually inspect the panel on a tablet computer and to judge whether the patient was infected with P. falciparum. The method achieved a diagnostic sensitivity and specificity of 95% and 100% as well as 90% and 100% for the two readers respectively using the diagnostic tool. Parasitemia was separately calculated by the automated system and the correlation coefficient between manual and automated parasitemia counts was 0.97. CONCLUSION: We developed a decision support system for detecting malaria parasites using a computer vision algorithm combined with visualization of sample areas with the highest probability of malaria infection. The system provides a novel method for blood smear screening with a significantly reduced need for

  10. Recombinant vesicular stomatitis virus-based dengue-2 vaccine candidate induces humoral response and protects mice against lethal infection.

    Science.gov (United States)

    Lauretti, Flavio; Chattopadhyay, Anasuya; de Oliveira França, Rafael Freitas; Castro-Jorge, Luiza; Rose, John; Fonseca, Benedito A L da

    2016-09-01

    Dengue is the most important arbovirus disease throughout the world and it is responsible for more than 500,000 dengue hemorrhagic cases and 22,000 deaths every year. One vaccine was recently licensed for human use in Brazil, Mexico and Philippines and although at least seven candidates have been in clinical trials the results of the most developed CYD vaccine have demonstrated immunization problems, such as uneven protection and interference between serotypes. We constructed a vaccine candidate based on vesicular stomatitis virus (VSV) expression of pre-membrane (prM) and envelope (E) proteins of dengue-2 virus (DENV-2) and tested it in mice to evaluate immunogenicity and protection against DENV-2 infection. VSV has been successfully used as vaccine vectors for several viruses to induce strong humoral and cellular immune responses. The VSV-DENV-2 recombinant was constructed by inserting the DENV-2 structural proteins into a VSV plasmid DNA for recombinant VSV-DENV-2 recovery. Infectious recombinant VSV viruses were plaque purified and prM and E expression were confirmed by immunofluorescence and radiolabeling of proteins of infected cells. Forty Balb/C mice were inoculated through subcutaneous (s.c.) route with VSV-DENV-2 vaccine in a two doses schedule 15 d apart and 29 d after first inoculation, sera were collected and the mice were challenged with 50 lethal doses (LD50) of a neurovirulent DENV-2. The VSV-DENV-2 induced anti-DENV-2 antibodies and protected animals in the challenge experiment comparable to DENV-2 immunization control group. We conclude that VSV is a promising platform to test as a DENV vaccine and perhaps against others Flaviviridae.

  11. Losing on all fronts: the effects of negative versus positive person-based campaigns on implicit and explicit evaluations of political candidates.

    Science.gov (United States)

    Carraro, Luciana; Gawronski, Bertram; Castelli, Luigi

    2010-09-01

    The current research investigated the effects of negative as compared to positive person-based political campaigns on explicit and implicit evaluations of the involved candidates. Participants were presented with two political candidates and statements that one of them ostensibly said during the last political campaign. For half of the participants, the campaign included positive remarks about the source of the statement (positive campaign); for the remaining half, the campaign included negative remarks about the opponent (negative campaign). Afterwards, participants completed measures of explicit and implicit evaluations of both candidates. Results indicate that explicit evaluations of the source, but not the opponent, were less favourable after negative as compared to positive campaigns. In contrast, implicit evaluations were less favourable for both candidates after negative campaigns. The results are discussed in terms of associative and propositional processes, highlighting the importance of associative processes in political decision making.

  12. Selecting candidate service based on functional reusability%基于功能重用性的候选服务选定方法

    Institute of Scientific and Technical Information of China (English)

    昌广才; 蒋溢; 熊安萍

    2012-01-01

    SOA-based service modeling is widely used in the enterprise applications. During SOMA service is modeling, according to the identification inaccuracy of function reusability between use case when selecting reusable candidate services, based on the expansion and containment relationship, the selection process of reusable candidate services are provided, which join generalization relationship between the use case, and the selection of reusability candidate services is improved. Practice shows that the improved candidate services selection methods not only simplify reusable candidate selection process, but also improve the selection accuracy of reusability candidate services.%基于SOA的服务建模在企业中得到了广泛运用,针对SOMA服务建模过程中基于用例间包含与扩展关系对可重用候选服务进行选定时存在功能重用性用例确定不准确的问题,给出了加入用例泛化关系的可重用候选服务选定方法,完善了可重用性候选服务的选定.实践表明,改进后的候选服务选定方法不仅使简化了可重用性候选服务选定过程,还提高了可重用性候选服务选定的准确率.

  13. Identification of putative candidate genes for red rot resistance in sugarcane (Saccharum species hybrid) using LD-based association mapping.

    Science.gov (United States)

    Singh, Ram K; Banerjee, Nandita; Khan, M S; Yadav, Sonia; Kumar, Sanjeev; Duttamajumder, S K; Lal, Ram Ji; Patel, Jinesh D; Guo, H; Zhang, Dong; Paterson, Andrew H

    2016-06-01

    Red rot is a serious disease of sugarcane caused by the fungus Colletotrichum falcatum that has a colossal damage potential. The fungus, prevalent mainly in the Indian sub-continent, keeps on producing new pathogenic strains leading to breakdown of resistance in newly released varieties and hence the deployment of linked markers for marker-assisted selection for resistance to this disease can fine tune the breeding programme. This study based on a panel of 119 sugarcane genotypes fingerprinted for 944 SSR alleles was undertaken with an aim to identify marker-trait associations (MTAs) for resistance to red rot. Mixed linear model containing population structure and kinship as co-factor detected four MTAs that were able to explain 10-16 % of the trait variation, individually. Among the four MTAs, EST sequences diagnostic of three could be BLAST searched to the sorghum genome with significant sequence homology. Several genes encoding important plant defence related proteins, viz., cytochrome P450, Glycerol-3-phosphate transporter-1, MAP Kinase-4, Serine/threonine-protein kinase, Ring finger domain protein and others were localized to the vicinity of these MTAs. These positional candidate genes are worth of further investigation and possibly these could contribute directly to red rot resistance, and may find a potential application in marker-assisted sugarcane breeding. PMID:26961118

  14. Glutathione transferase (GST) as a candidate molecular-based biomarker for soil toxin exposure in the earthworm Lumbricus rubellus

    Energy Technology Data Exchange (ETDEWEB)

    LaCourse, E. James, E-mail: james.la-course@liverpool.ac.u [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom); Hernandez-Viadel, Mariluz; Jefferies, James R. [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom); Svendsen, Claus; Spurgeon, David J. [Centre for Ecology and Hydrology, Huntingdon PE28 2LS (United Kingdom); Barrett, John [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom); John Morgan, A.; Kille, Peter [Biosciences, University of Cardiff, Cardiff CF10 3TL (United Kingdom); Brophy, Peter M. [Institute of Biological, Environmental, and Rural Sciences, Aberystwyth University, Aberystwyth SY23 3DA (United Kingdom)

    2009-08-15

    The earthworm Lumbricus rubellus (Hoffmeister, 1843) is a terrestrial pollution sentinel. Enzyme activity and transcription of phase II detoxification superfamily glutathione transferases (GST) is known to respond in earthworms after soil toxin exposure, suggesting GST as a candidate molecular-based pollution biomarker. This study combined sub-proteomics, bioinformatics and biochemical assay to characterise the L. rubellus GST complement as pre-requisite to initialise assessment of the applicability of GST as a biomarker. L. rubellus possesses a range of GSTs related to known classes, with evidence of tissue-specific synthesis. Two affinity-purified GSTs dominating GST protein synthesis (Sigma and Pi class) were cloned, expressed and characterised for enzyme activity with various substrates. Electrospray ionisation mass spectrometry (ESI-MS) and tandem mass spectrometry (MS/MS) following SDS-PAGE were superior in retaining subunit stability relative to two-dimensional gel electrophoresis (2-DE). This study provides greater understanding of Phase II detoxification GST superfamily status of an important environmental pollution sentinel organism. - This study currently provides the most comprehensive view of the Phase II detoxification enzyme superfamily of glutathione transferases within the important environmental pollution sentinel earthworm Lumbricus rubellus.

  15. New π-Conjugated Materials Based on Furylenevinylene Candidate for Organic Solar Cells Application: A DFT Study

    Directory of Open Access Journals (Sweden)

    El Alamy Aziz

    2015-12-01

    Full Text Available The specific properties of organic-conjugated molecules and polymers are of great importance since they have become the most promising materials for the optoelectronic device technology such as solar cells. The use of low band gap materials is a viable method for better harvesting of the solar spectrum and increasing its efficiency. The control of the parameters of these materials is a research issue of ongoing interest. In this work, a quantum chemical investigation was performed to explore the optical and electronic properties of a series of different compounds based on furylenevinylene. Different electron side groups were introduced to investigate their effects on the electronic structure. The theoretical knowledge of the highest occupied molecular orbital (HOMO and lowest unoccupied molecular orbital (LUMO energy levels of the components is basic in studying organic solar cells; so the HOMO, LUMO, Gap energy and open circuit voltage (Voc of the studied compounds have been calculated and reported. These properties suggest that these materials behave as good candidate for organic solar cells. DOI: http://dx.doi.org/10.17807/orbital.v7i4.763 

  16. The (w)hole survey: an unbiased sample study of transition disk candidates based on Spitzer catalogs

    CERN Document Server

    van der Marel, Nienke; van Terwisga, Sierk; Merin, Bruno; Herczeg, Gregory; Ligterink, Niels F W; van Dishoeck, Ewine F

    2016-01-01

    Understanding disk evolution and dissipation is essential for studies of planet formation. Transition disks, i.e., disks with large dust cavities and gaps, are promising candidates of active evolution. About two dozen SED-selected candidates have been confirmed to have dust cavities through millimeter interferometric imaging, but this sample is biased towards the brightest disks. The Spitzer surveys of nearby low-mass star forming regions have resulted in more than 4000 Young Stellar Objects (YSOs). Using color criteria we have selected a sample of ~150 candidates, and an additional 40 candidates and known transition disks from the literature. The Spitzer data were complemented by new observations at longer wavelengths, including new JCMT and APEX submillimeter photometry, and WISE and Herschel-PACS mid and far-infrared photometry. Furthermore, optical spectroscopy was obtained and stellar types were derived for 85% of the sample, including information from the literature. The SEDs were fit to a grid of RADMC...

  17. A new strategy based on SmRho protein loaded chitosan nanoparticles as a candidate oral vaccine against schistosomiasis.

    Directory of Open Access Journals (Sweden)

    Carolina R Oliveira

    Full Text Available BACKGROUND: Schistosomiasis is one of the most important neglected tropical diseases and an effective control is unlikely in the absence of improved sanitation and vaccination. A new approach of oral vaccination with alginate coated chitosan nanoparticles appears interesting because their great stability and the ease of target accessibility, besides of chitosan and alginate immunostimulatory properties. Here we propose a candidate vaccine based on the combination of chitosan-based nanoparticles containing the antigen SmRho and coated with sodium alginate. METHODS AND FINDINGS: Our results showed an efficient performance of protein loading of nanoparticles before and after coating with alginate. Characterization of the resulting nanoparticles reported a size around 430 nm and a negative zeta potential. In vitro release studies of protein showed great stability of coated nanoparticles in simulated gastric fluid (SGF and simulated intestinal fluid (SIF. Further in vivo studies was performed with different formulations of chitosan nanoparticles and it showed that oral immunization was not able to induce high levels of antibodies, otherwise intramuscular immunization induced high levels of both subtypes IgG1 and IgG2a SmRho specific antibodies. Mice immunized with nanoparticles associated to CpG showed significant modulation of granuloma reaction. Mice from all groups immunized orally with nanoparticles presented significant levels of protection against infection challenge with S. mansoni worms, suggesting an important role of chitosan in inducing a protective immune response. Finally, mice immunized with nanoparticles associated with the antigen SmRho plus CpG had 38% of the granuloma area reduced and also presented 48% of protection against of S. mansoni infection. CONCLUSIONS: Taken together, this results support this new strategy as an efficient delivery system and a potential vaccine against schistosomiasis.

  18. Field based measurements of albedo for two candidate perennial cellulosic feedstocks and row crops in Central Illinois

    Science.gov (United States)

    Miller, J. N.; VanLoocke, A.; Bernacchi, C. J.

    2012-12-01

    The production of perennial cellulosic feedstocks for bioenergy present the potential to diversify regional economies and the national energy supply, while also serving as a climate 'regulators' due to a number of biogeochemical and biophysical differences relative to row crops. Numerous observationally and modeling based approaches, including life cycle analyses have investigated biogeochemical tradeoffs, such as increased carbon sequestration and biophysical increased water use, associated with growing cellulosic feedstocks. A less understood aspect is the biophysical changes associated with the difference in albedo, which will alter the local energy balance and could cause a local to regional cooling several times larger than that associated with offsetting carbon. To address this factor an experiment consisting of paired fields of Miscanthus and Switchgrass, two of the leading perennial cellulosic feedstock candidates, and traditional row crops was established in central Illinois. Data from the first two growing seasons indicate that this effect is most pronounced during the spring and fall as perennial biofuel crops green up earlier and senesce later than common annual row crops. The albedo of the perennials converges to that of the row crops during the growing season as the canopies develop. During the early winter, before the perennial crops are harvested, the albedo over fallow soybean and maize fields can vary greatly depending on snowfall and, to a lesser extent, soil moisture, whereas perennials show less variation. Thus, perennial biofuel crops also have the potential to buffer the local environment against short-term variations in climate. These factors should be considered when evaluating the tradeoffs and climate-regulation services associated with large-scale planting of bioenergy crops.

  19. Isoquinoline-based analogs of the cancer drug clinical candidate tipifarnib as anti-Trypanosoma cruzi agents

    OpenAIRE

    Chennamaneni, Naveen Kumar; Arif, Jenifer; Buckner, Frederick S.; Gelb, Michael H

    2009-01-01

    We developed a synthetic route to prepare isoquinoline analogs of the cancer drug clinical candidate tipifarnib. We show that these compounds kill Trypanosoma cruzi amastigotes grown in mammalian host cells at concentrations in the low nanomolar range. These isoquinolines represent new leads for the development of drugs to treat Chagas disease.

  20. Quantitative iTRAQ-Based Proteomic Identification of Candidate Biomarkers for Diabetic Nephropathy in Plasma of Type 1 Diabetic Patients

    DEFF Research Database (Denmark)

    Overgaard, Anne Julie; Thingholm, Tine Engberg; Larsen, Martin R;

    2010-01-01

    INTRODUCTION: As part of a clinical proteomics programme focused on diabetes and its complications, it was our goal to investigate the proteome of plasma in order to find improved candidate biomarkers to predict diabetic nephropathy. METHODS: Proteins derived from plasma from a cross-sectional co...

  1. Candidates of eclipsing multiples based on extraneous eclipses on binary light curves: KIC 7622486, KIC 7668648, KIC 7670485 and KIC 8938628

    CERN Document Server

    Zhang, Jia; He, Jian-Duo

    2016-01-01

    Four candidates of eclipsing multiples, based on new extraneous eclipses found on Kepler binary light curves, are presented and studied. KIC 7622486 is a double eclipsing binary candidate with orbital period of 2.2799960 days and 40.246503 days. The two binary systems do not eclipse each other in the line of sight, but there is mutual gravitational influence between them which leads to the small but definite eccentricity 0.0035(0.0022) on the short 2.2799960 days period orbit. KIC 7668648 is hierarchical quadruple system candidate, with two sets of solid 203(+-5) days period extraneous eclipses and another independent set of extraneous eclipses. A clear and credible extraneous eclipse is found on the binary light curve of KIC 7670485 which made it a triple system candidates. Two sets of extraneous eclipse of about 390 days and 220 days period are found on KIC 8938628 binary curves, which not only confirms the previous conclusion of $388.5(+-0.3) triple system, but also proposed a new additional objects that m...

  2. Comparative testing of six antigen-based malaria vaccine candidates directed toward merozoite-stage Plasmodium falciparum

    DEFF Research Database (Denmark)

    Arnot, David E; Cavanagh, David R; Remarque, Edmond J;

    2008-01-01

    Immunogenicity testing of Plasmodium falciparum antigens being considered as malaria vaccine candidates was undertaken in rabbits. The antigens compared were recombinant baculovirus MSP-1(19) and five Pichia pastoris candidates, including two versions of MSP-1(19), AMA-1 (domains I and II), AMA-1......+MSP-1(19), and fused AMA-1/MSP-1(19)). Animals were immunized with equimolar amounts of each antigen, formulated in Montanide ISA720. The specificities and titers of antibodies were compared using immunofluorescence assays and enzyme-linked immunosorbent assay (ELISA). The antiparasite activity...... of immunoglobulin G (IgG) in in vitro cultures was determined by growth inhibition assay, flow cytometry, lactate dehydrogenase assay, and microscopy. Baculovirus MSP-1(19) immunizations produced the highest parasite-specific antibody titers in immunofluorescence assays. In ELISAs, baculovirus-produced MSP-1...

  3. Comprehensive analytical strategy for biomarker identification based on liquid chromatography coupled to mass spectrometry and new candidate confirmation tools.

    Science.gov (United States)

    Mohamed, Rayane; Varesio, Emmanuel; Ivosev, Gordana; Burton, Lyle; Bonner, Ron; Hopfgartner, Gérard

    2009-09-15

    A comprehensive analytical LC-MS(/MS) platform for low weight biomarkers molecule in biological fluids is described. Two complementary retention mechanisms were used in HPLC by optimizing the chromatographic conditions for a reversed-phase column and a hydrophilic interaction chromatography column. LC separation was coupled to mass spectrometry by using an electrospray ionization operating in positive polarity mode. This strategy enables us to correctly retain and separate hydrophobic as well as polar analytes. For that purpose artificial model study samples were generated with a mixture of 38 well characterized compounds likely to be present in biofluids. The set of compounds was used as a standard aqueous mixture or was spiked into urine at different concentration levels to investigate the capability of the LC-MS(/MS) platform to detect variations across biological samples. Unsupervised data analysis by principal component analysis was performed and followed by principal component variable grouping to find correlated variables. This tool allows us to distinguish three main groups whose variables belong to (a) background ions (found in all type of samples), (b) ions distinguishing urine samples from aqueous standard and blank samples, (c) ions related to the spiked compounds. Interpretation of these groups allows us to identify and eliminate isotopes, adducts, fragments, etc. and to generate a reduced list of m/z candidates. This list is then submitted to the prototype MZSearcher software tool which simultaneously searches several lists of potential metabolites extracted from metabolomics databases (e.g., KEGG, HMDB, etc) to propose biomarker candidates. Structural confirmation of these candidates was done off-line by fraction collection followed by nanoelectrospray infusion to provide high quality MS/MS data for spectral database queries. PMID:19702294

  4. Rapid communication: Computational simulation and analysis of a candidate for the design of a novel silk-based biopolymer.

    Science.gov (United States)

    Golas, Ewa I; Czaplewski, Cezary

    2014-09-01

    This work theoretically investigates the mechanical properties of a novel silk-derived biopolymer as polymerized in silico from sericin and elastin-like monomers. Molecular Dynamics simulations and Steered Molecular Dynamics were the principal computational methods used, the latter of which applies an external force onto the system and thereby enables an observation of its response to stress. The models explored herein are single-molecule approximations, and primarily serve as tools in a rational design process for the preliminary assessment of properties in a new material candidate. PMID:24723330

  5. Planetary Candidates Observed by Kepler. VII. The First Fully Uniform Catalog Based on The Entire 48 Month Dataset (Q1-Q17 DR24)

    CERN Document Server

    Coughlin, Jeffrey L; Thompson, Susan E; Rowe, Jason F; Burke, Christopher J; Latham, David W; Batalha, Natalie M; Ofir, Aviv; Quarles, Billy L; Henze, Christopher E; Wolfgang, Angie; Caldwell, Douglas A; Bryson, Stephen T; Shporer, Avi; Catanzarite, Joseph; Akeson, Rachel; Barclay, Thomas; Borucki, William J; Boyajian, Tabetha S; Campbell, Jennifer R; Christiansen, Jessie L; Girouard, Forrest R; Haas, Michael R; Howell, Steve B; Huber, Daniel; Jenkins, Jon M; Li, Jie; Patil-Sabale, Anima; Quintana, Elisa V; Ramirez, Solange; Seader, Shawn; Smith, Jeffrey C; Tenenbaum, Peter; Twicken, Joseph D; Zamudio, Khadeejah A

    2015-01-01

    We present the seventh Kepler planet candidate catalog, which is the first to be based on the entire, uniformly processed, 48 month Kepler dataset. This is the first fully automated catalog, employing robotic vetting procedures to uniformly evaluate every periodic signal detected by the Q1-Q17 Data Release 24 (DR24) Kepler pipeline. While we prioritize uniform vetting over the absolute correctness of individual objects, we find that our robotic vetting is overall comparable to, and in most cases is superior to, the human vetting procedures employed by past catalogs. This catalog is the first to utilize artificial transit injection to evaluate the performance of our vetting procedures and quantify potential biases, which are essential for accurate computation of planetary occurrence rates. With respect to the cumulative Kepler Object of Interest (KOI) catalog, we designate 1,478 new KOIs, of which 402 are dispositioned as planet candidates (PCs). Also, 237 KOIs dispositioned as false positives (FPs) in previou...

  6. VennPainter: A Tool for the Comparison and Identification of Candidate Genes Based on Venn Diagrams.

    Directory of Open Access Journals (Sweden)

    Guoliang Lin

    Full Text Available VennPainter is a program for depicting unique and shared sets of genes lists and generating Venn diagrams, by using the Qt C++ framework. The software produces Classic Venn, Edwards' Venn and Nested Venn diagrams and allows for eight sets in a graph mode and 31 sets in data processing mode only. In comparison, previous programs produce Classic Venn and Edwards' Venn diagrams and allow for a maximum of six sets. The software incorporates user-friendly features and works in Windows, Linux and Mac OS. Its graphical interface does not require a user to have programing skills. Users can modify diagram content for up to eight datasets because of the Scalable Vector Graphics output. VennPainter can provide output results in vertical, horizontal and matrix formats, which facilitates sharing datasets as required for further identification of candidate genes. Users can obtain gene lists from shared sets by clicking the numbers on the diagram. Thus, VennPainter is an easy-to-use, highly efficient, cross-platform and powerful program that provides a more comprehensive tool for identifying candidate genes and visualizing the relationships among genes or gene families in comparative analysis.

  7. VennPainter: A Tool for the Comparison and Identification of Candidate Genes Based on Venn Diagrams.

    Science.gov (United States)

    Lin, Guoliang; Chai, Jing; Yuan, Shuo; Mai, Chao; Cai, Li; Murphy, Robert W; Zhou, Wei; Luo, Jing

    2016-01-01

    VennPainter is a program for depicting unique and shared sets of genes lists and generating Venn diagrams, by using the Qt C++ framework. The software produces Classic Venn, Edwards' Venn and Nested Venn diagrams and allows for eight sets in a graph mode and 31 sets in data processing mode only. In comparison, previous programs produce Classic Venn and Edwards' Venn diagrams and allow for a maximum of six sets. The software incorporates user-friendly features and works in Windows, Linux and Mac OS. Its graphical interface does not require a user to have programing skills. Users can modify diagram content for up to eight datasets because of the Scalable Vector Graphics output. VennPainter can provide output results in vertical, horizontal and matrix formats, which facilitates sharing datasets as required for further identification of candidate genes. Users can obtain gene lists from shared sets by clicking the numbers on the diagram. Thus, VennPainter is an easy-to-use, highly efficient, cross-platform and powerful program that provides a more comprehensive tool for identifying candidate genes and visualizing the relationships among genes or gene families in comparative analysis. PMID:27120465

  8. Generation and Characterization of Live Attenuated Influenza A(H7N9 Candidate Vaccine Virus Based on Russian Donor of Attenuation.

    Directory of Open Access Journals (Sweden)

    Svetlana Shcherbik

    Full Text Available Avian influenza A (H7N9 virus has emerged recently and continues to cause severe disease with a high mortality rate in humans prompting the development of candidate vaccine viruses. Live attenuated influenza vaccines (LAIV are 6:2 reassortant viruses containing the HA and NA gene segments from wild type influenza viruses to induce protective immune responses and the six internal genes from Master Donor Viruses (MDV to provide temperature sensitive, cold-adapted and attenuated phenotypes.LAIV candidate A/Anhui/1/2013(H7N9-CDC-LV7A (abbreviated as CDC-LV7A, based on the Russian MDV, A/Leningrad/134/17/57 (H2N2, was generated by classical reassortment in eggs and retained MDV temperature-sensitive and cold-adapted phenotypes. CDC-LV7A had two amino acid substitutions N123D and N149D (H7 numbering in HA and one substitution T10I in NA. To evaluate the role of these mutations on the replication capacity of the reassortants in eggs, the recombinant viruses A(H7N9RG-LV1 and A(H7N9RG-LV2 were generated by reverse genetics. These changes did not alter virus antigenicity as ferret antiserum to CDC-LV7A vaccine candidate inhibited hemagglutination by homologous A(H7N9 virus efficiently. Safety studies in ferrets confirmed that CDC-LV7A was attenuated compared to wild-type A/Anhui/1/2013. In addition, the genetic stability of this vaccine candidate was examined in eggs and ferrets by monitoring sequence changes acquired during virus replication in the two host models. No changes in the viral genome were detected after five passages in eggs. However, after ten passages additional mutations were detected in the HA gene. The vaccine candidate was shown to be stable in the ferret model; post-vaccination sequence data analysis showed no changes in viruses collected in nasal washes present at day 5 or day 7.Our data indicate that the A/Anhui/1/2013(H7N9-CDC-LV7A reassortant virus is a safe and genetically stable candidate vaccine virus that is now available for

  9. Integration of gene-based markers in a pearl millet genetic map for identification of candidate genes underlying drought tolerance quantitative trait loci

    Directory of Open Access Journals (Sweden)

    Sehgal Deepmala

    2012-01-01

    Full Text Available Abstract Background Identification of genes underlying drought tolerance (DT quantitative trait loci (QTLs will facilitate understanding of molecular mechanisms of drought tolerance, and also will accelerate genetic improvement of pearl millet through marker-assisted selection. We report a map based on genes with assigned functional roles in plant adaptation to drought and other abiotic stresses and demonstrate its use in identifying candidate genes underlying a major DT-QTL. Results Seventy five single nucleotide polymorphism (SNP and conserved intron spanning primer (CISP markers were developed from available expressed sequence tags (ESTs using four genotypes, H 77/833-2, PRLT 2/89-33, ICMR 01029 and ICMR 01004, representing parents of two mapping populations. A total of 228 SNPs were obtained from 30.5 kb sequenced region resulting in a SNP frequency of 1/134 bp. The positions of major pearl millet linkage group (LG 2 DT-QTLs (reported from crosses H 77/833-2 × PRLT 2/89-33 and 841B × 863B were added to the present consensus function map which identified 18 genes, coding for PSI reaction center subunit III, PHYC, actin, alanine glyoxylate aminotransferase, uridylate kinase, acyl-CoA oxidase, dipeptidyl peptidase IV, MADS-box, serine/threonine protein kinase, ubiquitin conjugating enzyme, zinc finger C- × 8-C × 5-C × 3-H type, Hd3, acetyl CoA carboxylase, chlorophyll a/b binding protein, photolyase, protein phosphatase1 regulatory subunit SDS22 and two hypothetical proteins, co-mapping in this DT-QTL interval. Many of these candidate genes were found to have significant association with QTLs of grain yield, flowering time and leaf rolling under drought stress conditions. Conclusions We have exploited available pearl millet EST sequences to generate a mapped resource of seventy five new gene-based markers for pearl millet and demonstrated its use in identifying candidate genes underlying a major DT-QTL in this species. The reported gene-based

  10. Stochastic Dynamics of the Multi-State Voter Model over a Network based on Interacting Cliques and Zealot Candidates

    CERN Document Server

    Palombi, Filippo

    2013-01-01

    The stochastic dynamics of the multi-state voter model is investigated on a class of complex networks made of non-overlapping cliques, each hosting a political candidate and interacting with the others via Erd\\H{o}s-R\\'enyi links. Numerical simulations of the model are interpreted in terms of an ad-hoc mean field theory, specifically tuned to resolve the inter/intra-clique interactions. Under a proper definition of the thermodynamic limit (with the average degree of the agents kept fixed while increasing the network size), the model is found to display the empirical scaling discovered by Fortunato and Castellano (2007) [1] and the vote distribution resembles qualitatively that observed in Brazilian elections.

  11. Stochastic Dynamics of the Multi-State Voter Model Over a Network Based on Interacting Cliques and Zealot Candidates

    Science.gov (United States)

    Palombi, Filippo; Toti, Simona

    2014-07-01

    The stochastic dynamics of the multi-state voter model is investigated on a class of complex networks made of non-overlapping cliques, each hosting a political candidate and interacting with the others via Erdős-Rényi links. Numerical simulations of the model are interpreted in terms of an ad-hoc mean field theory, specifically tuned to resolve the inter/intra-clique interactions. Under a proper definition of the thermodynamic limit (with the average degree of the agents kept fixed while increasing the network size), the model is found to display the empirical scaling discovered by Fortunato and Castellano (Phys Rev Lett 99(13):138701, 2007) , while the vote distribution resembles roughly that observed in Brazilian elections.

  12. 基于Android系统的考生身份认证系统%Candidates identification system based on Android system

    Institute of Scientific and Technical Information of China (English)

    高嵩

    2012-01-01

      随着3G网络的发展,为了更快捷方便地认证考生身份,笔者基于开源的Android平台开发了一套考生身份认证系统。本文对系统结构进行了分析,阐述了客户端与服务器端的连接方式以及整个查询认证的执行过程,实现了通过手机辅助认证考生身份。%  With the development of 3G networks,I developed a set of candidates identification system based on open source Android system, for verifying the identity of candidates quickly. In this paper, the system structure is analyzed, described the connection of the client and server and Implementation of the certification process of the inquiries. The identity of the secondary certification candidates by phone.

  13. Predicted Coverage and Immuno-Safety of a Recombinant C-Repeat Region Based Streptococcus pyogenes Vaccine Candidate.

    Science.gov (United States)

    McNeilly, Celia; Cosh, Samantha; Vu, Therese; Nichols, Jemma; Henningham, Anna; Hofmann, Andreas; Fane, Anne; Smeesters, Pierre R; Rush, Catherine M; Hafner, Louise M; Ketheesan, Natkuman; Sriprakash, Kadaba S; McMillan, David J

    2016-01-01

    The C-terminal region of the M-protein of Streptococcus pyogenes is a major target for vaccine development. The major feature is the C-repeat region, consisting of 35-42 amino acid repeat units that display high but not perfect identity. SV1 is a S. pyogenes vaccine candidate that incorporates five 14mer amino acid sequences (called J14i variants) from differing C-repeat units in a single recombinant construct. Here we show that the J14i variants chosen for inclusion in SV1 are the most common variants in a dataset of 176 unique M-proteins. Murine antibodies raised against SV1 were shown to bind to each of the J14i variants present in SV1, as well as variants not present in the vaccine. Antibodies raised to the individual J14i variants were also shown to bind to multiple but different combinations of J14i variants, supporting the underlying rationale for the design of SV1. A Lewis Rat Model of valvulitis was then used to assess the capacity of SV1 to induce deleterious immune response associated with rheumatic heart disease. In this model, both SV1 and the M5 positive control protein were immunogenic. Neither of these antibodies were cross-reactive with cardiac myosin or collagen. Splenic T cells from SV1/CFA and SV1/alum immunized rats did not proliferate in response to cardiac myosin or collagen. Subsequent histological examination of heart tissue showed that 4 of 5 mice from the M5/CFA group had valvulitis and inflammatory cell infiltration into valvular tissue, whereas mice immunised with SV1/CFA, SV1/alum showed no sign of valvulitis. These results suggest that SV1 is a safe vaccine candidate that will elicit antibodies that recognise the vast majority of circulating GAS M-types. PMID:27310707

  14. Identification of candidate categories of the International Classification of Functioning Disability and Health (ICF for a Generic ICF Core Set based on regression modelling

    Directory of Open Access Journals (Sweden)

    Üstün Bedirhan T

    2006-07-01

    Full Text Available Abstract Background The International Classification of Functioning, Disability and Health (ICF is the framework developed by WHO to describe functioning and disability at both the individual and population levels. While condition-specific ICF Core Sets are useful, a Generic ICF Core Set is needed to describe and compare problems in functioning across health conditions. Methods The aims of the multi-centre, cross-sectional study presented here were: a to propose a method to select ICF categories when a large amount of ICF-based data have to be handled, and b to identify candidate ICF categories for a Generic ICF Core Set by examining their explanatory power in relation to item one of the SF-36. The data were collected from 1039 patients using the ICF checklist, the SF-36 and a Comorbidity Questionnaire. ICF categories to be entered in an initial regression model were selected following systematic steps in accordance with the ICF structure. Based on an initial regression model, additional models were designed by systematically substituting the ICF categories included in it with ICF categories with which they were highly correlated. Results Fourteen different regression models were performed. The variance the performed models account for ranged from 22.27% to 24.0%. The ICF category that explained the highest amount of variance in all the models was sensation of pain. In total, thirteen candidate ICF categories for a Generic ICF Core Set were proposed. Conclusion The selection strategy based on the ICF structure and the examination of the best possible alternative models does not provide a final answer about which ICF categories must be considered, but leads to a selection of suitable candidates which needs further consideration and comparison with the results of other selection strategies in developing a Generic ICF Core Set.

  15. Origin of the Au/Ge(001) metallic state

    Science.gov (United States)

    Heimbuch, René; Kuzmin, Mikhail; de Jong, Nick; Golden, Mark; Zandvliet, Harold J. W.

    2014-03-01

    Electronic transport in one-dimensional systems is a highly investigated topic, as electronic devices continue to shrink in size further and further. To understand the exotic behavior of electrons in structures of atomic length scales is crucial for future technological advances in electronics. We studied the spatial variation of the metallic state of the Au-induced nanowires on Ge(001). Spatial maps of the differential conductivity of the metallic state, which has its energy minimum at 0.1-0.15 eV below the Fermi level, are recorded with a low-temperature scanning tunneling microscope. The metallic state is not located on the ridges of the nanowires, but in the troughs between the nanowires. Electronic end effects were investigated and spatial profiling of the density of states, as a function of temperature reveal great inside into Tomonaga-Luttinger liquid in 1D electron systems. Fundamenteel Onderzoek der Materie (Grant No. FOM, 10ODE01), the Nederlandse Organisatie voor Wetenschappelijk onderzoek (Grant No. NWO/CW ECHO.08.F2.008).

  16. GC-MS Based Plasma Metabolomics for Identification of Candidate Biomarkers for Hepatocellular Carcinoma in Egyptian Cohort.

    Directory of Open Access Journals (Sweden)

    Mohammad R Nezami Ranjbar

    Full Text Available This study evaluates changes in metabolite levels in hepatocellular carcinoma (HCC cases vs. patients with liver cirrhosis by analysis of human blood plasma using gas chromatography coupled with mass spectrometry (GC-MS. Untargeted metabolomic analysis of plasma samples from participants recruited in Egypt was performed using two GC-MS platforms: a GC coupled to single quadruple mass spectrometer (GC-qMS and a GC coupled to a time-of-flight mass spectrometer (GC-TOFMS. Analytes that showed statistically significant changes in ion intensities were selected using ANOVA models. These analytes and other candidates selected from related studies were further evaluated by targeted analysis in plasma samples from the same participants as in the untargeted metabolomic analysis. The targeted analysis was performed using the GC-qMS in selected ion monitoring (SIM mode. The method confirmed significant changes in the levels of glutamic acid, citric acid, lactic acid, valine, isoleucine, leucine, alpha tocopherol, cholesterol, and sorbose in HCC cases vs. patients with liver cirrhosis. Specifically, our findings indicate up-regulation of metabolites involved in branched-chain amino acid (BCAA metabolism. Although BCAAs are increasingly used as a treatment for cancer cachexia, others have shown that BCAA supplementation caused significant enhancement of tumor growth via activation of mTOR/AKT pathway, which is consistent with our results that BCAAs are up-regulated in HCC.

  17. Systematic exploration of a class of hydrophobic unnatural base pairs yields multiple new candidates for the expansion of the genetic alphabet.

    Science.gov (United States)

    Dhami, Kirandeep; Malyshev, Denis A; Ordoukhanian, Phillip; Kubelka, Tomáš; Hocek, Michal; Romesberg, Floyd E

    2014-01-01

    We have developed a family of unnatural base pairs (UBPs), which rely on hydrophobic and packing interactions for pairing and which are well replicated and transcribed. While the pair formed between d5SICS and dNaM (d5SICS-dNaM) has received the most attention, and has been used to expand the genetic alphabet of a living organism, recent efforts have identified dTPT3-dNaM, which is replicated with even higher fidelity. These efforts also resulted in more UBPs than could be independently analyzed, and thus we now report a PCR-based screen to identify the most promising. While we found that dTPT3-dNaM is generally the most promising UBP, we identified several others that are replicated nearly as well and significantly better than d5SICS-dNaM, and are thus viable candidates for the expansion of the genetic alphabet of a living organism. Moreover, the results suggest that continued optimization should be possible, and that the putatively essential hydrogen-bond acceptor at the position ortho to the glycosidic linkage may not be required. These results clearly demonstrate the generality of hydrophobic forces for the control of base pairing within DNA, provide a wealth of new structure-activity relationship data and importantly identify multiple new candidates for in vivo evaluation and further optimization.

  18. Candidate Gene Identification with SNP Marker-Based Fine Mapping of Anthracnose Resistance Gene Co-4 in Common Bean.

    Directory of Open Access Journals (Sweden)

    Andrew J Burt

    Full Text Available Anthracnose, caused by Colletotrichum lindemuthianum, is an important fungal disease of common bean (Phaseolus vulgaris. Alleles at the Co-4 locus confer resistance to a number of races of C. lindemuthianum. A population of 94 F4:5 recombinant inbred lines of a cross between resistant black bean genotype B09197 and susceptible navy bean cultivar Nautica was used to identify markers associated with resistance in bean chromosome 8 (Pv08 where Co-4 is localized. Three SCAR markers with known linkage to Co-4 and a panel of single nucleotide markers were used for genotyping. A refined physical region on Pv08 with significant association with anthracnose resistance identified by markers was used in BLAST searches with the genomic sequence of common bean accession G19833. Thirty two unique annotated candidate genes were identified that spanned a physical region of 936.46 kb. A majority of the annotated genes identified had functional similarity to leucine rich repeats/receptor like kinase domains. Three annotated genes had similarity to 1, 3-β-glucanase domains. There were sequence similarities between some of the annotated genes found in the study and the genes associated with phosphoinositide-specific phosphilipases C associated with Co-x and the COK-4 loci found in previous studies. It is possible that the Co-4 locus is structured as a group of genes with functional domains dominated by protein tyrosine kinase along with leucine rich repeats/nucleotide binding site, phosphilipases C as well as β-glucanases.

  19. Candidate Gene Identification with SNP Marker-Based Fine Mapping of Anthracnose Resistance Gene Co-4 in Common Bean

    Science.gov (United States)

    Burt, Andrew J.; William, H. Manilal; Perry, Gregory; Khanal, Raja; Pauls, K. Peter; Kelly, James D.; Navabi, Alireza

    2015-01-01

    Anthracnose, caused by Colletotrichum lindemuthianum, is an important fungal disease of common bean (Phaseolus vulgaris). Alleles at the Co–4 locus confer resistance to a number of races of C. lindemuthianum. A population of 94 F4:5 recombinant inbred lines of a cross between resistant black bean genotype B09197 and susceptible navy bean cultivar Nautica was used to identify markers associated with resistance in bean chromosome 8 (Pv08) where Co–4 is localized. Three SCAR markers with known linkage to Co–4 and a panel of single nucleotide markers were used for genotyping. A refined physical region on Pv08 with significant association with anthracnose resistance identified by markers was used in BLAST searches with the genomic sequence of common bean accession G19833. Thirty two unique annotated candidate genes were identified that spanned a physical region of 936.46 kb. A majority of the annotated genes identified had functional similarity to leucine rich repeats/receptor like kinase domains. Three annotated genes had similarity to 1, 3-β-glucanase domains. There were sequence similarities between some of the annotated genes found in the study and the genes associated with phosphoinositide-specific phosphilipases C associated with Co-x and the COK–4 loci found in previous studies. It is possible that the Co–4 locus is structured as a group of genes with functional domains dominated by protein tyrosine kinase along with leucine rich repeats/nucleotide binding site, phosphilipases C as well as β-glucanases. PMID:26431031

  20. Serum-free microcarrier based production of replication deficient Influenza vaccine candidate virus lacking NS1 using Vero cells

    Directory of Open Access Journals (Sweden)

    Yan Mylene L

    2011-08-01

    Full Text Available Abstract Background Influenza virus is a major health concern that has huge impacts on the human society, and vaccination remains as one of the most effective ways to mitigate this disease. Comparing the two types of commercially available Influenza vaccine, the live attenuated virus vaccine is more cross-reactive and easier to administer than the traditional inactivated vaccines. One promising live attenuated Influenza vaccine that has completed Phase I clinical trial is deltaFLU, a deletion mutant lacking the viral Nonstructural Protein 1 (NS1 gene. As a consequence of this gene deletion, this mutant virus can only propagate effectively in cells with a deficient interferon-mediated antiviral response. To demonstrate the manufacturability of this vaccine candidate, a batch bioreactor production process using adherent Vero cells on microcarriers in commercially available animal-component free, serum-free media is described. Results Five commercially available animal-component free, serum-free media (SFM were evaluated for growth of Vero cells in agitated Cytodex 1 spinner flask microcarrier cultures. EX-CELL Vero SFM achieved the highest cell concentration of 2.6 × 10^6 cells/ml, whereas other SFM achieved about 1.2 × 10^6 cells/ml. Time points for infection between the late exponential and stationary phases of cell growth had no significant effect in the final virus titres. A virus yield of 7.6 Log10 TCID50/ml was achieved using trypsin concentration of 10 μg/ml and MOI of 0.001. The Influenza vaccine production process was scaled up to a 3 liter controlled stirred tank bioreactor to achieve a cell density of 2.7 × 10^6 cells/ml and virus titre of 8.3 Log10 TCID50/ml. Finally, the bioreactor system was tested for the production of the corresponding wild type H1N1 Influenza virus, which is conventionally used in the production of inactivated vaccine. High virus titres of up to 10 Log10 TCID50/ml were achieved. Conclusions We describe for the

  1. Selection and validation of potato candidate genes for maturity corrected resistance to Phytophthora infestans based on differential expression combined with SNP association and linkage mapping

    Directory of Open Access Journals (Sweden)

    Meki Shehabu Muktar

    2015-09-01

    Full Text Available Late blight of potato (Solanum tuberosum L. caused by the oomycete Phytophthora infestans (Mont. de Bary, is one of the most important bottlenecks of potato production worldwide. Cultivars with high levels of durable, race unspecific, quantitative resistance are part of a solution to this problem. However, breeding for quantitative resistance is hampered by the correlation between resistance and late plant maturity, which is an undesirable agricultural attribute. The objectives of our research are (i the identification of genes that condition quantitative resistance to P. infestans not compromised by late plant maturity and (ii the discovery of diagnostic single nucleotide polymorphism (SNP markers to be used as molecular tools to increase efficiency and precision of resistance breeding. Twenty two novel candidate genes were selected based on comparative transcript profiling by SuperSAGE (serial analysis of gene expression in groups of plants with contrasting levels of maturity corrected resistance (MCR. Reproducibility of differential expression was tested by quantitative real time PCR and allele specific pyrosequencing in four new sets of genotype pools with contrasting late blight resistance levels, at three infection time points and in three independent infection experiments. Reproducibility of expression patterns ranged from 28% to 97%. Association mapping in a panel of 184 tetraploid cultivars identified SNPs in five candidate genes that were associated with MCR. These SNPs can be used in marker-assisted resistance breeding. Linkage mapping in two half-sib families (n = 111 identified SNPs in three candidate genes that were linked with MCR. The differentially expressed genes that showed association and/or linkage with MCR putatively function in phytosterol synthesis, fatty acid synthesis, asparagine synthesis, chlorophyll synthesis, cell wall modification and in the response to pathogen elicitors.

  2. Integrating candidate metabolites and biochemical factors to elucidate the action mechanism of Xue-sai-tong injection based on (1)H NMR metabolomics.

    Science.gov (United States)

    Jiang, Miaomiao; Zhao, Xiaoping; Wang, Linli; Xu, Lei; Zhang, Yan; Li, Zheng

    2016-07-15

    A strategy of integrating candidate metabolites with crucial biochemical factors was proposed in this study to discover relevant biological functions for interpreting the action mechanism of Traditional Chinese Medicines (TCM). This approach was applied to Xue-Sai-Tong injection (XST) to reveal the action mechanism based on the metabolic response in an ischemia/reperfusion (I/R) rat model by analyzing NMR profile. Partial least squares discriminate analysis (PLS-DA) was used to compare metabolic profiles of serum samples and revealed nine metabolites altered by I/R injury could be restored to normal status (sham-operated group) under the therapy of XST. The pathway enrichment analysis suggested the metabolic changes were mainly involved in pyruvate metabolism, glycolysis, and citrate cycle. The functional roles of the candidate metabolites were further identified by Pearson correlation analysis with the key biochemical factors in serum. The results indicated pyruvate, succinate, acetate and lysine showed significant associations with the oxidative stress factors. Elevated level of pyruvate was found as an essential metabolic response for the major effect of XST against I/R injury by enhancing glycolysis and overcoming the induced reactive oxygen species (ROS). This metabolomics approach provides a better understanding of the mechanisms of TCM and helps to develop a holistic view of TCM efficacy. PMID:26862062

  3. Special Education Teacher Candidate Assessment: A Review

    Science.gov (United States)

    McCall, Zach; McHatton, Patricia Alvarez; Shealey, Monika Williams

    2014-01-01

    Teacher preparation has been under intense scrutiny in recent years. In order for preparation of special education teacher candidates to remain viable, candidate assessment practices must apply practices identified in the extant literature base, while special education teacher education researchers must extend this base with rigorous efforts to…

  4. A new high-throughput method utilizing porous silica-based nano-composites for the determination of partition coefficients of drug candidates.

    Science.gov (United States)

    Yu, Chih H; Tam, Kin; Tsang, Shik C

    2011-09-01

    We show that highly porous silica-based nanoparticles prepared via micro-emulsion and sol-gel techniques are stable colloids in aqueous solution. By incorporating a magnetic core into the porous silica nano-composite, it is found that the material can be rapidly separated (precipitated) upon exposure to an external magnetic field. Alternatively, the porous silica nanoparticles without magnetic cores can be equally separated from solution by applying a high-speed centrifugation. Using these silica-based nanostructures a new high-throughput method for the determination of partition coefficient for water/n-octanol is hereby described. First, a tiny quantity of n-octanol phase is pre-absorbed in the porous silica nano-composite colloids, which allows an establishment of interface at nano-scale between the adsorbed n-octanol with the bulk aqueous phase. Organic compounds added to the mixture can therefore undergo a rapid partition between the two phases. The concentration of drug compound in the supernatant in a small vial can be determined by UV-visible absorption spectroscopy. With the adaptation of a robotic liquid handler, a high-throughput technology for the determination of partition coefficients of drug candidates can be employed for drug screening in the industry based on these nano-separation skills. The experimental results clearly suggest that this new method can provide partition coefficient values of potential drug candidates comparable to the conventional shake-flask method but requires much shorter analytical time and lesser quantity of chemicals. PMID:21780284

  5. Effect of the Creative Drama-Based Assertiveness Program on the Assertiveness Skill of Psychological Counsellor Candidates

    Science.gov (United States)

    Gundogdu, Rezzan

    2012-01-01

    The purpose of this quasi-experimental research is to study the effects of the creative drama-based assertiveness program (CDBAP) on the assertiveness skill of Psychological Counselling and Guidance (PCG) department students. The opinions of experimental group students on the program were obtained through the CDBAP evaluation form. The sample of…

  6. Identification and prioritization of candidate genes for symptom variability in breast cancer survivors based on disease characteristics at the cellular level

    Directory of Open Access Journals (Sweden)

    Koleck TA

    2016-03-01

    Full Text Available Theresa A Koleck,1 Yvette P Conley2 1School of Nursing, 2Department of Human Genetics, School of Nursing and Graduate School of Public Health, University of Pittsburgh, Pittsburgh, PA, USA Abstract: Research is beginning to suggest that the presence and/or severity of symptoms reported by breast cancer survivors may be associated with disease-related factors of cancer. In this article, we present a novel approach to the identification and prioritization of biologically plausible candidate genes to investigate relationships between genomic variation and symptom variability in breast cancer survivors. Cognitive dysfunction is utilized as a representative breast cancer survivor symptom to elucidate the conceptualization of and justification for our cellular, disease-based approach to address symptom variability in cancer survivors. Initial candidate gene identification was based on genes evaluated as part of multigene expression profiles for breast cancer, which are commonly used in the clinical setting to characterize the biology of cancer cells for the purpose of describing overall tumor aggressiveness, prognostication, and individualization of therapy. A list of genes evaluated within five multigene expression profiles for breast cancer was compiled. In order to prioritize candidate genes for investigation, genes used in each profile were compared for duplication. Twenty-one genes (BAG1, BCL2, BIRC5, CCNB1, CENPA, CMC2, DIAPH3, ERBB2, ESR1, GRB7, MELK, MKI67, MMP11, MYBL2, NDC80, ORC6, PGR, RACGAP1, RFC4, RRM2, and SCUBE2 are utilized in two or more profiles, including five genes (CCNB1, CENPA, MELK, MYBL2, and ORC6 used in three profiles. To ensure that the parsimonious 21 gene set is representative of the more global biological hallmarks of cancer, an Ingenuity Pathway Analysis was conducted. Evaluation of genes known to impact pathways involved with cancer development and progression provide a means to evaluate the overlap between the

  7. Improving the quality of biomarker candidates in untargeted metabolomics via peak table-based alignment of comprehensive two-dimensional gas chromatography-mass spectrometry data.

    Science.gov (United States)

    Bean, Heather D; Hill, Jane E; Dimandja, Jean-Marie D

    2015-05-15

    The potential of high-resolution analytical technologies like GC×GC/TOF MS in untargeted metabolomics and biomarker discovery has been limited by the development of fully automated software that can efficiently align and extract information from multiple chromatographic data sets. In this work we report the first investigation on a peak-by-peak basis of the chromatographic factors that impact GC×GC data alignment. A representative set of 16 compounds of different chromatographic characteristics were followed through the alignment of 63 GC×GC chromatograms. We found that varying the mass spectral match parameter had a significant influence on the alignment for poorly-resolved peaks, especially those at the extremes of the detector linear range, and no influence on well-chromatographed peaks. Therefore, optimized chromatography is required for proper GC×GC data alignment. Based on these observations, a workflow is presented for the conservative selection of biomarker candidates from untargeted metabolomics analyses. PMID:25857541

  8. Benefit-of-doubt (BOD) scoring: a sequencing-based method for SNP candidate assessment from high to medium read number data sets.

    Science.gov (United States)

    Sedlazeck, Fritz Joachim; Talloji, Prabhavathi; von Haeseler, Arndt; Bachmair, Andreas

    2013-03-01

    Identification of single nucleotide polymorphisms (SNPs) is a key element in sequence-based genetic analysis. Next generation sequencing offers a cost-effective basis to generate the necessary, large sequence data sets, and bioinformatic methods are being developed to process sequencing machine readouts. We were interested in detection of SNPs in a 350 kb region of an EMS-mutagenized Arabidopsis chromosome 3. The region was selectively analyzed using PCR-generated, overlapping fragments for Solexa sequencing. The ensuing reads provided a high coverage and were processed bioinformatically. In order to assess the SNP candidates obtained with a frequently used alignment program and SNP caller, we developed an additional method that allows the identification of high confidence SNP loci. The method can easily be applied to complete genome sequence data of sufficient coverage.

  9. Newly identified YSO candidates towards LDN 1188

    Science.gov (United States)

    Marton , G.; Verebélyi, E.; Kiss, Cs.; Smidla, J.

    2013-11-01

    We present an analysis of young stellar object (YSO) candidates towards the LDN 1188 molecular cloud. The YSO candidates were selected from the WISE all-sky catalogue, based on a statistical method. We found 601 candidates in the region, and classified them as Class I, Flat, and Class II YSOs. Groups were identified and described with the Minimal Spanning Tree (MST) method. Previously identified molecular cores show evidence of ongoing star formation at different stages throughout the cloud complex.

  10. Synthesis and evaluation of influenza A viral neuraminidase candidate inhibitors based on a bicyclo[3.1.0]hexane scaffold.

    Science.gov (United States)

    Colombo, Cinzia; Pinto, B Mario; Bernardi, Anna; Bennet, Andrew J

    2016-07-01

    This manuscript describes a novel class of derivatives based on a bicyclo[3.1.0]hexane scaffold, proposed as mimics of sialic acid in a distorted boat conformation that is on the catalytic pathway of neuraminidases (sialidases). A general synthetic route for these constrained-ring molecules was developed using a photochemical reaction followed by a Johnson-Corey-Chaykovsky cyclopropanation. Functionalization with the goal of occupying the 150-cavity was also exploited. Inhibition assays demonstrated low micromolar inhibition against both group-1 (H5N1) and group-2 (H9N2) influenza neuraminidase subtypes, indicating good affinity for the alpha and beta sialic acid mimics and 150-cavity-targeted derivatives. These results provide a validation of a bicyclo[3.1.0]hexane scaffold as a mimic of a distorted sialic acid bound in the neuraminidase active site during catalysis. PMID:27305457

  11. Information criterion-based clustering with order-restricted candidate profiles in short time-course microarray experiments

    Directory of Open Access Journals (Sweden)

    Zhang Baoxue

    2009-05-01

    Full Text Available Abstract Background Time-course microarray experiments produce vector gene expression profiles across a series of time points. Clustering genes based on these profiles is important in discovering functional related and co-regulated genes. Early developed clustering algorithms do not take advantage of the ordering in a time-course study, explicit use of which should allow more sensitive detection of genes that display a consistent pattern over time. Peddada et al. 1 proposed a clustering algorithm that can incorporate the temporal ordering using order-restricted statistical inference. This algorithm is, however, very time-consuming and hence inapplicable to most microarray experiments that contain a large number of genes. Its computational burden also imposes difficulty to assess the clustering reliability, which is a very important measure when clustering noisy microarray data. Results We propose a computationally efficient information criterion-based clustering algorithm, called ORICC, that also takes account of the ordering in time-course microarray experiments by embedding the order-restricted inference into a model selection framework. Genes are assigned to the profile which they best match determined by a newly proposed information criterion for order-restricted inference. In addition, we also developed a bootstrap procedure to assess ORICC's clustering reliability for every gene. Simulation studies show that the ORICC method is robust, always gives better clustering accuracy than Peddada's method and saves hundreds of times computational time. Under some scenarios, its accuracy is also better than some other existing clustering methods for short time-course microarray data, such as STEM 2 and Wang et al. 3. It is also computationally much faster than Wang et al. 3. Conclusion Our ORICC algorithm, which takes advantage of the temporal ordering in time-course microarray experiments, provides good clustering accuracy and is meanwhile much

  12. High-yield production of a stable Vero cell-based vaccine candidate against the highly pathogenic avian influenza virus H5N1

    International Nuclear Information System (INIS)

    Highlights: ► Vero cell-based HPAI H5N1 vaccine with stable high yield. ► Stable high yield derived from the YNVa H3N2 backbone. ► H5N1/YNVa has a similar safety and immunogenicity to H5N1delta. -- Abstract: Highly pathogenic avian influenza (HPAI) viruses pose a global pandemic threat, for which rapid large-scale vaccine production technology is critical for prevention and control. Because chickens are highly susceptible to HPAI viruses, the supply of chicken embryos for vaccine production might be depleted during a virus outbreak. Therefore, developing HPAI virus vaccines using other technologies is critical. Meeting vaccine demand using the Vero cell-based fermentation process has been hindered by low stability and yield. In this study, a Vero cell-based HPAI H5N1 vaccine candidate (H5N1/YNVa) with stable high yield was achieved by reassortment of the Vero-adapted (Va) high growth A/Yunnan/1/2005(H3N2) (YNVa) virus with the A/Anhui/1/2005(H5N1) attenuated influenza vaccine strain (H5N1delta) using the 6/2 method. The reassorted H5N1/YNVa vaccine maintained a high hemagglutination (HA) titer of 1024. Furthermore, H5N1/YNVa displayed low pathogenicity and uniform immunogenicity compared to that of the parent virus.

  13. High-yield production of a stable Vero cell-based vaccine candidate against the highly pathogenic avian influenza virus H5N1

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Fangye; Zhou, Jian; Ma, Lei; Song, Shaohui; Zhang, Xinwen; Li, Weidong; Jiang, Shude [No. 5, Department of Bioproducts, Institute of Medical Biology, Chinese Academy of Medical Science and Pecking Union Medical College, Jiaoling Avenue 935, Kunming, Yunnan Province 650102, People' s Republic of China (China); Wang, Yue, E-mail: euy-tokyo@umin.ac.jp [National Institute for Viral Disease Control and Prevention, China Center for Disease Control and Prevention, Yingxin Lane 100, Xicheng District, Beijing 100052, People' s Republic of China (China); Liao, Guoyang, E-mail: liaogy@21cn.com [No. 5, Department of Bioproducts, Institute of Medical Biology, Chinese Academy of Medical Science and Pecking Union Medical College, Jiaoling Avenue 935, Kunming, Yunnan Province 650102, People' s Republic of China (China)

    2012-05-18

    Highlights: Black-Right-Pointing-Pointer Vero cell-based HPAI H5N1 vaccine with stable high yield. Black-Right-Pointing-Pointer Stable high yield derived from the YNVa H3N2 backbone. Black-Right-Pointing-Pointer H5N1/YNVa has a similar safety and immunogenicity to H5N1delta. -- Abstract: Highly pathogenic avian influenza (HPAI) viruses pose a global pandemic threat, for which rapid large-scale vaccine production technology is critical for prevention and control. Because chickens are highly susceptible to HPAI viruses, the supply of chicken embryos for vaccine production might be depleted during a virus outbreak. Therefore, developing HPAI virus vaccines using other technologies is critical. Meeting vaccine demand using the Vero cell-based fermentation process has been hindered by low stability and yield. In this study, a Vero cell-based HPAI H5N1 vaccine candidate (H5N1/YNVa) with stable high yield was achieved by reassortment of the Vero-adapted (Va) high growth A/Yunnan/1/2005(H3N2) (YNVa) virus with the A/Anhui/1/2005(H5N1) attenuated influenza vaccine strain (H5N1delta) using the 6/2 method. The reassorted H5N1/YNVa vaccine maintained a high hemagglutination (HA) titer of 1024. Furthermore, H5N1/YNVa displayed low pathogenicity and uniform immunogenicity compared to that of the parent virus.

  14. Teaching "Candide": A Debate.

    Science.gov (United States)

    Braun, Theodore E. D.; And Others

    1988-01-01

    Two different approaches to teaching Voltaire's "Candide", one deriving meaning from the textual fabric or "inside" of the story and the other focusing on the author's "external" intent in writing the story, are presented and compared. (MSE)

  15. [Bioinformatics-based Design of Peptide Vaccine Candidates Targeting Spike Protein of MERS-CoV and Immunity analysis in Mice].

    Science.gov (United States)

    Lan, Jiaming; Lu, Shuai; Deng, Yao; Wen, Bo; Chen, Hong; Wang, Wen; Tan, Wenjie

    2016-01-01

    Middle East respiratory syndrome coronavirus (MERS-CoV) was identified as a novel human coronavirus and posed great threat to public health world wide,which calls for the development of effective and safe vaccine urgently. In the study, peptide epitopes tagrgeting spike antigen were predicted based on bioinformatics methods. Nine polypeptides with high scores were synthesized and linked to keyhole limpet hemocyanin (KLH). Female BALB/C mice were immunized with individual polypeptide-KLH, and the total IgG was detected by ELISA as well as the cellular mediated immunity (CMI) was analyzed using ELIs-pot assay. The results showed that an individual peptide of YVDVGPDSVKSACIEVDIQQTFFDKTWPRPIDVSKADGI could induce the highest level of total IgG as well as CMI (high frequency of IFN-γ secretion) against MERS-CoV antigen in mice. Our study identified a promising peptide vaccine candidate against MERS-CoV and provided an experimental support for bioinformatics-based design of peptide vaccine.

  16. Single crystal growth of europium and ytterbium based intermetallic compounds using metal flux technique

    Indian Academy of Sciences (India)

    Sumanta Sarkar; Sebastian C Peter

    2012-11-01

    This article covers the use of indium as a potential metal solvent for the crystal growth of europium and ytterbium-based intermetallic compounds. A brief view about the advantage of metal flux technique and the use of indium as reactive and non-reactive flux are outlined. Large single crystals of EuGe2, EuCoGe3 and Yb2AuGe3 compounds were obtained in high yield from the reactions of the elements in liquid indium. The results presented here demonstrate that considerable advances in the discovery of single crystal growth of complex phases are achievable utilizing molten metals as solvents.

  17. Usolka section (southern Urals, Russia: a potential candidate for GSSP to define the base of the Gzhelian Stage in the global chronostratigraphic scale

    Directory of Open Access Journals (Sweden)

    Valery V. Chernykh

    2006-12-01

    Full Text Available Conodont species Streptognathodus simulator Ellison, 1941 has been proposed recently to define the Kasimovian-Gzhelian boundary in the global chronostratigraphic scale.The species distributed globally and traditionally has been used as a marker of the base of the Gzhelian Stage in the type sections in Moscow Basin and Urals. Recent studies of conodont taxonomy and biostratigraphy in southern Urals have established the chronocline with ascendant and descendant to Streptognathodus simulator species. Usolka section proposed here as a potential candidate for the GSSP (Global Stratotype Section and Point to define the global Gzhelian Stage at the FAD of the Streptognathodus simulator within the chronocline Streptognathodus praenuntius Chernykh, 2005 – St. simulator Ellison, 1941 – St. auritus Chernykh, 2005. The chronocline recovered within 2.7 m of beds 4 and 5 at the Usolka section, with all three species described and properly figured. No obvious interruptions in sedimentation are recorded within the Kasimovian-Gzhelian transition there. Several volcanic ash beds are present below and above the proposed boundary, making radiometric calibration highly possible in the near future. Mode of preservation of conodonts with a CAI of around 1.0–1.5 provides excellent basis for the geochemical studies. Accessibility presently is adequate, and this exposure will be improved and maintained permanently for interested scientists. Future access will be guaranteed by means of legislative action to create a scientific preserve.

  18. ZDHHC8 as a candidate gene for schizophrenia: Analysis of a putative functional intronic marker in case-control and family-based association studies

    Directory of Open Access Journals (Sweden)

    Jabs Burkhard

    2005-10-01

    Full Text Available Abstract Background The chromosome 22q11 region is proposed as a major candidate locus for susceptibility genes to schizophrenia. Recently, the gene ZDHHC8 encoding a putative palmitoyltransferase at 22q11 was proposed to increase liability to schizophrenia based on both animal models and human association studies by significant over-transmission of allele rs175174A in female, but not male subjects with schizophrenia. Methods Given the genetic complexity of schizophrenia and the potential genetic heterogeneity in different populations, we examined rs175174 in 204 German proband-parent triads and in an independent case-control study (schizophrenic cases: n = 433; controls: n = 186. Results In the triads heterozygous parents transmitted allele G preferentially to females, and allele A to males (heterogeneity χ2 = 4.43; p = 0.035. The case-control sample provided no further evidence for overall or gender-specific effects regarding allele and genotype frequency distributions. Conclusion The findings on rs175174 at ZDHHC8 are still far from being conclusive, but evidence for sexual dimorphism is moderate, and our data do not support a significant genetic contribution of rs175174 to the aetiopathogenesis of schizophrenia.

  19. TAXONOMY AND BIOSTRATIGRAPHIC RECORD OF THE UPPER TRIASSIC CONODONTS OF THE PIZZO MONDELLO SECTION (WESTERN SICILY, ITALY, GSSP CANDIDATE FOR THE BASE OF THE NORIAN

    Directory of Open Access Journals (Sweden)

    MICHELE MAZZA

    2012-03-01

    Full Text Available New taxonomic and biostratigraphic investigations on the late Carnian to Rhaetian (Upper Triassic platform conodonts from the Pizzo Mondello section (Western Sicily, Italy, Sicano basin are here presented. Pizzo Mondello is one of the two GSSP candidates for the Carnian/Norian boundary; the section is a 430 m thick continuous succession of upper Carnian to upper Norian marine limestones (Scillato Formation, characterized by uniform facies and high sedimentation rates, and ca. 20 m of Rhaetian white calcilutites (Portella Gebbia limestone. Pizzo Mondello offers one of the most complete conodont records for this time interval in the Tethys. The conodont faunas are characterized by a large variety of species, belonging to the genera Carnepigondolella, Epigondolella, Metapolygnathus, Misikella, Mockina, Neocavitella, Norigondolella, Paragondolella, and Parvigondolella. The richness of the populations allowed a detailed revision and description of all the Upper Triassic species and morphotypes recovered. The revision of the problematic species Carnepigondolella nodosa and "Metapolygnathus communisti B" was thus possible, leading to the establishment of two new species: Carnepigondolella tuvalica n.sp. and Carnepigondolella gulloae n.sp. The latter species would be a good proxy for the Carnian/Norian boundary in the case that the FAD of Halobia austriaca (sample FNP135a will be selected as the primary biomarker for the base of the Norian. 

  20. Protection against multiple influenza A virus strains induced by candidate recombinant vaccine based on heterologous M2e peptides linked to flagellin.

    Directory of Open Access Journals (Sweden)

    Liudmila A Stepanova

    Full Text Available Matrix 2 protein ectodomain (M2e is considered a promising candidate for a broadly protective influenza vaccine. M2e-based vaccines against human influenza A provide only partial protection against avian influenza viruses because of differences in the M2e sequences. In this work, we evaluated the possibility of obtaining equal protection and immune response by using recombinant protein on the basis of flagellin as a carrier of the M2e peptides of human and avian influenza A viruses. Recombinant protein was generated by the fusion of two tandem copies of consensus M2e sequence from human influenza A and two copies of M2e from avian A/H5N1 viruses to flagellin (Flg-2M2eh2M2ek. Intranasal immunisation of Balb/c mice with recombinant protein significantly elicited anti-M2e IgG in serum, IgG and sIgA in BAL. Antibodies induced by the fusion protein Flg-2M2eh2M2ek bound efficiently to synthetic peptides corresponding to the human consensus M2e sequence as well as to the M2e sequence of A/Chicken/Kurgan/05/05 RG (H5N1 and recognised native M2e epitopes exposed on the surface of the MDCK cells infected with A/PR/8/34 (H1N1 and A/Chicken/Kurgan/05/05 RG (H5N1 to an equal degree. Immunisation led to both anti-M2e IgG1 and IgG2a response with IgG1 prevalence. We observed a significant intracellular production of IL-4, but not IFN-γ, by CD4+ T-cells in spleen of mice following immunisation with Flg-2M2eh2M2ek. Immunisation with the Flg-2M2eh2M2ek fusion protein provided similar protection from lethal challenge with human influenza A viruses (H1N1, H3N2 and avian influenza virus (H5N1. Immunised mice experienced significantly less weight loss and decreased lung viral titres compared to control mice. The data obtained show the potential for the development of an M2e-flagellin candidate influenza vaccine with broad spectrum protection against influenza A viruses of various origins.

  1. Genetic dissection of drought and heat tolerance in chickpea through genome-wide and candidate gene-based association mapping approaches.

    Science.gov (United States)

    Thudi, Mahendar; Upadhyaya, Hari D; Rathore, Abhishek; Gaur, Pooran Mal; Krishnamurthy, Lakshmanan; Roorkiwal, Manish; Nayak, Spurthi N; Chaturvedi, Sushil Kumar; Basu, Partha Sarathi; Gangarao, N V P R; Fikre, Asnake; Kimurto, Paul; Sharma, Prakash C; Sheshashayee, M S; Tobita, Satoshi; Kashiwagi, Junichi; Ito, Osamu; Killian, Andrzej; Varshney, Rajeev Kumar

    2014-01-01

    To understand the genetic basis of tolerance to drought and heat stresses in chickpea, a comprehensive association mapping approach has been undertaken. Phenotypic data were generated on the reference set (300 accessions, including 211 mini-core collection accessions) for drought tolerance related root traits, heat tolerance, yield and yield component traits from 1-7 seasons and 1-3 locations in India (Patancheru, Kanpur, Bangalore) and three locations in Africa (Nairobi, Egerton in Kenya and Debre Zeit in Ethiopia). Diversity Array Technology (DArT) markers equally distributed across chickpea genome were used to determine population structure and three sub-populations were identified using admixture model in STRUCTURE. The pairwise linkage disequilibrium (LD) estimated using the squared-allele frequency correlations (r2; when r2<0.20) was found to decay rapidly with the genetic distance of 5 cM. For establishing marker-trait associations (MTAs), both genome-wide and candidate gene-sequencing based association mapping approaches were conducted using 1,872 markers (1,072 DArTs, 651 single nucleotide polymorphisms [SNPs], 113 gene-based SNPs and 36 simple sequence repeats [SSRs]) and phenotyping data mentioned above employing mixed linear model (MLM) analysis with optimum compression with P3D method and kinship matrix. As a result, 312 significant MTAs were identified and a maximum number of MTAs (70) was identified for 100-seed weight. A total of 18 SNPs from 5 genes (ERECTA, 11 SNPs; ASR, 4 SNPs; DREB, 1 SNP; CAP2 promoter, 1 SNP and AMDH, 1SNP) were significantly associated with different traits. This study provides significant MTAs for drought and heat tolerance in chickpea that can be used, after validation, in molecular breeding for developing superior varieties with enhanced drought and heat tolerance. PMID:24801366

  2. Genetic dissection of drought and heat tolerance in chickpea through genome-wide and candidate gene-based association mapping approaches.

    Directory of Open Access Journals (Sweden)

    Mahendar Thudi

    Full Text Available To understand the genetic basis of tolerance to drought and heat stresses in chickpea, a comprehensive association mapping approach has been undertaken. Phenotypic data were generated on the reference set (300 accessions, including 211 mini-core collection accessions for drought tolerance related root traits, heat tolerance, yield and yield component traits from 1-7 seasons and 1-3 locations in India (Patancheru, Kanpur, Bangalore and three locations in Africa (Nairobi, Egerton in Kenya and Debre Zeit in Ethiopia. Diversity Array Technology (DArT markers equally distributed across chickpea genome were used to determine population structure and three sub-populations were identified using admixture model in STRUCTURE. The pairwise linkage disequilibrium (LD estimated using the squared-allele frequency correlations (r2; when r2<0.20 was found to decay rapidly with the genetic distance of 5 cM. For establishing marker-trait associations (MTAs, both genome-wide and candidate gene-sequencing based association mapping approaches were conducted using 1,872 markers (1,072 DArTs, 651 single nucleotide polymorphisms [SNPs], 113 gene-based SNPs and 36 simple sequence repeats [SSRs] and phenotyping data mentioned above employing mixed linear model (MLM analysis with optimum compression with P3D method and kinship matrix. As a result, 312 significant MTAs were identified and a maximum number of MTAs (70 was identified for 100-seed weight. A total of 18 SNPs from 5 genes (ERECTA, 11 SNPs; ASR, 4 SNPs; DREB, 1 SNP; CAP2 promoter, 1 SNP and AMDH, 1SNP were significantly associated with different traits. This study provides significant MTAs for drought and heat tolerance in chickpea that can be used, after validation, in molecular breeding for developing superior varieties with enhanced drought and heat tolerance.

  3. Primary and Presidential Candidates

    DEFF Research Database (Denmark)

    Goddard, Joseph

    2012-01-01

    This article looks at primary and presidential candidates in 2008 and 2012. Evidence suggests that voters are less influenced by candidates’ color, gender, or religious observation than previously. Conversely, markers of difference remain salient in the imaginations of pollsters and journalists...

  4. Identification of candidate agents active against N. ceranae infection in honey bees: establishment of a medium throughput screening assay based on N. ceranae infected cultured cells.

    Directory of Open Access Journals (Sweden)

    Sebastian Gisder

    Full Text Available Many flowering plants in both natural ecosytems and agriculture are dependent on insect pollination for fruit set and seed production. Managed honey bees (Apis mellifera and wild bees are key pollinators providing this indispensable eco- and agrosystem service. Like all other organisms, bees are attacked by numerous pathogens and parasites. Nosema apis is a honey bee pathogenic microsporidium which is widely distributed in honey bee populations without causing much harm. Its congener Nosema ceranae was originally described as pathogen of the Eastern honey bee (Apis cerana but jumped host from A. cerana to A. mellifera about 20 years ago and spilled over from A. mellifera to Bombus spp. quite recently. N. ceranae is now considered a deadly emerging parasite of both Western honey bees and bumblebees. Hence, novel and sustainable treatment strategies against N. ceranae are urgently needed to protect honey and wild bees. We here present the development of an in vitro medium throughput screening assay for the identification of candidate agents active against N. ceranae infections. This novel assay is based on our recently developed cell culture model for N. ceranae and coupled with an RT-PCR-ELISA protocol for quantification of N. ceranae in infected cells. The assay has been adapted to the 96-well microplate format to allow automated analysis. Several substances with known (fumagillin or presumed (surfactin or no (paromomycin activity against N. ceranae were tested as well as substances for which no data concerning N. ceranae inhibition existed. While fumagillin and two nitroimidazoles (metronidazole, tinidazole totally inhibited N. ceranae proliferation, all other test substances were inactive. In summary, the assay proved suitable for substance screening and demonstrated the activity of two synthetic antibiotics against N. ceranae.

  5. Planetary Candidates Observed by Kepler. VII. The First Fully Uniform Catalog Based on the Entire 48-month Data Set (Q1-Q17 DR24)

    Science.gov (United States)

    Coughlin, Jeffrey L.; Mullally, F.; Thompson, Susan E.; Rowe, Jason F.; Burke, Christopher J.; Latham, David W.; Batalha, Natalie M.; Ofir, Aviv; Quarles, Billy L.; Henze, Christopher E.; Wolfgang, Angie; Caldwell, Douglas A.; Bryson, Stephen T.; Shporer, Avi; Catanzarite, Joseph; Akeson, Rachel; Barclay, Thomas; Borucki, William J.; Boyajian, Tabetha S.; Campbell, Jennifer R.; Christiansen, Jessie L.; Girouard, Forrest R.; Haas, Michael R.; Howell, Steve B.; Huber, Daniel; Jenkins, Jon M.; Li, Jie; Patil-Sabale, Anima; Quintana, Elisa V.; Ramirez, Solange; Seader, Shawn; Smith, Jeffrey C.; Tenenbaum, Peter; Twicken, Joseph D.; Zamudio, Khadeejah A.

    2016-05-01

    We present the seventh Kepler planet candidate (PC) catalog, which is the first catalog to be based on the entire, uniformly processed 48-month Kepler data set. This is the first fully automated catalog, employing robotic vetting procedures to uniformly evaluate every periodic signal detected by the Q1-Q17 Data Release 24 (DR24) Kepler pipeline. While we prioritize uniform vetting over the absolute correctness of individual objects, we find that our robotic vetting is overall comparable to, and in most cases superior to, the human vetting procedures employed by past catalogs. This catalog is the first to utilize artificial transit injection to evaluate the performance of our vetting procedures and to quantify potential biases, which are essential for accurate computation of planetary occurrence rates. With respect to the cumulative Kepler Object of Interest (KOI) catalog, we designate 1478 new KOIs, of which 402 are dispositioned as PCs. Also, 237 KOIs dispositioned as false positives (FPs) in previous Kepler catalogs have their disposition changed to PC and 118 PCs have their disposition changed to FPs. This brings the total number of known KOIs to 8826 and PCs to 4696. We compare the Q1-Q17 DR24 KOI catalog to previous KOI catalogs, as well as ancillary Kepler catalogs, finding good agreement between them. We highlight new PCs that are both potentially rocky and potentially in the habitable zone of their host stars, many of which orbit solar-type stars. This work represents significant progress in accurately determining the fraction of Earth-size planets in the habitable zone of Sun-like stars. The full catalog is publicly available at the NASA Exoplanet Archive.

  6. Identification of candidate agents active against N. ceranae infection in honey bees: establishment of a medium throughput screening assay based on N. ceranae infected cultured cells.

    Science.gov (United States)

    Gisder, Sebastian; Genersch, Elke

    2015-01-01

    Many flowering plants in both natural ecosytems and agriculture are dependent on insect pollination for fruit set and seed production. Managed honey bees (Apis mellifera) and wild bees are key pollinators providing this indispensable eco- and agrosystem service. Like all other organisms, bees are attacked by numerous pathogens and parasites. Nosema apis is a honey bee pathogenic microsporidium which is widely distributed in honey bee populations without causing much harm. Its congener Nosema ceranae was originally described as pathogen of the Eastern honey bee (Apis cerana) but jumped host from A. cerana to A. mellifera about 20 years ago and spilled over from A. mellifera to Bombus spp. quite recently. N. ceranae is now considered a deadly emerging parasite of both Western honey bees and bumblebees. Hence, novel and sustainable treatment strategies against N. ceranae are urgently needed to protect honey and wild bees. We here present the development of an in vitro medium throughput screening assay for the identification of candidate agents active against N. ceranae infections. This novel assay is based on our recently developed cell culture model for N. ceranae and coupled with an RT-PCR-ELISA protocol for quantification of N. ceranae in infected cells. The assay has been adapted to the 96-well microplate format to allow automated analysis. Several substances with known (fumagillin) or presumed (surfactin) or no (paromomycin) activity against N. ceranae were tested as well as substances for which no data concerning N. ceranae inhibition existed. While fumagillin and two nitroimidazoles (metronidazole, tinidazole) totally inhibited N. ceranae proliferation, all other test substances were inactive. In summary, the assay proved suitable for substance screening and demonstrated the activity of two synthetic antibiotics against N. ceranae.

  7. Evaluation and Selection of Bacillus Species Based on Enzyme Production, Antimicrobial Activity, and Biofilm Synthesis as Direct-Fed Microbial Candidates for Poultry

    Science.gov (United States)

    Latorre, Juan D.; Hernandez-Velasco, Xochitl; Wolfenden, Ross E.; Vicente, Jose L.; Wolfenden, Amanda D.; Menconi, Anita; Bielke, Lisa R.; Hargis, Billy M.; Tellez, Guillermo

    2016-01-01

    Social concern about misuse of antibiotics as growth promoters (AGP) and generation of multidrug-resistant bacteria have restricted the dietary inclusion of antibiotics in livestock feed in several countries. Direct-fed microbials (DFM) are one of the multiple alternatives commonly evaluated as substitutes of AGP. Sporeformer bacteria from the genus Bacillus have been extensively investigated because of their extraordinary properties to form highly resistant endospores, produce antimicrobial compounds, and synthesize different exogenous enzymes. The purpose of the present study was to evaluate and select Bacillus spp. from environmental and poultry sources as DFM candidates, considering their enzyme production profile, biofilm synthesis capacity, and pathogen-inhibition activity. Thirty-one Bacillus isolates were screened for in vitro relative enzyme activity of amylase, protease, lipase, and phytase using a selective media for each enzyme, with 3/31 strains selected as superior enzyme producers. These three isolates were identified as Bacillus subtilis (1/3), and Bacillus amyloliquefaciens (2/3), based on biochemical tests and 16S rRNA sequence analysis. For evaluation of biofilm synthesis, the generation of an adherent crystal violet-stained ring was determined in polypropylene tubes, resulting in 11/31 strains showing a strong biofilm formation. Moreover, all Bacillus strains were evaluated for growth inhibition activity against Salmonella enterica serovar Enteritidis (26/31), Escherichia coli (28/31), and Clostridioides difficile (29/31). Additionally, in previous in vitro and in vivo studies, these selected Bacillus strains have shown to be resistant to different biochemical conditions of the gastrointestinal tract of poultry. Results of the present study suggest that the selection and consumption of Bacillus-DFM, producing a variable set of enzymes and antimicrobial compounds, may contribute to enhanced performance through improving nutrient digestibility

  8. Oral Candidal Colonization in the Patients with RPDs by Different Base Materials%RPDs基托材料对口腔念珠菌定植的影响

    Institute of Scientific and Technical Information of China (English)

    姜薇; 陈骏; 吴凌莉; 何祥一; 车团结

    2011-01-01

    目的:初步研究可摘局部义齿(RPDs)不同基托材料对口腔念珠菌的定植的影响.方法:临床随机选择RPDs修复患者147例.其中树脂基托义齿(A组)58例,钴铬合金铸造基托义齿(B组)63例,纯钛及钛合金铸造基托义齿(C组)26例.吐唾法取样,用CHROMagar培养基鉴定念珠菌菌种.培养基中念珠菌菌落计数为每个样本的念珠菌检出强度.通过统计学方法,比较3组不同基托材料义齿戴用人群念珠菌检出率和检出强度的差异.结果:147例不同基托材料义齿戴用人群中检出的念珠菌包括白色念珠菌、热带念珠菌、克柔念珠菌3个菌种.A、B、C组白色念珠菌和非白色念珠菌检出率无显著差异.白色念珠菌的菌落形成单位数,A组显著高于B、C组(P<0.05);B组显著高于C组(P<0.05).非白色念珠菌间的菌落形成单位数无明显差异.结论:戴不同材料义齿患者口腔除了能检出白色念珠菌,还可检出非白色念珠菌;口腔念珠菌的菌落形成单位数与义齿基托材料密切相关,钛及钛合金基托义齿应为预防义齿性口炎的首选义齿.%Objective: To study of the oral Candidal colonization status with different base-materials denture. Methods: 147 cases who wear RPDs were divided into three groups: group A (resin base denture), group B (Co- Cr alloy base denture) . And group C (Titanium and Titanium alloy base denture). Non- stimulated saliva were collected by standard procedure as before. Salivary samples were inoculated on CHROMagar Candida? To identify Candida strains. The total number of colonies was considered as the detectable intensity of oral Candida. Statistical analysis was used to compare the differences of detection rate and detection intensity between three denture materials. Results; Candida was isolated from 147 cases who wear different base materials denture, such as Candida albi-cans. Candida tropical, Candida krusei. The frequency of Candida

  9. A 2015 International Geomagnetic Reference Field (IGRF) candidate model based on Swarm’s experimental absolute magnetometer vector mode data

    DEFF Research Database (Denmark)

    Vigneron, Pierre; Hulot, Gauthier; Olsen, Nils;

    2015-01-01

    geographical distribution of the selected data set (essentially due to a lack of availability of data at high northern latitude satisfying nighttime conditions at the end of the time period considered). These appear to be comparable to differences classically observed among IGRF candidate models...... to epoch 2015.0 and truncated at degree and order 13. The resulting ASM-only 2015.0 IGRF candidate model is compared to analogous models derived from the mission’s nominal data and to the now-published final 2015.0 IGRF model. Differences among models mainly highlight uncertainties enhanced by the limited...

  10. Do People 'Like' Candidates on Facebook?

    DEFF Research Database (Denmark)

    Nielsen, Rasmus Kleis

    The online popularity of a few exceptional candidates has led many to suggest that social media have given politicians powerful ways of communicating directly with voters. In this paper, we examine whether this is happening on a significant scale and show, based on analysis of 224 candidates....... We therefore suggest that the political implications of social media are generally better understood in terms of facilitating indirect communication and institutional change than in terms of direct communication....

  11. The Relating Level of Teacher Candidates Based on Scientific Information with Their Daily Lives: A Case of Ataturk and Caucasian Universities

    Science.gov (United States)

    Kurt, Murat

    2014-01-01

    The aim of this research is to determine and compare candidate teachers' level of relating scientific information with their daily lives. The teachers were studying in the 1st and 4th classes in Atatürk and Caucasian Universities, Education Faculty, Elementary School Science Teaching Department during the 2012-2013 academic year. The research…

  12. CASE via MS: Ranking Structure Candidates by Mass Spectra

    OpenAIRE

    Kerber, Adalbert; Meringer, Markus; Rücker, Christoph

    2006-01-01

    Two important tasks in computer-aided structure elucidation (CASE) are the generation of candidate structures from a given molecular formula, and the ranking of structure candidates according to compatibility with an experimental spectrum. Candidate ranking with respect to electron impact mass spectra is based on virtual fragmentation of a candidate structure and comparison of the fragments’ isotope distributions against the spectrum of the unknown compound, whence a structure–spectrum compat...

  13. RNA-Seq Based Identification of Candidate Parasitism Genes of Cereal Cyst Nematode (Heterodera avenae during Incompatible Infection to Aegilops variabilis.

    Directory of Open Access Journals (Sweden)

    Minghui Zheng

    targets with potential lethality were screened out and primarily validated, which provide candidates for engineering-based control of cereal cyst nematode in crops breeding.

  14. Prospects for high-z cluster detections with Planck, based on a follow-up of 28 candidates using MegaCam@CFHT

    CERN Document Server

    van der Burg, R F J; Pratt, G W; Arnaud, M; Melin, J -B; Aghanim, N; Barrena, R; Dahle, H; Douspis, M; Ferragamo, A; Fromenteau, S; Herbonnet, R; Hurier, G; Pointecouteau, E; Rubino-Martin, J A; Streblyanska, A

    2015-01-01

    The Planck catalogue of SZ sources limits itself to a significance threshold of 4.5 to ensure a low contamination rate by false cluster candidates. This means that only the most massive clusters at redshift z>0.5, and in particular z>0.7, are expected to enter into the catalogue, with a large number of systems in that redshift regime being expected around and just below that threshold. In this paper, we follow-up a sample of SZ sources from the Planck SZ catalogues from 2013 and 2015. In the latter maps, we consider detections around and at lower significance than the threshold adopted by the Planck Collaboration. To keep the contamination rate low, our 28 candidates are chosen to have significant WISE detections, in combination with non-detections in SDSS/DSS, which effectively selects galaxy cluster candidates at redshifts $z\\gtrsim0.5$. By taking r- and z-band imaging with MegaCam@CFHT, we bridge the 4000A rest-frame break over a significant redshift range, thus allowing accurate redshift estimates of red-...

  15. Differential CD4+ versus CD8+ T-Cell Responses Elicited by Different Poxvirus-Based Human Immunodeficiency Virus Type 1 Vaccine Candidates Provide Comparable Efficacies in Primates▿ †

    OpenAIRE

    Mooij, Petra; Balla-Jhagjhoorsingh, Sunita S.; Koopman, Gerrit; Beenhakker, Niels; van Haaften, Patricia; Baak, Ilona; Nieuwenhuis, Ivonne G.; Kondova, Ivanela; Wagner, Ralf; Wolf, Hans; Gómez, Carmen E.; José L Nájera; Jiménez, Victoria; Esteban, Mariano; Heeney, Jonathan L.

    2008-01-01

    Poxvirus vectors have proven to be highly effective for boosting immune responses in diverse vaccine settings. Recent reports reveal marked differences in the gene expression of human dendritic cells infected with two leading poxvirus-based human immunodeficiency virus (HIV) vaccine candidates, New York vaccinia virus (NYVAC) and modified vaccinia virus Ankara (MVA). To understand how complex genomic changes in these two vaccine vectors translate into antigen-specific systemic immune response...

  16. Immunogenicity of a virosomally-formulated Plasmodium falciparum GLURP-MSP3 chimeric protein-based malaria vaccine candidate in comparison to adjuvanted formulations

    Directory of Open Access Journals (Sweden)

    Tamborrini Marco

    2011-12-01

    Full Text Available Abstract Background In clinical trials, immunopotentiating reconstituted influenza virosomes (IRIVs have shown great potential as a versatile antigen delivery platform for synthetic peptides derived from Plasmodium falciparum antigens. This study describes the immunogenicity of a virosomally-formulated recombinant fusion protein comprising domains of the two malaria vaccine candidate antigens MSP3 and GLURP. Methods The highly purified recombinant protein GMZ2 was coupled to phosphatidylethanolamine and the conjugates incorporated into the membrane of IRIVs. The immunogenicity of this adjuvant-free virosomal formulation was compared to GMZ2 formulated with the adjuvants Montanide ISA 720 and Alum in three mouse strains with different genetic backgrounds. Results Intramuscular injections of all three candidate vaccine formulations induced GMZ2-specific antibody responses in all mice tested. In general, the humoral immune response in outbred NMRI mice was stronger than that in inbred BALB/c and C57BL/6 mice. ELISA with the recombinant antigens demonstrated immunodominance of the GLURP component over the MSP3 component. However, compared to the Al(OH3-adjuvanted formulation the two other formulations elicited in NMRI mice a larger proportion of anti-MSP3 antibodies. Analyses of the induced GMZ2-specific IgG subclass profiles showed for all three formulations a predominance of the IgG1 isotype. Immune sera against all three formulations exhibited cross-reactivity with in vitro cultivated blood-stage parasites. Immunofluorescence and immunoblot competition experiments showed that both components of the hybrid protein induced IgG cross-reactive with the corresponding native proteins. Conclusion A virosomal formulation of the chimeric protein GMZ2 induced P. falciparum blood stage parasite cross-reactive IgG responses specific for both MSP3 and GLURP. GMZ2 thus represents a candidate component suitable for inclusion into a multi-valent virosomal

  17. Identification and Comparison of Candidate Olfactory Genes in the Olfactory and Non-Olfactory Organs of Elm Pest Ambrostoma quadriimpressum (Coleoptera: Chrysomelidae Based on Transcriptome Analysis.

    Directory of Open Access Journals (Sweden)

    Yinliang Wang

    Full Text Available The leaf beetle Ambrostoma quadriimpressum (Coleoptera: Chrysomelidae is a predominant forest pest that causes substantial damage to the lumber industry and city management. However, no effective and environmentally friendly chemical method has been discovered to control this pest. Until recently, the molecular basis of the olfactory system in A. quadriimpressum was completely unknown. In this study, antennae and leg transcriptomes were analyzed and compared using deep sequencing data to identify the olfactory genes in A. quadriimpressum. Moreover, the expression profiles of both male and female candidate olfactory genes were analyzed and validated by bioinformatics, motif analysis, homology analysis, semi-quantitative RT-PCR and RT-qPCR experiments in antennal and non-olfactory organs to explore the candidate olfactory genes that might play key roles in the life cycle of A. quadriimpressum. As a result, approximately 102.9 million and 97.3 million clean reads were obtained from the libraries created from the antennas and legs, respectively. Annotation led to 34344 Unigenes, which were matched to known proteins. Annotation data revealed that the number of genes in antenna with binding functions and receptor activity was greater than that of legs. Furthermore, many pathway genes were differentially expressed in the two organs. Sixteen candidate odorant binding proteins (OBPs, 10 chemosensory proteins (CSPs, 34 odorant receptors (ORs, 20 inotropic receptors [1] and 2 sensory neuron membrane proteins (SNMPs and their isoforms were identified. Additionally, 15 OBPs, 9 CSPs, 18 ORs, 6 IRs and 2 SNMPs were predicted to be complete ORFs. Using RT-PCR, RT-qPCR and homology analysis, AquaOBP1/2/4/7/C1/C6, AquaCSP3/9, AquaOR8/9/10/14/15/18/20/26/29/33, AquaIR8a/13/25a showed olfactory-specific expression, indicating that these genes might play a key role in olfaction-related behaviors in A. quadriimpressum such as foraging and seeking. AquaOBP4/C5, Aqua

  18. Various Approaches for Targeting Quasar Candidates

    Science.gov (United States)

    Zhang, Y.; Zhao, Y.

    2015-09-01

    With the establishment and development of space-based and ground-based observational facilities, the improvement of scientific output of high-cost facilities is still a hot issue for astronomers. The discovery of new and rare quasars attracts much attention. Different methods to select quasar candidates are in bloom. Among them, some are based on color cuts, some are from multiwavelength data, some rely on variability of quasars, some are based on data mining, and some depend on ensemble methods.

  19. A novel dengue virus serotype 1 vaccine candidate based on Japanese encephalitis virus vaccine strain SA14-14-2 as the backbone.

    Science.gov (United States)

    Yang, Huiqiang; Li, Zhushi; Lin, Hua; Wang, Wei; Yang, Jian; Liu, Lina; Zeng, Xianwu; Wu, Yonglin; Yu, Yongxin; Li, Yuhua

    2016-06-01

    To develop a potential dengue vaccine candidate, a full-length cDNA clone of a novel chimeric virus was constructed using recombinant DNA technology, with Japanese encephalitis virus (JEV) vaccine strain SA14-14-2 as the backbone, with its premembrane (prM) and envelope (E) genes substituted by their counterparts from dengue virus type 1 (DENV1). The chimeric virus (JEV/DENV1) was successfully recovered from primary hamster kidney (PHK) cells by transfection with the in vitro transcription products of JEV/DENV1 cDNA and was identified by complete genome sequencing and immunofluorescent staining. No neuroinvasiveness of this chimeric virus was observed in mice inoculated by the subcutaneous route (s.c.) or by the intraperitoneal route (i.p.), while some neurovirulence was displayed in mice that were inoculated directly by the intracerebral route (i.c.). The chimeric virus was able to stimulate high-titer production of antibodies against DENV1 and provided protection against lethal challenge with neuroadapted dengue virus in mice. These results suggest that the chimeric virus is a promising dengue vaccine candidate. PMID:26976137

  20. Hypervelocity Star Candidates in the SEGUE G & K Dwarf Sample

    CERN Document Server

    Palladino, Lauren E; Holley-Bockelmann, Kelly; Prieto, Carlos Allende; Beers, Timothy C; Lee, Young Sun; Schneider, Donald P

    2013-01-01

    We identify 13 candidate hypervelocity stars from the Sloan Extension for Galactic Understanding and Exploration (SEGUE) G and K dwarf samples. Previous searches for hypervelocity stars have only focused on large radial velocities; in this study we also use proper motions to select the candidates. We determine the hypervelocity likelihood of each candidate, considering the significant errors often associated with high proper motion stars via Monte Carlo simulations. We find that more than half of the candidates exceed their escape velocities with at least 90% probability. All of our candidates also have less than a 60% chance of being a high velocity fluke within the SEGUE sample. Based on orbits calculated using the observed 6-d positions and velocities, few, if any, of these candidates originate from the Galactic Center. If these candidates are truly hypervelocity stars, they were not ejected by interactions with the Milky Way's supermassive black hole. This calls for a more serious examination of alternati...

  1. Research on the Social-cost-based Model for Bid Evaluation of BOT Project Concession Candidates%考虑社会成本的BOT项目特许经营者评标模型研究

    Institute of Scientific and Technical Information of China (English)

    路浩; 何德文

    2014-01-01

    对于BOT项目委托方而言,项目的价值在于社会效益的实现程度而不仅仅是考虑项目的建设成本。提出了一套考虑社会成本的BOT项目特许经营者评标属性集,当特许经营者评标属性的权重已知,评标委员会对各属性的评价以及业主对特许经营者的偏好不确定的情况下,运用区间数和灰色关联分析来构建特许经营者评标模型,通过引入区间数距离,求得区间数的灰色关联度,最终对各候选特许经营者进行排序。由于该模型考虑了社会成本因素,对促使特许经营者更加合理地规划项目方案,减少社会成本的形成具有一定的作用。此外,引入区间数来处理社会成本等模糊评价信息,提高了评标结果的科学性。%For BOT project clients,the project value is to realize social benefit,rather than merely to consider the construction cost of the project. This paper presents a set of social-cost-based attributes for bid evaluation of BOT project concession candidates. The bid evaluation committee can develop a model for bid evaluation of concession candidates based on interval numbers and grey relational analysis,if they understand weighted attributes and face uncertainties concerning the attributes evaluation and the owner’s preference for concession candidates. The ranking of concession candidates can be done by obtaining grey correlation for interval numbers through the distance between interval numbers. This social-cost-based model is established to contribute to less social costs by forcing a concession candidate to work out a more reasonable operational scheme. Meanwhile,uncertain information for decision making is offset by interval numbers,yielding more practical evaluation results.

  2. Protective effects of a Modified Vaccinia Ankara-based vaccine candidate against Crimean-Congo Haemorrhagic Fever virus require both cellular and humoral responses.

    Directory of Open Access Journals (Sweden)

    Stuart D Dowall

    Full Text Available Crimean-Congo Haemorrhagic Fever (CCHF is a severe tick-borne disease, endemic in many countries in Africa, the Middle East, Eastern Europe and Asia. There is no approved vaccine currently available against CCHF. The most promising candidate, which has previously been shown to confer protection in the small animal model, is a modified Vaccinia Ankara virus vector expressing the CCHF viral glycoprotein (MVA-GP. It has been shown that MVA-GP induces both humoral and cellular immunogenicity. In the present study, sera and T-lymphocytes were passively and adoptively transferred into recipient mice prior to challenge with CCHF virus. Results demonstrated that mediators from both arms of the immune system were required to demonstrate protective effects against lethal challenge.

  3. Protective effects of a Modified Vaccinia Ankara-based vaccine candidate against Crimean-Congo Haemorrhagic Fever virus require both cellular and humoral responses.

    Science.gov (United States)

    Dowall, Stuart D; Graham, Victoria A; Rayner, Emma; Hunter, Laura; Watson, Robert; Taylor, Irene; Rule, Antony; Carroll, Miles W; Hewson, Roger

    2016-01-01

    Crimean-Congo Haemorrhagic Fever (CCHF) is a severe tick-borne disease, endemic in many countries in Africa, the Middle East, Eastern Europe and Asia. There is no approved vaccine currently available against CCHF. The most promising candidate, which has previously been shown to confer protection in the small animal model, is a modified Vaccinia Ankara virus vector expressing the CCHF viral glycoprotein (MVA-GP). It has been shown that MVA-GP induces both humoral and cellular immunogenicity. In the present study, sera and T-lymphocytes were passively and adoptively transferred into recipient mice prior to challenge with CCHF virus. Results demonstrated that mediators from both arms of the immune system were required to demonstrate protective effects against lethal challenge.

  4. Electoral Systems and Candidate Selection

    NARCIS (Netherlands)

    Hazan, Reuven Y.; Voerman, Gerrit

    2006-01-01

    Electoral systems at the national level and candidate selection methods at the party level are connected, maybe not causally but they do influence each other. More precisely, the electoral system constrains and conditions the parties' menu of choices concerning candidate selection. Moreover, in ligh

  5. Newly identified YSO candidates towards the LDN 1188

    CERN Document Server

    Marton, Gábor; Kiss, Csaba; Smidla, József

    2013-01-01

    We present an analysis of Young Stellar Object (YSO) candidates towards the LDN 1188 molecular cloud. The YSO candidates were selected from the WISE all-sky catalogue, based on a statistical method. We found 601 candidates in the region, and classified them as Class I, Flat and Class II YSOs. Groups were identified and described with the Minimal Spanning Tree (MST) method. Previously identified molecular cores show evidence of ongoing star formation at different stages throughout the cloud complex.

  6. Generation and characterization of potential dengue vaccine candidates based on domain III of the envelope protein and the capsid protein of the four serotypes of dengue virus.

    Science.gov (United States)

    Suzarte, Edith; Marcos, Ernesto; Gil, Lázaro; Valdés, Iris; Lazo, Laura; Ramos, Yassel; Pérez, Yusleidi; Falcón, Viviana; Romero, Yaremis; Guzmán, María G; González, Sirenia; Kourí, Juan; Guillén, Gerardo; Hermida, Lisset

    2014-07-01

    Dengue is currently one of the most important arthropod-borne diseases, causing up to 25,000 deaths annually. There is currently no vaccine to prevent dengue virus infection, which needs a tetravalent vaccine approach. In this work, we describe the cloning and expression in Escherichia coli of envelope domain III-capsid chimeric proteins (DIIIC) of the four dengue serotypes as a tetravalent dengue vaccine candidate that is potentially able to generate humoral and cellular immunity. The recombinant proteins were purified to more than 85 % purity and were recognized by anti-dengue mouse and human sera. Mass spectrometry analysis verified the identity of the proteins and the correct formation of the intracatenary disulfide bond in the domain III region. The chimeric DIIIC proteins were also serotype-specific, and in the presence of oligonucleotides, they formed aggregates that were visible by electron microscopy. These results support the future use of DIIIC recombinant chimeric proteins in preclinical studies in mice for assessing their immunogenicity and efficacy. PMID:24420159

  7. SU-B-213-00: Education Council Symposium: Accreditation and Certification: Establishing Educational Standards and Evaluating Candidates Based on these Standards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2015-06-15

    The North American medical physics community validates the education received by medical physicists and the clinical qualifications for medical physicists through accreditation of educational programs and certification of medical physicists. Medical physics educational programs (graduate education and residency education) are accredited by the Commission on Accreditation of Medical Physics Education Programs (CAMPEP), whereas medical physicists are certified by several organizations, the most familiar of which is the American Board of Radiology (ABR). In order for an educational program to become accredited or a medical physicist to become certified, the applicant must meet certain specified standards set by the appropriate organization. In this Symposium, representatives from both CAMPEP and the ABR will describe the process by which standards are established as well as the process by which qualifications of candidates for accreditation or certification are shown to be compliant with these standards. The Symposium will conclude with a panel discussion. Learning Objectives: Recognize the difference between accreditation of an educational program and certification of an individual Identify the two organizations primarily responsible for these tasks Describe the development of educational standards Describe the process by which examination questions are developed GS is Executive Secretary of CAMPEP.

  8. The power of low-resolution spectroscopy: On the spectral classification of planet candidates in the ground-based CoRoT follow-up

    CERN Document Server

    Eiff, M Ammler-von; Guenther, E W; Stecklum, B; Cabrera, J

    2015-01-01

    Planetary transits detected by the CoRoT mission can be mimicked by a low-mass star in orbit around a giant star. Spectral classification helps to identify the giant stars and also early-type stars which are often excluded from further follow-up. We study the potential and the limitations of low-resolution spectroscopy to improve the photometric spectral types of CoRoT candidates. In particular, we want to study the influence of the signal-to-noise ratio (SNR) of the target spectrum in a quantitative way. We built an own template library and investigate whether a template library from the literature is able to reproduce the classifications. Including previous photometric estimates, we show how the additional spectroscopic information improves the constraints on spectral type. Low-resolution spectroscopy ($R\\approx$1000) of 42 CoRoT targets covering a wide range in SNR (1-437) and of 149 templates was obtained in 2012-2013 with the Nasmyth spectrograph at the Tautenburg 2m telescope. Spectral types have been d...

  9. SU-B-213-00: Education Council Symposium: Accreditation and Certification: Establishing Educational Standards and Evaluating Candidates Based on these Standards

    International Nuclear Information System (INIS)

    The North American medical physics community validates the education received by medical physicists and the clinical qualifications for medical physicists through accreditation of educational programs and certification of medical physicists. Medical physics educational programs (graduate education and residency education) are accredited by the Commission on Accreditation of Medical Physics Education Programs (CAMPEP), whereas medical physicists are certified by several organizations, the most familiar of which is the American Board of Radiology (ABR). In order for an educational program to become accredited or a medical physicist to become certified, the applicant must meet certain specified standards set by the appropriate organization. In this Symposium, representatives from both CAMPEP and the ABR will describe the process by which standards are established as well as the process by which qualifications of candidates for accreditation or certification are shown to be compliant with these standards. The Symposium will conclude with a panel discussion. Learning Objectives: Recognize the difference between accreditation of an educational program and certification of an individual Identify the two organizations primarily responsible for these tasks Describe the development of educational standards Describe the process by which examination questions are developed GS is Executive Secretary of CAMPEP

  10. Genetic variants determining survival and fertility in an adverse African environment: a population-based large-scale candidate gene association study.

    Science.gov (United States)

    Koopman, Jacob J E; Pijpe, Jeroen; Böhringer, Stefan; van Bodegom, David; Eriksson, Ulrika K; Sanchez-Faddeev, Hernando; Ziem, Juventus B; Zwaan, Bas; Slagboom, P Eline; de Knijff, Peter; Westendorp, Rudi G J

    2016-07-01

    Human survival probability and fertility decline strongly with age. These life history traits have been shaped by evolution. However, research has failed to uncover a consistent genetic determination of variation in survival and fertility. As an explanation, such genetic determinants have been selected in adverse environments, in which humans have lived during most of their history, but are almost exclusively studied in populations in modern affluent environments. Here, we present a large-scale candidate gene association study in a rural African population living in an adverse environment. In 4387 individuals, we studied 4052 SNPs in 148 genes that have previously been identified as possible determinants of survival or fertility in animals or humans. We studied their associations with survival comparing newborns, middle-age adults, and old individuals. In women, we assessed their associations with reported and observed numbers of children. We found no statistically significant associations of these SNPs with survival between the three age groups nor with women's reported and observed fertility. Population stratification was unlikely to explain these results. Apart from a lack of power, we hypothesise that genetic heterogeneity of complex phenotypes and gene-environment interactions prevent the identification of genetic variants explaining variation in survival and fertility in humans.

  11. Enhanced mucosal immune responses induced by a combined candidate mucosal vaccine based on Hepatitis A virus and Hepatitis E virus structural proteins linked to tuftsin.

    Directory of Open Access Journals (Sweden)

    Yan Gao

    Full Text Available Hepatitis A virus (HAV and Hepatitis E virus (HEV are the most common causes of infectious hepatitis. These viruses are spread largely by the fecal-oral route and lead to clinically important disease in developing countries. To evaluate the potential of targeting hepatitis A and E infection simultaneously, a combined mucosal candidate vaccine was developed with the partial open reading frame 2 (ORF2 sequence (aa 368-607 of HEV (HE-ORF2 and partial virus protein 1 (VP1 sequence (aa 1-198 of HAV (HA-VP1, which included the viral neutralization epitopes. Tuftsin is an immunostimulatory peptide which can enhance the immunogenicity of a protein by targeting it to macrophages and dendritic cells. Here, we developed a novel combined protein vaccine by conjugating tuftsin to HE-ORF2 and HA-VP1 and used synthetic CpG oligodeoxynucleotides (ODNs as the adjuvant. Subsequent experiments in BALB/c mice demonstrated that tuftsin enhanced the serum-specific IgG and IgA antibodies against HEV and HAV at the intestinal, vaginal and pulmonary interface when delivered intranasally. Moreover, mice from the intranasally immunized tuftsin group (HE-ORF2-tuftsin + HA-VP1-tuftsin + CpG showed higher levels of IFN-γ-secreting splenocytes (Th1 response and ratio of CD4+/CD8+ T cells than those of the no-tuftsin group (HE-ORF2 + HA-VP1 + CpG. Thus, the tuftsin group generated stronger humoral and cellular immune responses compared with the no-tuftsin group. Moreover, enhanced responses to the combined protein vaccine were obtained by intranasal immunization compared with intramuscular injection. By integrating HE-ORF2, HA-VP1 and tuftsin in a vaccine, this study validated an important concept for further development of a combined mucosal vaccine against hepatitis A and E infection.

  12. Phase I Clinical Trial of a Recombinant Blood Stage Vaccine Candidate for Plasmodium falciparum Malaria Based on MSP1 and EBA175.

    Directory of Open Access Journals (Sweden)

    Chetan E Chitnis

    Full Text Available A phase I randomised, controlled, single blind, dose escalation trial was conducted to evaluate safety and immunogenicity of JAIVAC-1, a recombinant blood stage vaccine candidate against Plasmodium falciparum malaria, composed of a physical mixture of two recombinant proteins, PfMSP-1(19, the 19 kD conserved, C-terminal region of PfMSP-1 and PfF2 the receptor-binding F2 domain of EBA175.Healthy malaria naïve Indian male subjects aged 18-45 years were recruited from the volunteer database of study site. Fifteen subjects in each cohort, randomised in a ratio of 2:1 and meeting the protocol specific eligibility criteria, were vaccinated either with three doses (10 μg, 25 μg and 50 μg of each antigen of JAIVAC-1 formulated with adjuvant Montanide ISA 720 or with standard dosage of Hepatitis B vaccine. Each subject received the assigned vaccine in the deltoid muscle of the upper arms on Day 0, Day 28 and Day 180.JAIVAC-1 was well tolerated and no serious adverse event was observed. All JAIVAC-1 subjects sero-converted for PfF2 but elicited poor immune response to PfMSP-1(19. Dose-response relationship was observed between vaccine dose of PfF2 and antibody response. The antibodies against PfF2 were predominantly of IgG1 and IgG3 isotype. Sera from JAIVAC-1 subjects reacted with late schizonts in a punctate pattern in immunofluorescence assays. Purified IgG from JAIVAC-1 sera displayed significant growth inhibitory activity against Plasmodium falciparum CAMP strain.Antigen PfF2 should be retained as a component of a recombinant malaria vaccine but PfMSP-1(19 construct needs to be optimised to improve its immunogenicity.Clinical Trial Registry, India CTRI/2010/091/000301.

  13. Phase I Clinical Trial of a Recombinant Blood Stage Vaccine Candidate for Plasmodium falciparum Malaria Based on MSP1 and EBA175

    Science.gov (United States)

    Chitnis, Chetan E.; Mukherjee, Paushali; Mehta, Shantanu; Yazdani, Syed Shams; Dhawan, Shikha; Shakri, Ahmad Rushdi; Bharadwaj, Rukmini; Gupta, Puneet Kumar; Hans, Dhiraj; Mazumdar, Suman; Singh, Bijender; Kumar, Sanjeev; Pandey, Gaurav; Parulekar, Varsha; Imbault, Nathalie; Shivyogi, Preethi; Godbole, Girish; Mohan, Krishna; Leroy, Odile; Singh, Kavita; Chauhan, Virander S.

    2015-01-01

    Background A phase I randomised, controlled, single blind, dose escalation trial was conducted to evaluate safety and immunogenicity of JAIVAC-1, a recombinant blood stage vaccine candidate against Plasmodium falciparum malaria, composed of a physical mixture of two recombinant proteins, PfMSP-119, the 19 kD conserved, C-terminal region of PfMSP-1 and PfF2 the receptor-binding F2 domain of EBA175. Method Healthy malaria naïve Indian male subjects aged 18–45 years were recruited from the volunteer database of study site. Fifteen subjects in each cohort, randomised in a ratio of 2:1 and meeting the protocol specific eligibility criteria, were vaccinated either with three doses (10μg, 25μg and 50μg of each antigen) of JAIVAC-1 formulated with adjuvant Montanide ISA 720 or with standard dosage of Hepatitis B vaccine. Each subject received the assigned vaccine in the deltoid muscle of the upper arms on Day 0, Day 28 and Day 180. Results JAIVAC-1 was well tolerated and no serious adverse event was observed. All JAIVAC-1 subjects sero-converted for PfF2 but elicited poor immune response to PfMSP-119. Dose-response relationship was observed between vaccine dose of PfF2 and antibody response. The antibodies against PfF2 were predominantly of IgG1 and IgG3 isotype. Sera from JAIVAC-1 subjects reacted with late schizonts in a punctate pattern in immunofluorescence assays. Purified IgG from JAIVAC-1 sera displayed significant growth inhibitory activity against Plasmodium falciparum CAMP strain. Conclusion Antigen PfF2 should be retained as a component of a recombinant malaria vaccine but PfMSP-119 construct needs to be optimised to improve its immunogenicity. Trial Registration Clinical Trial Registry, India CTRI/2010/091/000301 PMID:25927360

  14. An annotated history of container candidate material selection

    International Nuclear Information System (INIS)

    This paper documents events in the Nevada Nuclear Waste Storage Investigations (NNWSI) Project that have influenced the selection of metals and alloys proposed for fabrication of waste package containers for permanent disposal of high-level nuclear waste in a repository at Yucca Mountain, Nevada. The time period from 1981 to 1988 is covered in this annotated history. The history traces the candidate materials that have been considered at different stages of site characterization planning activities. At present, six candidate materials are considered and described in the 1988 Consultation Draft of the NNWSI Site Characterization Plan (SCP). The six materials are grouped into two alloy families, copper-base materials and iron to nickel-base materials with an austenitic structure. The three austenitic candidates resulted from a 1983 survey of a longer list of candidate materials; the other three candidates resulted from a special request from DOE in 1984 to evaluate copper and copper-base alloys. 24 refs., 2 tabs

  15. Preparing Preservice Teacher Candidates to Differentiate Instructional Practices

    Science.gov (United States)

    Ochoa, Bianca R.

    2013-01-01

    This action research study focused on how various grouping strategies influenced preservice teachers' differentiation of instruction. The participants included a third grade mentor teacher and three preservice teacher candidates. The candidate preparation curriculum consisted of seminars, daily field-based learning experiences, and ongoing…

  16. Pyrosequencing-based assessment of the bacteria diversity in surface and subsurface peat layers of a northern wetland, with focus on poorly studied phyla and candidate divisions.

    Directory of Open Access Journals (Sweden)

    Yulia M Serkebaeva

    Full Text Available Northern peatlands play a key role in the global carbon and water budget, but the bacterial diversity in these ecosystems remains poorly described. Here, we compared the bacterial community composition in the surface (0-5 cm depth and subsurface (45-50 cm peat layers of an acidic (pH 4.0 Sphagnum-dominated wetland, using pyrosequencing of 16S rRNA genes. The denoised sequences (37,229 reads, average length ∼430 bp were affiliated with 27 bacterial phyla and corresponded to 1,269 operational taxonomic units (OTUs determined at 97% sequence identity. Abundant OTUs were affiliated with the Acidobacteria (35.5±2.4% and 39.2±1.2% of all classified sequences in surface and subsurface peat, respectively, Alphaproteobacteria (15.9±1.7% and 25.8±1.4%, Actinobacteria (9.5±2.0% and 10.7±0.5%, Verrucomicrobia (8.5±1.4% and 0.6±0.2%, Planctomycetes (5.8±0.4% and 9.7±0.6%, Deltaproteobacteria (7.1±0.4% and 4.4%±0.3%, and Gammaproteobacteria (6.6±0.4% and 2.1±0.1%. The taxonomic patterns of the abundant OTUs were uniform across all the subsamples taken from each peat layer. In contrast, the taxonomic patterns of rare OTUs were different from those of the abundant OTUs and varied greatly among subsamples, in both surface and subsurface peat. In addition to the bacterial taxa listed above, rare OTUs represented the following groups: Armatimonadetes, Bacteroidetes, Chlamydia, Chloroflexi, Cyanobacteria, Elusimicrobia, Fibrobacteres, Firmicutes, Gemmatimonadetes, Spirochaetes, AD3, WS1, WS4, WS5, WYO, OD1, OP3, BRC1, TM6, TM7, WPS-2, and FCPU426. OTU richness was notably higher in the surface layer (882 OTUs than in the anoxic subsurface peat (483 OTUs, with only 96 OTUs common to both data sets. Most members of poorly studied phyla, such as the Acidobacteria, Verrucomicrobia, Planctomycetes and the candidate division TM6, showed a clear preference for growth in either oxic or anoxic conditions. Apparently, the bacterial communities in surface and

  17. PEACE: Pulsar Evaluation Algorithm for Candidate Extraction -- A software package for post-analysis processing of pulsar survey candidates

    CERN Document Server

    Lee, K J; Jenet, F A; Martinez, J; Dartez, L P; Mata, A; Lunsford, G; Cohen, S; Biwer, C M; Rohr, M; Flanigan, J; Walker, A; Banaszak, S; Allen, B; Barr, E D; Bhat, N D R; Bogdanov, S; Brazier, A; Camilo, F; Champion, D J; Chatterjee, S; Cordes, J; Crawford, F; Deneva, J; Desvignes, G; Ferdman, R D; Freire, P; Hessels, J W T; Karuppusamy, R; Kaspi, V M; Knispel, B; Kramer, M; Lazarus, P; Lynch, R; Lyne, A; McLaughlin, M; Ransom, S; Scholz, P; Siemens, X; Spitler, L; Stairs, I; Tan, M; van Leeuwen, J; Zhu, W W

    2013-01-01

    Modern radio pulsar surveys produce a large volume of prospective candidates, the majority of which are polluted by human-created radio frequency interference or other forms of noise. Typically, large numbers of candidates need to be visually inspected in order to determine if they are real pulsars. This process can be labor intensive. In this paper, we introduce an algorithm called PEACE (Pulsar Evaluation Algorithm for Candidate Extraction) which improves the efficiency of identifying pulsar signals. The algorithm ranks the candidates based on a score function. Unlike popular machine-learning based algorithms, no prior training data sets are required. This algorithm has been applied to data from several large-scale radio pulsar surveys. Using the human-based ranking results generated by students in the Arecibo Remote Command enter programme, the statistical performance of PEACE was evaluated. It was found that PEACE ranked 68% of the student-identified pulsars within the top 0.17% of sorted candidates, 95% ...

  18. Tantalum oxide coatings as candidate environmental barriers

    OpenAIRE

    Moldovan, Monica; Weyant, C. M.; Johnson, D. Lynn; Faber, K. T.

    2004-01-01

    Tantalum (Ta) oxide, due to its high-temperature capabilities and thermal expansion coefficient similar to silicon nitride, is a promising candidate for environmental barriers for silicon (Si) nitride-based ceramics. This paper focuses on the development of plasma-sprayed Ta oxide as an environmental barrier coating for silicon nitride. Using a D-optimal design of experiments, plasma-spray processing variables were optimized to maximize coating density. The effect of processing variables on c...

  19. 76 FR 4896 - Call for Candidates

    Science.gov (United States)

    2011-01-27

    ... From the Federal Register Online via the Government Publishing Office FEDERAL ACCOUNTING STANDARDS ADVISORY BOARD Call for Candidates AGENCY: Federal Accounting Standards Advisory Board. ACTION: Notice... Federal Accounting Standards Advisory Board (FASAB) is currently seeking candidates (candidates must...

  20. Multilocus Family-Based Association Analysis of Seven Candidate Polymorphisms with Essential Hypertension in an African-Derived Semi-Isolated Brazilian Population

    Directory of Open Access Journals (Sweden)

    L. Kimura

    2012-01-01

    Full Text Available Background. It has been widely suggested that analyses considering multilocus effects would be crucial to characterize the relationship between gene variability and essential hypertension (EH. Objective. To test for the presence of multilocus effects between/among seven polymorphisms (six genes on blood pressure-related traits in African-derived semi-isolated Brazilian populations (quilombos. Methods. Analyses were carried out using a family-based design in a sample of 652 participants (97 families. Seven variants were investigated: ACE (rs1799752, AGT (rs669, ADD2 (rs3755351, NOS3 (rs1799983, GNB3 (rs5441 and rs5443, and GRK4 (rs1801058. Sensitivity analyses were further performed under a case-control design with unrelated participants only. Results. None of the investigated variants were associated individually with both systolic and diastolic BP levels (SBP and DBP, respectively or EH (as a binary outcome. Multifactor dimensionality reduction-based techniques revealed a marginal association of the combined effect of both GNB3 variants on DBP levels in a family-based design (P=0.040, whereas a putative NOS3-GRK4 interaction also in relation to DBP levels was observed in the case-control design only (P=0.004. Conclusion. Our results provide limited support for the hypothesis of multilocus effects between/among the studied variants on blood pressure in quilombos. Further larger studies are needed to validate our findings.

  1. Multilocus Family-Based Association Analysis of Seven Candidate Polymorphisms with Essential Hypertension in an African-Derived Semi-Isolated Brazilian Population

    Science.gov (United States)

    Kimura, L.; Angeli, C. B.; Auricchio, M. T. B. M.; Fernandes, G. R.; Pereira, A. C.; Vicente, J. P.; Pereira, T. V.; Mingroni-Netto, R. C.

    2012-01-01

    Background. It has been widely suggested that analyses considering multilocus effects would be crucial to characterize the relationship between gene variability and essential hypertension (EH). Objective. To test for the presence of multilocus effects between/among seven polymorphisms (six genes) on blood pressure-related traits in African-derived semi-isolated Brazilian populations (quilombos). Methods. Analyses were carried out using a family-based design in a sample of 652 participants (97 families). Seven variants were investigated: ACE (rs1799752), AGT (rs669), ADD2 (rs3755351), NOS3 (rs1799983), GNB3 (rs5441 and rs5443), and GRK4 (rs1801058). Sensitivity analyses were further performed under a case-control design with unrelated participants only. Results. None of the investigated variants were associated individually with both systolic and diastolic BP levels (SBP and DBP, respectively) or EH (as a binary outcome). Multifactor dimensionality reduction-based techniques revealed a marginal association of the combined effect of both GNB3 variants on DBP levels in a family-based design (P = 0.040), whereas a putative NOS3-GRK4 interaction also in relation to DBP levels was observed in the case-control design only (P = 0.004). Conclusion. Our results provide limited support for the hypothesis of multilocus effects between/among the studied variants on blood pressure in quilombos. Further larger studies are needed to validate our findings. PMID:23056922

  2. Zero-point energy of vacuum fluctuation as a candidate for dark energy versus a new conjecture of antigravity based on the modified Einstein field equation in general relativity

    CERN Document Server

    Ni, G

    2005-01-01

    In order to clarify why the zero-point energy associated with the vacuum fluctuations cannot be a candidate for the dark energy in the universe, a comparison with the Casimir effect is analyzed in some detail. A principle of epistemology is stressed that it is meaningless to talk about an absolute (isolated) thing. A relative thing can only be observed when it is changing with respect to other things. Then a new conjecture of antigravity --the repulsive force between matter and antimatter derived from the modified Einstein field equation in general relativity-- is proposed. this is due to the particle-antiparticle symmetry based on a new understanding about the essence of special relativity. Its possible consequences in the theory of cosmology are discussed briefly, including a new explanation for the accelerating universe and gamma-ray-bursts.

  3. Detecting candidate cosmic bubble collisions with optimal filters

    CERN Document Server

    McEwen, J D; Johnson, M C; Peiris, H V

    2012-01-01

    We review an optimal-filter-based algorithm for detecting candidate sources of unknown and differing size embedded in a stochastic background, and its application to detecting candidate cosmic bubble collision signatures in Wilkinson Microwave Anisotropy Probe (WMAP) 7-year observations. The algorithm provides an enhancement in sensitivity over previous methods by a factor of approximately two. Moreover, it is optimal in the sense that no other filter-based approach can provide a superior enhancement of these signatures. Applying this algorithm to WMAP 7-year observations, eight new candidate bubble collision signatures are detected for follow-up analysis.

  4. Candidate Species Selection: Cultural and Photosynthetic Aspects

    Science.gov (United States)

    Mitchell, C. A.

    1982-01-01

    Cultural information is provided for a data base that will be used to select candidate crop species for a controlled ecological life support system (CELSS). Lists of food crops which will satisfy most nutritional requirements of humans and also fit within the scope of cultural restrictions that logically would apply to a closed, regenerating system were generated. Cultural and environmental conditions that will allow the most rapid production of edible biomass from candidate species in the shortest possible time are identified. Cultivars which are most productive in terms of edible biomass production by (CE) conditions, and which respond to the ever-closed approach to optimization realized by each shortened production cycle are selected. The experimental approach with lettuce was to grow the crop hydroponically in a growth chamber and to manipulate such variables as light level and duration, day/night temperature, and nutrient form and level in the solution culture.

  5. A response to information criterion-based clustering with order-restricted candidate profiles in short time-course microarray experiments

    Directory of Open Access Journals (Sweden)

    Umbach David M

    2009-12-01

    Full Text Available Abstract Background For gene expression data obtained from a time-course microarray experiment, Liu et al. 1 developed a new algorithm for clustering genes with similar expression profiles over time. Performance of their proposal was compared with three other methods including the order-restricted inference based methodology of Peddada et al. 23. In this note we point out several inaccuracies in Liu et al. 1 and conclude that the order-restricted inference based methodology of Peddada et al. (programmed in the software ORIOGEN indeed operates at the desired nominal Type 1 error level, an important feature of a statistical decision rule, while being computationally substantially faster than indicated by Liu et al. 1. Results Application of ORIOGEN to the well-known breast cancer cell line data of Lobenhofer et al. 4 revealed that ORIOGEN software took only 21 minutes to run (using 100,000 bootstraps with p = 0.0025, substantially faster than the 72 hours found by Liu et al. 1 using Matlab. Also, based on a data simulated according to the model and parameters of simulation 1 (σ2 = 1, M = 5 in 1 we found that ORIOGEN took less than 30 seconds to run in stark contrast to Liu et al. who reported that their implementation of the same algorithm in R took 2979.29 seconds. Furthermore, for the simulation studies reported in 1, unlike the claims made by Liu et al. 1, ORIOGEN always maintained the desired false positive rate. According to Figure three in Liu et al. 1 their algorithm had a false positive rate ranging approximately from 0.20 to 0.70 for the scenarios that they simulated. Conclusions Our comparisons of run times indicate that the implementations of ORIOGEN's algorithm in Matlab and R by Liu et al. 1 is inefficient compared to the publicly available JAVA implementation. Our results on the false positive rate of ORIOGEN suggest some error in Figure three of Liu et al. 1, perhaps due to a programming error.

  6. Electrical performance verification methodology for large reflector antennas: based on the P-band SAR payload of the ESA BIOMASS candidate mission

    DEFF Research Database (Denmark)

    Pivnenko, Sergey; Kim, Oleksiy S.; Nielsen, Jeppe Majlund;

    2013-01-01

    In this paper, an electrical performance verification methodology for large reflector antennas is proposed. The verification methodology was developed for the BIOMASS P-band (435 MHz) synthetic aperture radar (SAR), but can be applied to other large deployable or fixed reflector antennas for which...... antenna. The main emphasis of the work was on the assessment of the achievable pattern and gain uncertainty for the entire antenna and its compliance with the BIOMASS SAR requirements....... the verification of the entire antenna or payload is impossible. The two-step methodology is based on accurate measurement of the feed structure characteristics, such as complex radiation pattern and radiation efficiency, with an appropriate Measurement technique, and then accurate calculation of the radiation...

  7. Empathy Development in Teacher Candidates

    Science.gov (United States)

    Boyer, Wanda

    2010-01-01

    Using a grounded theory research design, the author examined 180 reflective essays of teacher candidates who participated in a "Learning Process Project," in which they were asked to synthesize and document their discoveries about the learning process over the course of a completely new learning experience as naive learners. This study explored…

  8. Candidate gene prioritization with Endeavour.

    Science.gov (United States)

    Tranchevent, Léon-Charles; Ardeshirdavani, Amin; ElShal, Sarah; Alcaide, Daniel; Aerts, Jan; Auboeuf, Didier; Moreau, Yves

    2016-07-01

    Genomic studies and high-throughput experiments often produce large lists of candidate genes among which only a small fraction are truly relevant to the disease, phenotype or biological process of interest. Gene prioritization tackles this problem by ranking candidate genes by profiling candidates across multiple genomic data sources and integrating this heterogeneous information into a global ranking. We describe an extended version of our gene prioritization method, Endeavour, now available for six species and integrating 75 data sources. The performance (Area Under the Curve) of Endeavour on cross-validation benchmarks using 'gold standard' gene sets varies from 88% (for human phenotypes) to 95% (for worm gene function). In addition, we have also validated our approach using a time-stamped benchmark derived from the Human Phenotype Ontology, which provides a setting close to prospective validation. With this benchmark, using 3854 novel gene-phenotype associations, we observe a performance of 82%. Altogether, our results indicate that this extended version of Endeavour efficiently prioritizes candidate genes. The Endeavour web server is freely available at https://endeavour.esat.kuleuven.be/. PMID:27131783

  9. Candidate Prediction Models and Methods

    DEFF Research Database (Denmark)

    Nielsen, Henrik Aalborg; Nielsen, Torben Skov; Madsen, Henrik;

    2005-01-01

    This document lists candidate prediction models for Work Package 3 (WP3) of the PSO-project called ``Intelligent wind power prediction systems'' (FU4101). The main focus is on the models transforming numerical weather predictions into predictions of power production. The document also outlines the...

  10. Candidate cave entrances on Mars

    Science.gov (United States)

    Cushing, Glen E.

    2012-01-01

    This paper presents newly discovered candidate cave entrances into Martian near-surface lava tubes, volcano-tectonic fracture systems, and pit craters and describes their characteristics and exploration possibilities. These candidates are all collapse features that occur either intermittently along laterally continuous trench-like depressions or in the floors of sheer-walled atypical pit craters. As viewed from orbit, locations of most candidates are visibly consistent with known terrestrial features such as tube-fed lava flows, volcano-tectonic fractures, and pit craters, each of which forms by mechanisms that can produce caves. Although we cannot determine subsurface extents of the Martian features discussed here, some may continue unimpeded for many kilometers if terrestrial examples are indeed analogous. The features presented here were identified in images acquired by the Mars Odyssey's Thermal Emission Imaging System visible-wavelength camera, and by the Mars Reconnaissance Orbiter's Context Camera. Select candidates have since been targeted by the High-Resolution Imaging Science Experiment. Martian caves are promising potential sites for future human habitation and astrobiology investigations; understanding their characteristics is critical for long-term mission planning and for developing the necessary exploration technologies.

  11. Pathogenic Network Analysis Predicts Candidate Genes for Cervical Cancer

    Directory of Open Access Journals (Sweden)

    Yun-Xia Zhang

    2016-01-01

    Full Text Available Purpose. The objective of our study was to predicate candidate genes in cervical cancer (CC using a network-based strategy and to understand the pathogenic process of CC. Methods. A pathogenic network of CC was extracted based on known pathogenic genes (seed genes and differentially expressed genes (DEGs between CC and normal controls. Subsequently, cluster analysis was performed to identify the subnetworks in the pathogenic network using ClusterONE. Each gene in the pathogenic network was assigned a weight value, and then candidate genes were obtained based on the weight distribution. Eventually, pathway enrichment analysis for candidate genes was performed. Results. In this work, a total of 330 DEGs were identified between CC and normal controls. From the pathogenic network, 2 intensely connected clusters were extracted, and a total of 52 candidate genes were detected under the weight values greater than 0.10. Among these candidate genes, VIM had the highest weight value. Moreover, candidate genes MMP1, CDC45, and CAT were, respectively, enriched in pathway in cancer, cell cycle, and methane metabolism. Conclusion. Candidate pathogenic genes including MMP1, CDC45, CAT, and VIM might be involved in the pathogenesis of CC. We believe that our results can provide theoretical guidelines for future clinical application.

  12. A risk-based statistical investigation of the quantification of polymorphic purity of a pharmaceutical candidate by solid-state 19F NMR.

    Science.gov (United States)

    Barry, Samantha J; Pham, Tran N; Borman, Phil J; Edwards, Andrew J; Watson, Simon A

    2012-01-27

    The DMAIC (Define, Measure, Analyse, Improve and Control) framework and associated statistical tools have been applied to both identify and reduce variability observed in a quantitative (19)F solid-state NMR (SSNMR) analytical method. The method had been developed to quantify levels of an additional polymorph (Form 3) in batches of an active pharmaceutical ingredient (API), where Form 1 is the predominant polymorph. In order to validate analyses of the polymorphic form, a single batch of API was used as a standard each time the method was used. The level of Form 3 in this standard was observed to gradually increase over time, the effect not being immediately apparent due to method variability. In order to determine the cause of this unexpected increase and to reduce method variability, a risk-based statistical investigation was performed to identify potential factors which could be responsible for these effects. Factors identified by the risk assessment were investigated using a series of designed experiments to gain a greater understanding of the method. The increase of the level of Form 3 in the standard was primarily found to correlate with the number of repeat analyses, an effect not previously reported in SSNMR literature. Differences in data processing (phasing and linewidth) were found to be responsible for the variability in the method. After implementing corrective actions the variability was reduced such that the level of Form 3 was within an acceptable range of ±1% ww(-1) in fresh samples of API. PMID:22177062

  13. Fc-based delivery system enhances immunogenicity of a tuberculosis subunit vaccine candidate consisting of the ESAT-6:CFP-10 complex.

    Science.gov (United States)

    Farsiani, Hadi; Mosavat, Arman; Soleimanpour, Saman; Sadeghian, Hamid; Akbari Eydgahi, Mohammad Reza; Ghazvini, Kiarash; Sankian, Mojtaba; Aryan, Ehsan; Jamehdar, Saeid Amel; Rezaee, Seyed Abdolrahim

    2016-06-21

    Tuberculosis (TB) remains a major global health threat despite chemotherapy and Bacilli Calmette-Guérin (BCG) vaccination. Therefore, a safer and more effective vaccine against TB is urgently needed. This study evaluated the immunogenicity of a recombinant fusion protein consisting of early secreted antigenic target protein 6 kDa (ESAT-6), culture filtrate protein 10 kDa (CFP-10) and the Fc-domain of mouse IgG2a as a novel subunit vaccine. The recombinant expression vectors (pPICZαA-ESAT-6:CFP-10:Fcγ2a and pPICZαA-ESAT-6:CFP-10:His) were transferred into Pichia pastoris. After SDS-PAGE and immunoblotting, the immunogenicity of the recombinant proteins was evaluated in mice. When both recombinant proteins (ESAT-6:CFP-10:Fcγ2a and ESAT-6:CFP-10:His) were used for vaccination, Th1-type cellular responses were induced producing high levels of IFN-γ and IL-12. However, the Fc-tagged recombinant protein induced more effective Th1-type cellular responses with a small increase in IL-4 as compared to the BCG and ESAT-6:CFP-10:His groups. Moreover, mice primed with BCG and then supplemented with ESAT-6:CFP-10:Fcγ2a produced the highest levels of IFN-γ and IL-12 in immunized groups. The findings indicate that when Fcγ2a is fused to the ESAT-6:CFP-10 complex, as a delivery vehicle, there could be an increase in the immunogenicity of this type of subunit vaccine. Therefore, additional investigations are necessary for the development of appropriate Fc-based tuberculosis vaccines. PMID:27138226

  14. Optical durability testing of candidate solar mirrors

    Energy Technology Data Exchange (ETDEWEB)

    Jorgensen, G.; Kennedy, C.; King, D.; Terwilliger, K.

    2000-03-24

    Durability testing of a variety of candidate solar reflector materials at outdoor test sites and in laboratory accelerated weathering chambers is the main activity within the Advanced Materials task of the Concentrated Solar Power (CSP) Program. Outdoor exposure testing (OET) at up to eight outdoor, worldwide exposure sites has been underway for several years. This includes collaboration under the auspices of the International Energy Agency (IEA) Solar Power and Chemical Energy Systems (SolarPACES) agreement. Outdoor sites are fully instrumented in terms of monitoring meteorological conditions and solar irradiance. Candidate materials are optically characterized prior to being subjected to exposure in real and simulated weathering environments. Optical durability is quantified by periodically re-measuring hemispherical and specular reflectance as a function of exposure time. By closely monitoring the site- and time-dependent environmental stress conditions experienced by the material samples, site-dependent loss of performance may be quantified. In addition, accelerated exposure testing (AET) of these materials in parallel under laboratory-controlled conditions may permit correlating the outdoor results with AET, and subsequently predicting service lifetimes. Test results to date for a large number of candidate solar reflector materials are presented in this report. Acronyms are defined. Based upon OET and AET results to date, conclusions can be drawn about the optical durability of the candidate reflector materials. The optical durability of thin glass, thick glass, and two metallized polymers can be characterized as excellent. The all-polymeric construction, several of the aluminized reflectors, and a metallized polymer can be characterized as having intermediate durability and require further improvement, testing and evaluation, or both.

  15. IAEA Director General candidates announced

    International Nuclear Information System (INIS)

    Full text: The IAEA today confirms receipt of the nomination of five candidates for Director General of the IAEA. Nominations of the following individuals have been received by the Chairperson of the IAEA Board of Governors, Ms. Taous Feroukhi: Mr. Jean-Pol Poncelet of Belgium; Mr. Yukiya Amano of Japan; Mr. Ernest Petric of Slovenia; Mr. Abdul Samad Minty of South Africa; and Mr. Luis Echavarri of Spain. The five candidates were nominated in line with a process approved by the Board in October 2008. IAEA Director General Mohamed ElBaradei's term of office expires on 30 November 2009. He has served as Director General since 1997 and has stated that he is not available for a fourth term of office. (IAEA)

  16. Enthalpy screen of drug candidates.

    Science.gov (United States)

    Schön, Arne; Freire, Ernesto

    2016-11-15

    The enthalpic and entropic contributions to the binding affinity of drug candidates have been acknowledged to be important determinants of the quality of a drug molecule. These quantities, usually summarized in the thermodynamic signature, provide a rapid assessment of the forces that drive the binding of a ligand. Having access to the thermodynamic signature in the early stages of the drug discovery process will provide critical information towards the selection of the best drug candidates for development. In this paper, the Enthalpy Screen technique is presented. The enthalpy screen allows fast and accurate determination of the binding enthalpy for hundreds of ligands. As such, it appears to be ideally suited to aid in the ranking of the hundreds of hits that are usually identified after standard high throughput screening.

  17. Leishmaniasis: vaccine candidates and perspectives.

    Science.gov (United States)

    Singh, Bhawana; Sundar, Shyam

    2012-06-01

    Leishmania is a protozoan parasite and a causative agent of the various clinical forms of leishmaniasis. High cost, resistance and toxic side effects of traditional drugs entail identification and development of therapeutic alternatives. The sound understanding of parasite biology is key for identifying novel drug targets, that can induce the cell mediated immunity (mainly CD4+ and CD8+ IFN-gamma mediated responses) polarized towards a Th1 response. These aspects are important in designing a new vaccine along with the consideration of the candidates with respect to their ability to raise memory response in order to improve the vaccine performance. This review is an effort to identify molecules according to their homology with the host and their ability to be used as potent vaccine candidates.

  18. The impact of alternate fuels on future candidate automotive engines

    Energy Technology Data Exchange (ETDEWEB)

    Rahnke, C.J.; Nichols, R.J.

    1982-06-01

    The thermal efficiency that could occur in the future for a variety of automotive engine candidates operating on conventional and alternate fuels is projected based on current automotive engine development trends and the special characteristics of the various alternate fuels. The multi-fuel engine candidates include mixture cycle and direct injection reciprocating engines, as well as adiabatic turbocompound engines and advanced gas turbine and Stirling engines. The alternate fuels considered are propane, methanol, ethanol, diesel and methane.

  19. Dynamics of copper-phthalocyanine molecules on Au/Ge(001)

    NARCIS (Netherlands)

    Sotthewes, K.; Heimbuch, R.U.; Zandvliet, H.J.W.

    2015-01-01

    Spatially resolved current-time scanning tunneling spectroscopy combined with current-distance spectroscopy has been used to characterize the dynamic behavior of copper-phthalocyanine (CuPc) molecules adsorbed on a Au-modified Ge(001) surface. The analyzed CuPc molecules are adsorbed in a “molecular

  20. One-dimensional electron system of Au/Ge(001) revealed by angle-resolved photoemission

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Sebastian; Schaefer, Joerg; Blumenstein, Christian; Claessen, Ralph [Experimentelle Physik 4, Universitaet Wuerzburg, 97074 Wuerzburg (Germany); Bostwick, Aaron; Rotenberg, Eli [Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley 94720, California (United States)

    2010-07-01

    Self-organized atomic nanowires of noble metals on semiconductor surfaces are characterized by strict spatial separation and a high degree of charge confinement. The ultimate width of single-atom dimension seems to be reached with gold chains on Ge(001).Thus they might offer the possibility to observe exotic properties, like a charge density wave (CDW), or, alternatively, a Luttinger liquid phase. Insight is gained by angle-resolved photoelectron spectroscopy (ARPES). We find that two shallow electron pockets disperse along the wire direction within the surface Brillouin zone, while a dispersion perpendicular to the wires is absent. This is confirmed by mapping the full Fermi surface (FS) topology, where sheets are found to be perfectly 1D without any interchain coupling. This is indicative of the virtual absence of coupling to the second dimension. Interestingly, while various nesting conditions are offered from the FS topology, no band back-folding from a CDW superstructure or energy gap opening is found, which opens a pathway for non-Fermi liquid physics. Thus the system emerges as a prototypical 1D electron system.

  1. Probing the electronic transport on the reconstructed Au/Ge(001 surface

    Directory of Open Access Journals (Sweden)

    Franciszek Krok

    2014-09-01

    Full Text Available By using scanning tunnelling potentiometry we characterized the lateral variation of the electrochemical potential µec on the gold-induced Ge(001-c(8 × 2-Au surface reconstruction while a lateral current flows through the sample. On the reconstruction and across domain boundaries we find that µec shows a constant gradient as a function of the position between the contacts. In addition, nanoscale Au clusters on the surface do not show an electronic coupling to the gold-induced surface reconstruction. In combination with high resolution scanning electron microscopy and transmission electron microscopy, we conclude that an additional transport channel buried about 2 nm underneath the surface represents a major transport channel for electrons.

  2. Dynamics of copper-phthalocyanine molecules on Au/Ge(001)

    Energy Technology Data Exchange (ETDEWEB)

    Sotthewes, K.; Heimbuch, R.; Zandvliet, H. J. W. [Physics of Interfaces and Nanomaterials, MESA" + Institute for Nanotechnology, University of Twente, P.O. Box 217, 7500AE Enschede (Netherlands)

    2015-10-07

    Spatially resolved current-time scanning tunneling spectroscopy combined with current-distance spectroscopy has been used to characterize the dynamic behavior of copper-phthalocyanine (CuPc) molecules adsorbed on a Au-modified Ge(001) surface. The analyzed CuPc molecules are adsorbed in a “molecular bridge” configuration, where two benzopyrrole groups (lobes) are connected to a Au-induced nanowire, whereas the other two lobes are connected to the adjacent nanowire. Three types of lobe configurations are found: a bright lobe, a dim lobe, and a fuzzy lobe. The dim and fuzzy lobes exhibit a well-defined switching behavior between two discrete levels, while the bright lobe shows a broad oscillation band. The observed dynamic behavior is induced by electrons that are injected into the LUMO+1 orbital of the CuPc molecule. By precisely adjusting the tip-molecule distance, the switching frequency of the lobes can be tuned accurately.

  3. Recognition of a wide-range of S-RNases by S locus F-box like 2, a general-inhibitor candidate in the Prunus-specific S-RNase-based self-incompatibility system.

    Science.gov (United States)

    Matsumoto, Daiki; Tao, Ryutaro

    2016-07-01

    Many species in the Rosaceae, the Solanaceae, and the Plantaginaceae exhibit S-RNase-based gametophytic self-incompatibility (GSI). This system comprises S-ribonucleases (S-RNases) as the pistil S determinant and a single or multiple F-box proteins as the pollen S determinants. In Prunus, pollen specificity is determined by a single S haplotype-specific F-box protein (SFB). The results of several studies suggested that SFB exerts cognate S-RNase cytotoxicity, and a hypothetical general inhibitor (GI) is assumed to detoxify S-RNases in non-specific manner unless it is affected by SFB. Although the identity of the GI is unknown, phylogenetic and evolutionary analyses have indicated that S locus F-box like 1-3 (or S locus F-box with low allelic sequence polymorphism 1-3; SLFL1-3), which are encoded by a region of the Prunus genome linked to the S locus, are good GI candidates. Here, we examined the biochemical characteristics of SLFL1-3 to determine whether they have appropriate GI characteristics. Pull-down assays and quantitative expression analyses indicated that Prunus avium SLFL1-3 mainly formed a canonical SCF complex with PavSSK1 and PavCul1A. Binding assays with PavS(1,3,4,6)-RNases showed that PavSLFL1, PavSLFL2, and PavSLFL3 bound to PavS(3)-RNase, all PavS-RNases tested, and none of the PavS-RNases tested, respectively. Together, these results suggested that SLFL2 has the appropriate characteristics to be the GI in sweet cherry pollen, while SLFL1 may redundantly work with SLFL2 to detoxify all S-RNases. We discuss the possible roles of SLFL1-3 as the GI in the Prunus-specific S-RNase-based GSI mechanism. PMID:27071402

  4. Recognition of a wide-range of S-RNases by S locus F-box like 2, a general-inhibitor candidate in the Prunus-specific S-RNase-based self-incompatibility system.

    Science.gov (United States)

    Matsumoto, Daiki; Tao, Ryutaro

    2016-07-01

    Many species in the Rosaceae, the Solanaceae, and the Plantaginaceae exhibit S-RNase-based gametophytic self-incompatibility (GSI). This system comprises S-ribonucleases (S-RNases) as the pistil S determinant and a single or multiple F-box proteins as the pollen S determinants. In Prunus, pollen specificity is determined by a single S haplotype-specific F-box protein (SFB). The results of several studies suggested that SFB exerts cognate S-RNase cytotoxicity, and a hypothetical general inhibitor (GI) is assumed to detoxify S-RNases in non-specific manner unless it is affected by SFB. Although the identity of the GI is unknown, phylogenetic and evolutionary analyses have indicated that S locus F-box like 1-3 (or S locus F-box with low allelic sequence polymorphism 1-3; SLFL1-3), which are encoded by a region of the Prunus genome linked to the S locus, are good GI candidates. Here, we examined the biochemical characteristics of SLFL1-3 to determine whether they have appropriate GI characteristics. Pull-down assays and quantitative expression analyses indicated that Prunus avium SLFL1-3 mainly formed a canonical SCF complex with PavSSK1 and PavCul1A. Binding assays with PavS(1,3,4,6)-RNases showed that PavSLFL1, PavSLFL2, and PavSLFL3 bound to PavS(3)-RNase, all PavS-RNases tested, and none of the PavS-RNases tested, respectively. Together, these results suggested that SLFL2 has the appropriate characteristics to be the GI in sweet cherry pollen, while SLFL1 may redundantly work with SLFL2 to detoxify all S-RNases. We discuss the possible roles of SLFL1-3 as the GI in the Prunus-specific S-RNase-based GSI mechanism.

  5. 11 CFR 100.154 - Candidate debates.

    Science.gov (United States)

    2010-01-01

    ... Expenditures § 100.154 Candidate debates. Funds used to defray costs incurred in staging candidate debates in accordance with the provisions of 11 CFR 110.13 and 114.4(f) are not expenditures. ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate debates. 100.154 Section...

  6. 11 CFR 100.92 - Candidate debates.

    Science.gov (United States)

    2010-01-01

    ... Contributions § 100.92 Candidate debates. Funds provided to defray costs incurred in staging candidate debates in accordance with the provisions of 11 CFR 110.13 and 114.4(f) are not contributions. ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate debates. 100.92 Section...

  7. Candidate eco-friendly gas mixtures for MPGDs

    CERN Document Server

    AUTHOR|(CDS)2071648; Saviano, G.; Muhammad, S.; Piccolo, D.; Primavera, F.; Ferrini, M.; Parvis, M.; Grassing, S.; Colafranceschi, S.; Kjøbro, J.; Sharma, A.; Yang, D.; Chen, G.; Ban, Y.; Li, Q.

    2015-01-01

    Modern gas detectors for detection of particles require F-based gases for optimal performance. Recent regulations demand the use of environmentally unfriendly F-based gases to be limited or banned. This review studies properties of potential eco-friendly gas candidate replacements.

  8. Candidate worldviews for design theory

    DEFF Research Database (Denmark)

    Galle, Per

    2008-01-01

    Our growing body of design theory risks being infected by more inconsistency than is justifiable by genuine disagreement among design theorists. Taking my cue from C. S. Peirce, who argued that theory inevitably rests on basic metaphysical assumptions that theorists ought to be critically aware of......, I demonstrate how ‘insidious inconsistency’ may infect design theory if we ignore his admonition. As a possible remedy, I propose a method by which the philosophy of design may develop sound metaphysical foundations (‘worldviews’) for design theory – and generate philosophical insights into design...... at the same time. Examples are given of how the first steps of the method may be carried out and a number of candidate worldviews are outlined and briefly discussed. In its own way, each worldview answers certain fundamental questions about the nature of design. These include the ontological question of what...

  9. Pulsar Candidates Toward Fermi Unassociated Sources

    CERN Document Server

    Frail, D A; Jagannathan, P; Intema, H T

    2016-01-01

    We report on a search for steep spectrum radio sources within the 95% confidence error ellipses of the Fermi unassociated sources from the Large Array Telescope (LAT). Using existing catalogs and the newly released GMRT all-sky survey at 150 MHz we identify compact radio sources that are bright at MHz frequencies but faint or absent at GHz frequencies. Such steep spectrum radio sources are rare and constitute a sample of pulsar candidates, selected independently of period, dispersion measure, interstellar scattering and orbital parameters. We find point-like, steep spectrum candidates toward 11 Fermi sources. Based on the gamma-ray/radio positional coincidence, the rarity of such radio sources, and the properties of the 3FGL sources themselves, we argue that many of these sources could be pulsars. They may have been missed by previous radio periodicity searches due to interstellar propagation effects or because they lie in an unusually tight binary. If this hypothesis is correct, then renewed gamma-ray and ra...

  10. Transiting exoplanet candidates from K2 Campaigns 5 and 6

    Science.gov (United States)

    Pope, Benjamin J. S.; Parviainen, Hannu; Aigrain, Suzanne

    2016-10-01

    We introduce a new transit search and vetting pipeline for observations from the K2 mission, and present the candidate transiting planets identified by this pipeline out of the targets in Campaigns 5 and 6. Our pipeline uses the Gaussian process-based K2SC code to correct for the K2 pointing systematics and simultaneously model stellar variability. The systematics-corrected, variability-detrended light curves are searched for transits with the box-least-squares method, and a period-dependent detection threshold is used to generate a preliminary candidate list. Two or three individuals vet each candidate manually to produce the final candidate list, using a set of automatically generated transit fits and assorted diagnostic tests to inform the vetting. We detect 145 single-planet system candidates and 5 multi-planet systems, independently recovering the previously published hot Jupiters EPIC 212110888b, WASP-55b (EPIC 212300977b) and Qatar-2b (EPIC 212756297b). We also report the outcome of reconnaissance spectroscopy carried out for all candidates with Kepler magnitude Kp ≤ 13, identifying 12 targets as likely false positives. We compare our results to those of other K2 transit search pipelines, noting that ours performs particularly well for variable and/or active stars, but that the results are very similar overall. All the light curves and code used in the transit search and vetting process are publicly available, as are the follow-up spectra.

  11. Transiting exoplanet candidates from K2 Campaigns 5 and 6

    Science.gov (United States)

    Pope, Benjamin J. S.; Parviainen, Hannu; Aigrain, Suzanne

    2016-06-01

    We introduce a new transit search and vetting pipeline for observations from the K2 mission, and present the candidate transiting planets identified by this pipeline out of the targets in Campaigns 5 and 6. Our pipeline uses the Gaussian Process-based K2SC code to correct for the K2 pointing systematics and simultaneously model stellar variability. The systematics-corrected, variability-detrended light curves are searched for transits with the Box Least Squares method, and a period-dependent detection threshold is used to generate a preliminary candidate list. Two or three individuals vet each candidate manually to produce the final candidate list, using a set of automatically-generated transit fits and assorted diagnostic tests to inform the vetting. We detect 147 single-planet system candidates and 5 multi-planet systems, independently recovering the previously-published hot Jupiters EPIC 212110888b, WASP-55b (EPIC 212300977b) and Qatar-2b (EPIC 212756297b). We also report the outcome of reconnaissance spectroscopy carried out for all candidates with Kepler magnitude Kp ≤ 13, identifying 12 targets as likely false positives. We compare our results to those of other K2 transit search pipelines, noting that ours performs particularly well for variable and/or active stars, but that the results are very similar overall. All the light curves and code used in the transit search and vetting process are publicly available, as are the follow-up spectra.

  12. Integrative analysis to select cancer candidate biomarkers to targeted validation

    Science.gov (United States)

    Heberle, Henry; Domingues, Romênia R.; Granato, Daniela C.; Yokoo, Sami; Canevarolo, Rafael R.; Winck, Flavia V.; Ribeiro, Ana Carolina P.; Brandão, Thaís Bianca; Filgueiras, Paulo R.; Cruz, Karen S. P.; Barbuto, José Alexandre; Poppi, Ronei J.; Minghim, Rosane; Telles, Guilherme P.; Fonseca, Felipe Paiva; Fox, Jay W.; Santos-Silva, Alan R.; Coletta, Ricardo D.; Sherman, Nicholas E.; Paes Leme, Adriana F.

    2015-01-01

    Targeted proteomics has flourished as the method of choice for prospecting for and validating potential candidate biomarkers in many diseases. However, challenges still remain due to the lack of standardized routines that can prioritize a limited number of proteins to be further validated in human samples. To help researchers identify candidate biomarkers that best characterize their samples under study, a well-designed integrative analysis pipeline, comprising MS-based discovery, feature selection methods, clustering techniques, bioinformatic analyses and targeted approaches was performed using discovery-based proteomic data from the secretomes of three classes of human cell lines (carcinoma, melanoma and non-cancerous). Three feature selection algorithms, namely, Beta-binomial, Nearest Shrunken Centroids (NSC), and Support Vector Machine-Recursive Features Elimination (SVM-RFE), indicated a panel of 137 candidate biomarkers for carcinoma and 271 for melanoma, which were differentially abundant between the tumor classes. We further tested the strength of the pipeline in selecting candidate biomarkers by immunoblotting, human tissue microarrays, label-free targeted MS and functional experiments. In conclusion, the proposed integrative analysis was able to pre-qualify and prioritize candidate biomarkers from discovery-based proteomics to targeted MS. PMID:26540631

  13. Ionospheric and induced field leakage in geomagnetic field models, and derivation of candidate models for DGRF 1995 and DGRF 2000

    DEFF Research Database (Denmark)

    Olsen, Nils; Lowes, F.; Sabaka, T.J.

    2005-01-01

    As part of the 9th generation of the IGRF defined by IAGA, we proposed a candidate model for DGRF 1995 and two candidate models for DGRF 2000. These candidate models, the derivation of which is described in the present note, are based on the "Comprehensive Model, Version 4 (CM4)", and on the "Ors......As part of the 9th generation of the IGRF defined by IAGA, we proposed a candidate model for DGRF 1995 and two candidate models for DGRF 2000. These candidate models, the derivation of which is described in the present note, are based on the "Comprehensive Model, Version 4 (CM4...

  14. Evaluation and selection of candidate high-level waste forms

    International Nuclear Information System (INIS)

    Seven candidate waste forms being developed under the direction of the Department of Energy's National High-Level Waste (HLW) Technology Program, were evaluated as potential media for the immobilization and geologic disposal of high-level nuclear wastes. The evaluation combined preliminary waste form evaluations conducted at DOE defense waste-sites and independent laboratories, peer review assessments, a product performance evaluation, and a processability analysis. Based on the combined results of these four inputs, two of the seven forms, borosilicate glass and a titanate based ceramic, SYNROC, were selected as the reference and alternative forms for continued development and evaluation in the National HLW Program. Both the glass and ceramic forms are viable candidates for use at each of the DOE defense waste-sites; they are also potential candidates for immobilization of commercial reprocessing wastes. This report describes the waste form screening process, and discusses each of the four major inputs considered in the selection of the two forms

  15. Cardiac evaluation of liver transplant candidates

    OpenAIRE

    Mandell, Mercedes Susan; Lindenfeld, JoAnn; Tsou, Mei-Yung; Zimmerman, Michael

    2008-01-01

    Physicians previously thought that heart disease was rare in patients with end stage liver disease. However, recent evidence shows that the prevalence of ischemic heart disease and cardiomyopathy is increased in transplant candidates compared to most other surgical candidates. Investigators estimate that up to 26% of all liver transplant candidates have at least one critical coronary artery stenosis and that at least half of these patients will die perioperatively of cardiac complications. Ca...

  16. Production of EV71 vaccine candidates.

    Science.gov (United States)

    Chong, Pele; Hsieh, Shih-Yang; Liu, Chia-Chyi; Chou, Ai-Hsiang; Chang, Jui-Yuan; Wu, Suh-Chin; Liu, Shih-Jen; Chow, Yen-Hung; Su, Ih-Jen; Klein, Michel

    2012-12-01

    Enterovirus 71 (EV71) is now recognized as an emerging neurotropic virus in Asia and with Coxsackie virus (CV) it is the other major causative agent of hand-foot-mouth diseases (HFMD). Effective medications and/or prophylactic vaccines against HFMD are urgently needed. From a scientific (the feasibility of bioprocess, immunological responses and potency in animal challenge model) and business development (cost of goods) points of view, we in this review address and discuss the pros and cons of different EV71 vaccine candidates that have been produced and evaluated in animal models. Epitope-based synthetic peptide vaccine candidates containing residues 211-225 of VP1 formulated with Freund's adjuvant (CFA/IFA) elicited low EV71 virus neutralizing antibody responses, but were protective in the suckling mouse challenge model. Among recombinant EV71 subunits (rVP1, rVP2 and rVP3) expressed in E. coli, purified and formulated with CFA/IFA, only VP1 elicited mouse antibody responses with measurable EV71-specific virus neutralization titers. Immunization of mice with either a DNA plasmid containing VP1 gene or VP1 expressed in Salmonella typhimurium also generated neutralizing antibody responses and protected animals against a live EV71 challenge. Recombinant EV71 virus-like particles (rVLP) produced from baculovirus formulated either with CFA/IFA or alum elicited good virus neutralization titers in both mice and non-human primates, and were found to be protective in the suckling mouse EV71 challenge model. Synthetic peptides or recombinant EV71 subunit vaccines (rVP1 and rVLP) formulated in alum were found to be poorly immunogenic in rabbits. Only formalin-inactivated (FI) EV71 virions formulated in alum elicited cross-neutralizing antibodies against different EV71 genotypes in mice, rabbits and non-human primates but induced weak neutralizing responses against CAV16. From a regulatory, economic and market acceptability standpoint, FI-EV71 virion vaccines are the most

  17. Optimal Distribution of Emergency Facilities on Network Based on Candidate Sites Algorithm%基于候选点集算法的应急设施网络布局优化

    Institute of Scientific and Technical Information of China (English)

    魏强; 涂子学; 周静生; 周嘉男

    2012-01-01

    To reasonably select locations of emergency facilities, a model aimed at minimizing the number of emergency facilities was built under the presuppositon of covering all demand points. From the network location point of view, distribution of emergency facilities on network was optimized based on set covering so that decision space was no longer limited to discrete set of points. For the difficulties caused by the continuity of the decision space to solve the problem, The candidate sites algorithm was used to dis-cretize the continuous solution space by solving possible effective path set, the solution space was greatly reduced and network design problems were converted into the 0 - 1 integer programming problem. The results show that by means of solving 0-1 integer programming problem can achieve distribution optimization of emergency facilitie on network.%为解决应急管理系统中的应急设施最优选址问题,提出在覆盖所有需求点前提下以应急设施数目最少为目标的选址模型.从网络选址的角度出发,基于集合覆盖优化应急设施在网络上的布局,使其决策空间不再局限于离散点集.针对决策空间连续性给问题求解带来的困难,利用候选点集算法通过求解可能的有效路径集将连续解空间离散化,极大地缩小问题的解空间,将此网络设计问题转换为0-1整数规划问题进行求解.将候选点集算法应用于实例分析中,求得该区应急服务设施数量及其位置.

  18. Undercover Stars Among Exoplanet Candidates

    Science.gov (United States)

    2005-03-01

    events by monitoring the brightness of a very large number of stars over extended time intervals. During the past years, it has also included a search for periodic, very shallow "dips" in the brightness of stars, caused by the regular transit of small orbiting objects (small stars, brown dwarfs [2] or Jupiter-size planets). The OGLE team has since announced 177 "planetary transit candidates" from their survey of several hundred thousand stars in three southern sky fields, one in the direction of the Galactic Centre, another within the Carina constellation and the third within the Centaurus/Musca constellations. The nature of the transiting object can however only be established by subsequent radial-velocity observations of the parent star. The size of the velocity variations (the amplitude) is directly related to the mass of the companion object and therefore allows discrimination between stars and planets as the cause of the observed brightness "dip". A Bonanza of Low-Mass Stars An international team of astronomers [3] has made use of the 8.2-m VLT Kueyen telescope for this work. Profiting from the multiplex capacity of the FLAMES/UVES facility that permits to obtain high-resolution spectra of up to 8 objects simultaneously, they have looked at 60 OGLE transit candidate stars, measuring their radial velocities with an accuracy of about 50 m/s [4]. This ambitious programme has so far resulted in the discovery of five new transiting exoplanets (see, e.g., ESO PR 11/04 for the announcement of two of those). Most of the other transit candidates identified by OGLE have turned out to be eclipsing binaries, that is, in most cases common, small and low-mass stars passing in front of a solar-like star. This additional wealth of data on small and light stars is a real bonanza for the astronomers. Constraining the Relation Between Mass and Radius Low-mass stars are exceptionally interesting objects, also because the physical conditions in their interiors have much in common with

  19. A New Optical Survey of Supernova Remnant Candidates in M31

    CERN Document Server

    Lee, Jong Hwan

    2014-01-01

    We present a survey of optically emitting supernova remnants (SNRs) in M31 based on H$\\alpha$ and [SII] images in the Local Group Survey. Using these images, we select objects that have [SII]:H$\\alpha$ $>$ 0.4 and circular shapes. We find 76 new SNR candidates. We also inspect 234 SNR candidates presented in previous studies, finding that only 80 of them are SNR candidates according to our criteria. Combining them with the new candidates, we produce a master catalog of 156 SNR candidates in M31. We classify these SNR candidates according to two criteria: the SNR progenitor type [Type Ia and core-collapse (CC) SNRs] and the morphological type. Type Ia and CC SNR candidates make up 23% and 77%, respectively, of the total sample. Most of the CC SNR candidates are concentrated in the spiral arms, while the Type Ia SNR candidates are rather distributed over the entire galaxy, including the inner region. The CC SNR candidates are brighter in H$\\alpha$ and [SII] than the Type Ia SNR candidates. We derive a cumulativ...

  20. Supervising PETE Candidates Using the Situational Supervision Model

    Science.gov (United States)

    Levy, Linda S.; Johnson, Lynn V.

    2012-01-01

    Physical education teacher candidates (PETCs) often, as part of their curricular requirements, engage in early field experiences that prepare them for student teaching. Matching the PETC's developmental level with the mentor's supervision style enhances this experience. The situational supervision model, based on the situational leadership model,…

  1. Effects of Critical Thinking Intervention for Early Childhood Teacher Candidates

    Science.gov (United States)

    Han, Heejeong Sophia; Brown, E. Todd

    2013-01-01

    This study is based on an intervention designed to enhance early childhood teacher candidates' critical thinking abilities. The concept, elements, standards, and traits of critical thinking were integrated into the main course contents, and the effects of the intervention were examined. The results indicated that early childhood teacher…

  2. A preliminary systems assessment of the Starlite Demo candidates

    Energy Technology Data Exchange (ETDEWEB)

    Bathke, C.G.

    1995-12-01

    The Starlite project has evaluated the following five tokamaks as candidates for the US Demo Power Plant: (1) steady state, first stability regime; (2) pulsed, first stability regime; (3) steady state, second stability regime; (4) steady state, reversed shear; and (5) steady state, low aspect ratio. Systems analysis of these candidates has played an important role in the selection of a reversed-shear tokamak for further conceptual design as a US Demo Power Plant. The cost-based systems analysis that led to the selection of a reversed-shear tokamak is described herein.

  3. Virus-like particles as nanovaccine candidates

    International Nuclear Information System (INIS)

    The existing vaccines are mainly limited to the microorganisms we are able to culture and produce and/or to those whose killing is mediated by humoral response (antibody mediated). It has been more difficult to develop vaccines capable of inducing a functional cellular response needed to prevent or cure chronic diseases. New strategies should be taken into account in the improvement of cell-based immune responses in order to prevent and control the infections and eventually clear the virus. Preclinical and clinical results with vaccine candidates developed as a vaccine platform based on virus-like particles (VLPs) evidenced their ability to stimulate mucosal as well as systemic immunity. Particles based on envelope, membrane or nucleocapsid microbial proteins induce a strong immune response after nasal or parenteral administration in mice, non-human primates and humans. In addition, the immune response obtained was modulated in a Th1 sense. The VLPs were also able to immunoenhance the humoral and cellular immune responses against several viral pathogens. Studies in animals and humans with nasal and systemic formulations evidenced that it is possible to induce functional immune response against HBV, HCV, HIV and dengue virus. (paper)

  4. Virus-like particles as nanovaccine candidates

    Science.gov (United States)

    Guillen, G.; Aguilar, J. C.; Dueñas, S.; Hermida, L.; Iglesias, E.; Penton, E.; Lobaina, Y.; Lopez, M.; Mussachio, A.; Falcon, V.; Alvarez, L.; Martinez, G.; Gil, L.; Valdes, I.; Izquierdo, A.; Lazo, L.; Marcos, E.; Guzman, G.; Muzio, V.; Herrera, L.

    2013-03-01

    The existing vaccines are mainly limited to the microorganisms we are able to culture and produce and/or to those whose killing is mediated by humoral response (antibody mediated). It has been more difficult to develop vaccines capable of inducing a functional cellular response needed to prevent or cure chronic diseases. New strategies should be taken into account in the improvement of cell-based immune responses in order to prevent and control the infections and eventually clear the virus. Preclinical and clinical results with vaccine candidates developed as a vaccine platform based on virus-like particles (VLPs) evidenced their ability to stimulate mucosal as well as systemic immunity. Particles based on envelope, membrane or nucleocapsid microbial proteins induce a strong immune response after nasal or parenteral administration in mice, non-human primates and humans. In addition, the immune response obtained was modulated in a Th1 sense. The VLPs were also able to immunoenhance the humoral and cellular immune responses against several viral pathogens. Studies in animals and humans with nasal and systemic formulations evidenced that it is possible to induce functional immune response against HBV, HCV, HIV and dengue virus. Invited talk at the 6th International Workshop on Advanced Materials Science and Nanotechnology, 30 October - 2 November 2012, Ha Long, Vietnam.

  5. Unifying candidate gene and GWAS Approaches in Asthma.

    Directory of Open Access Journals (Sweden)

    Sven Michel

    Full Text Available The first genome wide association study (GWAS for childhood asthma identified a novel major susceptibility locus on chromosome 17q21 harboring the ORMDL3 gene, but the role of previous asthma candidate genes was not specifically analyzed in this GWAS. We systematically identified 89 SNPs in 14 candidate genes previously associated with asthma in >3 independent study populations. We re-genotyped 39 SNPs in these genes not covered by GWAS performed in 703 asthmatics and 658 reference children. Genotyping data were compared to imputation data derived from Illumina HumanHap300 chip genotyping. Results were combined to analyze 566 SNPs covering all 14 candidate gene loci. Genotyped polymorphisms in ADAM33, GSTP1 and VDR showed effects with p-values <0.0035 (corrected for multiple testing. Combining genotyping and imputation, polymorphisms in DPP10, EDN1, IL12B, IL13, IL4, IL4R and TNF showed associations at a significance level between p = 0.05 and p = 0.0035. These data indicate that (a GWAS coverage is insufficient for many asthma candidate genes, (b imputation based on these data is reliable but incomplete, and (c SNPs in three previously identified asthma candidate genes replicate in our GWAS population with significance after correction for multiple testing in 14 genes.

  6. Transiting exoplanet candidates from K2 Campaigns 5 and 6

    CERN Document Server

    Pope, Benjamin J S; Aigrain, Suzanne

    2016-01-01

    We introduce a new transit search and vetting pipeline for observations from the K2 mission, and present the candidate transiting planets identified by this pipeline out of the targets in Campaigns 5 and 6. Our pipeline uses the Gaussian Process-based K2SC code to correct for the K2 pointing systematics and simultaneously model stellar variability. The systematics-corrected, variability-detrended light curves are searched for transits with the Box Least Squares method, and a period-dependent detection threshold is used to generate a preliminary candidate list. Two or three individuals vet each candidate manually to produce the final candidate list, using a set of automatically-generated transit fits and assorted diagnostic tests to inform the vetting. We detect 147 single-planet system candidates and 5 multi-planet systems, independently recovering the previously-published hot~Jupiters EPIC 212110888b, WASP-55b (EPIC 212300977b) and Qatar-2b (EPIC 212756297b). We also report the outcome of reconnaissance spec...

  7. Properties of Optically Selected Supernova Remnant Candidates in M33

    CERN Document Server

    Lee, Jong Hwan

    2014-01-01

    We present a sample of supernova remnant (SNR) candidates in M33 based on optical narrow band images in the Local Group Survey. We identify emission line objects that have enhanced [SII]:H{\\alpha} (> 0.4) and circular shapes using continuum-subtracted H{\\alpha}and [SII] images and produce a list of 199 SNR candidates, of which 79 are previously unknown. We classify them considering two types of criteria: their progenitor type (Type Ia and core-collapse (CC) SNRs) and their morphological type. Of the total sample, 170 are likely remnants of CC SNe and 29 are likely remnants of Type Ia SNe. We obtain a cumulative size distribution of the SNR candidates, showing that it follows a power law with an index,{\\alpha}= 2.38{\\pm}0.05 (17 < D < 50 pc). This indicates that most of the M33 SNR candidates found in this study are in the Sedov-Taylor phase, consistent with previous findings. The [SII]:H{\\alpha} distribution of the SNR candidates shows two peaks at [SII]:H{\\alpha} ~0.55 and ~0.8. Interestingly X-ray and...

  8. 11 CFR 110.13 - Candidate debates.

    Science.gov (United States)

    2010-01-01

    ... political parties may stage candidate debates in accordance with this section and 11 CFR 114.4(f). (2... also cover or carry candidate debates in accordance with 11 CFR part 100, subparts B and C and part 100... CFR 114.4(f), provided that they are not owned or controlled by a political party, political...

  9. On the Low False Positive Probabilities of Kepler Planet Candidates

    CERN Document Server

    Morton, Timothy D

    2011-01-01

    We present a framework to conservatively estimate the probability that any particular planet-like transit signal observed by the Kepler mission is in fact a planet, prior to any ground-based follow-up efforts. We use Monte Carlo methods based on stellar population synthesis and Galactic structure models, and we provide empirical analytic fits to our results that may be applied to the as-yet-unconfirmed Kepler candidates. We find that the false positive probability for candidates that pass preliminary Kepler vetting procedures is generally 20% to < 2%, assuming a continuous power law for the planet mass function with index alpha = -1.5. Since Kepler will detect many more planetary signals than can be positively confirmed with ground-based follow-up efforts in the near term, these calculations will be crucial to using the ensemble of Kepler data to determine population characteristic s of planetary systems.

  10. An evaluation of candidate oxidation resistant materials

    Science.gov (United States)

    Rutledge, Sharon; Banks, Bruce; Mirtich, Michael; Difilippo, Frank; Hotes, Deborah; Labed, Richard; Dever, Terese; Kussmaul, Michael

    1987-01-01

    Ground based testing of materials considered for Kapton solar array blanket protection, graphite epoxy structural member protection, and high temperature radiators was performed in an RF plasma asher. Ashing rates for Kapton were correlated with rates measured on STS-8 to determine the exposure time equivalent to one year in low Earth orbit (LEO) at a constant density space station orbital flux. Protective coatings on Kapton from Tekmat, Andus Corporation, and LeRC were evaluated in the plasma asher and mass loss rates per unit area were measured for each sample. All samples evaluated provided some protection to the underlying surface but ion beam sputter deposited samples of SiO2 and SiO2 with 8% polytetrafluoroethylene (PTFE) showed no evidence of degradation after 47 hours of exposure. Mica paint was evaluated as a protective coating for graphite epoxy structural members. Mica appears to be resistant to attack by atomic oxygen but only offers some limited protection as a paint because the paint vehicles evaluated to date were not resistant to atomic oxygen. Four materials were selected for evaluation as candidate radiator materials: stainless steel, copper, niobium-1% zirconium, and titanium-6% aluminum-4% vanadium. These materials were surface textured by various means to improve their emittance. Emittances as high as 0.93 at 2.5 microns for stainless steel and 0.89 at 2.5 microns for Nb-1 Zr were obtained from surface texturing. There were no significant changes in emittance after asher exposure.

  11. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.;

    2012-01-01

    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing......-278/OGLE-2011-BLG-012N. Among them, we are able to confirm that the companions of the lenses of MOA-2011-BLG-104/OGLE-2011-BLG-0172 and MOA-2011-BLG-149 are brown dwarfs by determining the mass of the lens based on the simultaneous measurement of the Einstein radius and the lens parallax. The measured...... masses of the brown dwarf companions are 0.02 ± 0.01 M⊙ and 0.019 ± 0.002 M⊙ for MOA-2011-BLG-104/OGLE-2011-BLG-0172 and MOA-2011-BLG-149, respectively, and both companions are orbiting low-mass M dwarf host stars. More microlensing brown dwarfs are expected to be detected as the number of lensing events...

  12. Bioinformatics methods for identifying candidate disease genes

    NARCIS (Netherlands)

    Driel, M.A. van; Brunner, H.G.

    2006-01-01

    With the explosion in genomic and functional genomics information, methods for disease gene identification are rapidly evolving. Databases are now essential to the process of selecting candidate disease genes. Combining positional information with disease characteristics and functional information i

  13. Cattle Candidate Genes for Milk Production Traits

    OpenAIRE

    Kadlec, Tomáš

    2012-01-01

    The aim of this thesis is to make an overview of important candidate genes affecting milk yield and milk quality parameters, with an emphasis on genes associated with the quantity and quality of milk proteins and milk fat.

  14. Evaluating historical candidate genes for schizophrenia

    DEFF Research Database (Denmark)

    Farrell, M S; Werge, T; Sklar, P;

    2015-01-01

    Prior to the genome-wide association era, candidate gene studies were a major approach in schizophrenia genetics. In this invited review, we consider the current status of 25 historical candidate genes for schizophrenia (for example, COMT, DISC1, DTNBP1 and NRG1). The initial study for 24...... of these genes explicitly evaluated common variant hypotheses about schizophrenia. Our evaluation included a meta-analysis of the candidate gene literature, incorporation of the results of the largest genomic study yet published for schizophrenia, ratings from informed researchers who have published...... on these genes, and ratings from 24 schizophrenia geneticists. On the basis of current empirical evidence and mostly consensual assessments of informed opinion, it appears that the historical candidate gene literature did not yield clear insights into the genetic basis of schizophrenia. A likely reason why...

  15. Towards Treating Chemistry Teacher Candidates as Human

    Science.gov (United States)

    Lewthwaite, Brian Ellis

    2008-05-01

    This research inquiry investigates the factors influencing chemistry teacher candidates’ development during their extended practica in the second and final year of an After-Degree Bachelor of Education at a university in central Canada. A variety of data sources are used to identify the risk and protective factors impeding and contributing to the achievement of their chemistry pedagogical aspirations. Two theoretical frameworks, both having their origins in the pioneering work of Kurt Lewin, are used to conceptualize how a complex amalgam of personal attribute and environmental factors and the interplay among these factors influence teacher candidate developmental trajectories. The tenets of both Bronfenbrenner’s bioecological model and Learning Environment research provide insights into how the factors influencing teacher candidate development can be understood and systematically documented to provide a template for reflective consideration of the practicum experience for both teacher candidates and those involved in fostering the development of chemistry teacher candidates.

  16. Developing Expertise: Using Video to Hone Teacher Candidates' Classroom Observation Skills

    Science.gov (United States)

    Cuthrell, Kristen; Steadman, Sharilyn C.; Stapleton, Joy; Hodge, Elizabeth

    2016-01-01

    This article explores the impact of a video observation model developed for teacher candidates in an early experiences course. Video Grand Rounds (VGR) combines a structured observation protocol, videos, and directed debriefing to enhance teacher candidates' observations skills within nonstructured and field-based observations. A comparative…

  17. Stress analysis for the candidate of lower end fitting of advanced LWR fuel using FEM

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S. S.; Moon, Y. C. [Korea University of Technology and Education, Chonan (Korea, Republic of); Kim, H. K. [Korea Nuclear Fuel Company, Taejon (Korea, Republic of)

    2002-10-01

    The geometric modeling has been conducted for the candidate of advanced LWR fuel using the three-dimensional solid modeler. Then the three-dimensional stress analysis using MSC/NASTRAN has been performed. The evaluation for the mechanical integrity of the candidate has been performed based on the stress distribution obtained from the finite elements analysis.

  18. A Proposed Pedagogical Approach for Preparing Teacher Candidates to Incorporate Academic Language in Mathematics Classrooms

    Science.gov (United States)

    Lim, Woong; Stallings, Lynn; Kim, Dong Joong

    2015-01-01

    The purpose of this article is to present issues related to prioritizing academic language in teaching performance assessments and to propose a pedagogical approach that prepares middle grades mathematics teacher candidates to teach academic language. Based on our experience with teacher candidates and our knowledge of edTPA standards involving…

  19. Effects of Lesson Study on Science Teacher Candidates' Teaching Efficacies

    Science.gov (United States)

    Pektas, Murat

    2014-01-01

    The aim of this study was to investigate the effects of the lesson study process on science teacher candidates' teaching in terms of lesson plan content, pedagogy and classroom management based on expert, peer and self-evaluations. The participants of this case study consisted of 16 teacher candidates in elementary science education in their…

  20. Candidal Leukoplakia on Patient with Removable Denture

    OpenAIRE

    Shiril Paskalis; Anandina Irmagita

    2013-01-01

    Candida infection is a common problem in patients using removable dentures, with the most frequent type is denture stomatitis. But other type of candidal infection could also happen in these patients, such as candidal leukoplakia. We reported a 61 years old female patient who complained a painful lesion under her lower removable denture. Oral examination revealed white plaque that could not be rubbed over an ulcer on the lingual part of alveolar processes under the lower removable denture pla...

  1. Cardiac evaluation of liver transplant candidates

    Institute of Scientific and Technical Information of China (English)

    Mercedes Susan Mandell; JoAnn Lindenfeld; Mei-Yung Tsou; Michael Zimmerman

    2008-01-01

    Physicians previously thought that heart disease was rare in patients with end stage liver disease. However, recent evidence shows that the prevalence of ischemic heart disease and cardiomyopathy is increased in transplant candidates compared to most other surgical candidates. Investigators estimate that up to 26% of all liver transplant candidates have at least one critical coronary artery stenosis and that at least half of these patients will die perioperatively of cardiac complications. Cardiomyopathy also occurs in greater frequency. While all patients with advanced cardiac disease have defects in cardiac performance, a larger than expected number of patients have classical findings of dilated, restrictive and hypertropic cardiomyopathy. This may explain why up to 56% of patients suffer from hypoxemia due to pulmonary edema following transplant surgery. There is considerable controversy on how to screen transplant candidates for the presence of heart disease. Questions focus upon, which patients should be screened and what tests should be used. This review examines screening strategies for transplant candidates and details the prognostic value of common tests used to identify ischemic heart disease. We also review the physiological consequences of cardiomyopathy in transplant candidates and explore the specific syndrome of "cirrhotic cardiomyopathy".

  2. Single Transit Candidates from K2: Detection and Period Estimation

    CERN Document Server

    Osborn, H P; Brown, D J A; McCormac, J; Doyle, A P; Louden, T M; Kirk, J; Spake, J J; Lam, K W F; Walker, S R; Faedi, F; Pollacco, D L

    2015-01-01

    Photometric surveys such as Kepler have the precision to identify exoplanet and eclipsing binary candidates from only a single transit. K2, with its 75d campaign duration, is ideally suited to detect significant numbers of single-eclipsing objects. Here we develop a Bayesian transit-fitting tool ("Namaste: An Mcmc Analysis of Single Transit Exoplanets") to extract orbital information from single transit events. We achieve favourable results testing this technique on known Kepler planets, and apply the technique to 7 candidates identified from a targeted search of K2 campaigns 1, 2 and 3. We find EPIC203311200 to host an excellent exoplanet candidate with a period, assuming zero eccentricity, of $540 ^{+410}_{-230}$ days and a radius of $0.51 \\pm 0.05 R_{Jup}$. We also find six further transit candidates for which more follow-up is required to determine a planetary origin. Such a technique could be used in the future with TESS, PLATO and ground-based photometric surveys such as NGTS, potentially allowing the d...

  3. Preformulation Considerations for Controlled Release Dosage Forms: Part I Selecting Candidates

    OpenAIRE

    Chrzanowski, Frank

    2008-01-01

    The physical–chemical properties of interest for Controlled Release (CR) dosage form development presented are based on the author’s experience. Part I addresses selection of the final form based on a logical progression of physical–chemical properties evaluation of candidate forms and elimination of forms with undesirable properties from further evaluation in order to simplify final form selection. Several candidate forms which could include salt, free base or acid, polymorphic and amorphic ...

  4. Identification of genes from the Treacher Collins candidate region

    Energy Technology Data Exchange (ETDEWEB)

    Dixon, M.; Dixon, J.; Edwards, S. [Univ. of California, Irvine, CA (United States)]|[Univ. of Manchester (United Kingdom)] [and others

    1994-09-01

    Treacher Collins syndrome (TCOF1) is an autosomal dominant disorder of craniofacial development. The TCOF1 locus has previously been mapped to chromosome 5q32-33. The candidate gene region has been defined as being between two flanking markers, ribosomal protein S14 (RPS14) and Annexin 6 (ANX6), by analyzing recombination events in affected individuals. It is estimated that the distance between these flanking markers is 500 kb by three separate analysis methods: (1) radiation hybrid mapping; (2) genetic linkage; and (3) YAC contig analysis. A cosmid contig which spans the candidate gene region for TCOF1 has been constructed by screening the Los Alamos National Laboratory flow-sorted chromosome 5 cosmid library. Cosmids were obtained by using a combination of probes generated from YAC end clones, Alu-PCR fragments from YACs, and asymmetric PCR fragments from both T7 and T3 cosmid ends. Exon amplifications, the selection of genomic coding sequences based upon the presence of functional splice acceptor and donor sites, was used to identify potential exon sequences. Sequences found to be conserved between species were then used to screen cDNA libraries in order to identify candidate genes. To date, four different cDNAs have been isolated from this region and are being analyzed as potential candidate genes for TCOF1. These include the genes encoding plasma glutathione peroxidase (GPX3), heparin sulfate sulfotransferase (HSST), a gene with homology to the ETS family of proteins and one which shows no homology to any known genes. Work is also in progress to identify and characterize additional cDNAs from the candidate gene region.

  5. Extracting definition candidates from specialized corpora

    Directory of Open Access Journals (Sweden)

    Senja Pollak

    2014-07-01

    Full Text Available Human knowledge is available in different forms, including domain texts, terminological dictionaries, encyclopaediae, and recently also in computer- understandable representations of domain knowledge, such as taxonomies and ontologies. Since manual domain modeling is costly and time-consuming, researchers in human language technologies have started developing methods and tools for semi-automatic extraction of domain-specific knowledge from unstructured texts, involving tasks, such as terminology extraction, definition extraction, semantic relations extraction, or semi-automatic ontology building. This article presents a methodology for definition extraction from domain corpora, currently available for Slovene and English. Since most of the existing methods and tools are language specific and not developed for minor languages, the main contribution of the dissertation is the developed definition extraction methodology for Slovene. The proposed definition extraction methodology is based on three different approaches to extracting definition candidates. The first follows the traditional pattern-based approach, in which patterns are composed of lemmas and morphosyntactic descriptions; the second approach relies on pairs of domain terms extracted through automatic term extraction; the third approach exploits wordnet hypernym pairs. We propose an original combination of the three approaches. The developed methodology was applied to a real-case problem of modeling the language technologies domain, for which we constructed a comparable Slovene- English corpus consisting of about two million tokens. We extracted more than 3,400 definition candidates, of which over 700 (approximately 480 for Slovene and 230 for English were evaluated as definitions. The results are used as a basis for the Language Technologies Glossary.17 An additional contribution is the proposed domain-modeling pipeline—from corpus uploading and preprocessing to inspecting the

  6. Characterization for Fusion Candidate Vanadium Alloys

    Institute of Scientific and Technical Information of China (English)

    T. Muroga; T. Nagasaka; J. M. Chen; Z. Y. Xu; Q. Y. Huang; y. C. Wu

    2004-01-01

    This paper summarizes recent achievements in the characterization of candidate vanadium alloys obtained for fusion in the framework of the Japan-China Core University Program.National Institute for Fusion Science (NIFS) has a program of fabricating high-purity V-4Cr4Ti alloys. The resulting products (NIFS-HEAT-1,2), were characterized by various research groups in the world including Chinese partners. South Western Institute of Physics (SWIP) fabricated a new V-4Cr-4Ti alloy (SWIP-Heat), and carried out a comparative evaluation of hydrogen embrittlement of NIFS-HEATs and SWIP-Heat. The tensile test of hydrogen-doped alloys showed that the NIFS-HEAT maintained the ductility to relatively high hydrogen levels.The comparison of the data with those of previous studies suggested that the reduced oxygen level in the NIFS-HEATs should be responsible for the increased resistance to hydrogen embrittlement.Based on the chemical analysis data of NIFS-HEATs and SWIP-Heats, neutron-induced activation was analyzed in Institute of Plasma Physics (IPP-CAS) as a function of cooling time after the use in the fusion first wall. The results showed that the low level of Co dominates the activity up to 50 years followed by a domination of Nb or Nb and Al in the respective alloys. It was suggested that reduction of Co and Nb, both of which are thought to have been introduced via cross-contamination into the alloys from the molds used should be crucial for reducing further the activation.

  7. Corrosion resistance of candidate transportation container materials

    International Nuclear Information System (INIS)

    The Department of Energy is currently remediating several sites that have been contaminated over the years with hazardous, mixed waste and radioactive materials. Regulatory guidelines require strict compliance demonstrating public safety during remediation and the transport of these hazardous, mixed waste and radioactive materials. The compatibility of the metallic transportation containers with the contents they are designed to transport is an ultimate concern that must be satisfied to ensure public safety. The transportation issue is inherently complicated due to the complex, varied, and unknown composition of the hazardous, mixed and radioactive waste that is being, considered for transport by the DOE facilities. Never before have the interactions between the waste being transported and the materials that comprise the transportation packages been more important. Therefore, evaluation of material performance when subjected to a simulated waste will ensure that all regulatory issues and requirements for transportation of hazardous, mixed, and radioactive wastes are satisfied. The tasks encompassed by this study include defining criteria for candidate material selection, defining a test matrix that will provide pertinent information on the material compatibility with the waste stimulant, and evaluation of material performance when subjected to a stimulant waste. Our goal is to provide package design engineers with a choice of materials which exhibit enhanced performance upon exposure to hazardous, mixed, and radioactive waste that is similar in composition to the waste stimulant used in this study. Due to the fact that there are many other possible waste compositions, additional work needs to be done to broaden our materials compatibility/waste stream data base

  8. Cattle Candidate Genes for Meat Production Traits

    OpenAIRE

    Bláhová, Alice

    2013-01-01

    The objective of this study was to compile a summary of the most important candidate genes for meat production. The studied genes were: GH, GHR, MSTN, MyoD family, leptin, IGF, TG5, SCD, DGAT and STAT5A. Growth hormone (GH) is involved in physiological processes of growth and metabolism. Growth hormone receptor (GHR) has been proposed as a candidate gene for meat production in cattle. Myostatin is a significant marker. It affects the amount of muscle, reduces marbling and elevate meat tendern...

  9. Issue-Advocacy versus Candidate Advertising: Effects on Candidate Preferences and Democratic Process.

    Science.gov (United States)

    Pfau, Michael; Holbert, R. Lance; Szabo, Erin Alison; Kaminski, Kelly

    2002-01-01

    Examines the influence of soft-money-sponsored issue-advocacy advertising in U.S. House and Senate campaigns, comparing its effects against candidate-sponsored positive advertising and contrast advertising on viewers' candidate preferences and on their attitude that reflect democratic values. Reveals no main effects for advertising approach on…

  10. Evaluation and selection of candidate high-level waste forms

    Energy Technology Data Exchange (ETDEWEB)

    Bernadzikowski, T. A.; Allender, J. S.; Butler, J. L.; Gordon, D. E.; Gould, Jr., T. H.; Stone, J. A.

    1982-03-01

    Seven candidate waste forms being developed under the direction of the Department of Energy's National High-Level Waste (HLW) Technology Program, were evaluated as potential media for the immobilization and geologic disposal of high-level nuclear wastes. The evaluation combined preliminary waste form evaluations conducted at DOE defense waste-sites and independent laboratories, peer review assessments, a product performance evaluation, and a processability analysis. Based on the combined results of these four inputs, two of the seven forms, borosilicate glass and a titanate based ceramic, SYNROC, were selected as the reference and alternative forms for continued development and evaluation in the National HLW Program. Both the glass and ceramic forms are viable candidates for use at each of the DOE defense waste-sites; they are also potential candidates for immobilization of commercial reprocessing wastes. This report describes the waste form screening process, and discusses each of the four major inputs considered in the selection of the two forms.

  11. Development of Polypeptide-based Nanoparticles for Non-viral Delivery of CD22 RNA Trans-splicing Molecule as a New Precision Medicine Candidate Against B-lineage ALL

    Directory of Open Access Journals (Sweden)

    Fatih M. Uckun

    2015-07-01

    Full Text Available CD22ΔE12 has emerged as a driver lesion in the pathogenesis of pediatric B-lineage acute lymphoblastic leukemia (ALL and a new molecular target for RNA therapeutics. Here we report a 43-gene CD22ΔE12 signature transcriptome that shows a striking representation in primary human leukemia cells from patients with relapsed BPL. Our data uniquely indicate that CD22ΔE12 is a candidate driver lesion responsible for the activation of MAPK and PI3-K pathways in aggressive forms of B-lineage ALL. We also show that the forced expression of a CD22 RNA trans-splicing molecule (RTM markedly reduces the capacity of the leukemic stem cell fraction of CD22ΔE12+ B-lineage ALL cells to engraft and cause overt leukemia in NOD/SCID mice. We have successfully complexed our rationally designed lead CD22-RTM with PVBLG-8 to prepare a non-viral nanoscale formulation of CD22ΔE12-RTM with potent anti-cancer activity against CD22ΔE12+ B-lineage leukemia and lymphoma cells. CD22-RTM nanoparticles effectively delivered the CD22-RTM cargo into B-lineage ALL cells and exhibited significant anti-leukemic activity in vitro.

  12. A novel live-attenuated vaccine candidate for mayaro Fever.

    Directory of Open Access Journals (Sweden)

    William J Weise

    2014-08-01

    Full Text Available Mayaro virus (MAYV is an emerging, mosquito-borne alphavirus that causes a dengue-like illness in many regions of South America, and which has the potential to urbanize. Because no specific treatment or vaccine is available for MAYV infection, we capitalized on an IRES-based approach to develop a live-attenuated MAYV vaccine candidate. Testing in infant, immunocompetent as well as interferon receptor-deficient mice demonstrated a high degree of attenuation, strong induction of neutralizing antibodies, and efficacy against lethal challenge. This vaccine strain was also unable to infect mosquito cells, a major safety feature for a live vaccine derived from a mosquito-borne virus. Further preclinical development of this vaccine candidate is warranted to protect against this important emerging disease.

  13. Planetary transit candidates in COROT-IRa01 field

    CERN Document Server

    Carpano, S; Alonso, R; Barge, P; Aigrain, S; Almenara, J -M; Bordé, P; Bouchy, F; Carone, L; Deeg, H J; De la Reza, R; Deleuil, M; Dvorak, R; Erikson, A; Fressin, F; Fridlund, M; Gondoin, P; Guillot, T; Hatzes, A; Jorda, L; Lammer, H; Léger, A; Llebaria, A; Magain, P; Moutou, C; Ofir, A; Ollivier, M; Pacheco, E J; Pátzold, M; Pont, F; Queloz, D; Rauer, H; Régulo, C; Renner, S; Rouan, D; Samuel, B; Schneider, J; Wuchterl, G

    2009-01-01

    Context: CoRoT is a pioneering space mission devoted to the analysis of stellar variability and the photometric detection of extrasolar planets. Aims: We present the list of planetary transit candidates detected in the first field observed by CoRoT, IRa01, the initial run toward the Galactic anticenter, which lasted for 60 days. Methods: We analysed 3898 sources in the coloured bands and 5974 in the monochromatic band. Instrumental noise and stellar variability were taken into account using detrending tools before applying various transit search algorithms. Results: Fifty sources were classified as planetary transit candidates and the most reliable 40 detections were declared targets for follow-up ground-based observations. Two of these targets have so far been confirmed as planets, COROT-1b and COROT-4b, for which a complete characterization and specific studies were performed.

  14. A thermodynamic approach to the affinity optimization of drug candidates.

    Science.gov (United States)

    Freire, Ernesto

    2009-11-01

    High throughput screening and other techniques commonly used to identify lead candidates for drug development usually yield compounds with binding affinities to their intended targets in the mid-micromolar range. The affinity of these molecules needs to be improved by several orders of magnitude before they become viable drug candidates. Traditionally, this task has been accomplished by establishing structure activity relationships to guide chemical modifications and improve the binding affinity of the compounds. As the binding affinity is a function of two quantities, the binding enthalpy and the binding entropy, it is evident that a more efficient optimization would be accomplished if both quantities were considered and improved simultaneously. Here, an optimization algorithm based upon enthalpic and entropic information generated by Isothermal Titration Calorimetry is presented.

  15. A stereo matching algorithm using multi-peak candidate matches and geometric constraints

    Institute of Scientific and Technical Information of China (English)

    Yepeng Guan

    2008-01-01

    Gray cross correlation matching technique is adopted to extract candidate matches with gray cross correla- tion coefficients less than some certain range of maximal correlation coefficient called multi-peak candidate matches. Multi-peak candidates are extracted corresponding to three closest feature points at first. The corresponding multi-peak candidate matches are used to construct the model polygon. Correspondence is determined based on the local geometric relations between the three feature points and the multi-peak candidates. The disparity test and the global consistency checkout are applied to eliminate the remaining ambiguous matches that are not removed by the local geometric relational test. Experimental results show that the proposed algorithm is feasible and accurate.

  16. Towards Treating Chemistry Teacher Candidates as Human

    Science.gov (United States)

    Lewthwaite, Brian Ellis

    2008-01-01

    This research inquiry investigates the factors influencing chemistry teacher candidates' development during their extended practica in the second and final year of an After-Degree Bachelor of Education at a university in central Canada. A variety of data sources are used to identify the risk and protective factors impeding and contributing to the…

  17. Spectroscopy of Hyades L dwarf candidates

    CERN Document Server

    Lodieu, N; Bejar, V J S

    2014-01-01

    We present the results of photometric, astrometric, and spectroscopic follow-up of L dwarf candidates identified in the Hyades cluster by Hogan et al. (2008). We obtained low-resolution optical spectroscopy with the OSIRIS spectrograph on the Gran Telescopio de Canarias for all 12 L dwarf candidates as well as new J-band imaging for a subsample of eight to confirm their proper motion. We also present mid-infrared photometry from the Wise Field Infrared Survey Explorer (WISE) for the Hyades L and T dwarf candidates and estimate their spectroscopic distances, effective temperatures, and masses. We confirm the cool nature of several L dwarf candidates and confirm astrometrically their membership, bridging the gap between the coolest M dwarfs and the two T dwarfs previously reported in the Hyades cluster. These members represent valuable spectral templates at an age of 625 Myr and slightly super solar metallicity (Fe/H=+0.13). We update the Hyades mass function across the hydrogen-burning limit and in the substel...

  18. 76 FR 36130 - Call for Candidates

    Science.gov (United States)

    2011-06-21

    ... From the Federal Register Online via the Government Publishing Office FEDERAL ACCOUNTING STANDARDS ADVISORY BOARD Call for Candidates AGENCY: Federal Accounting Standards Advisory Board. ACTION: Request for... Accounting Standards Advisory Board (FASAB or the Board) with the requested materials in response to...

  19. 11 CFR 9003.2 - Candidate certifications.

    Science.gov (United States)

    2010-01-01

    ... excess of the aggregate payments to which they will be entitled under 11 CFR part 9004. (2) That no... funds under 11 CFR 9003.2(c)(3) shall not count against such candidate's $50,000 expenditure limitation... expenditures in excess of the limitations of 11 CFR 110.8(a), the Commission may seek civil penalties under...

  20. Emotional Intelligence and Beginning Teacher Candidates

    Science.gov (United States)

    Justice, Madeline; Espinoza, Sue

    2007-01-01

    According to the Bureau of Labor Statistics, Texas will need over 82,000 new teachers by 2008. Many teachers are leaving the profession within 5 years of being employed. Closing a revolving door, teacher preparation programs are discussing this phenomenon. One hundred sixty beginning teacher candidates were surveyed using the Emotional Skills…

  1. Fuzzy Treatment of Candidate Outliers in Measurements

    Directory of Open Access Journals (Sweden)

    Giampaolo E. D'Errico

    2012-01-01

    Full Text Available Robustness against the possible occurrence of outlying observations is critical to the performance of a measurement process. Open questions relevant to statistical testing for candidate outliers are reviewed. A novel fuzzy logic approach is developed and exemplified in a metrology context. A simulation procedure is presented and discussed by comparing fuzzy versus probabilistic models.

  2. Promoting Team Leadership Skills in Doctoral Candidates

    Science.gov (United States)

    Suleiman, Mahmoud; Whetton, Danny

    2014-01-01

    Doctoral programs can serve as an optimal opportunity for candidates to engage in tasks and activities to transform them and their schools. The paradigm shifts in such preparation involve moving from sitting and getting to making and taking. Most importantly, it requires building leadership skills and styles necessary to bring about desired change…

  3. Gallium-67 imaging in candidal esophagitis

    Energy Technology Data Exchange (ETDEWEB)

    Rundback, J.H.; Goldfarb, C.R.; Ongseng, F. (Beth Israel Medical Center, New York, NY (USA))

    1990-01-01

    Ga-67 scanning has been used to evaluate esophageal carcinoma. It has demonstrated candidal infection in other body sites and, in one previous case, in the esophagus. The authors present a case of diffuse esophageal uptake of Ga-67 in esophageal candidiasis.

  4. The Responsibility Education of Teacher Candidates

    Science.gov (United States)

    Toremen, Fatih

    2011-01-01

    In this study, it was aimed to take the views and suggestions of academicians working at the faculty of education on what can be done about teacher candidates' responsibility education. This study was designed on the basis of qualitative research approach and purposive sampling method was used. Data were collected by unstructured interview method…

  5. Candidal Leukoplakia on Patient with Removable Denture

    Directory of Open Access Journals (Sweden)

    Shiril Paskalis

    2013-07-01

    Full Text Available Candida infection is a common problem in patients using removable dentures, with the most frequent type is denture stomatitis. But other type of candidal infection could also happen in these patients, such as candidal leukoplakia. We reported a 61 years old female patient who complained a painful lesion under her lower removable denture. Oral examination revealed white plaque that could not be rubbed over an ulcer on the lingual part of alveolar processes under the lower removable denture plate, and also an erythematous area on palatum durum above the upper full denture. The patient was suspected to have candidal leukoplakia on the lingual part of the mandible and denture stomatitis on the palate area. The treatment consisted of nystatin oral suspension, chlorhexidine solution, multivitamins, along with denture replacement and oral health education. The entire lesion resolved within 2 months therapy. Candidal infection treatment on denture patient needs not only medication or denture replacement, but also patient compliance to achieve maximal result.

  6. FAME's Search for Extrasolar Planet Candidates

    Science.gov (United States)

    Johnston, K.

    FAME is a five year survey mission to observe the positions, proper motions, and parallaxes of 40,000,000 stars down to 15th magnitude with accuracies of 50 microarcseconds at 9th magnitude. In addition to producing an astrometric and photometric catalog unparalleled for its accuracy and size, the survey will provide significant astrophysics results and search for extrasolar planet candidates.

  7. Secondary Teacher Candidates' Lesson Planning Learning

    Science.gov (United States)

    Santoyo, Christina; Zhang, Shaoan

    2016-01-01

    Teacher candidates (TCs) use clinical experiences to enact concepts taught in their university courses; therefore field experiences may be the most important component of teacher preparation (Hammerness et al., 2005). TCs require support and guidance as they learn to adapt curriculum materials for effective use in the classroom (Davis, 2006). They…

  8. Candidate genes in ocular dominance plasticity

    NARCIS (Netherlands)

    M.L. Rietman; J.-P. Sommeijer; C.N. Levelt; J.A. Heimel; A.B. Brussaard; J.G.G. Borst; Y. Elgersma; N. Galjart; G.T. van der Horst; C.M. Pennartz; A.B. Smit; B.M. Spruijt; M. Verhage; C.I. de Zeeuw

    2012-01-01

    Many studies have been devoted to the identification of genes involved in experience-dependent plasticity in the visual cortex. To discover new candidate genes, we have reexamined data from one such study on ocular dominance (OD) plasticity in recombinant inbred BXD mouse strains. We have correlated

  9. Microlensing Binaries with Candidate Brown Dwarf Companions

    DEFF Research Database (Denmark)

    Shin, I.-G; Han, C.; Gould, A.;

    2012-01-01

    Brown dwarfs are important objects because they may provide a missing link between stars and planets, two populations that have dramatically different formation histories. In this paper, we present the candidate binaries with brown dwarf companions that are found by analyzing binary microlensing ...

  10. Gallium-67 imaging in candidal esophagitis

    International Nuclear Information System (INIS)

    Ga-67 scanning has been used to evaluate esophageal carcinoma. It has demonstrated candidal infection in other body sites and, in one previous case, in the esophagus. The authors present a case of diffuse esophageal uptake of Ga-67 in esophageal candidiasis

  11. Social Justice Perceptions of Teacher Candidates

    Science.gov (United States)

    Turhan, Muhammed

    2010-01-01

    This study aims to determine the social justice perceptions of teacher candidates being trained in an education faculty. For this purpose, national and international literature was reviewed by the researcher and a 32-item questionnaire was developed and implemented on 237 senior year education faculty students. Data from the questionnaires were…

  12. Candidate genes in ocular dominance plasticity

    Directory of Open Access Journals (Sweden)

    M. Liset Rietman

    2012-02-01

    Full Text Available The objective of this study was to identify new candidate genes involved in experience-dependent plasticity. To this aim, we combined previously obtained data from recombinant inbred BXD strains on ocular dominance (OD plasticity and gene expression levels in the neocortex. We validated our approach using a list of genes which alter OD plasticity when inactivated. The expression levels of one fifth of these genes correlated with the amount of OD plasticity. Moreover, the two genes with the highest relative inter-strain differences were among the correlated genes. This suggests that correlation between gene expression levels and OD plasticity is indeed likely to point to genes with a causal role in modulating or generating plasticity in the visual cortex. After this validation on known plasticity genes, we identified new candidate genes by a multi-step approach. First, a list was compiled of all genes of which the expression level in BXD strains correlate with the amount of OD plasticity. To narrow this list to the more promising candidates, we took its cross-section with a list of genes co-regulated with the sensitive period for OD plasticity and a list of genes associated with pathways implicated in OD plasticity. This analysis resulted in a list of 32 candidate genes. The list contained unproven, but not surprising, candidates, such as the genes for IGF-1, NCAM1, NOGO-A, the gamma2 subunit of the GABA(A receptor, acetylcholine esterase and the catalytic subunit of cAMP-dependent protein kinase A. This was indicative of the viability of our approach, but more interesting were the novel candidate genes: Akap7, Akt1, Camk2d, Cckbr, Cd44, Crim1, Ctdsp2, Dnajc5, Gnai1, Itpka, Mapk8, Nbea, Nfatc3, Nlk, Npy5r, Phf21a, Phip, Ppm1l, Ppp1r1b, Rbbp4, Slc1a3, Slit2, Socs2, Spock3, St8sia1, Zfp207. The possible role of some of these candidates is discussed in the article.

  13. Candidate genes for drought tolerance and improved productivity in rice (Oryza sativa L.)

    Indian Academy of Sciences (India)

    M S Vinod; Naveen Sharma; K Manjunatha; Adnan Kanbar; N B Prakash; H E Shashidhar

    2006-03-01

    Candidate genes are sequenced genes of known biological action involved in the development or physiology of a trait. Twenty-one putative candidate genes were designed after an exhaustive search in the public databases along with an elaborate literature survey for candidate gene products and/or regulatory sequences associated with enhanced drought resistance. The downloaded sequences were then used to design primers considering the flanking sequences as well. Polymerase chain reaction (PCR) performed on 10 diverse cultivars that involved Japonica, Indica and local accessions, revealed 12 polymorphic candidate genes. Seven polymorphic candidate genes were then utilized to genotype 148 individuals of CT9993 × IR62266 doubled haploid (DH) mapping population. The segregation data were tested for deviation from the expected Mendelian ratio (1:1) using a Chi-square test (<1%). Based on this, four candidate genes were assessed to be significant and the remaining three, as non-significant. All the significant candidate genes were biased towards CT9993, the female parent in the DH mapping population. Single-marker analysis strongly associated ( < 1%) them to different traits under both well-watered and low-moisture stress conditions. Two candidate genes, EXP15 and EXP13, were found to be associated with root number and silicon content in the stem respectively, under both well-watered and low-moisture stress conditions.

  14. 22 CFR 11.8 - Travel expenses of candidates.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Travel expenses of candidates. 11.8 Section 11... Travel expenses of candidates. The travel and other personal expenses of candidates incurred in... Department may issue round-trip invitational travel orders to bring candidates to Washington at...

  15. 32 CFR 901.6 - Candidate fitness test requirement.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Candidate fitness test requirement. 901.6... Requirements § 901.6 Candidate fitness test requirement. Before being offered an appointment, candidates must take a Candidate Fitness Test (CFT) which consists of exercises designed to measure muscular...

  16. Candidate z~8-9 Galaxies from WFC3 Imaging

    CERN Document Server

    Lorenzoni, Silvio; Wilkins, Stephen; Stanway, Elizabeth; Jarvis, Matt; Caruana, Joseph

    2010-01-01

    We present a search for galaxies at 7.5based on the Lyman-break technique. We search for galaxies which have large (Y-J) colours (Y-drops) on account of the Lyman-alpha forest absorption, and with (J-H) colours inconsistent with being low-redshift contaminants. We identify 22 candidates at redshift z~8-9 over an area of ~50 square arcminutes. Previous searches for Y-drops with WFC3 have focussed only on the Hubble Ultra Deep Field (HUDF), and our larger survey (involving two other nearby deep fields and a wider area survey) has trebelled the number of robust Y-drop candidates. For the first time, we have sufficient Z~8-9 galaxies to fit a both phi* and M* of the UV Schechter luminosity function. There is evidence for evolution in this luminosity function from z=6-7 to z=8-9, in the sense that there are fewer UV-bright galaxies at z~8-9, consistent with an evolution mainly in M*. The candidate z~8-9 galaxies we detect have insufficient ionizing flux to ...

  17. Searches for millisecond pulsar candidates among the unidentified Fermi objects

    CERN Document Server

    Hui, C Y; Hu, C P; Lin, L C C; Li, K L; Kong, A K H; Tam, P H T; Takata, J; Cheng, K S; Jin, Ruolan; Yen, T -C; Kim, Chunglee

    2015-01-01

    Here we report the results of searching millisecond pulsar (MSP) candidates from the Fermi LAT second source catalog (2FGL). Seven unassociated $\\gamma-$ray sources in this catalog are identified as promising MSP candidates based on their $\\gamma$-ray properties. Through the X-ray analysis, we have detected possible X-ray counterparts, localized to an arcsecond accuracy. We have systematically estimated their X-ray fluxes and compared with the corresponding $\\gamma$-ray fluxes. The X-ray to $\\gamma$-ray flux ratios for 2FGL J1653.6-0159 and 2FGL J1946.4-5402 are comparable with the typical value for pulsars. For 2FGL J1625.2-0020, 2FGL J1653.6-0159 and 2FGL J1946.4-5402, their candidate X-ray counterparts are bright enough for performing a detailed spectral and temporal analysis to discriminate their thermal/non thermal nature and search for the periodic signal. We have also searched for possible optical/IR counterparts at the X-ray positions. For the optical/IR source coincident with the brightest X-ray obje...

  18. Candidate marketing takes the guessing game out of choosing employers.

    Science.gov (United States)

    Russell, Judith; Havel, Stacey

    2010-01-01

    Candidate marketing builds a foundation for relationships between employers and potential employees. Additionally, candidate marketing differentiates organizations in the marketplace. Organizations using candidate marketing to communicate the employer brand can expect a higher quality of candidates, and new employees are better prepared for the work environment and culture. Today, organizations can use a variety of integrated tools and techniques to communicate and build relationships with candidates. Candidate marketing demonstrates an organization's willingness towards transparency, and ability to invite open conversations between candidates and members of the organizations.

  19. Candidate marketing takes the guessing game out of choosing employers.

    Science.gov (United States)

    Russell, Judith; Havel, Stacey

    2010-01-01

    Candidate marketing builds a foundation for relationships between employers and potential employees. Additionally, candidate marketing differentiates organizations in the marketplace. Organizations using candidate marketing to communicate the employer brand can expect a higher quality of candidates, and new employees are better prepared for the work environment and culture. Today, organizations can use a variety of integrated tools and techniques to communicate and build relationships with candidates. Candidate marketing demonstrates an organization's willingness towards transparency, and ability to invite open conversations between candidates and members of the organizations. PMID:20672542

  20. Fruit and Oil Characteristics of Olive Candidate Cultivars from Turkey

    Directory of Open Access Journals (Sweden)

    Yasin OZDEMIR

    2016-06-01

    Full Text Available This is the first study in Turkey that evaluated olive fruit and oil characteristics of 23 cultivar candidates selected among 393 olive genotypes, on the bases of agronomical characteristics; the candidate cultivars were obtained by cross breeding between standard cultivars (‘Gemlik’, ‘Edinciksu’, ‘Uslu’, ‘Tavşan Yüreği’, ‘Karamürselsu’ and foreign cultivars (‘Lucques’, ‘Belle d’Espagne’ and ‘Manzanilla’. Fruit traits such as fruit weight, flesh to seed ratio, fruit and seed size, as well as oil characteristics such as moisture, oil content, specific absorption at ultraviolet light, free acid content, peroxide value, chlorophyll and fatty acid composition were determined. Fruits and oils of intensely cultivated ‘Gemlik’ and ‘Ayvalık’ olive cultivars were also analyzed to compare them with the new candidate cultivars. According to the oil content, ‘GE067’ (23.30%, ‘GE181’ (23.97%, ‘GE366’ (22.52%, ‘GE417’ (22.16%, ‘GT009’ (24.14%, ‘GT014’ (21.02%, ‘GU247’ (22.48%, ‘GU320’ (27.15% and ‘GU434’ (21.89% gave better results, thus having good potential for registration as new cultivars for oil production. ‘GE366’ and ‘GU434’ were determined as the best cultivar candidates for producing dual purpose olives (table olives and oil. ‘GE363’ had the best fatty acid composition, which is an important feature in terms of oxidative stability and disease prevention.

  1. Planetary Candidates Observed by \\ik V: Planet Sample from Q1-Q12 (36 Months)

    CERN Document Server

    Rowe, Jason F; Antoci, Victoria; Barclay, Thomas; Batalha, Natalie M; Borucki, William J; Burke, Christopher J; Bryson, Steven T; Caldwell, Douglas A; Campbell, Jennifer R; Catanzarite, Joseph H; Christiansen, Jessie L; Cochran, William; Gilliland, Ronald L; Girouard, Forrest R; Haas, Michael R; Helminiak, Krzysztof G; Henze, Christopher E; Hoffman, Kelsey L; Howell, Steve B; Huber, Daniel; Hunter, Roger C; Jang-Condell, Hannah; Jenkins, Jon M; Klaus, Todd C; Latham, David W; Li, Jie; Lissauer, Jack J; McCauliff, Sean D; Morris, Robert L; Mullally, F; Ofir, Aviv; Quarles, Billy; Quintana, Elisa; Sabale, Anima; Seader, Shawn; Shporer, Avi; Smith, Jeffrey C; Steffen, Jason H; Still, Martin; Tenenbaum, Peter; Thompson, Susan E; Twicken, Joseph D; Van Laerhoven, Christa; Wolfgang, Angie; Zamudio, Khadeejah A

    2015-01-01

    The Kepler mission discovered 2842 exoplanet candidates with 2 years of data. We provide updates to the Kepler planet candidate sample based upon 3 years (Q1-Q12) of data. Through a series of tests to exclude false-positives, primarily caused by eclipsing binary stars and instrumental systematics, 855 additional planetary candidates have been discovered, bringing the total number known to 3697. We provide revised transit parameters and accompanying posterior distributions based on a Markov Chain Monte Carlo algorithm for the cumulative catalogue of Kepler Objects of Interest. There are now 130 candidates in the cumulative catalogue that receive less than twice the flux the Earth receives and more than 1100 have a radius less than 1.5 Rearth. There are now a dozen candidates meeting both criteria, roughly doubling the number of candidate Earth analogs. A majority of planetary candidates have a high probability of being bonafide planets, however, there are populations of likely false-positives. We discuss and s...

  2. Most of the benefits from genomic selection can be realised by genotyping a proportion of selection candidates

    DEFF Research Database (Denmark)

    Henryon, Mark; Berg, Peer; Sørensen, Anders Christian;

    2012-01-01

    We reasoned that there are diminishing marginal returns from genomic selection as the proportion of genotyped selection candidates is increased and breeding values based on a priori information are used to choose the candidates that are genotyped. We tested this premise by stochastic simulation...... of breeding schemes that resembled those used for pigs. We estimated rates of genetic gain and inbreeding realized by genomic selection in breeding schemes where candidates were phenotyped before genotyping and 0-100% of the candidates were genotyped based on predicted breeding values. Genotypings were...... allocated to male and female candidates at ratios of 100:0, 75:25, 50:50, 25:75, and 0:100. For genotyped candidates, a direct-genomic value (DGV) was sampled with reliabilities 0.10, 0.50, and 0.90. Ten sires and 300 dams with the highest breeding values after genotyping were selected at each generation...

  3. Planetary Candidates Observed by Kepler VI: Planet Sample from Q1-Q16 (47 Months)

    CERN Document Server

    Mullally, F; Thompson, Susan E; Rowe, Jason; Burke, Christopher; Latham, David W; Batalha, Natalie M; Bryson, Stephen T; Christiansen, Jessie; Henze, Christopher E; Ofir, Aviv; Quarles, Billy; Shporer, Avi; Van Eylen, Vincent; Van Laerhoven, Christa; Shah, Yash; Wolfgang, Angie; Chaplin, W J; Xie, Ji-Wei; Akeson, Rachel; Argabright, Vic; Bachtell, Eric; Borucki, Thomas Barclay William J; Caldwell, Douglas A; Campbell, Jennifer R; Catanzarite, Joseph H; Cochran, William D; Duren, Riley M; Fleming, Scott W; Fraquelli, Dorothy; Girouard, Forrest R; Haas, Michael R; Hełminiak, Krzysztof G; Howell, Steve B; Huber, Daniel; Larson, Kipp; Gautier, Thomas N; Jenkins, Jon; Li, Jie; Lissauer, Jack J; McArthur, Scot; Miller, Chris; Morris, Robert L; Patil-Sabale, Anima; Plavchan, Peter; Putnam, Dustin; Quintana, Elisa V; Ramirez, Solange; Aguirre, V Silva; Seader, Shawn; Smith, Jeffrey C; Steffen, Jason H; Stewart, Chris; Stober, Jeremy; Still, Martin; Tenenbaum, Peter; Troeltzsch, John; Twicken, Joseph D; Zamudio, Khadeejah A

    2015-01-01

    \\We present the sixth catalog of Kepler candidate planets based on nearly 4 years of high precision photometry. This catalog builds on the legacy of previous catalogs released by the Kepler project and includes 1493 new Kepler Objects of Interest (KOIs) of which 554 are planet candidates, and 131 of these candidates have best fit radii 50 days to provide a consistently vetted sample that can be used to improve planet occurrence rate calculations. We discuss the performance of our planet detection algorithms, and the consistency of our vetting products. The full catalog is publicly available at the NASA Exoplanet Archive.

  4. Attitudes of Teacher Candidates Towards Teaching Profession

    Directory of Open Access Journals (Sweden)

    Aykut Emre BOZDOĞAN

    2007-12-01

    Full Text Available The objective of this study is to determine the attitudes of teacher candidates regarding teaching profession from the point of view of different variables. This study was taken place at Ahi Ervan University Teachers’ College in 2006-2007 year of education and 181 Applied science and Social science students participated it. In order to obtain the data of the research scanning method entitled “Determination of Attitude Towards Teaching Profession” was used which was developed by Aşkar and Erden (1987 . During the analysis of the research data SPSS 12.0 program and the necessary statistical methods were used to analize the data of the research. As a result of the research it is understood that the attitudes of teacher candidates change according to sex and factor that made them to choose the department they study.

  5. Spectroscopic follow up of Kepler planet candidates

    DEFF Research Database (Denmark)

    Latham..[], D. W.; Cochran, W. D.; Marcy, G.W.;

    2010-01-01

    Spectroscopic follow-up observations play a crucial role in the confirmation and characterization of transiting planet candidates identified by Kepler. The most challenging part of this work is the determination of radial velocities with a precision approaching 1 m/s in order to derive masses from...... spectroscopic orbits. The most precious resource for this work is HIRES on Keck I, to be joined by HARPS-North on the William Herschel Telescope when that new spectrometer comes on line in two years. Because a large fraction of the planet candidates are in fact stellar systems involving eclipsing stars...... and not planets, our strategy is to start with reconnaissance spectroscopy using smaller telescopes, to sort out and reject as many of the false positives as possible before going to Keck. During the first Kepler observing season in 2009, more than 100 nights of telescope time were allocated for this work, using...

  6. New drug candidates in tuberculosis treatment

    Directory of Open Access Journals (Sweden)

    Begüm Evranos Aksöz

    2014-12-01

    makes them quit the treatment. From these problems emerges the need for development of effective new drugs, with smaller duration of therapy, less side effects and without the problem of resistance. After a long period such as 40 years, a new drug molecule bedaquiline was approved in December 2012 by FDA while the drug was in phase II research. Bedaquiline will be used in multidrug resistant tuberculosis therapy. When the chemical structures of bedaquilline and other candidate drugs were examined, the structures such as diarylquinoline, oxazolidinone, nitroimidazole, ethylenediamine drew attention. These common structures will be directive in designing new molecules. In this review, bedaquiline and other candidate drug molecules such as sutezolide, linezolide, PA-824, delamanide, rifapentine, gatifloxacin, moxifloxacin, BTZ-043, TBA-354, CPZEN-45, DC-159a, Q201, SQ-609, SQ-641 were mentioned.

  7. NHI economic analysis of candidate nuclear hydrogen processes

    International Nuclear Information System (INIS)

    The DOE Nuclear Hydrogen Initiative (NHI) is investigating candidate technologies for large scale hydrogen production using high temperature gas-cooled reactors (HTGR) in concert with the Next Generation Nuclear Plant (NGNP) programme. The candidate processes include high temperature thermochemical and high temperature electrolytic processes which are being investigated in a sequence of experimental and analytic studies to establish the most promising and cost effective means of hydrogen production with nuclear energy. Although these advanced processes are in an early development stage, it is important that the projected economic potential of these processes be evaluated to assist in the prioritisation of research activities, and ultimately in the selection of the most promising processes for demonstration and deployment. The projected cost of hydrogen produced is the most comprehensive metric in comparing candidate processes. Since these advanced processes are in the early stages of development and much of the technology is still unproven, the estimated production costs are also significantly uncertain. The programme approach has been to estimate the cost of hydrogen production from each process periodically, based on the best available data at that time, with the intent of increasing fidelity and reducing uncertainty as the research programme and system definition studies progress. These updated cost estimates establish comparative costs at that stage of development but are also used as inputs to the evaluation of research priorities, and identify the key cost and risk (uncertainty) drivers for each process. The economic methodology used to assess the candidate processes are based on the H2A ground rules and modelling tool (discounted cash flow) developed by the DOE Office of Energy Efficiency and Renewable Energy (EERE). The figure of merit output from the calculation is the necessary selling price for hydrogen in dollars per kilogram that satisfies the cost

  8. Reducing stigma and discrimination: Candidate interventions

    OpenAIRE

    Kassam Aliya; Brohan Elaine; Thornicroft Graham; Lewis-Holmes Elanor

    2008-01-01

    Abstract This paper proposes that stigma in relation to people with mental illness can be understood as a combination of problems of knowledge (ignorance), attitudes (prejudice) and behaviour (discrimination). From a literature review, a series of candidate interventions are identified which may be effective in reducing stigmatisation and discrimination at the following levels: individuals with mental illness and their family members; the workplace; and local, national and international. The ...

  9. Critical Thinking Tendencies of Music Teacher Candidates

    OpenAIRE

    Duygu PİJİ KÜÇÜK; Yusuf Barış UZUN

    2013-01-01

    In this study, determining critical thinking and education levels, which are in sub-dimensions, of music teacher candidates, determining critical thinking tendency and the relations between sub dimensions and detecting if or if not critical thinking tendency creates a difference in terms of gender, class and what type of school they graduated from are aimed. Work group composes of 274 students being educated in the Departments of Music Education GSEB of Education Faculty of Bolu Abant İzzet B...

  10. MANAGEMENT OF ALLOSENSITIZED CARDIAC TRANSPLANT CANDIDATES

    OpenAIRE

    Velez, Mauricio; Johnson, Maryl R.

    2009-01-01

    Cardiac transplantation remains the best treatment in advanced heart failure patients with a high risk of death. However, an inadequate supply of donor hearts decreases the likelihood of transplantation for many patients. Ventricular assist devices (VAD) are being increasingly used as a bridge to transplant in patients who may not survive long enough to receive a heart. This expansion in VAD use has been associated with increasing rates of allosensitization in cardiac transplant candidates. A...

  11. Comparing Candidate Selection : A Feminist Institutionalist Approach

    OpenAIRE

    Bjarnegard, Elin; Kenny, Meryl

    2016-01-01

    This contribution evaluates the theoretical and methodological challenges ofresearching the gendered dynamics of candidate selection in comparativeperspective. It argues that comparative studies should take into account not only thegendered nature of political parties and their wider institutional context, but mustalso investigate the informal aspects of the selection process and their genderedconsequences. The article explores these dynamics by revisiting original in-depthresearch on the can...

  12. Nonclinical Development of BCG Replacement Vaccine Candidates

    OpenAIRE

    Bernd Eisele; Martin Gengenbacher; Reginald Kidd; David McCown; Sheldon Morris; Steven Derrick; David Hokey; Dominick Laddy; Rosemary Chang; Megan Fitzpatrick; Leander Grode; Kamalakannan Velmurugan; Stefan H. E. Kaufmann; John Fulkerson; Brennan, Michael J.

    2013-01-01

    The failure of current Mycobacterium bovis bacille Calmette–Guérin (BCG) vaccines, given to neonates to protect against adult tuberculosis and the risk of using these live vaccines in HIV-infected infants, has emphasized the need for generating new, more efficacious and safer replacement vaccines. With the availability of genetic techniques for constructing recombinant BCG (rBCG) strains containing well-defined gene deletions or insertions, new vaccine candidates are under evaluation at both ...

  13. Alcoholism and Alternative Splicing of Candidate Genes

    OpenAIRE

    Toshikazu Sasabe; Shoichi Ishiura

    2010-01-01

    Gene expression studies have shown that expression patterns of several genes have changed during the development of alcoholism. Gene expression is regulated not only at the level of transcription but also through alternative splicing of pre-mRNA. In this review, we discuss some of the evidence suggesting that alternative splicing of candidate genes such as DRD2 (encoding dopamine D2 receptor) may form the basis of the mechanisms underlying the pathophysiology of alcoholism. These reports sugg...

  14. Nuclear safety in EU candidate countries

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-10-01

    Nuclear safety in the candidate countries to the European Union is a major issue that needs to be addressed in the framework of the enlargement process. Therefore WENRA members considered it was their duty to offer their technical assistance to their Governments and the European Union Institutions. They decided to express their collective opinion on nuclear safety in those candidate countries having at least one nuclear power plant: Bulgaria, the Czech Republic, Hungary, Lithuania, Romania, Slovakia and Slovenia. The report is structured as follows: A foreword including background information, structure of the report and the methodology used, General conclusions of WENRA members reflecting their collective opinion, For each candidate country, an executive summary, a chapter on the status of the regulatory regime and regulatory body, and a chapter on the nuclear power plant safety status. Two annexes are added to address the generic safety characteristics and safety issues for RBMK and VVER plants. The report does not cover radiation protection and decommissioning issues, while safety aspects of spent fuel and radioactive waste management are only covered as regards on-site provisions. In order to produce this report, WENRA used different means: For the chapters on the regulatory regimes and regulatory bodies, experts from WENRA did the work. For the chapters on nuclear power plant safety status, experts from WENRA and from French and German technical support organisations did the work. Taking into account the contents of these chapters, WENRA has formulated its general conclusions in this report.

  15. Searching for candidate genes for male infertility

    Institute of Scientific and Technical Information of China (English)

    B.N.Truong; E.K.Moses; J.E.Armes; D.J.Venter; H.W.G.Baker

    2003-01-01

    Aim: We describe an approach to search for candidate genes for male infertility using the two human genome databases: the public University of California at Santa Cruz (UCSC) and private Celera databases which list known and predicted gene sequences and provide related information such as gene function, tissue expression,known mutations and single nucleotide polymorphisms (SNPs). Methods and Results: To demonstrate this in silico research, the following male infertility candidate genes were selected: (1) human BOULE, mutations of which may lead to germ cell arrest at the primary spermatocyte stage, (2) mutations of casein kinase 2 alpha genes which may cause globozoospermia, (3) DMR-N9 which is possibly involved in the spermatogenic defect of myotonic dystrophy and (4) several testes expressed genes at or near the breakpoints of a balanced translocation associated with hypospermatogenesis. We indicate how information derived from the human genome databases can be used to confirm these candidate genes may be pathogenic by studying RNA expression in tissue arrays using in situ hybridization and gene sequencing. Conclusion: The paper explains the new approach to discovering genetic causes of male infertility using information about the human genome. ( Asian J Andro1 2003 Jun; 5:137-147 )

  16. UNCOVERING THE NUCLEUS CANDIDATE FOR NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Günthardt, G. I.; Camperi, J. A. [Observatorio Astronómico, Universidad Nacional de Córdoba (Argentina); Agüero, M. P. [Observatorio Astronómico, Universidad Nacional de Córdoba, and CONICET (Argentina); Díaz, R. J.; Gomez, P. L.; Schirmer, M. [Gemini Observatory, AURA (United States); Bosch, G., E-mail: gunth@oac.uncor.edu, E-mail: camperi@oac.uncor.edu, E-mail: mpaguero@oac.uncor.edu, E-mail: rdiaz@gemini.edu, E-mail: pgomez@gemini.edu, E-mail: mschirmer@gemini.edu, E-mail: guille@fcaglp.unlp.edu.ar [Instituto de Astrofísica de La Plata (CONICET-UNLP) (Argentina)

    2015-11-15

    NGC 253 is the nearest spiral galaxy with a nuclear starburst that becomes the best candidate for studying the relationship between starburst and active galactic nucleus activity. However, this central region is veiled by large amounts of dust, and it has been so far unclear which is the true dynamical nucleus to the point that there is no strong evidence that the galaxy harbors a supermassive black hole co-evolving with the starburst as was supposed earlier. Near-infrared (NIR) spectroscopy, especially NIR emission line analysis, could be advantageous in shedding light on the true nucleus identity. Using Flamingos-2 at Gemini South we have taken deep K-band spectra along the major axis of the central structure and through the brightest infrared source. In this work, we present evidence showing that the brightest NIR and mid-infrared source in the central region, already known as radio source TH7 and so far considered just a large stellar supercluster, in fact presents various symptoms of a genuine galactic nucleus. Therefore, it should be considered a valid nucleus candidate. Mentioning some distinctive aspects, it is the most massive compact infrared object in the central region, located at 2.″0 of the symmetry center of the galactic bar, as measured in the K-band emission. Moreover, our data indicate that this object is surrounded by a large circumnuclear stellar disk and it is also located at the rotation center of the large molecular gas disk of NGC 253. Furthermore, a kinematic residual appears in the H{sub 2} rotation curve with a sinusoidal shape consistent with an outflow centered in the candidate nucleus position. The maximum outflow velocity is located about 14 pc from TH7, which is consistent with the radius of a shell detected around the nucleus candidate, observed at 18.3 μm (Qa) and 12.8 μm ([Ne ii]) with T-ReCS. Also, the Brγ emission line profile shows a pronounced blueshift and this emission line also has the highest equivalent width at this

  17. Assessment of potential solder candidates for high temperature applications

    DEFF Research Database (Denmark)

    of the package with different solders of different melting temperatures. High Pb containing alloys where the lead levels can be above 85% by weight, is one of the solders currently being used in this technology. Responding to market pressure i.e. need for green electronic products there is now an increasing...... complicates the corrosion problems. Although the cost of corrosion in the electronic sector could not be estimated, it has been suggested that a significant part of all electronic system failures are caused by corrosion. Thus, the determined potential solder candidates were classified based on its property...

  18. Carbamylated Erythropoietin: A Prospective Drug Candidate for Neuroprotection.

    Science.gov (United States)

    Chen, Jianmin; Yang, Zheng; Zhang, Xiao

    2015-01-01

    Carbamylated erythropoietin (cEpo), which is neuroprotective but lacks hematopoietic activity, has been attracting rising concerns. However, the cellular and molecular mechanisms involved in the process of neuroprotection of cEpo are not well known. Based on several recent reports, the neuroprotective effects of cEpo are illustrated, and signaling pathways involved in the different effects of erythropoietin and cEpo are discussed. These newly reported researches may shed new light on the development and application of cEpo, a prospective drug candidate for neuroprotection. PMID:26862298

  19. Mechanical Properties of Fuel Cladding Candidate Alloys for Canadian SCWR Concept

    Science.gov (United States)

    Xu, Su; Amirkhiz, Babak Shalchi

    2016-02-01

    An assessment of tensile and creep of five representative candidate fuel cladding alloys for a Canadian Gen IV super-critical water reactor concept was performed based on database development work and complementary experiments including a transmission electron microscopy study of creep in stainless steels. The limiting property would be creep strength of candidate alloys for the "free-standing" fuel cladding design with a hot-spot peak temperature range of 1073-1123 K (800-850°C).

  20. Hypervelocity star candidates in the SEGUE G and K dwarf sample

    Energy Technology Data Exchange (ETDEWEB)

    Palladino, Lauren E.; Holley-Bockelmann, Kelly [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Schlesinger, Katharine J. [Research School of Astronomy and Astrophysics, The Australian National University, Weston, ACT 2611 (Australia); Allende Prieto, Carlos [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Beers, Timothy C. [National Optical Astronomy Observatory, Tucson, AZ 85719 (United States); Lee, Young Sun [Department of Astronomy, New Mexico State University, Las Cruces, NM 88003 (United States); Schneider, Donald P., E-mail: lauren.e.palladino.1@vanderbilt.edu, E-mail: k.holley@vanderbilt.edu [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States)

    2014-01-01

    We present 20 candidate hypervelocity stars from the Sloan Extension for Galactic Understanding and Exploration (SEGUE) G and K dwarf samples. Previous searches for hypervelocity stars have only focused on large radial velocities; in this study, we also use proper motions to select the candidates. We determine the hypervelocity likelihood of each candidate by means of Monte Carlo simulations, considering the significant errors often associated with high proper motion stars. We find that nearly half of the candidates exceed their escape velocities with at least 98% probability. Every candidate also has less than a 25% chance of being a high-velocity fluke within the SEGUE sample. Based on orbits calculated using the observed six-dimensional positions and velocities, few, if any, of these candidates originate from the Galactic center. If these candidates are truly hypervelocity stars, they were not ejected by interactions with the Milky Way's supermassive black hole. This calls for a more serious examination of alternative hypervelocity-star ejection scenarios.

  1. ARIEL: an ESA M4 mission candidate

    Science.gov (United States)

    Puig, L.; Pilbratt, G. L.; Heske, A.; Escudero Sanz, I.; Crouzet, P.-E.

    2016-07-01

    The Atmospheric Remote sensing Infrared Exoplanet Large survey (ARIEL) mission is an M-class mission candidate within the science program Cosmic Vision of the European Space Agency (ESA). It was selected in June 2015 as one of three candidates to enter an assessment phase (phase 0/A). This process involves the definition of science and mission requirements as well as a preliminary model payload, and an internal Concurrent Design Facility (CDF) study providing the input to parallel industrial studies (in progress since 2016). After this process, the three candidates will be reviewed and in mid-2017 one of them will be selected as the M4 mission for launch in 2026. ARIEL is a survey-type mission dedicated to the characterisation of exoplanetary atmospheres. Using the differential technique of transit spectroscopy, ARIEL will obtain transmission and/or emission spectra of the atmospheres of a large and diverse sample of known exoplanets (~500) covering a wide range of masses, densities, equilibrium temperatures, orbital properties and host-star characteristics. This will include hot Jupiters to warm Super-Earths, orbiting M5 to F0 stars. This paper describes critical requirements, and reports on the results of the Concurrent Design Facility (CDF) study that was conducted in June / July 2015, providing a description of the resulting spacecraft design. It will employ a 0.7 m x 1.1 m off-axis three mirror telescope, feeding four photometric channels in the VNIR range (0.5-1.95 μm) and an IR spectrometer covering 1.95-7.8 μm.

  2. INVESTIGATING THE OPTICAL COUNTERPART CANDIDATES OF FOUR INTEGRAL SOURCES LOCALIZED WITH CHANDRA

    Energy Technology Data Exchange (ETDEWEB)

    Oezbey Arabac Latin-Small-Letter-Dotless-I , Mehtap [Department of Physics, Middle East Technical University, Ankara, 06531 (Turkey); Kalemci, Emrah [Faculty of Engineering and Natural Sciences, Sabanc Latin-Small-Letter-Dotless-I University, Orhanl Latin-Small-Letter-Dotless-I -Tuzla, Istanbul, 34596 (Turkey); Tomsick, John A.; Bodaghee, Arash [Space Sciences Laboratory, 7 Gauss Way, University of California, Berkeley, CA 94720-7450 (United States); Halpern, Jules [Columbia Astrophysics Laboratory, Columbia University, 550 West 120th Street, New York, NY 10027-6601 (United States); Chaty, Sylvain; Rodriguez, Jerome [AIM (UMR-E 9005 CEA/DSM-CNRS-Universite Paris Diderot) Irfu/Service d' Astrophysique, Centre de Saclay, F-91191 Gif-sur-Yvette Cedex (France); Rahoui, Farid, E-mail: mehtap@astroa.physics.metu.edu.tr [Astronomy Department, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States)

    2012-12-10

    We report on the optical spectroscopic follow-up observations of the candidate counterparts to four INTEGRAL sources: IGR J04069+5042, IGR J06552-1146, IGR J21188+4901, and IGR J22014+6034. The candidate counterparts were determined with Chandra, and the optical observations were performed with 1.5 m RTT-150 telescope (TUeBITAK National Observatory, Antalya, Turkey) and 2.4 m Hiltner Telescope (MDM Observatory, Kitt Peak, Arizona). Our spectroscopic results show that one of the two candidates of IGR J04069+5042 and the one observed for IGR J06552-1146 could be active late-type stars in RS CVn systems. However, according to the likelihood analysis based on Chandra and INTEGRAL, two optically weaker sources in the INTEGRAL error circle of IGR J06552-1146 have higher probabilities to be the actual counterpart. The candidate counterparts of IGR J21188+4901 are classified as an active M-type star and a late-type star. Among the optical spectra of four candidates of IGR J22014+6034, two show H{alpha} emission lines, one is a late-type star, and the other is an M type. The likelihood analysis favors a candidate with no distinguishing features in the optical spectrum. Two of the candidates classified as M-type dwarfs, are similar to some IGR candidates claimed to be symbiotic stars. However, some of the prominent features of symbiotic systems are missing in our spectra, and their NIR colors are not consistent with those expected for giants. We consider the IR colors of all IGR candidates claimed to be symbiotic systems and find that low-resolution optical spectrum may not be enough for conclusive identification.

  3. Dark Matter and its Particle Candidates

    CERN Document Server

    Bottino, A

    1999-01-01

    In these lectures we first briefly review the main observational facts which imply that most part of matter in the Universe is not visible and some recent intriguing experimental data which would point to a significant contribution to Omega due to a cosmological constant. We subsequently discuss some particle candidates for dark matter, with particular emphasis for the neutralino. We present the main properties of this particle, also in the light of the most recent experimental results in direct search for relic particles; furthermore, we discuss the perspectives for their indirect searches.

  4. Blend Analysis of HATNet Transit Candidates

    Directory of Open Access Journals (Sweden)

    Bakos G.Á.

    2011-02-01

    Full Text Available Candidate transiting planet systems discovered by wide-field groundbased surveys must go through an intensive follow-up procedure to distinguish the true transiting planets from the much more common false positives. Especially pernicious are configurations of three or more stars which produce radial velocity and light curves that are similar to those of single stars transited by a planet. In this contribution we describe the methods used by the HATNet team to reject these blends, giving a few illustrative examples.

  5. Candidate gene effects on beef quality

    OpenAIRE

    Ekerljung, Marie

    2012-01-01

    The contribution of five candidate genes to the variation in meat tenderness, pH, colour, marbling and water holding capacity (WHC) was analysed in muscle samples from 243 young bulls of Angus, Charolais, Hereford, Limousin, or Simmental breed, raised in Swedish commercial herds. The animals were genotyped for single nucleotide polymorphisms (SNPs) in the genes encoding calpain 1 (CAPN1:c.947G>C), calpastatin, (CAST:c.155C>T), diacylglycerol O-acyltransferase 1 (DGAT1), leptin (UASMS2C>T) a...

  6. Reducing stigma and discrimination: Candidate interventions

    Directory of Open Access Journals (Sweden)

    Kassam Aliya

    2008-04-01

    Full Text Available Abstract This paper proposes that stigma in relation to people with mental illness can be understood as a combination of problems of knowledge (ignorance, attitudes (prejudice and behaviour (discrimination. From a literature review, a series of candidate interventions are identified which may be effective in reducing stigmatisation and discrimination at the following levels: individuals with mental illness and their family members; the workplace; and local, national and international. The strongest evidence for effective interventions at present is for (i direct social contact with people with mental illness at the individual level, and (ii social marketing at the population level.

  7. Oxygen-Diffused Titanium as a Candidate Brake Rotor Material

    Energy Technology Data Exchange (ETDEWEB)

    Qu, Jun [ORNL; Blau, Peter Julian [ORNL; Jolly, Brian C [ORNL

    2009-01-01

    Titanium alloys are one of several candidate materials for the next generation of truck disk brake rotors. Despite their advantages of lightweight relative to cast iron and good strength and corrosion resistance, titanium alloys are unlikely to be satisfactory brake rotor materials unless their friction and wear behavior can be significantly improved. In this study, a surface engineering process oxygen diffusion was applied to titanium rotors and has shown very encouraging results. The oxygen diffused Ti-6Al-4V (OD-Ti) was tested on a sub-scale brake tester against a flat block of commercial brake lining material and benchmarked against several other Ti-based materials, including untreated Ti-6Al-4V, ceramic particle-reinforced Ti composites (MMCs), and a thermal-spray-coated Ti alloy. With respect to friction, the OD-Ti outperformed all other candidate materials under the imposed test conditions with the friction coefficient remaining within a desirable range of 0.35-0.50, even under the harshest conditions when the disk surface temperature reached nearly 600 C. In addition, the OD-Ti showed significantly improved wear-resistance over the non-treated one and was even better than the Ti-based composite materials.

  8. ADAM33, a new candidate for psoriasis susceptibility.

    Directory of Open Access Journals (Sweden)

    Fabienne Lesueur

    Full Text Available Psoriasis is a chronic skin disorder with multifactorial etiology. In a recent study, we reported results of a genome-wide scan on 46 French extended families presenting with plaque psoriasis. In addition to unambiguous linkage to the major susceptibility locus PSORS1 on Chromosome 6p21, we provided evidence for a susceptibility locus on Chromosome 20p13. To follow up this novel psoriasis susceptibility locus we used a family-based association test (FBAT for an association scan over the 17 Mb candidate region. A total of 85 uncorrelated SNP markers located in 65 genes of the region were initially investigated in the same set of large families used for the genome wide search, which consisted of 295 nuclear families. When positive association was obtained for a SNP, candidate genes nearby were explored more in detail using a denser set of SNPs. Thus, the gene ADAM33 was found to be significantly associated with psoriasis in this family set (The best association was on a 3-SNP haplotype P = 0.00004, based on 1,000,000 permutations. This association was independent of PSORS1. ADAM33 has been previously associated with asthma, which demonstrates that immune system diseases may be controlled by common susceptibility genes with general effects on dermal inflammation and immunity. The identification of ADAM33 as a psoriasis susceptibility gene identified by positional cloning in an outbred population should provide insights into the pathogenesis and natural history of this common disease.

  9. No Evidence for Association between Amelogenesis Imperfecta and Candidate Genes

    Directory of Open Access Journals (Sweden)

    M Ghandehari Motlagh

    2009-03-01

    Full Text Available "nBackground: Amelogenesis imperfecta (AI is an inherited tooth disorder. Despite the fact that up to now, several gene muta­tions in MMP20, ENAM, AMELX and KLK4 genes have been reported to be associated with AI, many other genes sug­gested to be involved. The main objective of this study was to find the mutations in three major candidate genes including MMP20, ENAM and KLK4 responsible for AI from three Iranian families with generalized hypoplastic phenotype in all teeth. "nMethods: All exon/intron boundaries of subjected genes were amplified by polymerase chain reaction and subjected to direct sequencing."nResults: One polymorphisms was identified in KLK4 exon 2, in one family a homozygous mutation was found in the third base of codon 22 for serine (TCG>TCT, but not in other families. Although these base substitutions have been occurred in the signaling domain, they do not seem to influence the activity of KLK4 protein."nConclusion: Our results might support the further evidence for genetic heterogeneity; at least, in some AI cases are not caused by a gene in these reported candidate genes.

  10. Corrosion mechanisms of candidate structural materials for supercritical water-cooled reactor

    Institute of Scientific and Technical Information of China (English)

    Lefu ZHANG; Fawen ZHU; Rui TANG

    2009-01-01

    Nickel-based alloys, austenitic stainless steel, ferritic/martensitic heat-resistant steels, and oxide dispersion strengthened steel are presently considered to be the candidate structural or fuel-cladding materials for supercritical water-cooled reactor (SCWR), one of the promising generation IV reactor for large-scale electric power production. However, corrosion and stress corrosion cracking of these candidate alloys still remain to be a major problem in the selection of nuclear fuel cladding and other structural materials, such as water rod. Survey of literature and experimental results reveal that the general corrosion mechanism of those candidate materials exhibits quite complicated mechanism in high-temperature and high-pressure supercritical water. Formation of a stable protective oxide film is the key to the best corrosion-resistant alloys. This paper focuses on the mechanism of corrosion oxide film breakdown for SCWR candidate materials.

  11. The Opinions of the Teacher Candidates Who Attended the Pedagogical Formation Certificate Programme for the Professional Competency of Instructors

    Science.gov (United States)

    Sahin, Mehmet

    2013-01-01

    The main purpose of this study was to determine the opinions of the teacher candidates who attend the pedagogical formation certificate programme for the professional competency of instructors. The method of the research is a descriptive survey based on scanning. The study group included the teacher candidates who attend the pedagogical formation…

  12. Top Zika Vaccine Candidate Moves Closer to Field Testing

    Science.gov (United States)

    ... https://medlineplus.gov/news/fullstory_161274.html Top Zika Vaccine Candidate Moves Closer to Field Testing DNA- ... MONDAY, Oct. 3, 2016 (HealthDay News) -- The leading Zika vaccine candidate should be ready for field testing ...

  13. Nonclinical Development of BCG Replacement Vaccine Candidates

    Directory of Open Access Journals (Sweden)

    Bernd Eisele

    2013-04-01

    Full Text Available The failure of current Mycobacterium bovis bacille Calmette–Guérin (BCG vaccines, given to neonates to protect against adult tuberculosis and the risk of using these live vaccines in HIV-infected infants, has emphasized the need for generating new, more efficacious and safer replacement vaccines. With the availability of genetic techniques for constructing recombinant BCG (rBCG strains containing well-defined gene deletions or insertions, new vaccine candidates are under evaluation at both the preclinical and clinical stages of development. Since most BCG vaccines in use today were evaluated in clinical trials decades ago and are produced by outdated processes, the development of new BCG vaccines offers a number of advantages that include a modern well-defined manufacturing process along with state-of-the-art evaluation of safety and efficacy in target populations. We provide a description of the preclinical development of two novel rBCGs, VPM1002 that was constructed by adding a modified hly gene coding for the protein listeriolysin O (LLO from Listeria monocytogenes and AERAS-422, which carries a modified pfoA gene coding for the protein perfringolysin O (PFO from Clostridium perfringens, and three genes from Mycobacterium tuberculosis. Novel approaches like these should be helpful in generating stable and effective rBCG vaccine candidates that can be better characterized than traditional BCG vaccines.

  14. Advanced vaccine candidates for Lassa fever.

    Science.gov (United States)

    Lukashevich, Igor S

    2012-11-01

    Lassa virus (LASV) is the most prominent human pathogen of the Arenaviridae. The virus is transmitted to humans by a rodent reservoir, Mastomys natalensis, and is capable of causing lethal Lassa Fever (LF). LASV has the highest human impact of any of the viral hemorrhagic fevers (with the exception of Dengue Fever) with an estimated several hundred thousand infections annually, resulting in thousands of deaths in Western Africa. The sizeable disease burden, numerous imported cases of LF in non-endemic countries, and the possibility that LASV can be used as an agent of biological warfare make a strong case for vaccine development. Presently there is no licensed vaccine against LF or approved treatment. Recently, several promising vaccine candidates have been developed which can potentially target different groups at risk. The purpose of this manuscript is to review the LASV pathogenesis and immune mechanisms involved in protection. The current status of pre-clinical development of the advanced vaccine candidates that have been tested in non-human primates will be discussed. Major scientific, manufacturing, and regulatory challenges will also be considered. PMID:23202493

  15. Advanced Vaccine Candidates for Lassa Fever

    Science.gov (United States)

    Lukashevich, Igor S.

    2012-01-01

    Lassa virus (LASV) is the most prominent human pathogen of the Arenaviridae. The virus is transmitted to humans by a rodent reservoir, Mastomys natalensis, and is capable of causing lethal Lassa Fever (LF). LASV has the highest human impact of any of the viral hemorrhagic fevers (with the exception of Dengue Fever) with an estimated several hundred thousand infections annually, resulting in thousands of deaths in Western Africa. The sizeable disease burden, numerous imported cases of LF in non-endemic countries, and the possibility that LASV can be used as an agent of biological warfare make a strong case for vaccine development. Presently there is no licensed vaccine against LF or approved treatment. Recently, several promising vaccine candidates have been developed which can potentially target different groups at risk. The purpose of this manuscript is to review the LASV pathogenesis and immune mechanisms involved in protection. The current status of pre-clinical development of the advanced vaccine candidates that have been tested in non-human primates will be discussed. Major scientific, manufacturing, and regulatory challenges will also be considered. PMID:23202493

  16. Advanced Vaccine Candidates for Lassa Fever

    Directory of Open Access Journals (Sweden)

    Igor S. Lukashevich

    2012-10-01

    Full Text Available Lassa virus (LASV is the most prominent human pathogen of the Arenaviridae. The virus is transmitted to humans by a rodent reservoir, Mastomys natalensis, and is capable of causing lethal Lassa Fever (LF. LASV has the highest human impact of any of the viral hemorrhagic fevers (with the exception of Dengue Fever with an estimated several hundred thousand infections annually, resulting in thousands of deaths in Western Africa. The sizeable disease burden, numerous imported cases of LF in non-endemic countries, and the possibility that LASV can be used as an agent of biological warfare make a strong case for vaccine development. Presently there is no licensed vaccine against LF or approved treatment. Recently, several promising vaccine candidates have been developed which can potentially target different groups at risk. The purpose of this manuscript is to review the LASV pathogenesis and immune mechanisms involved in protection. The current status of pre-clinical development of the advanced vaccine candidates that have been tested in non-human primates will be discussed. Major scientific, manufacturing, and regulatory challenges will also be considered.

  17. Serological profile of candidates for corneal donation

    Directory of Open Access Journals (Sweden)

    Adroaldo Lunardelli

    2014-10-01

    Full Text Available Objetive: The purpose of this study is to map the serological profile of candidates to corneal donation at Irmandade Santa Casa de Misericórdia de Porto Alegre, identifying the percentage of disposal by serology and the marker involved. Methods: There have been analised – retrospectively – the results of serology of all corneal donors, made between the period of 1st january 2006 and 31st december 2012. Data analised were related to age, gender and the results of serology pertinent to viral markers (HBsAg, anti-HBc, anti-HCV and anti-HIV, these, determined by immunosorbent tests (ELISA. Results: In the period of the study, there were 2476 corneal donors at the institution, with a major incidence on the male gender, on an average of 58.7 years old. 23% of retention because of serological unfitness was also identified, that is, 570 samples were non-negative to any of the used tests. The marker anti- HBc was the most prevalent on the studied population, followed by the Hepatitis C virus (HCV and by the Human Immunodeficiency Virus (HIV. Conclusion: From the data found through this study, it is essential to have the participation of an efficient service on the serological evaluation of the candidates to corneal donation, once the security of the receptor must be taken into consideration in a population of donors with 23% of unfitness prevalence, in which the most prevalent marker is the one of Hepatits B.

  18. Elemental Abundances of Solar Sibling Candidates

    CERN Document Server

    Ramirez, I; Bobylev, V V; Roederer, I U; Lambert, D L; Endl, M; Cochran, W D; MacQueen, P J; Wittenmyer, R A

    2014-01-01

    Dynamical information along with survey data on metallicity and in some cases age have been used recently by some authors to search for candidates of stars that were born in the cluster where the Sun formed. We have acquired high resolution, high signal-to-noise ratio spectra for 30 of these objects to determine, using detailed elemental abundance analysis, if they could be true solar siblings. Only two of the candidates are found to have solar chemical composition. Updated modeling of the stars' past orbits in a realistic Galactic potential reveals that one of them, HD162826, satisfies both chemical and dynamical conditions for being a sibling of the Sun. Measurements of rare-element abundances for this star further confirm its solar composition, with the only possible exception of Sm. Analysis of long-term high-precision radial velocity data rules out the presence of hot Jupiters and confirms that this star is not in a binary system. We find that chemical tagging does not necessarily benefit from studying a...

  19. Vaccine candidates for leishmaniasis: a review.

    Science.gov (United States)

    Nagill, Rajeev; Kaur, Sukhbir

    2011-10-01

    Leishmaniasis is a diverse group of clinical syndromes caused by protozoan parasites of the genus Leishmania. The clinical manifestation of the disease varies from self-limiting cutaneous lesions to progressive visceral disease. It is estimated that 350 million people are at risk in 88 countries, with a global incidence of 1-1.5 million cases of cutaneous and 500,000 cases of visceral leishmaniasis. The key control measures mainly rely on early case detection and chemotherapy which has been hampered by the toxicity of drugs, side-effects and by the emergence of drug resistance in parasites. Control of reservoir host and vector is difficult due to operational difficulties and frequent relapses in the host. Therefore, the development of effective and affordable vaccine against leishmaniasis is highly desirable. Although considerable progress has been made over the last decade in understanding immune mechanisms underlying potential candidate antigens, including killed, live attenuated parasites, crude parasites, pure or recombinant Leishmania proteins or DNA encoding leishmanial proteins, as well as immunomodulators from sand fly saliva, very few candidate vaccines have progressed beyond the experimental stage. As such there is no vaccine against any form of human leishmaniasis. In recent years, however, much interest has been stimulated towards vaccination against leishmaniasis focused mainly on cutaneous leishmaniasis with fewer attempts against visceral leishmaniasis.

  20. Nonclinical Development of BCG Replacement Vaccine Candidates.

    Science.gov (United States)

    Velmurugan, Kamalakannan; Grode, Leander; Chang, Rosemary; Fitzpatrick, Megan; Laddy, Dominick; Hokey, David; Derrick, Steven; Morris, Sheldon; McCown, David; Kidd, Reginald; Gengenbacher, Martin; Eisele, Bernd; Kaufmann, Stefan H E; Fulkerson, John; Brennan, Michael J

    2013-01-01

    The failure of current Mycobacterium bovis bacille Calmette-Guérin (BCG) vaccines, given to neonates to protect against adult tuberculosis and the risk of using these live vaccines in HIV-infected infants, has emphasized the need for generating new, more efficacious and safer replacement vaccines. With the availability of genetic techniques for constructing recombinant BCG (rBCG) strains containing well-defined gene deletions or insertions, new vaccine candidates are under evaluation at both the preclinical and clinical stages of development. Since most BCG vaccines in use today were evaluated in clinical trials decades ago and are produced by outdated processes, the development of new BCG vaccines offers a number of advantages that include a modern well-defined manufacturing process along with state-of-the-art evaluation of safety and efficacy in target populations. We provide a description of the preclinical development of two novel rBCGs, VPM1002 that was constructed by adding a modified hly gene coding for the protein listeriolysin O (LLO) from Listeria monocytogenes and AERAS-422, which carries a modified pfoA gene coding for the protein perfringolysin O (PFO) from Clostridium perfringens, and three genes from Mycobacterium tuberculosis. Novel approaches like these should be helpful in generating stable and effective rBCG vaccine candidates that can be better characterized than traditional BCG vaccines. PMID:26343962

  1. Candidate chemosensory cells in the porcine stomach.

    Science.gov (United States)

    Widmayer, Patricia; Breer, Heinz; Hass, Nicole

    2011-07-01

    A continuous chemosensory monitoring of the ingested food is of vital importance for adjusting digestive processes according to diet composition. Although any dysfunction of this surveillance system may be the cause of severe gastrointestinal disorders, information about the cellular and molecular basis of chemosensation in the gastrointestinal tract is limited. The porcine alimentary canal is considered as an appropriate model for the human gastrointestinal tract. Therefore, in this study we have investigated the gastric mucosa of swine for cells which express gustatory transduction elements such as TRPM5 or PLCβ2, and thus may represent candidate "chemosensors". It was found that the porcine stomach indeed contains cells expressing gustatory marker molecules; however, the morphology and topographic distribution of putative chemosensory cells varied significantly from that in mice. Whereas in the murine stomach these cells were clustered at a distinct region near the gastric entrance, no such compact cell cluster was found in the pig stomach. These results indicate substantial differences regarding the phenotype of candidate chemosensory cells of mice and swine and underline the importance of choosing the most suitable model organisms. PMID:21667283

  2. Criteria for candidate species for aquaculture

    Energy Technology Data Exchange (ETDEWEB)

    Webber, H.H.; Riordan, P.F.

    1976-01-01

    The nature of the animal taxa that are the most probable candidates for an intensive, commercial aquatic animal husbandry industry is considered. A characterization is presented of those biological criteria that lend the species the necessary physiological and genetic malleability to be adapted and molded into a domesticated race. The animal cultivated must be amenable to intensive management in high-density confinements such as those now being engineered for high-yield aquaculture. Attributes considered are discussed in the context of the various aquacultural ecosystems in which the specific biotype is expected to achieve satisfactory growth and survival. Correlative with bionomic criteria, economic requirements are posed and evaluated in an effort to define a socially and financially profitable agribusiness system. Investment requirements and operating costs are considered in terms of expected returns. However, since production alone is insufficient to sustain an enterprise - i.e., the product must be sold - production costs must be judged against market values. Therefore, ultimate use or consumer acceptance criteria are incorporated into the list of essential requirements for a candidate species for aquafarming.

  3. Encouraging Discussion between Teacher Candidates and Families with Exceptional Children

    Science.gov (United States)

    Williams, Emily

    2012-01-01

    The Families as Faculty experience assists universities to better prepare candidates for service as classroom teachers. Upon entering their practica and student teaching, many teacher candidates have had no to limited contact with exceptional students. Often candidates are unaware of the realities of having a student with disabilities in their…

  4. Views on Values Education: From Teacher Candidates to Experienced Teachers

    Science.gov (United States)

    Iscan, Canay Demirhan

    2015-01-01

    This study aimed to identify the views of experienced class teachers and class teacher candidates on values education. It conducted standard open-ended interviews with experienced class teachers and teacher candidates. The study group comprised 9 experienced class teachers from different socio-economic levels and 9 teacher candidates with…

  5. Opinions of the Geography Teacher Candidates toward Mind Maps

    Science.gov (United States)

    Seyihoglu, Aysegul

    2013-01-01

    The purpose of this study is to reveal the opinions of the teacher candidates about mind mapping technique used in Geography education of undergraduate program. In this study, the qualitative research techniques were used. The study group consists of 55 teacher candidates. The teacher candidates have been asked for their opinions about the process…

  6. Identity Functions and Empathetic Tendencies of Teacher Candidates

    Science.gov (United States)

    Ay, Alpaslan; Kadi, Aysegul

    2016-01-01

    Objective of this research is to investigate identity functions and empathetic tendencies of teacher candidates. Sample consists of 232 teacher candidates in social studies teacher education. Survey model is preferred to investigate the difference between identity functions and empathetic tendencies of teacher candidates. And also correlational…

  7. Mirror Images: Teacher Candidates' Perceptions of Disposition Development

    Science.gov (United States)

    Bercaw, Lynne A.; Summers, Deborah G.; Colby, Susan A.; Payne, Maggie

    2012-01-01

    The complexity of disposition development for teacher candidates continues to be discussed and debated in teacher education. This study compares two programs and the different ways each approaches the disposition development of their respective candidates. More than 200 candidates from two institutions were surveyed on how and where they perceived…

  8. Towards a values-based person specification for recruitment of compassionate nursing and midwifery candidates: a study of registered and student nurses' and midwives' perceptions of prerequisite attributes and key skills.

    Science.gov (United States)

    Waugh, Anne; Smith, Dave; Horsburgh, Dorothy; Gray, Morag

    2014-09-01

    Selection and retention of preregistration nursing and midwifery students are issues that exercise educators, universities and commissioning bodies both nationally and internationally. It has recently become an expectation that a values-based approach is used within recruitment and selection activities in the UK. The desirability of a person specification to support transparent recruitment and selection is well recognised. An online survey of registered and student nurses and midwives found consensus around the desirability of several personal attributes and key skills. There was consensus in the top seven ranked attributes which were honesty and trustworthiness, communication skills, being a good listener, patience and tactfulness, sensitivity and compassion, the ability to seek and act on guidance and being a good team worker; this was between registered and unregistered nurses and midwives and also between participants representing all fields of nursing and midwifery practice. Some of the responses from Practice Education Facilitators (PEFs) (n=5) and senior managers (n=15) differed from those of other registrants surveyed. The attribute 'Able to draw on knowledge and experience' was considered more important by PEFs and 'Observant and able to act on your own initiative within your level of responsibility' and 'Able to draw on knowledge and experience' were ranked more highly by senior managers.

  9. Candidate eco-friendly gas mixtures for MPGDs

    CERN Document Server

    Saviano, Giovanna

    2015-01-01

    Modern gas detectors for the detection of elementary particles, and MPGDs in particular, require F-based gases for optimal performance. Recent regulations demand the use of environmentally unfriendly F-based gases to be limited or banned. This work investigates the properties of potential eco-friendly gas candidate replacements. The aim is to discuss some of the important properties of gases for MPGDs, to list and summarize basic properties of eco-friendly refrigerants from the literature available, to discuss their properties for materials compatibility and safe use, and to make a prediction on selected parameters (i.e., ionization potentials, ionization pairs, etc) crucial for the performance of gas detectors considered by making use of both known parametrizations and quantum chemistry simulation codes.

  10. Computational identification of candidate nucleotide cyclases in higher plants

    KAUST Repository

    Wong, Aloysius Tze

    2013-09-03

    In higher plants guanylyl cyclases (GCs) and adenylyl cyclases (ACs) cannot be identified using BLAST homology searches based on annotated cyclic nucleotide cyclases (CNCs) of prokaryotes, lower eukaryotes, or animals. The reason is that CNCs are often part of complex multifunctional proteins with different domain organizations and biological functions that are not conserved in higher plants. For this reason, we have developed CNC search strategies based on functionally conserved amino acids in the catalytic center of annotated and/or experimentally confirmed CNCs. Here we detail this method which has led to the identification of >25 novel candidate CNCs in Arabidopsis thaliana, several of which have been experimentally confirmed in vitro and in vivo. We foresee that the application of this method can be used to identify many more members of the growing family of CNCs in higher plants. © Springer Science+Business Media New York 2013.

  11. A direct molecular link between the autism candidate gene RORa and the schizophrenia candidate MIR137

    Science.gov (United States)

    Devanna, Paolo; Vernes, Sonja C.

    2014-02-01

    Retinoic acid-related orphan receptor alpha gene (RORa) and the microRNA MIR137 have both recently been identified as novel candidate genes for neuropsychiatric disorders. RORa encodes a ligand-dependent orphan nuclear receptor that acts as a transcriptional regulator and miR-137 is a brain enriched small non-coding RNA that interacts with gene transcripts to control protein levels. Given the mounting evidence for RORa in autism spectrum disorders (ASD) and MIR137 in schizophrenia and ASD, we investigated if there was a functional biological relationship between these two genes. Herein, we demonstrate that miR-137 targets the 3'UTR of RORa in a site specific manner. We also provide further support for MIR137 as an autism candidate by showing that a large number of previously implicated autism genes are also putatively targeted by miR-137. This work supports the role of MIR137 as an ASD candidate and demonstrates a direct biological link between these previously unrelated autism candidate genes.

  12. Candidate genes for obesity-susceptibility show enriched association within a large genome-wide association study for BMI

    Science.gov (United States)

    Vimaleswaran, Karani S.; Tachmazidou, Ioanna; Zhao, Jing Hua; Hirschhorn, Joel N.; Dudbridge, Frank; Loos, Ruth J.F.

    2012-01-01

    Before the advent of genome-wide association studies (GWASs), hundreds of candidate genes for obesity-susceptibility had been identified through a variety of approaches. We examined whether those obesity candidate genes are enriched for associations with body mass index (BMI) compared with non-candidate genes by using data from a large-scale GWAS. A thorough literature search identified 547 candidate genes for obesity-susceptibility based on evidence from animal studies, Mendelian syndromes, linkage studies, genetic association studies and expression studies. Genomic regions were defined to include the genes ±10 kb of flanking sequence around candidate and non-candidate genes. We used summary statistics publicly available from the discovery stage of the genome-wide meta-analysis for BMI performed by the genetic investigation of anthropometric traits consortium in 123 564 individuals. Hypergeometric, rank tail-strength and gene-set enrichment analysis tests were used to test for the enrichment of association in candidate compared with non-candidate genes. The hypergeometric test of enrichment was not significant at the 5% P-value quantile (P = 0.35), but was nominally significant at the 25% quantile (P = 0.015). The rank tail-strength and gene-set enrichment tests were nominally significant for the full set of genes and borderline significant for the subset without SNPs at P < 10−7. Taken together, the observed evidence for enrichment suggests that the candidate gene approach retains some value. However, the degree of enrichment is small despite the extensive number of candidate genes and the large sample size. Studies that focus on candidate genes have only slightly increased chances of detecting associations, and are likely to miss many true effects in non-candidate genes, at least for obesity-related traits. PMID:22791748

  13. ELECTIONS PENSION FUND CANDIDATE NR 4

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : MYERS First Name : Stephen I have been at CERN since 1972, and was elected member of the Governing Board for the first time in 1998. The Governing Board then nominated me to the Investments Committee where I have been a member since the beginning of 1999. Since then I have actively participated in redefining and transforming the investment portfolio in order to improve the overall return and where possible reduce the risk. The portfolio has recently been greatly improved and now allows much simpler more transparent monitoring of our investment. I have also actively participated and hopefully made useful contributions in discussions conc...

  14. ELECTIONS PENSION FUND 4th candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : MYERS First Name : Stephen I have been at CERN since 1972, and was elected member of the Governing Board for the first time in 1998. The Governing Board then nominated me to the Investments Committee where I have been a member since the beginning of 1999. Since then I have actively participated in redefining and transforming the investment portfolio in order to improve the overall return and where possible reduce the risk. The portfolio has recently been greatly improved and now allows much simpler more transparent monitoring of our investment. I have also actively participated and hopefully made useful contributions in discussions conc...

  15. New potential AChE inhibitor candidates.

    Science.gov (United States)

    de Paula, A A N; Martins, J B L; dos Santos, M L; Nascente, L de C; Romeiro, L A S; Areas, T F M A; Vieira, K S T; Gambôa, N F; Castro, N G; Gargano, R

    2009-09-01

    We have theoretically studied new potential candidates of acetylcholinesterase (AChE) inhibitors designed from cardanol, a non-isoprenoid phenolic lipid of cashew Anacardium occidentale nut-shell liquid. The electronic structure calculations of fifteen molecule derivatives from cardanol were performed using B3LYP level with 6-31G, 6-31G(d), and 6-311+G(2d,p) basis functions. For this study we used the following groups: methyl, acetyl, N,N-dimethylcarbamoyl, N,N-dimethylamine, N,N-diethylamine, piperidine, pyrrolidine, and N,N-methylbenzylamine. Among the proposed compounds we identified that the structures with substitution by N,N-dimethycarbamoyl, N,N-dimethylamine, and pyrrolidine groups were better correlated to rivastigmine, and represent possible AChE inhibitors against Alzheimer disease. PMID:19446931

  16. ELECTIONS PENSION FUND 3rd candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : Hauviller First Name : Claude Dear colleague of CERN and ESO, For the first time, I am standing and requesting your support to become a member of the Governing Board of our Pension Fund. CERN staff member since 1974, I have already carried elective mandates: I have been Delegate to the Staff Council and Member of the Senior Staff Consultative Committee (the Nine). For the majority of us, our Pension Fund is our only social provident scheme and source of retirement income; I believe I can usefully contribute to its successful management and help ensure its balance. Our Fund reaches its majority: soon, there will be more beneficiaries tha...

  17. ELECTIONS PENSION FUND CANDIDATE NR 3

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : HAUVILLER First Name : Claude Dear colleague of CERN and ESO, For the first time, I am standing and requesting your support to become a member of the Governing Board of our Pension Fund. CERN staff member since 1974, I have already carried elective mandates: I have been Delegate to the Staff Council and Member of the Senior Staff Consultative Committee (the Nine). For the majority of us, our Pension Fund is our only social provident scheme and source of retirement income; I believe I can usefully contribute to its successful management and help ensure its balance. Our Fund reaches its majority: soon, there will be more beneficiaries tha...

  18. Halopentacenes: Promising Candidates for Organic Semiconductors

    Institute of Scientific and Technical Information of China (English)

    DU Gong-He; REN Zhao-Yu; GUO Ping; ZHENG Ji-Ming

    2009-01-01

    We introduce polar substituents such as F, Cl, Br into pentacene to enhance the dissolubility in common organic solvents while retaining the high charge-carrier mobilities of pentacene. Geometric structures, dipole moments,frontier molecule orbits, ionization potentials and electron affinities, as well as reorganization energies of those molecules, and of pentacene for comparison, are successively calculated by density functional theory. The results indicate that halopentacenes have rather small reorganization energies (< 0.2 eV), and when the substituents are in position 2 or positions 2 and 9, they are polarity molecules. Thus we conjecture that they can easily be dissolved in common organic solvents, and are promising candidates for organic semiconductors.

  19. Radion Candidate for the LHC Diphoton Resonance

    CERN Document Server

    Bardhan, Debjyoti; Chakraborty, Amit; Maitra, Ushoshi; Raychaudhuri, Sreerup; Samui, Tousik

    2015-01-01

    The recent observation of a modest excess in diphoton final states at the LHC, by both the ATLAS and CMS Collaborations, has sparked off the expected race among theorists to find the right explanation for this proto-resonance, assuming that the signal will survive and not prove to be yet another statistical fluctuation. We carry out a general analysis of this `signal' in the case of a scalar which couples only to pairs of gluons (for production) and photons (for diphoton decay modes), and establish that an explanation of the observed resonance, taken together with the null results of new physics searches in all the other channels, requires a scalar with rather exotic behaviour. We then demonstrate that a fairly simple-minded extension of the minimal Randall-Sundrum model can yield a radion candidate which might reproduce this exotic behaviour.

  20. Pituitary stem cells: candidates and implications.

    Science.gov (United States)

    Nassiri, Farshad; Cusimano, Michael; Zuccato, Jeff A; Mohammed, Safraz; Rotondo, Fabio; Horvath, Eva; Syro, Luis V; Kovacs, Kalman; Lloyd, Ricardo V

    2013-09-01

    The pituitary is the master endocrine gland of the body. It undergoes many changes after birth, and these changes may be mediated by the differentiation of pituitary stem cells. Stem cells in any tissue source must display (1) pluripotent capacity, (2) capacity for indefinite self-renewal, and (3) a lack of specialization. Unlike neural stem cells identified in the hippocampus and subventricular zone, pituitary stem cells are not associated with one specific cell type. There are many major candidates that are thought to be potential pituitary stem cell sources. This article reviews the evidence for each of the major cell types and discuss the implications of identifying a definitive pituitary stem cell type. PMID:23423660

  1. Properties of optically selected BL Lac candidates from the SDSS

    CERN Document Server

    Kügler, S D; Heidt, J; Esser, J; Schultz, T

    2014-01-01

    \\textbf{Context.} Deep optical surveys open the avenue for find large numbers of BL Lac objects that are hard to identify because they lack the unique properties classifying them as such. While radio or X-ray surveys typically reveal dozens of sources, recent compilations based on optical criteria alone have increased the number of BL Lac candidates considerably. However, these compilations are subject to biases and may contain a substantial number of contaminating sources. \\textbf{Aims.} In this paper we extend our analysis of 182 optically selected BL Lac object candidates from the SDSS with respect to an earlier study. The main goal is to determine the number of bona fide BL Lac objects in this sample. \\textbf{Methods.} We examine their variability characteristics, determine their broad-band radio-UV SEDs, and search for the presence of a host galaxy. In addition we present new optical spectra for 27 targets with improved S/N with respect to the SDSS spectra. \\textbf{Results.} At least 59% of our targets h...

  2. Novel approaches to identify protective malaria vaccine candidates

    Directory of Open Access Journals (Sweden)

    Wan Ni eChia

    2014-11-01

    Full Text Available Efforts to develop vaccines against malaria have been the focus of substantial research activities for decades. Several categories of candidate vaccines are currently being developed for protection against malaria, based on antigens corresponding to the pre-erythrocytic, blood-stage or sexual stages of the parasite. Long lasting sterile protection from Plasmodium falciparum sporozoite challenge has been observed in human following vaccination with whole parasite formulations, clearly demonstrating that a protective immune response targeting predominantly the pre-erythrocytic stages can develop against malaria. However, most of vaccine candidates currently being investigated, which are mostly subunits vaccines, have not been able to induce substantial (>50% protection thus far. This is due to the fact that the antigens responsible for protection against the different parasite stages are still yet to be known and relevant correlates of protection have remained elusive. For a vaccine to be developed in a timely manner, novel approaches are required. In this article, we review the novel approaches that have been developed to identify the antigens for the development of an effective malaria vaccine.

  3. Spectral analysis of Kepler SPB and Beta Cep candidate stars

    CERN Document Server

    Lehmann, H; Semaan, T; Gutiérrez, J; Smalley, B; Briquet, M; Shulyak, D; Tsymbal, V; de Cat, P

    2010-01-01

    We determine the fundamental parameters of SPB and Beta Cep candidate stars observed by the Kepler satellite mission and estimate the expected types of non-radial pulsators by comparing newly obtained high-resolution spectra with synthetic spectra computed on a grid of stellar parameters assuming LTE and check for NLTE effects for the hottest stars. For comparison, we determine Teff independently from fitting the spectral energy distribution of the stars obtained from the available photometry. We determine Teff, log(g), micro-turbulent velocity, vsin(i), metallicity, and elemental abundance for 14 of the 16 candidate stars, two of the stars are spectroscopic binaries. No significant influence of NLTE effects on the results could be found. For hot stars, we find systematic deviations of the determined effective temperatures from those given in the Kepler Input Catalogue. The deviations are confirmed by the results obtained from ground-based photometry. Five stars show reduced metallicity, two stars are He-stro...

  4. PLANETARY CANDIDATES OBSERVED BY KEPLER IV: PLANET SAMPLE FROM Q1-Q8 (22 MONTHS)

    International Nuclear Information System (INIS)

    We provide updates to the Kepler planet candidate sample based upon nearly two years of high-precision photometry (i.e., Q1-Q8). From an initial list of nearly 13,400 threshold crossing events, 480 new host stars are identified from their flux time series as consistent with hosting transiting planets. Potential transit signals are subjected to further analysis using the pixel-level data, which allows background eclipsing binaries to be identified through small image position shifts during transit. We also re-evaluate Kepler Objects of Interest (KOIs) 1-1609, which were identified early in the mission, using substantially more data to test for background false positives and to find additional multiple systems. Combining the new and previous KOI samples, we provide updated parameters for 2738 Kepler planet candidates distributed across 2017 host stars. From the combined Kepler planet candidates, 472 are new from the Q1-Q8 data examined in this study. The new Kepler planet candidates represent ∼40% of the sample with R P ∼ 1 R ⊕ and represent ∼40% of the low equilibrium temperature (T eq < 300 K) sample. We review the known biases in the current sample of Kepler planet candidates relevant to evaluating planet population statistics with the current Kepler planet candidate sample

  5. Peptide-based candidate vaccine against respiratory syncytial virus.

    Science.gov (United States)

    Yusibov, Vidadi; Mett, Vadim; Mett, Valentina; Davidson, Carley; Musiychuk, Konstantin; Gilliam, Suzan; Farese, Ann; Macvittie, Thomas; Mann, Dean

    2005-03-18

    We engineered a 21-mer peptide representing amino acids 170-190 of the respiratory syncytial virus (RSV) G protein as a fusion with the Alfalfa mosaic virus (AlMV) coat protein (CP), produced recombinant AlMV particles presenting this peptide (VMR-RSV) on their surfaces and tested the immunogenicity in vitro in human dendritic cells and in vivo in non-human primates. Significant pathogen-specific immune responses were generated in both systems: (i) human dendritic cells armed with VMR-RSV generated vigorous CD4+ and CD8+ T cell responses; (ii) non-human primates that received these particles responded by mounting strong cellular and humoral immune responses. This approach may validate the use of a novel RSV vaccine delivery vehicle in humans. PMID:15755607

  6. Mapping of Candidate Genes Involved in Bud Dormancy and Flowering Time in Sweet Cherry (Prunus avium.

    Directory of Open Access Journals (Sweden)

    Sophie Castède

    Full Text Available The timing of flowering in perennial plants is crucial for their survival in temperate climates and is regulated by the duration of bud dormancy. Bud dormancy release and bud break depend on the perception of cumulative chilling during endodormancy and heat during the bud development. The objectives of this work were to identify candidate genes involved in dormancy and flowering processes in sweet cherry, their mapping in two mapping progenies 'Regina' × 'Garnet' and 'Regina' × 'Lapins', and to select those candidate genes which co-localized with quantitative trait loci (QTLs associated with temperature requirements for bud dormancy release and flowering. Based on available data on flowering processes in various species, a list of 79 candidate genes was established. The peach and sweet cherry orthologs were identified and primers were designed to amplify sweet cherry candidate gene fragments. Based on the amplified sequences of the three parents of the mapping progenies, SNPs segregations in the progenies were identified. Thirty five candidate genes were genetically mapped in at least one of the two progenies and all were in silico mapped. Co-localization between candidate genes and QTLs associated with temperature requirements and flowering date were identified for the first time in sweet cherry. The allelic composition of the candidate genes located in the major QTL for heat requirements and flowering date located on linkage group 4 have a significant effect on these two traits indicating their potential use for breeding programs in sweet cherry to select new varieties adapted to putative future climatic conditions.

  7. Mapping of Candidate Genes Involved in Bud Dormancy and Flowering Time in Sweet Cherry (Prunus avium).

    Science.gov (United States)

    Castède, Sophie; Campoy, José Antonio; Le Dantec, Loïck; Quero-García, José; Barreneche, Teresa; Wenden, Bénédicte; Dirlewanger, Elisabeth

    2015-01-01

    The timing of flowering in perennial plants is crucial for their survival in temperate climates and is regulated by the duration of bud dormancy. Bud dormancy release and bud break depend on the perception of cumulative chilling during endodormancy and heat during the bud development. The objectives of this work were to identify candidate genes involved in dormancy and flowering processes in sweet cherry, their mapping in two mapping progenies 'Regina' × 'Garnet' and 'Regina' × 'Lapins', and to select those candidate genes which co-localized with quantitative trait loci (QTLs) associated with temperature requirements for bud dormancy release and flowering. Based on available data on flowering processes in various species, a list of 79 candidate genes was established. The peach and sweet cherry orthologs were identified and primers were designed to amplify sweet cherry candidate gene fragments. Based on the amplified sequences of the three parents of the mapping progenies, SNPs segregations in the progenies were identified. Thirty five candidate genes were genetically mapped in at least one of the two progenies and all were in silico mapped. Co-localization between candidate genes and QTLs associated with temperature requirements and flowering date were identified for the first time in sweet cherry. The allelic composition of the candidate genes located in the major QTL for heat requirements and flowering date located on linkage group 4 have a significant effect on these two traits indicating their potential use for breeding programs in sweet cherry to select new varieties adapted to putative future climatic conditions. PMID:26587668

  8. Large screen approaches to identify novel malaria vaccine candidates.

    Science.gov (United States)

    Davies, D Huw; Duffy, Patrick; Bodmer, Jean-Luc; Felgner, Philip L; Doolan, Denise L

    2015-12-22

    Until recently, malaria vaccine development efforts have focused almost exclusively on a handful of well characterized Plasmodium falciparum antigens. Despite dedicated work by many researchers on different continents spanning more than half a century, a successful malaria vaccine remains elusive. Sequencing of the P. falciparum genome has revealed more than five thousand genes, providing the foundation for systematic approaches to discover candidate vaccine antigens. We are taking advantage of this wealth of information to discover new antigens that may be more effective vaccine targets. Herein, we describe different approaches to large-scale screening of the P. falciparum genome to identify targets of either antibody responses or T cell responses using human specimens collected in Controlled Human Malaria Infections (CHMI) or under conditions of natural exposure in the field. These genome, proteome and transcriptome based approaches offer enormous potential for the development of an efficacious malaria vaccine. PMID:26428458

  9. Systematic errors in estimation of gravitational-wave candidate significance

    CERN Document Server

    Capano, Collin; Hu, Yi-Ming; Hendry, Martin; Messenger, Chris; Veitch, John

    2016-01-01

    We investigate the issue in determining the significance of candidate transient gravitational-wave events in a ground-based interferometer network. Given the presence of non-Gaussian noise artefacts in real data, the noise background must be estimated empirically from the data itself. However, the data also potentially contains signals, thus the background estimate may be overstated due to contributions from signals. It has been proposed to mitigate possible bias by removing single-detector data samples that pass a multi-detector consistency test from the background estimates. We conduct a high-statistics Mock Data Challenge to evaluate the effects of removing such samples, modelling a range of scenarios with plausible detector noise distributions and with a range of plausible foreground astrophysical signal rates. We consider the the two different modes: one in which coincident samples are removed, and one in which all samples are retained and used. Three algorithms were operated in both modes, show good con...

  10. Maximized ExoEarth Candidate Yields for Starshades

    CERN Document Server

    Stark, Christopher C; Lisman, Doug; Cady, Eric; Savransky, Dmitry; Roberge, Aki; Mandell, Avi M

    2016-01-01

    The design and scale of a future mission to directly image and characterize potentially Earth-like planets will be impacted, to some degree, by the expected yield of such planets. Recent efforts to increase the estimated yields, by creating observation plans optimized for the detection and characterization of Earth-twins, have focused solely on coronagraphic instruments; starshade-based missions could benefit from a similar analysis. Here we explore how to prioritize observations for a starshade given the limiting resources of both fuel and time, present analytic expressions to estimate fuel use, and provide efficient numerical techniques for maximizing the yield of starshades. We implemented these techniques to create an approximate design reference mission code for starshades and used this code to investigate how exoEarth candidate yield responds to changes in mission, instrument, and astrophysical parameters for missions with a single starshade. We find that a starshade mission operates most efficiently so...

  11. Biochemical Markers for Osteoarthritis: Is There any Promising Candidate?

    Directory of Open Access Journals (Sweden)

    Elif Aydın

    2016-04-01

    Full Text Available Osteoarthritis (OA is the most common degenerative joint disease. OA affects millions of individuals each year and becoming the most important cause of pain in geriatric population. Progressive destruction of articular cartilage is one of the prominent features of the disease. The diagnosis of OA is generally based on clinical and radiographical findings, which are insufficient to determine early-stage OA and predict disease course. There is a need for biomarkers that help clinicians early diagnose, assess disease activity, predict prognosis and monitor response to therapy. There are a growing number of publications regarding candidate markers in this field. The aim of this paper was to review recent studies on biochemical markers that reflect cartilage, synovial and bone turnover and their clinical use in patients with OA.

  12. Tagging Blast Resistance Gene Pi 1 in Rice (Oryza sativa) Using Candidate Resistance Genes

    Institute of Scientific and Technical Information of China (English)

    LI Ai-hong; WU Jian-li; XU Xin-ping; Menchu BERNADO; DAI Zheng-yuan; ZHUANG Jie-yun; CHEN Zong-xiang; ZHENG Kang-le; LI Bao-jian; Hei LEUNG; ZHANG Hong-xi; PAN Xue-biao

    2004-01-01

    An F3 population derived from C101LAC/CO39 containing 90 lines was analyzed for blast resistance with 48 candidate genes developed from resistance gene analogs (RGA) and suppression subtractive library. Genetic analysis confirmed that blast resistance of the population was controlled by a single gene Pi 1. One of the candidate genes, R10 was identified as associated with the blast resistance gene on the long arm of chromosome 11 and mapped using a DH population derived from Azucena/IR64.A pair of PCR based primers was designed based on the sequence of R10 for marker-aided selection of the blast resistance gene.The recombination frequency between Pi 1 and the marker was estimated as 1.28%. It suggested that strategy of employing candidate genes is useful for gene identification and mapping. A new RFLP marker and the corresponding PCR marker for tagging of Pi 1 were provided.

  13. Questions and Answers for Transplant Candidates about Model for End-Stage Liver Disease (MELD) and Pediatric End-Stage ....

    Science.gov (United States)

    ... developed a system for prioritizing candidates waiting for liver transplants based on statistical formulas that are very accurate for predicting who needs a liver transplant most urgently. The MELD (Model for End Stage ...

  14. Comet candidates among quasi-Hilda objects

    Science.gov (United States)

    Gil-Hutton, R.; García-Migani, E.

    2016-05-01

    Aims: We present the results of a search for quasi-Hilda comets. We wanted to find objects that have recently arrived from the Centaur zone that could became active near the perihelion of their orbits. Methods: Two hundred and seventy-seven objects from the ASTORB database were selected following a dynamical criteria to constrain the unstable quasi-Hilda region. These objects were integrated backward 50 000 yr in order to identify those that have recently arrived from the outer regions of the solar system. Results: The backward integration showed that 11 objects could be Centaurs or transneptunian objects that ended their dynamical evolution as quasi-Hilda comets. The dynamical evolution of these objects from a statistical point of view was studied by computing the time-averaged distribution of a number of clones as a function of the aphelion and perihelion distances. All the candidates show a dynamical behavior that is expected for comets injected in the inner solar system from the Centaur or transneptunian regions and reaching the quasi-Hilda region.

  15. Genetic markers: Potential candidates for cardiovascular disease.

    Science.gov (United States)

    Rather, Riyaz Ahmad; Dhawan, Veena

    2016-10-01

    The effective prevention of cardiovascular disease depends upon the ability to recognize the high-risk individuals at an early stage of the disease or long before the development of adverse events. Evolving technologies in the fields of proteomics, metabolomics, and genomics have played a significant role in the discovery of cardiovascular biomarkers, but so far these methods have achieved the modest success. Hence, there is a crucial need for more reliable, suitable, and lasting diagnostic and therapeutic markers to screen the disease well in time to start the clinical aid to the patients. Gene polymorphisms associated with the cardiovascular disease play a decisive role in the disease onset. Therefore, the genetic marker evaluation to classify high-risk patients from low-risk patients trends an effective approach to patient management and care. Currently, there are no genetic markers available for extensive adoption as risk factors for coronary vascular disease, yet, there are numerous promising, biologically acceptable candidates. Many of these gene biomarkers, alone or in combination, can play an essential role in the prediction of cardiovascular risk. The present review highlights some putative emerging genetic biomarkers that could facilitate more authentic and fast diagnosis of CVD. This review also briefly describes few technological approaches employed in the biomarker search. PMID:27416153

  16. ELECTIONS PENSION FUND CANDIDATE NR 1

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : CHIAVERI First Name : Enrico I have been a CERN staff member since 1973 and have always been interested in our working conditions. As a member of the Executive Committee of the Staff Association I participated from 1980 to 1984 in the Working Group on Pensions mandated by the CERN Council. This commitment led to my becoming a member of the Governing Board of the Pension Fund in 1983, since when I have taken an active part in various commissions and working groups (Real Estate Asset Management Committee, Working Group on Actuarial Matters etc.); in so doing I have gained a thorough knowledge of different areas of the Pension Fund. Since ...

  17. Galactic worms. I - Catalog of worm candidates

    Science.gov (United States)

    Koo, Bon-Chul; Heiles, Carl; Reach, William T.

    1992-01-01

    A catalog of candidates for the Galactic worms that are possibly the walls surrounding the superbubbles is compiled; 118 isolated structures that appear both in H I and in IR (60 and 100 microns). Fifty-two are possibly associated with H II regions. It is found that the 100-micron emissivity increases systematically toward the Galactic interior, which is consistent with the increase of the general interstellar radiation field. The 100-micron emissivity of the structures associated with the H II regions is larger than that of the structures without associated H II regions. The 60-100-micron ratio is large, 0.28 +/- 0.03, which may indicate that the grains associated with the atomic gas have a relatively large population of small grains. Thirty-five structures appear in the 408-MHz continuum. The IR and the radio continuum properties suggest that the 408-MHz continuum emission in those structures is very likely thermal. The implications of these results on the ionization of gas far from the Galactic plane are discussed.

  18. MR imaging of cochlear implant candidates

    International Nuclear Information System (INIS)

    This paper reports on the value of diagnostic imaging in the workup of patients for possible placement of a multichannel intracochlear hearing device. Forty-five candidates for cochlear implantation were examined with both CT and MR imaging. In 32 adult patients coronal and axial T2-weighted spin-echo sequences were performed. In 10 patients, we used a T2*-weighted gradient-echo three-dimensional sequence with axial presaturation instead. Three children were examined with an ultrafast snapshot sequence for scout viewing, followed by a T2-weighted axial half-Fourier spin-echo sequence. In 36 patients we found the cochlea to be patent. Thirty-three of these patients successfully received an implant device. Three patients still await surgery. Six patients showed pathologic conditions in at least one ear at CT and MR alone. In 3 patients there was evidence of bony occulsion of the cochlear duct at CT; MR revealed a reduced signal intensity in the cochlea as well. Two patients with normal CT results showed abnormal conditions at MR imaging (reduced signal on T2-weighted images) and were not operated on

  19. ELECTIONS PENSION FUND 2nd candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : FRANDSEN First Name : Poul Kjaer  I have been member of the staff since 1974, and member of staff council for more than 12 years, and my main motivation has been to work for improving the social conditions of the CERN staff. A very important pillar of this is a sound and healthy pension fund. A capitalised scheme has been and still is the best choice for assuring the benefits for the CERN staff, present and future, this social system being part of the whole necessary to attract the best staff to the future High Energy Physics in Europe. However, even the hypothetic close down of the Organisation should allow the benefits to exi...

  20. ELECTIONS PENSION FUND CANDIDATE NO 1

    CERN Multimedia

    2000-01-01

    This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name: MAURINFirst Name:Guy I have been a member of the personnel since 1967 and as early as 1972 I was involved, in my capacity as President of the Staff Association, in the improvement of the Pension Fund benefits. As for most of us the Pension Fund is the only social provident scheme to which we belong, it is important to ensure that it is well managed and in balance. As a member of the Governing Board since 1974 and Vice-Chairman of this Board since 1977, I have continued to pursue these objectives.One of the main responsibilities of the Governing Board is our asset investment policy. The Investment Committee, of which I am Chairman, must have an overall view of the management of our 4 billion Swiss francs and seek the best yield with minimum risk. The investment structure must continuously be adapted...

  1. ELECTIONS PENSION FUND CANDIDATE NR 2

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate : Name : FRANDSEN First Name : Poul Kjaer  I have been member of the staff since 1974, and member of staff council for more than 12 years, and my main motivation has been to work for improving the social conditions of the CERN staff. A very important pillar of this is a sound and healthy pension fund. A capitalised scheme has been and still is the best choice for assuring the benefits for the CERN staff, present and future, this social system being part of the whole necessary to attract the best staff to the future High Energy Physics in Europe. However, even the hypothetic close down of the Organisation should allow the benefits to exi...

  2. ELECTIONS PENSION FUND CANDIDATE NO 2

    CERN Multimedia

    2000-01-01

    This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund.   Candidate: Name: RANJARDFirst Name: Florence Having been a member of the Governing Board of the Pension Fund since 1983 as Guy Maurin’s alternate, I am standing for a further 3-year term of office. Over the past few years work has concentrated essentially on following items: Monitoring of the work of the fund managers and their performances. The three-yearly study of the Fund’s actuarial situation. The pension guarantees ­ second phase. The Fund is approaching its maturity: the level of benefits exceeds contributions. In this context it has to strike a suitable balance between management of the risk from a dynamic investment policy, while a prudent policy avoiding any significant loss of its capital. These will be my concerns within the Governing Board of the Pension Fund if you...

  3. ELECTIONS PENSION FUND CANDIDATE NR 5

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate :  Name : Sonnemann  First Name : Florian Since my arrival at CERN in 1997 I have worked in the accelerator and administrative sectors. I have recently been elected as member of the Staff Council and of the Executive Committee of the Staff Association in which I am actively following matters concerning the Pension Fund. My candidature for the Governing Board of the CERN Pension Fund is mainly motivated to add my part in ensuring a solid financial situation of the Pension Fund. The Pension Fund is our only social security system. I wish to play a role in ensuring that the pensions will remain a secure revenue for all staff membe...

  4. ELECTIONS PENSION FUND 5th candidate

    CERN Multimedia

    2001-01-01

    ORGANISATION EUROPEENNE POUR LA RECHERCHE NUCLEAIRE CERN EUROPEAN ORGANIZATION FOR NUCLEAR RESEARCH CAISSE DE PENSIONS / PENSION FUND Caisse de Pensions - ELECTIONS - Pension Fund This candidature has been duly registered and is hereby presented in accordance with paragraph 6.h of the Regulations for Elections to the Governing Board of the Pension Fund. Candidate :  Name : Sonnemann  First Name : Florian Since my arrival at CERN in 1997 I have worked in the accelerator and administrative sectors. I have recently been elected as member of the Staff Council and of the Executive Committee of the Staff Association in which I am actively following matters concerning the Pension Fund. My candidature for the Governing Board of the CERN Pension Fund is mainly motivated to add my part in ensuring a solid financial situation of the Pension Fund. The Pension Fund is our only social security system. I wish to play a role in ensuring that the pensions will remain a secure revenue for all staff membe...

  5. Candidate gene prioritization by network analysis of differential expression using machine learning approaches

    Directory of Open Access Journals (Sweden)

    Nitsch Daniela

    2010-09-01

    Full Text Available Abstract Background Discovering novel disease genes is still challenging for diseases for which no prior knowledge - such as known disease genes or disease-related pathways - is available. Performing genetic studies frequently results in large lists of candidate genes of which only few can be followed up for further investigation. We have recently developed a computational method for constitutional genetic disorders that identifies the most promising candidate genes by replacing prior knowledge by experimental data of differential gene expression between affected and healthy individuals. To improve the performance of our prioritization strategy, we have extended our previous work by applying different machine learning approaches that identify promising candidate genes by determining whether a gene is surrounded by highly differentially expressed genes in a functional association or protein-protein interaction network. Results We have proposed three strategies scoring disease candidate genes relying on network-based machine learning approaches, such as kernel ridge regression, heat kernel, and Arnoldi kernel approximation. For comparison purposes, a local measure based on the expression of the direct neighbors is also computed. We have benchmarked these strategies on 40 publicly available knockout experiments in mice, and performance was assessed against results obtained using a standard procedure in genetics that ranks candidate genes based solely on their differential expression levels (Simple Expression Ranking. Our results showed that our four strategies could outperform this standard procedure and that the best results were obtained using the Heat Kernel Diffusion Ranking leading to an average ranking position of 8 out of 100 genes, an AUC value of 92.3% and an error reduction of 52.8% relative to the standard procedure approach which ranked the knockout gene on average at position 17 with an AUC value of 83.7%. Conclusion In this study we

  6. The presidential candidates on Twitter during the 2009 Romanian elections

    OpenAIRE

    Antonio MOMOC

    2012-01-01

    What changes introduced Twitter in political communication? Which are the advantages and disadvantages of Twitter usage in electoral communication for candidates and for voters? As the specialized literature barely mentions the use of Twitter in the Romanian elections, we shall answer the question regarding the way in which the 2009 presidential candidates used their own Twitter accounts. This article starts from the assumption that presidential candidates use the online communication tools i...

  7. Physical education candidate teachers' beliefs about vocational self-esteem

    OpenAIRE

    OZSAKER, Murat; CANPOLAT, A. Meliha

    2014-01-01

    The purpose of this study was to determine epistemological belief and vocational self-esteem physical education candidate teachers of Physical Education and Sports Department in 3 different universities, and also to examine effect of epistemological beliefs on vocational self-esteem. A total of 346 candidate teacher respondents (137 female and 209 male) participated in the study. Epistemological Beliefs and Vocational Self-Esteem Scale were used to determine candidate teachers’ epistemologica...

  8. Fifty Years of Pulsar Candidate Selection: From simple filters to a new principled real-time classification approach

    Science.gov (United States)

    Lyon, R. J.; Stappers, B. W.; Cooper, S.; Brooke, J. M.; Knowles, J. D.

    2016-04-01

    Improving survey specifications are causing an exponential rise in pulsar candidate numbers and data volumes. We study the candidate filters used to mitigate these problems during the past fifty years. We find that some existing methods such as applying constraints on the total number of candidates collected per observation, may have detrimental effects on the success of pulsar searches. Those methods immune to such effects are found to be ill-equipped to deal with the problems associated with increasing data volumes and candidate numbers, motivating the development of new approaches. We therefore present a new method designed for on-line operation. It selects promising candidates using a purpose-built tree-based machine learning classifier, the Gaussian Hellinger Very Fast Decision Tree (GH-VFDT), and a new set of features for describing candidates. The features have been chosen so as to i) maximise the separation between candidates arising from noise and those of probable astrophysical origin, and ii) be as survey-independent as possible. Using these features our new approach can process millions of candidates in seconds (˜1 million every 15 seconds), with high levels of pulsar recall (90%+). This technique is therefore applicable to the large volumes of data expected to be produced by the Square Kilometre Array (SKA). Use of this approach has assisted in the discovery of 20 new pulsars in data obtained during the LOFAR Tied-Array All-Sky Survey (LOTAAS).

  9. A Catalog of Kepler Habitable Zone Exoplanet Candidates

    Science.gov (United States)

    Kane, Stephen R.; Hill, Michelle L.; Kasting, James F.; Kopparapu, Ravi Kumar; Quintana, Elisa V.; Barclay, Thomas; Batalha, Natalie M.; Borucki, William J.; Ciardi, David R.; Haghighipour, Nader; Hinkel, Natalie R.; Kaltenegger, Lisa; Selsis, Franck; Torres, Guillermo

    2016-10-01

    The NASA Kepler mission ha s discovered thousands of new planetary candidates, many of which have been confirmed through follow-up observations. A primary goal of the mission is to determine the occurrence rate of terrestrial-size planets within the Habitable Zone (HZ) of their host stars. Here we provide a list of HZ exoplanet candidates from the Kepler Q1–Q17 Data Release 24 data-vetting process. This work was undertaken as part of the Kepler HZ Working Group. We use a variety of criteria regarding HZ boundaries and planetary sizes to produce complete lists of HZ candidates, including a catalog of 104 candidates within the optimistic HZ and 20 candidates with radii less than two Earth radii within the conservative HZ. We cross-match our HZ candidates with the stellar properties and confirmed planet properties from Data Release 25 to provide robust stellar parameters and candidate dispositions. We also include false-positive probabilities recently calculated by Morton et al. for each of the candidates within our catalogs to aid in their validation. Finally, we performed dynamical analysis simulations for multi-planet systems that contain candidates with radii less than two Earth radii as a step toward validation of those systems.

  10. A method of searching for supernova candidates from massive galaxy spectra

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    This paper presents a novel spectroscopic method for searching for supernova candidates from massive galaxy spectra,which is expected to be applied to the Large Sky Area Multi-Object Fiber Spectroscopic Telescope (LAMOST).This method includes mainly five steps.The first step is spectral preprocessing,including removing spectral noise using wavelet transform,spectral de-redshift,etc.The second step is decomposition of galactic spectra;we can get the galaxy component and supernova component and calculate the Supernova Statistical Characterization Vector (SNSCV) of each galaxy spectrum.The third step is to decrease samples in all the galaxy spectral datasets according to SNSCV of each spectrum,and to use the LOF (Local Outlier Factor)-based outlier detection algorithm to obtain the preliminary selected spectral data.The fourth step is template matching by cross-correlation,according to the matched results we get the secondary selected spectral data.Finally,we choose the final supernova candidates manually through checking the spectral features characteristic of a supernova.By the spectroscopic method proposed in this paper,thirty-six supernova candidates have been detected in a dataset including 294843 galaxy spectra from the Sloan Digital Sky Survey Data Release 7.Nine of these objects are detected first and the other twenty-seven have been reported in other publications (fifteen of which are detected and reported first by us).The twenty-four new super-nova candidates include twenty Ia type supernova candidates,three Ic type supernova candidates and one II type supernova candidate.

  11. Transit timing observations from Kepler. V. Transit timing variation candidates in the first sixteen months from polynomial models

    DEFF Research Database (Denmark)

    Ford, E.B.; Ragozzine, D.; Holman, M.J.;

    2012-01-01

    Transit timing variations provide a powerful tool for confirming and characterizing transiting planets, as well as detecting non-transiting planets. We report the results of an updated transit timing variation (TTV) analysis for 1481 planet candidates based on transit times measured during...... the first sixteen months of Kepler observations. We present 39 strong TTV candidates based on long-term trends (2.8% of suitable data sets). We present another 136 weaker TTV candidates (9.8% of suitable data sets) based on the excess scatter of TTV measurements about a linear ephemeris. We anticipate...... that several of these planet candidates could be confirmed and perhaps characterized with more detailed TTV analyses using publicly available Kepler observations. For many others, Kepler has observed a long-term TTV trend, but an extended Kepler mission will be required to characterize the system via TTVs. We...

  12. 少数民族高层次骨干人才政策的现状分析--基于B基地2011届硕士研究生的网络数据调查%An analysis on the status quo of the elite policy of ethnic group b ased on the data collected from 2011 master candidate base

    Institute of Scientific and Technical Information of China (English)

    刘健

    2013-01-01

    The elite policy of ethnic group is an important policy that install by relevant governmental au thority in order to improve the education of ethnic group. This essay take the 2011 master candidate base a s analyzing sample,reflects the problem on the enforcement of such policy via a quantity angle,and summar izes the factors influence the enforcement of such policy via a quality angle,finally works out the improv ing and optimizing suggestions.%  少数民族高层次人才培养计划,是国家有关部门针对少数民族教育而制定的一项重大公共政策。本文以对 B 基地2011级硕士研究生的调查数据为样本,从定量的角度反映当前少数民族高层次骨干人才政策实施中存在的问题,从定性的角度总结影响少数民族高层次骨干人才政策发挥的因素,并提出优化和改进的对策建议。

  13. Mechanical Properties of Candidate Materials for Hot Gas Duct of VHTR

    International Nuclear Information System (INIS)

    Hot gas duct of VHTR is operated at 950 .deg.. Ni based superalloys, such as Hastelloy XR, Alloy 617, Haynes 230, for hot gas duct have been candidate material because of good strength and corrosion properties at high temperature. Mechanical properties of these alloys are tested at high temperature to apply to hot gas duct of VHTR

  14. 29 CFR 1990.121 - Candidate list of potential occupational carcinogens.

    Science.gov (United States)

    2010-07-01

    ... present in any American workplace and which, on the basis of a brief scientific review of available data, may be considered candidates for further scientific review and possible regulation as Category I... substances without a tentative designation, based on the brief scientific review of available data for...

  15. Candidate materials performance under Supercritical Water Reactor (SCWR) conditions

    Energy Technology Data Exchange (ETDEWEB)

    Toivonen, A.; Penttilae, S.; Rissanen, L. (VTT Technical Research Centre of Finland, Espoo (Finland))

    2010-05-15

    The High Performance Light Water Reactor (HPLWR) is working at super-critical pressure (25 MPa) and a core coolant temperature up to 500 deg C. As an evolutionary step this reactor type follows the development path of modern supercritical coal-fired plants. This paper reviews the results on performance of commercial candidate materials for in-core applications focusing on corrosion, stress corrosion cracking (SCC) and creep issues. General corrosion (oxidation) tests with an inlet oxygen concentration of 125-150 ppb have been performed on several iron and nickel alloys at 300 to 650 deg C and 25 MPa in supercritical water. Stress corrosion cracking (SCC) susceptibility of selected austenitic stainless steels and a high chromium ODS (Oxide Dispersion Strengthened) alloy were also studied in slow strain rate tests (SSRT) in supercritical water at 500 deg C and 650 deg C. Furthermore, constant load creep tests have been performed on selected austenitic steels at 500 deg C and 650 deg C in supercritical water (25 MPa, 1 ppm O{sub 2}) and in an inert atmosphere (He, pressure 1 atm). Based on the materials studies, the current candidate materials for the core internals are austenitic steels with sufficient oxidation and creep resistance up to 500-550 deg C. High chromium austenitic steels and ODS alloys steels are considered for the fuel rod cladding due to their oxidation resistance up to 650 deg C. However, problems with manufacturing and joining of ODS alloys need to be solved. Alloys with high nickel content were not considered for the SCC or creep studies because of the strong effect of Ni on neutronics of the reactor core (orig.)

  16. Selection of Lactic Acid Bacteria as Probiotic Candidate for Chicken

    Directory of Open Access Journals (Sweden)

    F. Hamida

    2015-08-01

    Full Text Available Lactic acid bacteria (LAB regarded as safe microorganisms; they can naturally live in gastrointestinal tract, so appropriately used as a probiotic for chicken. This study aimed to select six isolates of LAB (E1223, E3, E4, E5, E7, and E8 to obtain the isolates potentially as probiotic candidate for chicken. The six isolates were derived from spontaneous fermented corn obtained from Laboratory of Animal Biotechnology and Biomedical, PPSHB, Bogor Agricultural University, Indonesia. LAB isolates were tested their susceptibility to antibiotics (bambermycin, erythromycin, chloramphenicol, and tetracycline then were examined in vitro for their tolerance to gastrointestinal pH (2, 3, 4, and 7.2 and 0.5% bile salt condition, antimicrobial activity against Salmonella enteritidis and Enterococcus casseliflavus, and ability to adhere to chicken ileal cells. The results showed the isolates E5, E7, and E8 were sensitive to tetracycline and chloramphenicol, they could survive at pH 2, 3, 4, and 7.2, could survive at 0.5% bile salts, produced antimicrobial activity, and able to adhere to ileal cells (9.40±0.00 Log CFU/cm2 of E8 and were significantly (P<0.05 higher than those of control (5.30±0.14 Log CFU/cm2. In conclusion, this study showed that isolate E8 had better potential compared to isolates E5 and E7 in most in vitro assays as a probiotic candidate for chicken. E5, E7, and E8 were closely related with Pediococcus pentosaceus based on 16S rRNA gene.

  17. Adaptations to climate in candidate genes for common metabolic disorders.

    Directory of Open Access Journals (Sweden)

    Angela M Hancock

    2008-02-01

    Full Text Available Evolutionary pressures due to variation in climate play an important role in shaping phenotypic variation among and within species and have been shown to influence variation in phenotypes such as body shape and size among humans. Genes involved in energy metabolism are likely to be central to heat and cold tolerance. To test the hypothesis that climate shaped variation in metabolism genes in humans, we used a bioinformatics approach based on network theory to select 82 candidate genes for common metabolic disorders. We genotyped 873 tag SNPs in these genes in 54 worldwide populations (including the 52 in the Human Genome Diversity Project panel and found correlations with climate variables using rank correlation analysis and a newly developed method termed Bayesian geographic analysis. In addition, we genotyped 210 carefully matched control SNPs to provide an empirical null distribution for spatial patterns of allele frequency due to population history alone. For nearly all climate variables, we found an excess of genic SNPs in the tail of the distributions of the test statistics compared to the control SNPs, implying that metabolic genes as a group show signals of spatially varying selection. Among our strongest signals were several SNPs (e.g., LEPR R109K, FABP2 A54T that had previously been associated with phenotypes directly related to cold tolerance. Since variation in climate may be correlated with other aspects of environmental variation, it is possible that some of the signals that we detected reflect selective pressures other than climate. Nevertheless, our results are consistent with the idea that climate has been an important selective pressure acting on candidate genes for common metabolic disorders.

  18. Extremely metal-poor star candidates in the SDSS

    Institute of Scientific and Technical Information of China (English)

    Si-Yao Xu; Hua-Wei Zhang; Xiao-Wei Liu

    2013-01-01

    For a sample of metal-poor stars (-3.3 ≤ [Fe/H] ≤-2.2) that have highresolution spectroscopic abundance determinations,we have measured equivalent widths of the Ca Ⅱ K,Mg Ⅰ b and near-infrared Ca Ⅱ triplet lines using low-resolution spectra from the Sloan Digital Sky Survey (SDSS),calculated effective temperatures from (g-z)o color,deduced stellar surface gravities by fitting stellar isochrones,and determined metallicities based on the aforementioned quantities.Metallicities thus derived from the Ca Ⅱ K line are in much better agreement with the results determined from high-resolution spectra than the values given in the SDSS Data Release 7.The metallicities derived from the Mg Ⅰ b lines have a large dispersion owing to the large measurement errors,whereas those deduced from the Ca Ⅱ triplet lines are too high due to both non-local thermodynamical equilibrium (NLTE) effects and measurement errors.Abundances after correction for the NLTE effect for the Mg Ⅰ b lines and Ca Ⅱ triplet lines are also presented.Following this method,we have identified six candidates of ultra-metal-poor stars with [Fe/H] ~-4.0 from a sample of 166 metal-poor star candidates.One of them,SDSS J102915+172927,was recently confirmed to be an ultra-metal-poor ([Fe/H] <-4.0) star with the lowest metallicity ever measured.Follow-up high-resolution spectroscopy for the other five ultra-metal-poor stars in our sample will therefore be of great interest.

  19. RCT photometry and HCT spectroscopy of blazar candidates in the Kepler field of view

    Science.gov (United States)

    Carini, Michael T.; Goyal, A.; Jose, J.

    2014-01-01

    The results of photometric and spectroscopic monitoring of 9 blazar candidates in the Kepler field of view are presented. These sources were identified as blazar candidates based on their position in the so-called WISE blazar strip. Finding charts and comparison sequences were created using the NOMAD database. R band photometric monitoring was begun in spring 2013 with the Robotically Controlled Telescope(RCT), and spectroscopic observations of 7 of the sources were obtained with the Himalayan Chandra Telescope (HCT) in September, 2013. Light curves for all 9 sources and preliminary spectroscopic classifications for the 7 sources with spectra will be presented.

  20. Testing of Candidate Icons to Identify Acetaminophen-Containing Medicines

    Directory of Open Access Journals (Sweden)

    Saul Shiffman

    2016-01-01

    Full Text Available Adding icons on labels of acetaminophen-containing medicines could help users identify the active ingredient and avoid concomitant use of multiple medicines containing acetaminophen. We evaluated five icons for communication effectiveness. Adults (n = 300 were randomized to view a prescription container label or over-the-counter labels with either one or two icons. Participants saw two icon candidates, and reported their interpretation; experts judged whether these reflected critical confusions that might cause harm. Participants rated how effectively each icon communicated key messages. Icons based on abbreviations of “acetaminophen” (“Ac”, “Ace”, “Acm” were rated less confusing and more effective in communicating the active ingredient than icons based on “APAP” or an abstract symbol. Icons did not result in critical confusion when seen on a readable medicine label. Icon implementation on prescription labels was more effective at communicating the warning against concomitant use than implementation on over-the-counter (OTC labels. Adding an icon to a second location on OTC labels did not consistently enhance this communication, but reduced rated effectiveness of acetaminophen ingredient communication among participants with limited health literacy. The abbreviation-based icons seem most suitable for labeling acetaminophen-containing medications to enable users to identify acetaminophen-containing products.

  1. ‘Don’t Leave Before You Understand’: Supporting Master’s Candidates in Business Studies

    Directory of Open Access Journals (Sweden)

    Christine Winberg

    2015-06-01

    Full Text Available Postgraduate studies in business faculties pose particular challenges to candidates who have come from practically-oriented undergraduate programmes, particularly those that adopt a ‘technical-rational’ approach towards the improvement of business practices or organisational efficiency. Research studies in the applied business fields usually expect that the candidate will take a more sociological approach, or be able to work within socio-historical or political frameworks (Hordern, 2014. Candidates who are enrolled for postgraduate business studies have to negotiate this complex transition. The focus of this paper is how candidates acquire the necessary academic and social practices for theorising their research, for conducting research activities and writing up their research findings in Masters level applied business studies. We selected candidates who had experienced difficulties throughout their Masters studies and who had successfully completed, or who were close to completion, despite initial difficulty for narrative interviews. The interview data were analysed with a view to establishing the practices that supported successful transition from practice-based undergraduate business degrees to postgraduate studies in the field. This paper concludes with suggestions for supervisory practices that have the potential to support successful postgraduate research in applied business studies. 

  2. Discovery of Candidate H$_2$O Disk Masers in AGN and Estimations of Centripetal Accelerations

    CERN Document Server

    Greenhill, Lincoln J; Moran, James M; Tilak, Avanti

    2009-01-01

    Based on spectroscopic signatures, about one-third of known H$_2$O maser sources in active galactic nuclei (AGN) are believed to arise in highly inclined accretion disks around central engines. These "disk maser candidates" are of interest primarily because angular structure and rotation curves can be resolved with interferometers, enabling dynamical study. We identify five new disk maser candidates in studies with the Green Bank Telescope, bringing the total number published to 30. We discovered two (NGC1320, NGC17) in a survey of 40 inclined active galaxies (v_{sys}< 20000 kms^{-1}). The remaining three disk maser candidates were identified in monitoring of known sources: NGC449, NGC2979, NGC3735. We also confirm a previously marginal case in UGC4203. For the disk maser candidates reported here, inferred rotation speeds are 130-500 kms^{-1}. Monitoring of three more rapidly rotating candidate disks (CG211, NGC6264, VV340A) has enabled measurement of likely orbital centripetal acceleration, and estimation...

  3. Factors Influencing Entering Teacher Candidates' Preferences for Instructional Activities: A glimpse into their orientations towards teaching

    Science.gov (United States)

    Talanquer, Vicente; Novodvorsky, Ingrid; Tomanek, Debra

    2010-07-01

    The present study was designed to identify and characterize the major factors that influence entering science teacher candidates' preferences for different types of instructional activities, and to analyze what these factors suggest about teacher candidates' orientations towards science teaching. The study involved prospective teachers enrolled in the introductory science teaching course in an undergraduate science teacher preparation program. Our analysis was based on data collected using a teaching and learning beliefs questionnaire, together with structured interviews. Our results indicate that entering science teacher candidates have strong preferences for a few activity types. The most influential factors driving entering science teacher candidates' selections were the potential of the instructional activities to motivate students, be relevant to students' personal lives, result in transfer of skills to non-science situations, actively involve students in goal-directed learning, and implement curriculum that represents what students need to know. This set of influencing factors suggests that entering science teacher candidates' orientations towards teaching are likely driven by one or more of these three central teaching goals: (1) motivating students, (2) developing science process skills, and (3) engaging students in structured science activities. These goals, and the associated beliefs about students, teaching, and learning, can be expected to favor the development or enactment of three major orientations towards teaching in this population of future science teachers: "motivating students," "process," and "activity-driven."

  4. Investigating the Optical Counterpart Candidates of Four INTEGRAL Sources localized with Chandra

    CERN Document Server

    Arabacı, Mehtap Özbey; Tomsick, John A; Halpern, Jules; Bodaghee, Arash; Chaty, Sylvain; Rodriguez, Jerome; Rahoui, Farid

    2012-01-01

    We report on the optical spectroscopic follow up observations of the candidate counterparts to four INTEGRAL sources: IGR J04069+5042, IGR J06552-1146, IGR J21188+4901 and IGR J22014+6034. The candidate counterparts were determined with Chandra, and the optical observations were performed with 1.5-m RTT-150 telescope (T\\"{U}B\\.{I}TAK National Observatory, Antalya, Turkey) and 2.4-m Hiltner Telescope (MDM Observatory, Kitt Peak, Arizona). Our spectroscopic results show that one of the two candidates of IGR J04069+5042 and the one observed for IGR J06552-1146 could be active late-type stars in RS CVn systems. However, according to the likelihood analysis based on Chandra and INTEGRAL, two optically weaker sources in the INTEGRAL error circle of IGR J06552-1146 have higher probabilities to be the actual counterpart. The candidate counterparts of IGR J21188+4901 are classified as an active M-type star and a late-type star. Among the optical spectra of four candidates of IGR J22014+6034, two show H\\alpha emission ...

  5. Functional validation of GWAS gene candidates for abnormal liver function during zebrafish liver development

    Directory of Open Access Journals (Sweden)

    Leah Y. Liu

    2013-09-01

    Genome-wide association studies (GWAS have revealed numerous associations between many phenotypes and gene candidates. Frequently, however, further elucidation of gene function has not been achieved. A recent GWAS identified 69 candidate genes associated with elevated liver enzyme concentrations, which are clinical markers of liver disease. To investigate the role of these genes in liver homeostasis, we narrowed down this list to 12 genes based on zebrafish orthology, zebrafish liver expression and disease correlation. To assess the function of gene candidates during liver development, we assayed hepatic progenitors at 48 hours post fertilization (hpf and hepatocytes at 72 hpf using in situ hybridization following morpholino knockdown in zebrafish embryos. Knockdown of three genes (pnpla3, pklr and mapk10 decreased expression of hepatic progenitor cells, whereas knockdown of eight genes (pnpla3, cpn1, trib1, fads2, slc2a2, pklr, mapk10 and samm50 decreased cell-specific hepatocyte expression. We then induced liver injury in zebrafish embryos using acetaminophen exposure and observed changes in liver toxicity incidence in morphants. Prioritization of GWAS candidates and morpholino knockdown expedites the study of newly identified genes impacting liver development and represents a feasible method for initial assessment of candidate genes to instruct further mechanistic analyses. Our analysis can be extended to GWAS for additional disease-associated phenotypes.

  6. Eliciting, Identifying, Interpreting, and Responding to Students' Ideas: Teacher Candidates' Growth in Formative Assessment Practices

    Science.gov (United States)

    Gotwals, Amelia Wenk; Birmingham, Daniel

    2016-06-01

    With the goal of helping teacher candidates become well-started beginners, it is important that methods courses in teacher education programs focus on high-leverage practices. Using responsive teaching practices, specifically eliciting, identifying, interpreting, and responding to students' science ideas (i.e., formative assessment), can be used to support all students in learning science successfully. This study follows seven secondary science teacher candidates in a yearlong practice-based methods course. Course assignments (i.e., plans for and reflections on teaching) as well as teaching videos were analyzed using a recursive qualitative approach. In this paper, we present themes and patterns in teacher candidates' abilities to elicit, identify, interpret, and respond to students' ideas. Specifically, we found that those teacher candidates who grew in the ways in which they elicited students' ideas from fall to spring were also those who were able to adopt a more balanced reflection approach (considering both teacher and student moves). However, we found that even the teacher candidates who grew in these practices did not move toward seeing students' ideas as nuanced; rather, they saw students' ideas in a dichotomous fashion: right or wrong. We discuss implications for teacher preparation, specifically for how to promote productive reflection and tools for better understanding students' ideas.

  7. Effect of microwave cured acrylic resin on candidal growth in complete denture

    International Nuclear Information System (INIS)

    This study was conducted to evaluate the effect of heat-cured acrylic resin denture base and microwave-cured acrylic resin denture base on candidal growth . Seven completely edentulous male patients with on history of denture wearing participated in this study. all the selected patients were re-habilitated by mucosa supported complete dentures .The dentures were constructed from conventional heat-cured acrylic resin denture base following monoplane concept of occlusion. Before dismissing the patients and one month after denture insertion, salivary samples were collected according to oral rinse technique. one month resting period was allowed so as candidal count can reach to normal, then dentures were re based using microwave-cured acrylic denture base, before denture insertion and one month after denture insertion, salivary sample were collected before and one month following the same oral rinse technique.

  8. A Systematic Approach to Identify Candidate Transcription Factors that Control Cell Identity

    Directory of Open Access Journals (Sweden)

    Ana C. D’Alessio

    2015-11-01

    Full Text Available Hundreds of transcription factors (TFs are expressed in each cell type, but cell identity can be induced through the activity of just a small number of core TFs. Systematic identification of these core TFs for a wide variety of cell types is currently lacking and would establish a foundation for understanding the transcriptional control of cell identity in development, disease, and cell-based therapy. Here, we describe a computational approach that generates an atlas of candidate core TFs for a broad spectrum of human cells. The potential impact of the atlas was demonstrated via cellular reprogramming efforts where candidate core TFs proved capable of converting human fibroblasts to retinal pigment epithelial-like cells. These results suggest that candidate core TFs from the atlas will prove a useful starting point for studying transcriptional control of cell identity and reprogramming in many human cell types.

  9. Candidate genes for cross-resistance against DNA-damaging drugs

    DEFF Research Database (Denmark)

    Wittig, Rainer; Nessling, Michelle; Will, Rainer D;

    2002-01-01

    Drug resistance of tumor cells leads to major drawbacks in the treatment of cancer. To identify candidate genes for drug resistance, we compared the expression patterns of the drug-sensitive human malignant melanoma cell line MeWo and three derived sublines with acquired resistance to the DNA......-damaging agents cisplatin, etoposide, and fotemustine. Subarray analyses confirmed 57 candidate genes recovered from a genome-wide scan for differential expression. By specifically addressing cancer genes we retrieved another set of 209 candidates. Exemplary Northern blot studies indicated qualitative concordance...... converged in their expression patterns. A total of 110 genes was transiently or permanently deregulated in at least two resistant sublines. Fourteen genes displayed differential expression in all three of the sublines. We hypothesize that the variations in fotemustine and cisplatin resistance are based...

  10. Physical rehabilitation for lung transplant candidates and recipients: An evidence-informed clinical approach

    Science.gov (United States)

    Wickerson, Lisa; Rozenberg, Dmitry; Janaudis-Ferreira, Tania; Deliva, Robin; Lo, Vincent; Beauchamp, Gary; Helm, Denise; Gottesman, Chaya; Mendes, Polyana; Vieira, Luciana; Herridge, Margaret; Singer, Lianne G; Mathur, Sunita

    2016-01-01

    Physical rehabilitation of lung transplant candidates and recipients plays an important in optimizing physical function prior to transplant and facilitating recovery of function post-transplant. As medical and surgical interventions in lung transplantation have evolved over time, there has been a demographic shift of individuals undergoing lung transplantation including older individuals, those with multiple co-morbidites, and candidates with respiratory failure requiring bridging to transplantation. These changes have an impact on the rehabilitation needs of lung transplant candidates and recipients. This review provides a practical approach to rehabilitation based on research and clinical practice at our transplant centre. It focuses on functional assessment and exercise prescription during an uncomplicated and complicated clinical course in the pre-transplant, early and late post-transplant periods. The target audience includes clinicians involved in pre- and post-transplant patient care and rehabilitation researchers.

  11. Evolution and magnitudes of candidate Planet Nine

    Science.gov (United States)

    Linder, Esther F.; Mordasini, Christoph

    2016-05-01

    Context. The recently renewed interest in a possible additional major body in the outer solar system prompted us to study the thermodynamic evolution of such an object. We assumed that it is a smaller version of Uranus and Neptune. Aims: We modeled the temporal evolution of the radius, temperature, intrinsic luminosity, and the blackbody spectrum of distant ice giant planets. The aim is also to provide estimates of the magnitudes in different bands to assess whether the object might be detectable. Methods: Simulations of the cooling and contraction were conducted for ice giants with masses of 5, 10, 20, and 50 M⊕ that are located at 280, 700, and 1120 AU from the Sun. The core composition, the fraction of H/He, the efficiency of energy transport, and the initial luminosity were varied. The atmospheric opacity was set to 1, 50, and 100 times solar metallicity. Results: We find for a nominal 10 M⊕ planet at 700 AU at the current age of the solar system an effective temperature of 47 K, much higher than the equilibrium temperature of about 10 K, a radius of 3.7 R⊕, and an intrinsic luminosity of 0.006 L♃. It has estimated apparent magnitudes of Johnson V, R, I, L, N, Q of 21.7, 21.4, 21.0, 20.1, 19.9, and 10.7, and WISE W1-W4 magnitudes of 20.1, 20.1, 18.6, and 10.2. The Q and W4 band and other observations longward of about 13 μm pick up the intrinsic flux. Conclusions: If candidate Planet 9 has a significant H/He layer and an efficient energy transport in the interior, then its luminosity is dominated by the intrinsic contribution, making it a self-luminous planet. At a likely position on its orbit near aphelion, we estimate for a mass of 5, 10, 20, and 50 M⊕ a V magnitude from the reflected light of 24.3, 23.7, 23.3, and 22.6 and a Q magnitude from the intrinsic radiation of 14.6, 11.7, 9.2, and 5.8. The latter would probably have been detected by past surveys.

  12. Elections, Information, and State-Dependent Candidate Quality

    DEFF Research Database (Denmark)

    Jensen, Thomas

    The quality of political candidates often depends on the current state of the world, for example because their personal characteristics are more valuable in some situations than in others. We explore the implications of state-dependent candidate quality in a model of electoral competition where v...

  13. 11 CFR 9033.1 - Candidate and committee agreements.

    Science.gov (United States)

    2010-01-01

    ... pursuant to 11 CFR part 9039. The candidate and authorized committee(s) shall facilitate the audit by... authorized committee(s) will comply with the conditions set forth in 11 CFR 9033.1(b). The candidate may... committee(s) will comply with the documentation requirements set forth in 11 CFR 9033.11. (3) The...

  14. Social Studies Teacher Candidates' Views on Historical Thinking Skills

    Science.gov (United States)

    Ozmen, Cengiz

    2015-01-01

    Current study aimed to present Social Studies teacher candidates' views on historical thinking skills. Study was conducted using qualitative design and working group was composed of a total of 121 teacher candidates (62 females and 59 males) attending Social Studies Teaching Department of Karadeniz Technical University and Adiyaman University…

  15. Five kepler target stars that show multiple transiting exoplanet candidates

    DEFF Research Database (Denmark)

    Steffen..[], Jason H.; Batalha, N. M.; Broucki, W J.;

    2010-01-01

    We present and discuss five candidate exoplanetary systems identified with the Kepler spacecraft. These five systems show transits from multiple exoplanet candidates. Should these objects prove to be planetary in nature, then these five systems open new opportunities for the field of exoplanets...

  16. Primary-Grade Teacher Candidates' Views on Museum Education

    Science.gov (United States)

    Tas, Ayse Mentis

    2012-01-01

    This study identifies the primary-grade teacher candidates' views on museum education. The research is a descriptive research that used survey model. The study group is made up of 209 primary-grade teacher candidates who were seniors in the Primary-Grade Teaching Program. They were all attending Konya University's Faculty of Education. A survey…

  17. Assessing Student Teaching Experiences: Teacher Candidates' Perceptions of Preparedness

    Science.gov (United States)

    Lee, Joohi; Tice, Kathleen; Collins, Denise; Brown, Amber; Smith, Cleta; Fox, Jill

    2012-01-01

    The purpose of this study is to investigate the effectiveness of student teaching experiences by measuring teacher candidates' perceptions of their preparedness. The participants were 130 teacher candidates who had completed their student teaching as part of a program preparing them to teach children in pre-K through grade 4. Teacher candidates…

  18. Chemical Literacy Levels of Science and Mathematics Teacher Candidates

    Science.gov (United States)

    Celik, Suat

    2014-01-01

    The goal of this study was to investigate Turkish science and mathematics teacher candidates' levels of attainment in chemical literacy. These candidates had all studied the new Turkish chemistry curriculum in high school. The sample of the study consisted of 112 students, who were first-year students in the Department of Secondary Science…

  19. Teacher Candidates' Views of Digital Games as Learning Devices

    Science.gov (United States)

    Sardone, Nancy B.; Devlin-Scherer, Roberta

    2009-01-01

    The objective of this research study was to explore teacher candidate views toward digital learning games using an immersive strategy. Specifically, we were interested in finding out what game use in classroom settings taught candidates about the role of teacher as facilitator of instruction. The procedures first focused teacher candidate…

  20. Investigating Academic Achievements and Critical Thinking Dispositions of Teacher Candidates

    Science.gov (United States)

    Karagöl, Ibrahim; Bekmezci, Sinan

    2015-01-01

    The aim of this study is to examine the relationship between academic achievements and critical thinking dispositions of teacher candidates in Faculty of Education and to find out whether critical thinking dispositions and academic achievements scores of teacher candidates differ according to different variables. The population consists of the…

  1. Facebook Connection Styles among Physical Education Teacher Candidates

    Science.gov (United States)

    Erdogdu, Murat

    2016-01-01

    The purpose of this study is to determine the Facebook connection styles of physical education (PE) teacher candidates. The participants were composed of 626 (age = 21.21 ± 2.024) physical education teacher candidates from the departments of Physical Education and Sports. They teach in five different universities. It was done in 2014-2015 academic…

  2. 28 CFR 105.14 - Risk assessment for candidates.

    Science.gov (United States)

    2010-07-01

    ... or national security as a result of the preliminary risk assessment, the candidate or the Provider... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Risk assessment for candidates. 105.14... CHECKS Aviation Training for Aliens and Other Designated Individuals § 105.14 Risk assessment...

  3. Opinions of Counselor Candidates Regarding Counseling Skills Training

    Science.gov (United States)

    Aladag, Mine; Yaka, Baris; Koç, Ismet

    2014-01-01

    The aim of this study is to contribute to the enhancement of the quality of counseling skills training and counselor education through the medium of understanding the opinions of counselor candidates regarding counseling skills training. The research group consisted of 67 counselor candidates who voluntarily participated in the study. The research…

  4. Developing Benchmarks to Measure Teacher Candidates' Performance

    Science.gov (United States)

    Frazier, Laura Corbin; Brown-Hobbs, Stacy; Palmer, Barbara Martin

    2013-01-01

    This paper traces the development of teacher candidate benchmarks at one liberal arts institution. Begun as a classroom assessment activity over ten years ago, the benchmarks, through collaboration with professional development school partners, now serve as a primary measure of teacher candidates' performance in the final phases of the…

  5. Fostering the Development of Chemistry Teacher Candidates: A Bioecological Approach

    Science.gov (United States)

    Lewthwaite, Brian; Wiebe, Rick

    2012-01-01

    This ongoing research inquiry investigates through the analysis of teacher candidate experiences the factors influencing two groups of chemistry teacher candidates' development during their extended practica in their second and final year of an after-degree bachelor of education at a university in central Canada. The tenets of Bronfenbrenner's…

  6. Preformulation Considerations for Controlled Release Dosage Forms: Part III. Candidate Form Selection Using Numerical Weighting and Scoring

    OpenAIRE

    Chrzanowski, Frank

    2008-01-01

    Two numerical methods, Decision Analysis (DA) and Potential Problem Analysis (PPA) are presented as alternative selection methods to the logical method presented in Part I. In DA properties are weighted and outcomes are scored. The weighted scores for each candidate are totaled and final selection is based on the totals. Higher scores indicate better candidates. In PPA potential problems are assigned a seriousness factor and test outcomes are used to define the probability of occurrence. The ...

  7. Provisional Assessment of Candidate High-Temperature Thermal Conductivity Reference Materials in the EMRP “Thermo” Project

    OpenAIRE

    Wu, J.; Morrell, R; T. Fry; Gnaniah, S.; Gohil, D.; Dawson, A.; Hameury, J.; Koenen, Alain; Hammerschmidt, U.; Turzó-András, E.; Strnad, R.; Blahut, A.

    2015-01-01

    This article describes the provisional assessment of a short list of four candidate high-temperature thermal conductivity reference materials in a European research project, “Thermo.” These four candidate materials are low-density calcium silicate, amorphous silica, high-density calcium silicate, and exfoliated vermiculite. Based on initial tests on material composition and microstructure changes, dimensional stability, mechanical stability, chemical stability and uniformity, the best two can...

  8. Hair & skin derived progenitor cells: In search of a candidate cell for regenerative medicine

    OpenAIRE

    Anil Kumar; Sujata Mohanty; Sushmita Bose Nandy; Somesh Gupta; Binod K Khaitan; Shilpa Sharma; Balram Bhargava; Balram Airan

    2016-01-01

    Background & objectives: Skin is an established tissue source for cell based therapy. The hair follicle has been introduced later as a tissue source for cell based therapy. The ease of tissue harvest and multipotent nature of the resident stem cells in skin and hair follicle has promoted basic and clinical research in this area. This study was conducted to evaluate skin stem cells (SSCs) and hair follicle stem cells (HFSCs) as candidate cells appropriate for neuronal and melanocyte lineage di...

  9. 病例对照设计为基础的候选基因关联研究中交互作用的统计方法进展%Progress of statistical methods for testing interactions in candidate gene association studies based on case-control design

    Institute of Scientific and Technical Information of China (English)

    金如锋

    2011-01-01

    候选基因关联研究中基因-基因、基因-环境交互作用的统计分析有利于揭示疾病的发生机制.本文针对病例对照设计的候选基因关联研究,综述交互作用的统计方法及其进展.交互作用的统计方法包括参数法和非参数法.参数法中最常用的为Logistic回归模型,非参数法主要是数据挖掘方法.有4类数据挖掘方法可用于候选基因关联研究,包括降维法、基于树的方法、模式识别法和贝叶斯法.本文对最常用且可靠的几种数据挖掘方法(多因子降维法、分类回归树、随机森林、贝叶斯上位效应关联图谱)的原理、分析过程和优缺点予以比较.参数法和非参数法分析交互作用时各有优缺点;低维数据的分析可采用参数法和非参数法,高维数据的分析则主要采用非参数法.随着基因分型技术的发展,可检测的SNP规模逐渐增大,使得非参数方法的应用越来越广.%Testing for gene-gene and gene-environment interactions in candidate gene association studies will help to reveal possible mechanisms underlying diseases. This article summarized the progress of statistical methods for testing interactions in candidate gene association studies based on case-control design. Parametric and non-parametric methods can be used to detect the interactions. Logistic regression is the most frequently used parametric method,and data mining techniques offer a variety of alternative non-parametric methods. Data mining techniques that can be applied in association studies consist of dimension reduction, tree-based approach, pattern recognition and Bayesian methods. Among alternative non-parametric methods we concentrated on the four methods which have become popular and are reliable for detection of interactions, including multifactor dimensionality reduction (MDR),classification and regression tree (CART), random forest, and Bayesian epistasis association mapping (BEAM). The principles

  10. Structure and evolution of barley powdery mildew effector candidates

    Directory of Open Access Journals (Sweden)

    Pedersen Carsten

    2012-12-01

    Full Text Available Abstract Background Protein effectors of pathogenicity are instrumental in modulating host immunity and disease resistance. The powdery mildew pathogen of grasses Blumeria graminis causes one of the most important diseases of cereal crops. B. graminis is an obligate biotrophic pathogen and as such has an absolute requirement to suppress or avoid host immunity if it is to survive and cause disease. Results Here we characterise a superfamily predicted to be the full complement of Candidates for Secreted Effector Proteins (CSEPs in the fungal barley powdery mildew parasite B. graminis f.sp. hordei. The 491 genes encoding these proteins constitute over 7% of this pathogen’s annotated genes and most were grouped into 72 families of up to 59 members. They were predominantly expressed in the intracellular feeding structures called haustoria, and proteins specifically associated with the haustoria were identified by large-scale mass spectrometry-based proteomics. There are two major types of effector families: one comprises shorter proteins (100–150 amino acids, with a high relative expression level in the haustoria and evidence of extensive diversifying selection between paralogs; the second type consists of longer proteins (300–400 amino acids, with lower levels of differential expression and evidence of purifying selection between paralogs. An analysis of the predicted protein structures underscores their overall similarity to known fungal effectors, but also highlights unexpected structural affinities to ribonucleases throughout the entire effector super-family. Candidate effector genes belonging to the same family are loosely clustered in the genome and are associated with repetitive DNA derived from retro-transposons. Conclusions We employed the full complement of genomic, transcriptomic and proteomic analyses as well as structural prediction methods to identify and characterize the members of the CSEPs superfamily in B. graminis f

  11. Fifty Years of Pulsar Candidate Selection: From simple filters to a new principled real-time classification approach

    CERN Document Server

    Lyon, R J; Cooper, S; Brooke, J M; Knowles, J D

    2016-01-01

    Improving survey specifications are causing an exponential rise in pulsar candidate numbers and data volumes. We study the candidate filters used to mitigate these problems during the past fifty years. We find that some existing methods such as applying constraints on the total number of candidates collected per observation, may have detrimental effects on the success of pulsar searches. Those methods immune to such effects are found to be ill-equipped to deal with the problems associated with increasing data volumes and candidate numbers, motivating the development of new approaches. We therefore present a new method designed for on-line operation. It selects promising candidates using a purpose-built tree-based machine learning classifier, the Gaussian Hellinger Very Fast Decision Tree (GH-VFDT), and a new set of features for describing candidates. The features have been chosen so as to i) maximise the separation between candidates arising from noise and those of probable astrophysical origin, and ii) be as...

  12. Biological Networks for Cancer Candidate Biomarkers Discovery

    Science.gov (United States)

    Yan, Wenying; Xue, Wenjin; Chen, Jiajia; Hu, Guang

    2016-01-01

    Due to its extraordinary heterogeneity and complexity, cancer is often proposed as a model case of a systems biology disease or network disease. There is a critical need of effective biomarkers for cancer diagnosis and/or outcome prediction from system level analyses. Methods based on integrating omics data into networks have the potential to revolutionize the identification of cancer biomarkers. Deciphering the biological networks underlying cancer is undoubtedly important for understanding the molecular mechanisms of the disease and identifying effective biomarkers. In this review, the networks constructed for cancer biomarker discovery based on different omics level data are described and illustrated from recent advances in the field.

  13. Biological Networks for Cancer Candidate Biomarkers Discovery.

    Science.gov (United States)

    Yan, Wenying; Xue, Wenjin; Chen, Jiajia; Hu, Guang

    2016-01-01

    Due to its extraordinary heterogeneity and complexity, cancer is often proposed as a model case of a systems biology disease or network disease. There is a critical need of effective biomarkers for cancer diagnosis and/or outcome prediction from system level analyses. Methods based on integrating omics data into networks have the potential to revolutionize the identification of cancer biomarkers. Deciphering the biological networks underlying cancer is undoubtedly important for understanding the molecular mechanisms of the disease and identifying effective biomarkers. In this review, the networks constructed for cancer biomarker discovery based on different omics level data are described and illustrated from recent advances in the field. PMID:27625573

  14. A Catalog of Kepler Habitable Zone Exoplanet Candidates

    CERN Document Server

    Kane, Stephen R; Kasting, James F; Kopparapu, Ravi Kumar; Quintana, Elisa V; Barclay, Thomas; Batalha, Natalie M; Borucki, William J; Ciardi, David R; Haghighipour, Nader; Hinkel, Natalie R; Kaltenegger, Lisa; Selsis, Franck; Torres, Guillermo

    2016-01-01

    The NASA Kepler mission has discovered thousands of new planetary candidates, many of which have been confirmed through follow-up observations. A primary goal of the mission is to determine the occurrance rate of terrestrial-size planets within the Habitable Zone (HZ) of their host stars. Here we provide a list of HZ exoplanet candidates from the Kepler Data Release 24 Q1-Q17 data vetting process. This work was undertaken as part of the Kepler Habitable Zone Working Group. We use a variety of criteria regarding HZ boundaries and planetary sizes to produce complete lists of HZ candidates, including a catalog of 104 candidates within the optimistic HZ and 20 candidates with radii less than two Earth radii within the conservative HZ. We cross-match our HZ candidates with the Data Release 25 stellar properties and confirmed planet properties to provide robust stellar parameters and candidate dispositions. We also include false positive probabilities recently calculated by Morton et al. (2016) for each of the cand...

  15. Bimodal Networks as Candidates for Electroactive Polymers

    DEFF Research Database (Denmark)

    Bahrt, Frederikke; Daugaard, Anders Egede; Bejenariu, Anca Gabriela;

    An alternative network formulation method was adopted in order to obtain a different type of silicone based elastomeric systems - the so-called bimodal networks - using two vinyl-terminated polydimethyl siloxanes (PDMS) of different molecular weight, a labelled crosslinker (3 or 4-functional), an...

  16. The influence of high-energy electrons irradiation on the electrical properties of Schottky barrier detectors based on semi-insulating GaAs

    Science.gov (United States)

    Zatko, B.; Sagatova, A.; Bohacek, P.; Sedlackova, K.; Sekacová, M.; Arbet, J.; Necas, V.

    2016-01-01

    In this work we fabricated detectors based on semi-insulating GaAs and studied their electrical properties (current-voltage characteristics, galvanomagnetic measurements) after irradiation with 5 MeV electrons from a linear accelerator up to a dose of 104 kGy. A series of detectors were prepared using Ti/Pt/Au Schottky contact with 1 mm diameter. The thickness of the base material was about 230 μm. A whole area Ni/AuGe/Au ohmic contact was evaporated on the back side. For galvanomagnetic measurements we used three samples from the same wafer. All samples were irradiated by a pulse beam of 5 MeV electrons using the linear accelerator in 11 steps, where the accumulative dose increased from 1 kGy up to 104 kGy. Also different dose rates (20, 40 and 80 kGy/h) were applied to the samples. After each irradiation step we performed electrical measurement of each sample. We analyze the electron Hall mobility, resistivity, electron Hall concentration, breakdown voltage and reverse current of samples before and after irradiation using different dose rates.

  17. Halo Stream candidates in the LAMOST DR2

    Science.gov (United States)

    Zhao, Jingkun

    2015-08-01

    We have detected eight stellar halo stream candidates in the solar neighborhood using a sample including 64,819 FGK metal-poor ([Fe/H] match among the LAMOST DR2, WISE, 2MASS and PPMXL catalogues. With the strategy of halo stream detection in Klement et al, several significant ‘phase-space overdensi- ties” of stars on very similar orbits are identified. Three structures are known previously. Five new halo stream candidates are also found. The kinematics and metallicity of these stream candidates are then analyzed. Detailed element abundance are needed to better know the ori-gin of these streams.

  18. Face Time: Educating Face Transplant Candidates

    OpenAIRE

    Lamparello, Brooke M.; Bueno, Ericka M.; Diaz-Siso, Jesus Rodrigo; Sisk, Geoffroy C.; Pomahac, Bohdan

    2013-01-01

    Objective: Face transplantation is the innovative application of microsurgery and immunology to restore appearance and function to those with severe facial disfigurements. Our group aims to establish a multidisciplinary education program that can facilitate informed consent and build a strong knowledge base in patients to enhance adherence to medication regimes, recovery, and quality of life. Methods: We analyzed handbooks from our institution's solid organ transplant programs to identify top...

  19. AN EVALUATION OF THE VIEWS OF TEACHER CANDIDATES ON THE DEVELOPMENT OF A CONSTRUCTIVIST LEARNING BASED CURRICULUM YAPILANDIRMACI ÖĞRENME TEMELLİ BİR ÖĞRETİM PROGRAMININ OLUŞTURULMASINA İLİŞKİN ÖĞRETMEN ADAYLARININ GÖRÜŞLERİNİN DEĞERLENDİRİLMESİ

    Directory of Open Access Journals (Sweden)

    Etem YEŞİLYURT

    2011-12-01

    Full Text Available The aim of this qualitative study is to evaluate the views of teachercandidates on the development of a constructivist learning basedcurriculum. In line with this main purpose, the views of teachercandidates on the identification of objectives, development of content,organization of learning situations and implementation of testingsituations were evaluated in the study. The study group comprised 39teacher candidates attending the last year of the Class TeacherEducation program of Fırat University Education Faculty during the2009-2010 academic year. Data obtained by semi-structured interviewforms were analyzed by using the content analysis method on NVivo 8qualitative data analysis software. The findings of the study showed thatteacher candidates were knowledgeable about the identification ofconstructivist learning based curriculum objectives, development of content, organization of learning situations and implementation of testingsituations. Nitel araştırma yöntemi kullanılarak yapılan bu çalışmanın amacı,yapılandırmacı öğrenme temelli bir öğretim programının oluşturulmasınailişkin öğretmen adaylarının görüşlerini değerlendirmektir. Bu genelamaç doğrultusunda hedeflerin nasıl belirlenmesi, içeriğin nasıloluşturulması, eğitim durumlarının nasıl düzenlenmesi ve sınamadurumlarının nasıl yapılması gerektiğine yönelik öğretmen adaylarınıngörüşlerinin değerlendirilmesi çalışma kapsamında ele alınmıştır.Araştırmanın çalışma grubunu, 2009–2010 akademik yılında FıratÜniversitesi Eğitim Fakültesi Sınıf Öğretmenliği programı son sınıftaöğrenim gören 39 öğretmen adayı oluşturmaktadır. Yarı yapılandırılmışgörüşme formuyla elde edilen veriler NVivo 8 nitel veri analizi programıkullanılarak içerik analizi yöntemiyle çözümlenmiştir. Araştırmadan eldeedilen bulgulara bakıldığında, yapılandırmacı öğrenme temelli bir

  20. Planet Hunters VI: The First Kepler Seven Planet Candidate System and 13 Other Planet Candidates from the Kepler Archival Data

    CERN Document Server

    Schmitt, Joseph R; Fischer, Debra A; Jek, Kian J; Moriarty, John C; Boyajian, Tabetha S; Schwamb, Megan E; Lintott, Chris; Smith, Arfon M; Parrish, Michael; Schawinski, Kevin; Lynn, Stuart; Simpson, Robert; Omohundro, Mark; Winarski, Troy; Goodman, Samuel J; Jebson, Tony; Lacourse, Daryll

    2013-01-01

    We report the discovery of 14 new transiting planet candidates in the Kepler field from the Planet Hunters citizen science program. None of these candidates overlap with Kepler Objects of Interest (KOIs), and five of the candidates were missed by the Kepler Transit Planet Search (TPS) algorithm. The new candidates have periods ranging from 124-904 days, eight residing in their host star's habitable zone (HZ) and two (now) in multiple planet systems. We report the discovery of one more addition to the six planet candidate system around KOI-351, marking the first seven planet candidate system from Kepler. Additionally, KOI-351 bears some resemblance to our own solar system, with the inner five planets ranging from Earth to mini-Neptune radii and the outer planets being gas giants; however, this system is very compact, with all seven planet candidates orbiting $\\lesssim 1$ AU from their host star. We perform a numerical integration of the orbits and show that the system remains stable for over 100 million years....

  1. Improving initial polyp candidate extraction for CT colonography

    Science.gov (United States)

    Zhu, Hongbin; Fan, Yi; Lu, Hongbing; Liang, Zhengrong

    2010-04-01

    Reducing the number of false positives (FPs) as much as possible is a challenging task for computer-aided detection (CAD) of colonic polyps. As part of a typical CAD pipeline, an accurate and robust process for segmenting initial polyp candidates (IPCs) will significantly benefit the successive FP reduction procedures, such as feature-based classification of false and true positives (TPs). In this study, we introduce an improved scheme for segmenting IPCs. It consists of two main components. One is geodesic distance-based merging, which merges suspicious patches (SPs) for IPCs. Based on the merged SPs, another component, called convex dilation, grows each SP beyond the inner surface of the colon wall to form a volume of interest (VOI) for that IPC, so that the inner border of the VOI beyond the colon inner surface could be segmented as convex, as expected. The IPC segmentation strategy was evaluated using a database of 50 patient studies, which include 100 scans at supine and prone positions with 84 polyps and masses sized from 6 to 35 mm. The presented IPC segmentation strategy (or VOI extraction method) demonstrated improvements, in terms of having no undesirably merged true polyp and providing more helpful mean and variance of the image intensities rooted from the extracted VOI for classification of the TPs and FPs, over two other VOI extraction methods (i.e. the conventional method of Nappi and Yoshida (2003 Med. Phys. 30 1592-601) and our previous method (Zhu et al 2009 Cancer Manag. Res. 1 1-13). At a by-polyp sensitivity of 0.90, these three methods generated the FP rate (number of FPs per scan) of 4.78 (new method), 6.37 (Nappi) and 7.01 (Zhu) respectively.

  2. Identification of Schistosoma mansoni candidate antigens for diagnosis of schistosomiasis

    Directory of Open Access Journals (Sweden)

    Gardenia Braz Figueiredo Carvalho

    2011-11-01

    Full Text Available The development of a more sensitive diagnostic test for schistosomiasis is needed to overcome the limitations of the use of stool examination in low endemic areas. Using parasite antigens in enzyme linked immunosorbent assay is a promising strategy, however a more rational selection of parasite antigens is necessary. In this study we performed in silico analysis of the Schistosoma mansoni genome, using SchistoDB database and bioinformatic tools for screening immunogenic antigens. Based on evidence of expression in all parasite life stage within the definitive host, extracellular or plasmatic membrane localization, low similarity to human and other helminthic proteins and presence of predicted B cell epitopes, six candidates were selected: a glycosylphosphatidylinositol-anchored 200 kDa protein, two putative cytochrome oxidase subunits, two expressed proteins and one hypothetical protein. The recognition in unidimensional and bidimensional Western blot of protein with similar molecular weight and isoelectric point to the selected antigens by sera from S. mansoni infected mice indicate a good correlation between these two approaches in selecting immunogenic proteins.

  3. Factors influencing Turkish teacher candidates' elective course preferences

    Directory of Open Access Journals (Sweden)

    Duygu Uçgun

    2012-10-01

    Full Text Available By the Academic Year of 2006-2007, new curriculum has been begun to be applied in the Faculties of Education. When it is evaluated in terms of Turkish Language Teacher Training Departments, it is seen that the most attractive changes are the abolition of Side Branch application, the increase in the number of the courses which will contribute to teacher candidates’ profession and the enrichment in the content. In the curriculum are 5 elective courses beside necessary ones. The aim of this study is to determine what and how much effects the Turkish Language Teacher Candidates as they decide on the courses mentioned above. In the study, based on scanning method, of which subject is consists of 2nd, 3rd and 4th year students from Turkish Language Teacher Training Department, The Faculty of Education of Nigde University Likert-type Scale with four grades which was improved by Tezcan and Gumus (2008 has been used as data collection tool. According to the finding acquired from the study the factors effecting Turkish Language Teacher Candidates’ preferences about elective courses have been determined and ideas which are going to contribute to determination of elective courses and effective process of them have been suggested.

  4. Candidate glutamatergic neurons in the visual system of Drosophila.

    Directory of Open Access Journals (Sweden)

    Shamprasad Varija Raghu

    Full Text Available The visual system of Drosophila contains approximately 60,000 neurons that are organized in parallel, retinotopically arranged columns. A large number of these neurons have been characterized in great anatomical detail. However, studies providing direct evidence for synaptic signaling and the neurotransmitter used by individual neurons are relatively sparse. Here we present a first layout of neurons in the Drosophila visual system that likely release glutamate as their major neurotransmitter. We identified 33 different types of neurons of the lamina, medulla, lobula and lobula plate. Based on the previous Golgi-staining analysis, the identified neurons are further classified into 16 major subgroups representing lamina monopolar (L, transmedullary (Tm, transmedullary Y (TmY, Y, medulla intrinsic (Mi, Mt, Pm, Dm, Mi Am, bushy T (T, translobula plate (Tlp, lobula intrinsic (Lcn, Lt, Li, lobula plate tangential (LPTCs and lobula plate intrinsic (LPi cell types. In addition, we found 11 cell types that were not described by the previous Golgi analysis. This classification of candidate glutamatergic neurons fosters the future neurogenetic dissection of information processing in circuits of the fly visual system.

  5. Photometry of some neglected bright cataclysmic variables and candidates

    CERN Document Server

    Bruch, Albert

    2016-01-01

    As part of an effort to better characterize bright cataclysmic variables (CVs) which have received little attention in the past light curves of four confirmed systems (CZ Aql, BO Cet, V380 Oph and EF Tuc) and one candidate (Lib 3) are analyzed. For none of these stars time resolved photometry has been published previously. While no variability was found in the case of Lib 3, which thus cannot be confirmed as a CV, the light curves of all other targets are dominated by strong flickering. Modulations on hourly time scales superimposed on the flickering can probably be related to orbital variations in BO Cet and V380 Oph, but not in CZ Aql and EF Tuc. Variations on the time scale of 10 minutes in CZ Aql, while not yet constituting convincing evidence, together with previous suspicions of a magnetically channeled accretion flow may point at an intermediate polar nature of this star. Some properties of the flickering are quantified in an effort to enlarge the data base for future comparative flickering studies in ...

  6. Lap Shear Testing of Candidate Radiator Panel Adhesives

    Science.gov (United States)

    Ellis, David; Briggs, Maxwell; McGowan, Randy

    2013-01-01

    During testing of a subscale radiator section used to develop manufacturing techniques for a full-scale radiator panel, the adhesive bonds between the titanium heat pipes and the aluminum face sheets failed during installation and operation. Analysis revealed that the thermal expansion mismatch between the two metals resulted in relatively large shear stresses being developed even when operating the radiator at moderate temperatures. Lap shear testing of the adhesive used in the original joints demonstrated that the two-part epoxy adhesive fell far short of the strength required. A literature review resulted in several candidate adhesives being selected for lap shear joint testing at room temperature and 398 K, the nominal radiator operating temperature. The results showed that two-part epoxies cured at room and elevated temperatures generally did not perform well. Epoxy film adhesives cured at elevated temperatures, on the other hand, did very well with most being sufficiently strong to cause yielding in the titanium sheet used for the joints. The use of an epoxy primer generally improved the strength of the joint. Based upon these results, a new adhesive was selected for the second subscale radiator section.

  7. Humans Need Not Apply: Robotization of Kepler Planet Candidate Vetting

    Science.gov (United States)

    Coughlin, Jeffrey; Mullally, Fergal; Thompson, Susan E.; Kepler Team

    2015-01-01

    Until now, the vast majority of Kepler planet candidate vetting has been performed by a dedicated team of humans. While human expertise has been invaluable in understanding the nuances of Kepler data, human vetting is very time-consuming and can be inconsistent. Over 20,000 threshold crossing events have been produced by the latest pipeline run on all 17 quarters of Kepler mission data, and many more artificial planet transits have been injected to estimate completeness. Given these large numbers, human vetting is no longer feasible on a reasonable time-scale, and would be difficult to characterize. We have created automated vetting programs known as "robovetters" that are specifically designed to mimic the decision-making process employed by the humans. They analyze both the light curve and pixel-level data in order to produce specific reasons for identifying false positives. We present benchmark tests on the Q1-Q16 Kepler planet catalog, which was vetted by humans, and present preliminary robovetter results based on a recent transit-search of the newly reprocessed Q1-Q17 data set.

  8. Blazar candidates beyond redshift 4 observed with GROND

    CERN Document Server

    Sbarrato, T; Nardini, M; Tagliaferri, G; Greiner, J; Rau, A; Schady, P

    2013-01-01

    The search for extremely massive high redshift blazars is essential to put strong constraints on the supermassive black holes formation theories. Up to now, the few blazars known to have a redshift larger than 4 have been discovered serendipitously. We try a more systematic approach. Assuming radio-loudness as a proxy for the jet orientation, we select a sample of extremely radio-loud quasars. We measure their black hole masses with a method based on fitting the thermal emission from the accretion disc. We achieve a precision of a factor of two for our measures, thanks to the observations performed with the Gamma-Ray Burst Optical Near-Infrared Detector (GROND). The infrared to optical GROND data allow us to observe directly the peak of the disc emission, thus constraining the overall disc luminosity. We obtain a small range of masses, that peaks at 10^{9.3}Msun. If some of our candidates will be confirmed as blazars, these results would introduce interesting constraints on the mass function of extremely mass...

  9. Architecture and Dynamics of Kepler's Candidate Multiple Transiting Planet Systems

    CERN Document Server

    Lissauer, Jack J; Fabrycky, Daniel C; Batalha, Natalie M; Borucki, William J; Bryson, Stephen T; Caldwell, Douglas A; Dunham, Edward W; Ford, Eric B; Fortney, Jonathan J; Gautier, Thomas N; Holman, Matthew J; Jenkins, Jon M; Koch, David G; Latham, David W; Marcy, Geoffrey W; Morehead, Robert; Rowe, Jason; Quintana, Elisa V; Sasselov, Dimitar; Shporer, Avi; Steffen, Jason H

    2011-01-01

    Borucki et al. 2011 (ApJ, submitted) report on characteristics of over 1200 candidate transiting planets orbiting nearly 1000 Kepler spacecraft target stars detected in the first four months of spacecraft data. Included among these targets are 115 targets with two transiting planet candidates, 45 targets with three, 8 with four, and one each with five and six sets of transit signatures. We characterize herein the dynamical properties of these candidate multi-planet systems. We find that virtually all systems are stable, as tested by numerical integration assuming a mass-radius relationship. The distribution of observed period ratios is also clustered just outside resonances, particularly the 2:1 resonance. Neither of these characteristics would emerge if the systems were significantly contaminated with false positives, and these combined with other considerations strongly suggest that the majority of these multi-candidate systems are true planetary systems. Using the observed multiplicity frequencies (e.g., t...

  10. Spectroscopy of candidate electromagnetic counterparts to gravitational wave sources

    CERN Document Server

    Steele, Iain A; Piascik, Andrzej S

    2016-01-01

    A programme of worldwide, multi-wavelength electromagnetic follow-up of sources detected by gravitational wave detectors is in place. Following the discovery of GW150914 and GW151226, wide field imaging of their sky localisations identified a number of candidate optical counterparts which were then spectrally classified. The majority of candidates were found to be supernovae at redshift ranges similar to the GW events and were thereby ruled out as a genuine counterpart. Other candidates ruled out include AGN and solar system objects. Given the GW sources were black hole binary mergers, the lack of an identified electromagnetic counterpart is not surprising. However the observations show that is it is possible to organise and execute a campaign that can eliminate the majority of potential counterparts. Finally we note the existence of a "classification gap" with a significant fraction of candidates going unclassified.

  11. Value-Added Measures of Teacher Candidates' Dispositions

    Science.gov (United States)

    Cosgrove, Maryellen; Carpenter, Barbara

    2012-01-01

    This article describes how a teacher preparation program can positively impact professional dispositions. Pre and post essays from a sample of sixty candidates were qualitatively analyzed to determine the value-added growth of their professional dispositions.

  12. 11 CFR 100.148 - Volunteer activity for candidate.

    Science.gov (United States)

    2010-01-01

    ..., magazines, billboards, direct mail or similar types of general public communication or political advertising... developed by the candidate. But see 11 CFR 100.24, 104.17(a), and part 300, subparts D and E for...

  13. 11 CFR 100.88 - Volunteer activity for candidates.

    Science.gov (United States)

    2010-01-01

    ..., billboards, direct mail or similar types of general public communication or political advertising. (b) The... developed by the candidate. But see 11 CFR 100.24, 104.17(a), and part 300, subparts D and E for...

  14. Resolved Companions of Cepheids: Testing the Candidates with X-Ray Observations

    Science.gov (United States)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Mason, Brian D.

    2016-04-01

    We have made XMM-Newton observations of 14 Galactic Cepheids that have candidate resolved (≥5″) companion stars based on our earlier HST Wide Field Camera 3 (WFC3) imaging survey. Main-sequence stars that are young enough to be physical companions of Cepheids are expected to be strong X-ray producers in contrast to field stars. XMM-Newton exposures were set to detect essentially all companions hotter than spectral type M0 (corresponding to 0.5 M⊙). The large majority of our candidate companions were not detected in X-rays, and hence are not confirmed as young companions. One resolved candidate (S Nor #4) was unambiguously detected, but the Cepheid is a member of a populous cluster. For this reason, it is likely that S Nor #4 is a cluster member rather than a gravitationally bound companion. Two further Cepheids (S Mus and R Cru) have X-ray emission that might be produced by either the Cepheid or the candidate resolved companion. A subsequent Chandra observation of S Mus shows that the X-rays are at the location of the Cepheid/spectroscopic binary. R Cru and also V659 Cen (also X-ray bright) have possible companions closer than 5″ (the limit for this study) which are the likely sources of X-rays. One final X-ray detection (V473 Lyr) has no known optical companion, so the prime suspect is the Cepheid itself. It is a unique Cepheid with a variable amplitude. The 14 stars that we observed with XMM constitute 36% of the 39 Cepheids found to have candidate companions in our HST/WFC3 optical survey. No young probable binary companions were found with separations of ≥5″ or 4000 au. Based on observations obtained with XMM-Newton, an ESA science mission with instruments and contributions directly funded by ESA Member States and the USA (NASA).

  15. New planetary and eclipsing binary candidates from campaigns 1-6 of the K2 mission

    Science.gov (United States)

    Barros, S. C. C.; Demangeon, O.; Deleuil, M.

    2016-10-01

    Context. With only two functional reaction wheels, Kepler cannot maintain stable pointing at its original target field and has entered a new mode of observation called K2. Aims: We describe a new pipeline to reduce K2 pixel files into light curves that are later searched for transit like features. Methods: Our method is based on many years of experience in planet hunting for the CoRoT mission. Owing to the unstable pointing, K2 light curves present systematics that are correlated with the target position in the charge coupled device (CCD). Therefore, our pipeline also includes a decorrelation of this systematic noise. Our pipeline is optimised for bright stars for which spectroscopic follow-up is possible. We achieve a maximum precision on 6 hours of 6 ppm. The decorrelated light curves are searched for transits with an adapted version of the CoRoT alarm pipeline. Results: We present 172 planetary candidates and 327 eclipsing binary candidates from campaigns 1, 2, 3, 4, 5, and 6 of K2. Both the planetary candidates and eclipsing binary candidates lists are made public to promote follow-up studies. The light curves will also be available to the community. Full Tables A.1 and A.2 are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/594/A100

  16. Planetary Candidates Observed by Kepler IV: Planet Sample From Q1-Q8 (22 Months)

    CERN Document Server

    Burke, Christopher J; Mullally, F; Rowe, Jason F; Christiansen, Jessie L; Thompson, Susan E; Coughlin, Jeffrey L; Haas, Michael R; Batalha, Natalie M; Caldwell, Douglas A; Jenkins, Jon M; Still, Martin; Barclay, Thomas; Borucki, William J; Chaplin, William J; Ciardi, David R; Clarke, Bruce D; Cochran, William D; Demory, Brice-Olivier; Esquerdo, Gilbert A; Gautier, Thomas N; Gilliland, Ronald L; Girouard, Forrest R; Havel, Mathieu; Henze, Christopher E; Howell, Steve B; Huber, Daniel; Latham, David W; Li, Jie; Morehead, Robert C; Morton, Timothy D; Pepper, Joshua; Quintana, Elisa; Ragozzine, Darin; Seader, Shawn E; Shah, Yash; Shporer, Avi; Tenenbaum, Peter; Twicken, Joseph D; Wolfgang, Angie

    2013-01-01

    We provide updates to the Kepler planet candidate sample based upon nearly two years of high-precision photometry (i.e., Q1-Q8). From an initial list of nearly 13,400 Threshold Crossing Events (TCEs), 480 new host stars are identified from their flux time series as consistent with hosting transiting planets. Potential transit signals are subjected to further analysis using the pixel-level data, which allows background eclipsing binaries to be identified through small image position shifts during transit. We also re-evaluate Kepler Objects of Interest (KOI) 1-1609, which were identified early in the mission, using substantially more data to test for background false positives and to find additional multiple systems. Combining the new and previous KOI samples, we provide updated parameters for 2,738 Kepler planet candidates distributed across 2,017 host stars. From the combined Kepler planet candidates, 472 are new from the Q1-Q8 data examined in this study. The new Kepler planet candidates represent ~40% of th...

  17. An independent test of the photometric selection of white dwarf candidates using LAMOST DR3

    CERN Document Server

    Fusillo, N P Gentile; Gänsicke, B T; Liu, X -W; Ren, J J; Koester, D; Zhan, Y; Hou, Y; Wang, Y; Yang, M

    2015-01-01

    In Gentile Fusillo et al. (2015) we developed a selection method for white dwarf candidates which makes use of photometry, colours and proper motions to calculate a probability of being a white dwarf (Pwd). The application of our method to the Sloan Digital Sky Survey (SDSS) data release 10 resulted in nearly 66,000 photometrically selected objects with a derived Pwd, approximately 21000 of which are high confidence white dwarf candidates. Here we present an independent test of our selection method based on a sample of spectroscopically confirmed white dwarfs from the LAMOST (Large Sky Area Multi-Fiber Spectroscopic Telescope) survey. We do this by cross matching all our $\\sim$66,000 SDSS photometric white dwarf candidates with the over 4 million spectra available in the third data release of LAMOST. This results in 1673 white dwarf candidates with no previous SDSS spectroscopy, but with available LAMOST spectra. Among these objects we identify 309 genuine white dwarfs. We find that our Pwd can efficiently di...

  18. Resolved Companions of Cepheids: Testing the Candidates with X-Ray Observations

    CERN Document Server

    Evans, Nancy Remage; Wolk, Scott; Karovska, Margarita; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E; Schaefer, Gail H; Mason, Brian D

    2016-01-01

    We have made {\\it XMM-Newton\\/} observations of 14 Galactic Cepheids that have candidate resolved ($\\geq$5$\\arcsec$) companion stars based on our earlier {\\it HST\\/} WFC3 imaging survey. Main-sequence stars that are young enough to be physical companions of Cepheids are expected to be strong X-ray producers in contrast to field stars. {\\it XMM-Newton\\/} exposures were set to detect essentially all companions hotter than spectral type M0 (corresponding to 0.5 $ M_\\odot$.) The large majority of our candidate companions were not detected in X-rays, and hence are not confirmed as young companions. One resolved candidate (S~Nor \\#4) was unambiguously detected, but the Cepheid is a member of a populous cluster. For this reason, it is likely that S~Nor \\#4 is a cluster member rather than a gravitationally bound companion. Two further Cepheids (S~Mus and R~Cru) have X-ray emission that might be produced by either the Cepheid or the candidate resolved companion. A subsequent {\\it Chandra} observation of S Mus shows th...

  19. Drug repurposing: a systematic approach to evaluate candidate oral neuroprotective interventions for secondary progressive multiple sclerosis.

    Directory of Open Access Journals (Sweden)

    Hanna M Vesterinen

    Full Text Available To develop and implement an evidence based framework to select, from drugs already licenced, candidate oral neuroprotective drugs to be tested in secondary progressive multiple sclerosis.Systematic review of clinical studies of oral putative neuroprotective therapies in MS and four other neurodegenerative diseases with shared pathological features, followed by systematic review and meta-analyses of the in vivo experimental data for those interventions. We presented summary data to an international multi-disciplinary committee, which assessed each drug in turn using pre-specified criteria including consideration of mechanism of action.We identified a short list of fifty-two candidate interventions. After review of all clinical and pre-clinical evidence we identified ibudilast, riluzole, amiloride, pirfenidone, fluoxetine, oxcarbazepine, and the polyunsaturated fatty-acid class (Linoleic Acid, Lipoic acid; Omega-3 fatty acid, Max EPA oil as lead candidates for clinical evaluation.We demonstrate a standardised and systematic approach to candidate identification for drug rescue and repurposing trials that can be applied widely to neurodegenerative disorders.

  20. New planetary and EB candidates from Campaigns 1-6 of the K2 mission

    CERN Document Server

    Barros, S C C; Deleuil, M

    2016-01-01

    With only two functional reaction wheels, Kepler cannot maintain stable pointing at its original target field and entered a new mode of observation called K2. Our method is based on many years of experience in planet hunting for the CoRoT mission. Due to the unstable pointing, K2 light curves present systematics that are correlated with the target position in the CCD. Therefore, our pipeline also includes a decorrelation of this systematic noise. Our pipeline is optimised for bright stars for which spectroscopic follow-up is possible. We achieve a maximum precision on 6 hours of 6 ppm. The decorrelated light curves are searched for transits with an adapted version of the CoRoT alarm pipeline. We present 172 planetary candidates and 327 eclipsing binary candidates from campaigns 1, 2, 3, 4, 5 and 6 of K2. Both the planetary candidates and eclipsing binary candidates lists are made public to promote follow-up studies. The light curves will also be available to the community.

  1. Vote Choice, Ideology, and Social Dominance Orientation Influence Preferences for Lower Pitched Voices in Political Candidates

    Directory of Open Access Journals (Sweden)

    Lasse Laustsen

    2015-08-01

    Full Text Available Humans are equipped with a psychological system of followership that evolved to regulate choices of leaders based partly on would-be leaders’ physiological features. One such feature is voice pitch, which is determined by the physiology of the throat. Recent studies find that political candidates in modern elections with lower-pitched voices are generally more successful. As lower-pitched voices are perceived as stronger and more dominant, these findings have been taken to indicate a general preference for dispositional abilities in leaders to protect and prevail in conflicts. Here we extend upon these findings by demonstrating that conservatives and Republicans tend to view the world as much more competitive and threatening than liberals and Democrats. We utilize two existing data sources to show that political candidates with lower-pitched voices are preferred more among conservative Republicans than among liberal Democrats. In a third study we show that preferences for lower-pitched candidate voices stem from individual differences in Social Dominance Orientation (SDO. Importantly, across all three studies subjects’ party affiliation, ideology, and SDO only predict preferences for male candidate voices. We conclude with a discussion of the results in relation to followership psychology and general debates on the rationality of the public with respect to elections.

  2. Syndrome to gene (S2G): in-silico identification of candidate genes for human diseases.

    Science.gov (United States)

    Gefen, Avitan; Cohen, Raphael; Birk, Ohad S

    2010-03-01

    The identification of genomic loci associated with human genetic syndromes has been significantly facilitated through the generation of high density SNP arrays. However, optimal selection of candidate genes from within such loci is still a tedious labor-intensive bottleneck. Syndrome to Gene (S2G) is based on novel algorithms which allow an efficient search for candidate genes in a genomic locus, using known genes whose defects cause phenotypically similar syndromes. S2G (http://fohs.bgu.ac.il/s2g/index.html) includes two components: a phenotype Online Mendelian Inheritance in Man (OMIM)-based search engine that alleviates many of the problems in the existing OMIM search engine (negation phrases, overlapping terms, etc.). The second component is a gene prioritizing engine that uses a novel algorithm to integrate information from 18 databases. When the detailed phenotype of a syndrome is inserted to the web-based software, S2G offers a complete improved search of the OMIM database for similar syndromes. The software then prioritizes a list of genes from within a genomic locus, based on their association with genes whose defects are known to underlie similar clinical syndromes. We demonstrate that in all 30 cases of novel disease genes identified in the past year, the disease gene was within the top 20% of candidate genes predicted by S2G, and in most cases--within the top 10%. Thus, S2G provides clinicians with an efficient tool for diagnosis and researchers with a candidate gene prediction tool based on phenotypic data and a wide range of gene data resources. S2G can also serve in studies of polygenic diseases, and in finding interacting molecules for any gene of choice.

  3. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    International Nuclear Information System (INIS)

    Three copper-based alloys, CDA 102 (oxygen-free copper), CDA 613 (Cu-7Al), and CDA 715 (Cu-30Ni), are being considered along with three austenitic candidates as possible materials for fabrication of containers for disposal of high-level radioactive waste. The waste will include spent fuel assemblies from reactors as well as high-level reprocessing wastes in borosilicate glass and will be sent to the prospective repository at Yucca Mountain, Nevada, for disposal. The containers must maintain mechanical integrity for 50 yr after emplacement to allow for retrieval of waste during the preclosure phase of repository operation. Containment is required to be substantially complete for up to 300 to 1000 yr. During the early period, the containers will be exposed to high temperatures and high gamma radiation fields from the decay of high-level waste. The final closure joint will be critical to the integrity of the containers. This volume surveys the available data on the metallurgy of the copper-based candidate alloys and the welding techniques employed to join these materials. The focus of this volume is on the methods applicable to remote-handling procedures in a hot-cell environment with limited possibility of postweld heat treatment. The three copper-based candidates are ranked on the basis of the various closure techniques. On the basis of considerations regarding welding, the following ranking is proposed for the copper-based alloys: CDA 715 (best) > CDA 102 > CDA 613 (worst). 49 refs., 15 figs., 1 tab

  4. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    Energy Technology Data Exchange (ETDEWEB)

    Bullen, D.B.; Gdowski, G.E. (Science and Engineering Associates, Inc., Pleasanton, CA (USA)); Weiss, H. (Lawrence Livermore National Lab., CA (USA))

    1988-06-01

    Three copper-based alloys, CDA 102 (oxygen-free copper), CDA 613 (Cu-7Al), and CDA 715 (Cu-30Ni), are being considered along with three austenitic candidates as possible materials for fabrication of containers for disposal of high-level radioactive waste. The waste will include spent fuel assemblies from reactors as well as high-level reprocessing wastes in borosilicate glass and will be sent to the prospective repository at Yucca Mountain, Nevada, for disposal. The containers must maintain mechanical integrity for 50 yr after emplacement to allow for retrieval of waste during the preclosure phase of repository operation. Containment is required to be substantially complete for up to 300 to 1000 yr. During the early period, the containers will be exposed to high temperatures and high gamma radiation fields from the decay of high-level waste. The final closure joint will be critical to the integrity of the containers. This volume surveys the available data on the metallurgy of the copper-based candidate alloys and the welding techniques employed to join these materials. The focus of this volume is on the methods applicable to remote-handling procedures in a hot-cell environment with limited possibility of postweld heat treatment. The three copper-based candidates are ranked on the basis of the various closure techniques. On the basis of considerations regarding welding, the following ranking is proposed for the copper-based alloys: CDA 715 (best) > CDA 102 > CDA 613 (worst). 49 refs., 15 figs., 1 tab.

  5. An all-sky support vector machine selection of WISE YSO candidates

    Science.gov (United States)

    Marton, G.; Tóth, L. V.; Paladini, R.; Kun, M.; Zahorecz, S.; McGehee, P.; Kiss, Cs.

    2016-06-01

    We explored the AllWISE catalogue of the Wide-field Infrared Survey Explorer (WISE) mission and identified Young Stellar Object (YSO) candidates. Reliable 2MASS and WISE photometric data combined with Planck dust opacity values were used to build our data set and to find the best classification scheme. A sophisticated statistical method, the support vector machine (SVM) is used to analyse the multidimensional data space and to remove source types identified as contaminants (extragalactic sources, main-sequence stars, evolved stars and sources related to the interstellar medium). Objects listed in the SIMBAD data base are used to identify the already known sources and to train our method. A new all-sky selection of 133 980 Class I/II YSO candidates is presented. The estimated contamination was found to be well below 1 per cent based on comparison with our SIMBAD training set. We also compare our results to that of existing methods and catalogues. The SVM selection process successfully identified >90 per cent of the Class I/II YSOs based on comparison with photometric and spectroscopic YSO catalogues. Our conclusion is that by using the SVM, our classification is able to identify more known YSOs of the training sample than other methods based on colour-colour and magnitude-colour selection. The distribution of the YSO candidates well correlates with that of the Planck Galactic Cold Clumps in the Taurus-Auriga-Perseus-California region.

  6. How Black Are Black Hole Candidates?

    CERN Document Server

    Robertson, S L; Robertson, Stanley L.; Leiter, Darryl J.

    2002-01-01

    In previous work we found that many of the spectral properties of x-ray binaries, including both galactic black hole candiates (GBHC) and neutron stars, were consistent with the existence of intrinsically magnetized central objects. Here we review and extend the observational evidence for the existence of intrinsically magnetized GBHC and show that their existence is consistent with a new class of solutions of the Einstein field equations of General Relativity. These solutions are based on a strict adherence to the Principle of Equivalence, which prevents the time-like geodesics of physical matter from becoming null on trapped surfaces of infinite red shift. The new solutions emerge from the fact that the structure and radiation transfer properties of the energy-momentum tensor on the right hand side of the Einstein field equations must have a form that is consistent with this Principle of Equivalence requirement. In this context, we show that the Einstein field equations allow the existence of highly red shi...

  7. A Natural Vaccine Candidate Strain Against Cholera

    Institute of Scientific and Technical Information of China (English)

    LIUYAN-QING; QIGUO-MING; 等

    1995-01-01

    El Tor Vibrio cholerae(EVC)strains may be classified into two kinds-epidemigenic(EEVC)strains and non-epidemigenic(NEEVC)strains-based on a phage-biotyping system.A large number of EEVC strains have been screened for toxigenic and putative colonization attributes.One such naturally occurring strain(designated IEM101)has been found which is devoid of genes encoding cholera toxin(CT),accessory cholera enterotoxin(ACE),zonula occludens toxin(ZOT),but possesses RS1 sequences and toixn-coregulated pilus A gene(tcpA)although tcpA is poorly expressed.It expresses type B pili but does not posses type C pili.It is an El Tor Ogawa strain and does not cause fluid accumulation in rabbit ileal loop tests.Active immunization of rabbits with strain IEM101 elicited good protection against challenge with virulent strains of V.cholerae Ol.Oral administration cased no side effects in 15 human volunteers.colonized the gut for four to ten days and elicited good immune responses.

  8. Promising Therapy Candidates for Liver Fibrosis

    Directory of Open Access Journals (Sweden)

    Ping eWang

    2016-02-01

    Full Text Available Liver fibrosis is a wound-healing process in response to repeated and chronic injury to hepatocytes and/or cholangiocytes. Ongoing hepatocyte apoptosis or necrosis lead to increase in ROS production and decrease in antioxidant activity, which recruits inflammatory cells from the blood and activate hepatic stellate cells changing to myofibroblasts. Injury to cholangiocytes also recruits inflammatory cells to the liver and activates portal fibroblasts in the portal area, which release molecules to activate and amplify cholangiocytes. No matter what origin of myofibroblasts, either hepatic stellate cells or portal fibroblasts, they share similar characteristics, including being positive for -smooth muscle actin and sproducing extra cellular matrix. Based on the extensive pathogenesis knowledge of liver fibrosis, therapeutic strategies have been designed to target each step of this process, including hepatocyte apoptosis, cholangiocyte proliferation, inflammation, and activation of myofibroblasts to deposit extracellular matrix, yet the current therapies are still in early-phase clinical development. There is an urgent need to translate the molecular mechanism of liver fibrosis to effective and potent reagents or therapies in human.

  9. Identifying disease candidate genes via large-scale gene network analysis.

    Science.gov (United States)

    Kim, Haseong; Park, Taesung; Gelenbe, Erol

    2014-01-01

    Gene Regulatory Networks (GRN) provide systematic views of complex living systems, offering reliable and large-scale GRNs to identify disease candidate genes. A reverse engineering technique, Bayesian Model Averaging-based Networks (BMAnet), which ensembles all appropriate linear models to tackle uncertainty in model selection that integrates heterogeneous biological data sets is introduced. Using network evaluation metrics, we compare the networks that are thus identified. The metric 'Random walk with restart (Rwr)' is utilised to search for disease genes. In a simulation our method shows better performance than elastic-net and Gaussian graphical models, but topological quantities vary among the three methods. Using real-data, brain tumour gene expression samples consisting of non-tumour, grade III and grade IV are analysed to estimate networks with a total of 4422 genes. Based on these networks, 169 brain tumour-related candidate genes were identified and some were found to relate to 'wound', 'apoptosis', and 'cell death' processes. PMID:25796737

  10. Robo-AO Kepler Planetary Candidate Survey III: Adaptive Optics Imaging of 1629 Kepler Exoplanet Candidate Host Stars

    CERN Document Server

    Ziegler, Carl; Morton, Tim; Baranec, Christoph; Riddle, Reed; Atkinson, Dani; Baker, Anna; Roberts, Sarah; Ciardi, David R

    2016-01-01

    The Robo-AO \\textit{Kepler} Planetary Candidate Survey is observing every \\textit{Kepler} planet candidate host star with laser adaptive optics imaging to search for blended nearby stars, which may be physically associated companions and/or responsible for transit false positives. We present in this paper the results of our search for stars nearby 1629 \\textit{Kepler} planet candidate hosts. With survey sensitivity to objects as close as $\\sim$0.15" and magnitude differences $\\Delta$m$\\le$6, we find 223 stars in the vicinity of 206 target KOIs; 209 of these nearby stars have not previously been imaged in high resolution. We measure an overall nearby-star probability for \\textit{Kepler} planet candidates of 12.6\\%$\\pm$0.9\\% out to a separation of 4.0". Particularly interesting KOI systems are discussed, including 23 stars with detected companions which host rocky, habitable zone candidates, and five new candidate planet-hosting quadruple star systems. We explore the broad correlations between planetary systems...

  11. Land markets in the EU candidate countries of Croatia, Former Yugoslav Republic of Macedonia and Turkey

    OpenAIRE

    Bojnec, Štefan

    2013-01-01

    The paper provides an overview and a comparison of land markets covering the three candidate countries for European Union membership: Croatia, the Former Yugoslav Republic (FYR) of Macedonia and Turkey. We analyse and compare agricultural land structures and factors driving land markets. The analyses are based on the available cross-section and time-series evidence on agricultural land structures and land productivity (yields). The land productivity measured by production per hectare of agric...

  12. Selection of candidate sites for Iranian national observatory by wind-rose studies

    Directory of Open Access Journals (Sweden)

    S. Nasiri

    2003-06-01

    Full Text Available   The site selection procedure for optical observatories housing a telescope with a sizeable aperture is described. The theory of seeing is briefly introduced and a special type of seeing monitor that is widely used for seeing measurements is discussed. The results of the meteorological studies mainly based on the wind-rose diagrams are presented. These are done for 31 preliminary selected candidate sites using the data obtained from meteorological synoptic stations during the last 20 years.

  13. Candidate gene study to investigate the genetic determinants of normal variation in central corneal thickness

    OpenAIRE

    Dimasi, David P.; Kathryn P Burdon; Hewitt, Alex W; Savarirayan, Ravi; Healey, Paul R.; Mitchell, Paul; Mackey, David A.; Craig, Jamie E

    2010-01-01

    Purpose The genetic component underlying variation in central corneal thickness (CCT) in the normal population remains largely unknown. As CCT is an identified risk factor for open-angle glaucoma, understanding the genes involved in CCT determination could improve our understanding of the mechanisms involved in this association. Methods To identify novel CCT genes, we selected eight different candidates based on a range of criteria. These included; aquaporin 1 (AQ1), aquaporin 5 (AQ5), decori...

  14. Physiological and molecular characterization of drought responses and identification of candidate tolerance genes in cassava

    OpenAIRE

    Turyagyenda, Laban F.; Kizito, Elizabeth B.; Ferguson, Morag; Baguma, Yona; Agaba, Morris; Jagger J W Harvey; Osiru, David S. O.

    2013-01-01

    Cassava is an important root crop to resource-poor farmers in marginal areas, where its production faces drought stress constraints. Given the difficulties associated with cassava breeding, a molecular understanding of drought tolerance in cassava will help in the identification of markers for use in marker-assisted selection and genes for transgenic improvement of drought tolerance. This study was carried out to identify candidate drought-tolerance genes and expression-based markers of droug...

  15. Classification of Variable Objects for Search for GRB Candidates on Bamberg Photographic Plates

    Directory of Open Access Journals (Sweden)

    René Hudec

    2013-01-01

    Full Text Available We report on an ongoing study based on blink-comparison of more than 5000 Bamberg Observatory Southern Sky Patrol Plates performed within a continuation of a student high school project (Jugend Forscht. After a detailed analyses and classification, 6 non-classified objects were identified as emulsion defects, 19 as asteroids, 37 as variable stars, and 6 as real OT-GRB candidates.

  16. Corrosion of Candidate High Temperature Alloys in Supercritical Carbon Dioxide

    Science.gov (United States)

    Parks, Curtis J.

    The corrosion resistance of three candidate alloys is tested in supercritical carbon dioxide (S-CO2) at different levels of temperature and pressure for up to 3000 hours. The purpose of the testing is to evaluate the compatibility of different engineering alloys in S-CO2 for use in a S-CO 2 Brayton cycle. The three alloys used are austenitic stainless steel 316, iron-nickel-base superalloy 718, and nickel-base superalloy 738. Each alloy is exposed to four combinations of temperature and pressure, consisting of either 550°C or 700°C at either 15 or 25 MPa for up to 1500 hours. At each temperature, an additional sample set is tested for 3000 hours and experienced an increase in pressure from 15 MPa to 25 MPa after 1500 hours of testing. All three alloys are successful in producing a protective oxide layer at the lower temperature of 550°C based on the logarithmic weight gain trends. At the higher temperature of 700°C, 316SS exhibits unfavourable linear weight gain trends at both pressures of 15 and 25 MPa. In comparison, IN-718 and IN-738 performs similarly in producing a protective oxide layer illustrated through a power weight gain relation. The effect of pressure is most pronounced at the operating temperature of 700°C, where the higher pressure of 25 MPa results in an increased rate of oxide formation. SEM analysis exposes a thin film oxide for both IN-718 and IN-738 but severe intergranular corrosion is exhibited by IN-738. Based on the testing conducted, both alloys show favourable characteristics for use in S-CO 2 conditions up to 700°C, but further testing is required to characterize the effect of the intergranular corrosion on the stability of oxide in IN-738. 316SS provided favourable results for use in temperatures of 550°C, but the protective oxide deteriorated at an operating temperature of 700°C.

  17. Next-generation sequencing for identification of candidate genes for Fusarium wilt and sterility mosaic disease in pigeonpea (Cajanus cajan).

    Science.gov (United States)

    Singh, Vikas K; Khan, Aamir W; Saxena, Rachit K; Kumar, Vinay; Kale, Sandip M; Sinha, Pallavi; Chitikineni, Annapurna; Pazhamala, Lekha T; Garg, Vanika; Sharma, Mamta; Sameer Kumar, Chanda Venkata; Parupalli, Swathi; Vechalapu, Suryanarayana; Patil, Suyash; Muniswamy, Sonnappa; Ghanta, Anuradha; Yamini, Kalinati Narasimhan; Dharmaraj, Pallavi Subbanna; Varshney, Rajeev K

    2016-05-01

    To map resistance genes for Fusarium wilt (FW) and sterility mosaic disease (SMD) in pigeonpea, sequencing-based bulked segregant analysis (Seq-BSA) was used. Resistant (R) and susceptible (S) bulks from the extreme recombinant inbred lines of ICPL 20096 × ICPL 332 were sequenced. Subsequently, SNP index was calculated between R- and S-bulks with the help of draft genome sequence and reference-guided assembly of ICPL 20096 (resistant parent). Seq-BSA has provided seven candidate SNPs for FW and SMD resistance in pigeonpea. In parallel, four additional genotypes were re-sequenced and their combined analysis with R- and S-bulks has provided a total of 8362 nonsynonymous (ns) SNPs. Of 8362 nsSNPs, 60 were found within the 2-Mb flanking regions of seven candidate SNPs identified through Seq-BSA. Haplotype analysis narrowed down to eight nsSNPs in seven genes. These eight nsSNPs were further validated by re-sequencing 11 genotypes that are resistant and susceptible to FW and SMD. This analysis revealed association of four candidate nsSNPs in four genes with FW resistance and four candidate nsSNPs in three genes with SMD resistance. Further, In silico protein analysis and expression profiling identified two most promising candidate genes namely C.cajan_01839 for SMD resistance and C.cajan_03203 for FW resistance. Identified candidate genomic regions/SNPs will be useful for genomics-assisted breeding in pigeonpea. PMID:26397045

  18. Safety Lead Optimization and Candidate Identification: Integrating New Technologies into Decision-Making.

    Science.gov (United States)

    Dambach, Donna M; Misner, Dinah; Brock, Mathew; Fullerton, Aaron; Proctor, William; Maher, Jonathan; Lee, Dong; Ford, Kevin; Diaz, Dolores

    2016-04-18

    Discovery toxicology focuses on the identification of the most promising drug candidates through the development and implementation of lead optimization strategies and hypothesis-driven investigation of issues that enable rational and informed decision-making. The major goals are to [a] identify and progress the drug candidate with the best overall drug safety profile for a therapeutic area, [b] remove the most toxic drugs from the portfolio prior to entry into humans to reduce clinical attrition due to toxicity, and [c] establish a well-characterized hazard and translational risk profile to enable clinical trial designs. This is accomplished through a framework that balances the multiple considerations to identify a drug candidate with the overall best drug characteristics and provides a cogent understanding of mechanisms of toxicity. The framework components include establishing a target candidate profile for each program that defines the qualities of a successful candidate based on the intended therapeutic area, including the risk tolerance for liabilities; evaluating potential liabilities that may result from engaging the therapeutic target (pharmacology-mediated or on-target) and that are chemical structure-mediated (off-target); and characterizing identified liabilities. Lead optimization and investigation relies upon the integrated use of a variety of technologies and models (in silico, in vitro, and in vivo) that have achieved a sufficient level of qualification or validation to provide confidence in their use. We describe the strategic applications of various nonclinical models (established and new) for a holistic and integrated risk assessment that is used for rational decision-making. While this review focuses on strategies for small molecules, the overall concepts, approaches, and technologies are generally applicable to biotherapeutics. PMID:26625186

  19. RESOLVED COMPANIONS OF CEPHEIDS: TESTING THE CANDIDATES WITH X-RAY OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden St., Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Ave., Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H. [The CHARA Array of Georgia State University, Mount Wilson, California 91023 (United States); Mason, Brian D., E-mail: nevans@cfa.harvard.edu, E-mail: heb11@psu.edu, E-mail: schaefer@chara-array.org [US Naval Observatory, 3450 Massachusetts Ave., NW, Washington, DC 20392-5420 (United States)

    2016-04-15

    We have made XMM-Newton observations of 14 Galactic Cepheids that have candidate resolved (≥5″) companion stars based on our earlier HST Wide Field Camera 3 (WFC3) imaging survey. Main-sequence stars that are young enough to be physical companions of Cepheids are expected to be strong X-ray producers in contrast to field stars. XMM-Newton exposures were set to detect essentially all companions hotter than spectral type M0 (corresponding to 0.5 M{sub ⊙}). The large majority of our candidate companions were not detected in X-rays, and hence are not confirmed as young companions. One resolved candidate (S Nor #4) was unambiguously detected, but the Cepheid is a member of a populous cluster. For this reason, it is likely that S Nor #4 is a cluster member rather than a gravitationally bound companion. Two further Cepheids (S Mus and R Cru) have X-ray emission that might be produced by either the Cepheid or the candidate resolved companion. A subsequent Chandra observation of S Mus shows that the X-rays are at the location of the Cepheid/spectroscopic binary. R Cru and also V659 Cen (also X-ray bright) have possible companions closer than 5″ (the limit for this study) which are the likely sources of X-rays. One final X-ray detection (V473 Lyr) has no known optical companion, so the prime suspect is the Cepheid itself. It is a unique Cepheid with a variable amplitude. The 14 stars that we observed with XMM constitute 36% of the 39 Cepheids found to have candidate companions in our HST/WFC3 optical survey. No young probable binary companions were found with separations of ≥5″ or 4000 au.

  20. Third chromosome candidate genes for conspecific sperm precedence between D. simulans and D. mauritiana

    Directory of Open Access Journals (Sweden)

    Brouwers Barb

    2010-04-01

    Full Text Available Abstract Background Male - female incompatibilities can be critical in keeping species as separate and discrete units. Premating incompatibilities and postzygotic hybrid sterility/inviability have been widely studied as isolating barriers between species. In recent years, a number of studies have brought attention to postmating prezygotic barriers arising from male - male competition and male - female interactions. Yet little is known about the genetic basis of postmating prezygotic isolation barriers between species. Results Using D. simulans lines with mapped introgressions of D. mauritiana into their third chromosome, we find at least two D. mauritiana introgressions causing male breakdown in competitive paternity success. Eighty one genes within the mapped introgressed regions were identified as broad-sense candidates on the basis of male reproductive tract expression and male-related function. The list of candidates was narrowed down to five genes based on differences in male reproductive tract expression between D. simulans and D. mauritiana. Another ten genes were confirmed as candidates using evidence of adaptive gene coding sequence diversification in the D. simulans and/or D. mauritiana lineage. Our results show a complex genetic basis for conspecific sperm precedence, with evidence of gene interactions between at least two third chromosome loci. Pleiotropy is also evident from correlation between conspecific sperm precedence and female induced fecundity and the identification of candidate genes that might exert an effect through genetic conflict and immunity. Conclusions We identified at least two loci responsible for conspecific sperm precedence. A third of candidate genes within these two loci are located in the 89B cytogenetic position, highlighting a possible major role for this chromosome position during the evolution of species specific adaptations to postmating prezygotic reproductive challenges.

  1. Safety Lead Optimization and Candidate Identification: Integrating New Technologies into Decision-Making.

    Science.gov (United States)

    Dambach, Donna M; Misner, Dinah; Brock, Mathew; Fullerton, Aaron; Proctor, William; Maher, Jonathan; Lee, Dong; Ford, Kevin; Diaz, Dolores

    2016-04-18

    Discovery toxicology focuses on the identification of the most promising drug candidates through the development and implementation of lead optimization strategies and hypothesis-driven investigation of issues that enable rational and informed decision-making. The major goals are to [a] identify and progress the drug candidate with the best overall drug safety profile for a therapeutic area, [b] remove the most toxic drugs from the portfolio prior to entry into humans to reduce clinical attrition due to toxicity, and [c] establish a well-characterized hazard and translational risk profile to enable clinical trial designs. This is accomplished through a framework that balances the multiple considerations to identify a drug candidate with the overall best drug characteristics and provides a cogent understanding of mechanisms of toxicity. The framework components include establishing a target candidate profile for each program that defines the qualities of a successful candidate based on the intended therapeutic area, including the risk tolerance for liabilities; evaluating potential liabilities that may result from engaging the therapeutic target (pharmacology-mediated or on-target) and that are chemical structure-mediated (off-target); and characterizing identified liabilities. Lead optimization and investigation relies upon the integrated use of a variety of technologies and models (in silico, in vitro, and in vivo) that have achieved a sufficient level of qualification or validation to provide confidence in their use. We describe the strategic applications of various nonclinical models (established and new) for a holistic and integrated risk assessment that is used for rational decision-making. While this review focuses on strategies for small molecules, the overall concepts, approaches, and technologies are generally applicable to biotherapeutics.

  2. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    International Nuclear Information System (INIS)

    Three iron- to nickel-based austenitic alloys and three copper-based alloys are being considered as candidate materials for the fabrication of high-level radioactive-waste disposal containers. The austenitic alloys are Types 304L and 316L stainless steels and the high-nickel material Alloy 825. The copper-based alloys are CDA 102 (oxygen-free copper), CDA 613 (Cu-7Al), and CDA 715 (Cu-30Ni). Waste in the forms of both spent fuel assemblies from reactors and borosilicate glass will be sent to the prospective repository at Yucca Mountain, Nevada. The decay of radionuclides will result in the generation of substantial heat and gamma radiation. Container materials may undergo any of several modes of degradation in this environment, including undesirable phase transformations due to a lack of phase stability; atmospheric oxidation; general aqueous corrosion; pitting; crevice corrosion; intergranular stress corrosion cracking; and transgranular stress corrosion cracking. Problems specific to welds, such as hot cracking, may also occur. A survey of the literature has been prepared as part of the process of selecting, from among the candidates, a material that is adequate for repository conditions. The modes of degradation are discussed in detail in the survey to determine which apply to the candidate alloys and the extent to which they may actually occur. The eight volumes of the survey are summarized in Sections 1 through 8 of this overview. The conclusions drawn from the survey are also given in this overview

  3. Vaporisation of candidate nuclear fuels and targets for transmutation of minor actinides

    Energy Technology Data Exchange (ETDEWEB)

    Gotcu-Freis, P., E-mail: p.gotcu@tudelft.nl [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Delft University of Technology, Faculty of Applied Sciences, Mekelweg 15, 2629 JB Delft (Netherlands); Hiernaut, J.-P. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Colle, J.-Y., E-mail: jean-yves.colle@ec.europa.eu [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Naestren, C.; Carretero, A. Fernandez; Konings, R.J.M. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany)

    2011-04-15

    The thermal stability and high temperature behaviour of candidate fuels and targets for transmutation of minor actinides has been investigated. Zirconia-based solid solution, MgO-based CERCER and molybdenum-based CERMET fuels containing Am and/or Pu in various concentrations were heated up to 2700 K in a Knudsen cell coupled with a quadrupole mass spectrometer, to measure their vapour pressure and vapour composition. The results reveal that the vaporisation of the actinides from the samples is not only determined by the thermodynamics of the system but is also related to the dynamic evolution of multi-component mixtures with complex composition or microstructure.

  4. Vaporisation of candidate nuclear fuels and targets for transmutation of minor actinides

    International Nuclear Information System (INIS)

    The thermal stability and high temperature behaviour of candidate fuels and targets for transmutation of minor actinides has been investigated. Zirconia-based solid solution, MgO-based CERCER and molybdenum-based CERMET fuels containing Am and/or Pu in various concentrations were heated up to 2700 K in a Knudsen cell coupled with a quadrupole mass spectrometer, to measure their vapour pressure and vapour composition. The results reveal that the vaporisation of the actinides from the samples is not only determined by the thermodynamics of the system but is also related to the dynamic evolution of multi-component mixtures with complex composition or microstructure.

  5. 22 CFR 11.1 - Junior Foreign Service officer career candidate appointments.

    Science.gov (United States)

    2010-04-01

    ... affirmative factor in the selection of candidates for appointment as Foreign Service officer career candidates... political functions of the Department of State; for Career Candidates in the information/cultural...

  6. Transit Timing Observations from Kepler: VI. Transit Timing Variation Candidates in the First Seventeen Months from Polynomial Models

    CERN Document Server

    Ford, Eric B; Rowe, Jason F; Steffen, Jason H; Barclay, Thomas; Batalha, Natalie M; Borucki, William J; Bryson, Stephen T; Caldwell, Douglas A; Fabrycky, Daniel C; Gautier, Thomas N; Holman, Matthew J; Ibrahim, Khadeejah A; Kjeldsen, Hans; Kinemuchi, Karen; Koch, David G; Lissauer, Jack J; Still, Martin; Tenenbaum, Peter; Uddin, Kamal; Welsh, William

    2012-01-01

    Transit timing variations provide a powerful tool for confirming and characterizing transiting planets, as well as detecting non-transiting planets. We report the results an updated TTV analysis for 822 planet candidates (Borucki et al. 2011; Batalha et al. 2012) based on transit times measured during the first seventeen months of Kepler observations (Rowe et al 2012). We present 35 TTV candidates (4.1% of suitable data sets) based on long-term trends and 153 mostly weaker TTV candidates (18% of suitable data sets) based on excess scatter of TTV measurements about a linear ephemeris. We anticipate that several of these planet candidates could be confirmed and perhaps characterized with more detailed TTV analyses using publicly available Kepler observations. For many others, Kepler has observed a long-term TTV trend, but an extended Kepler mission will be required to characterize the system via TTVs. We find that the occurence rate of planet candidates that show TTVs is significantly increased (~60%-76%) for p...

  7. Photometric Selection of High-Redshift Type Ia Supernova Candidates

    Science.gov (United States)

    Sullivan, M.; Howell, D. A.; Perrett, K.; Nugent, P. E.; Astier, P.; Aubourg, E.; Balam, D.; Basa, S.; Carlberg, R. G.; Conley, A.; Fabbro, S.; Fouchez, D.; Guy, J.; Hook, I.; Lafoux, H.; Neill, J. D.; Pain, R.; Palanque-Delabrouille, N.; Pritchet, C. J.; Regnault, N.; Rich, J.; Taillet, R.; Aldering, G.; Baumont, S.; Bronder, J.; Filiol, M.; Knop, R. A.; Perlmutter, S.; Tao, C.

    2006-02-01

    We present a method for selecting high-redshift Type Ia supernovae (SNe Ia) located via rolling SN searches. The technique, using both color and magnitude information of events from only two to three epochs of multiband real-time photometry, is able to discriminate between SNe Ia and core-collapse SNe. Furthermore, for SNe Ia the method accurately predicts the redshift, phase, and light-curve parameterization of these events based only on pre-maximum-light data. We demonstrate the effectiveness of the technique on a simulated survey of SNe Ia and core-collapse SNe, where the selection method effectively rejects most core-collapse SNe while retaining SNe Ia. We also apply the selection code to real-time data acquired as part of the Canada-France-Hawaii Telescope Supernova Legacy Survey (SNLS). During the period 2004 May to 2005 January in the SNLS, 440 SN candidates were discovered, of which 70 were confirmed spectroscopically as SNe Ia and 15 as core-collapse events. For this test data set, the selection technique correctly identifies 100% of the identified SNe II as non-SNe Ia with only a 1%-2% false rejection rate. The predicted parameterization of the SNe Ia has a precision of Δz/(1+zspec)<0.09 in redshift and +/-2-3 rest-frame days in phase, providing invaluable information for planning spectroscopic follow-up observations. We also investigate any bias introduced by this selection method on the ability of surveys such as SNLS to measure cosmological parameters (e.g., w and ΩM) and find any effect to be negligible.

  8. DENSE CLUMPS AND CANDIDATES FOR MOLECULAR OUTFLOWS IN W40

    Energy Technology Data Exchange (ETDEWEB)

    Shimoikura, Tomomi; Dobashi, Kazuhito [Department of Astronomy and Earth Sciences, Tokyo Gakugei University, Koganei, Tokyo 184-8501 (Japan); Nakamura, Fumitaka; Hara, Chihomi; Kawabe, Ryohei [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Tanaka, Tomohiro [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan); Shimajiri, Yoshito [Laboratoire AIM, CEA/DSM-CNRS-Université Paris Diderot, IRFU/Service d’Astrophysique, CEA Saclay, F-91191 Gif-sur-Yvette (France); Sugitani, Kouji, E-mail: ikura@u-gakugei.ac.jp [Graduate School of Natural Sciences, Nagoya City University, Mizuho-ku, Nagoya 467-8501 (Japan)

    2015-06-20

    We report the results of the {sup 12}CO (J = 3−2) and HCO{sup +} (J = 4−3) observations of the W40 H ii region with the Atacama Submillimeter Telescope Experiment (ASTE) 10 m telescope (HPBW ≃ 22″) to search for molecular outflows and dense clumps. We found that the velocity field in the region is highly complex, consisting of at least four distinct velocity components at V{sub LSR} ≃ 3, 5, 7, and 10 km s{sup −1}. The ∼7 km s{sup −1} component represents the systemic velocity of cold gas surrounding the entire region, and causes heavy absorption in the {sup 12}CO spectra over the velocity range 6 ≲ V{sub LSR} ≲ 9 km s{sup −1}. The ∼5 and ∼10 km s{sup −1} components exhibit high {sup 12}CO temperature (≳40 K) and are found mostly around the H ii region, suggesting that these components are likely to be tracing dense gas interacting with the expanding shell around the H ii region. Based on the {sup 12}CO data, we identified 13 regions of high velocity gas, which we interpret as candidate outflow lobes. Using the HCO{sup +} data, we also identified six clumps and estimated their physical parameters. On the basis of the ASTE data and near-infrared images from 2MASS, we present an updated three-dimensional model of this region. In order to investigate molecular outflows in W40, the SiO (J = 1−0, v = 0) emission line and some other emission lines at 40 GHz were also observed with the 45 m telescope at the Nobeyama Radio Observatory, but they were not detected at the present sensitivity.

  9. A Census of Star-Forming Galaxies in the z~9-10 Universe based on HST+Spitzer Observations Over 19 CLASH clusters: Three Candidate z~9-10 Galaxies and Improved Constraints on the Star Formation Rate Density at z~9.2

    CERN Document Server

    Bouwens, R; Zitrin, A; Coe, D; Franx, M; Zheng, W; Smit, R; Host, O; Postman, M; Moustakas, L; Labbe, I; Carrasco, M; Molino, A; Donahue, M; Kelson, D D; Meneghetti, M; Jha, S; Benitez, N; Lemze, D; Umetsu, K; Broadhurst, T; Moustakas, J; Rosati, P; Bartelmann, M; Ford, H; Graves, G; Grillo, C; Infante, L; Jiminez-Teja, Y; Jouvel, S; Lahav, O; Maoz, D; Medezinski, E; Melchior, P; Merten, J; Nonino, M; Ogaz, S; Seitz, S

    2012-01-01

    We utilise a two-color Lyman-break selection criterion to search for z~9-10 galaxies over the first 19 clusters in the CLASH program. Key to this search are deep observations in five near-IR passbands to 1.6 microns, allowing us good constraints on the position of the Lyman break to z~10. A systematic search yields three z~9-10 candidates in total above a 6 sigma detection limit. While we have already reported on the most robust of these candidates, two new z~9 candidates (H~26.2-26.9) are also revealed in our expanded search. The observed H-IRAC colors for the sources are sufficiently blue to strongly favor redshifts of z>~9 for these sources. A careful assessment of various sources of contamination suggests 8 than seen at lower redshifts. Compared to similar evolutionary findings from the HUDF, our result is much more insensitive to large-scale structure uncertainties, given our many independent sightlines on the high-redshift universe.

  10. Preoperative cardiovascular investigations in liver transplant candidate: An update

    Science.gov (United States)

    Sehgal, Lalit; Srivastava, Piyush; Pandey, Chandra Kant; Jha, Amit

    2016-01-01

    Cardiovascular complications are a major cause of morbidity and mortality in patients with end-stage liver disease (ESLD) undergoing liver transplantation. Identifying candidates at the highest risk of postoperative cardiovascular complications is the cornerstone for optimizing the outcome. Ischaemic heart disease contributes to major portion of cardiovascular complications and therefore warrants evaluation in the preoperative period. Patients of ESLD usually demonstrate increased cardiac output, compromised ventricular response to stress, low systemic vascular resistance and occasionally bradycardia. Despite various recommendations for preoperative evaluation of cardiovascular disease in liver transplant candidates, a considerable controversy on screening methodology persists. This review critically focuses on the rapidly expanding body of evidence for diagnosis and risk stratification of cardiovascular disorder in liver transplant candidates. PMID:26962249

  11. Detection Confidence Tests for Burst and Inspiral Candidate Events

    CERN Document Server

    Gouaty, R

    2008-01-01

    The LIGO Scientific Collaboration (LSC) is developing and running analysis pipelines to search for gravitational-wave transients emitted by astrophysical events such as compact binary mergers or core-collapsed supernovae. However, because of the non-Gaussian, non-stationary nature of the noise exhibited by the LIGO detectors, residual false alarms might be found at the end of the pipelines. A critical aspect of the search is then to assess our confidence for gravitational waves and to distinguish them from those false alarms. Both the ''Compact Binary Coalescence'' and the ''Burst'' working groups have been developing a detection checklist for the validation of candidate-events, consisting of a series of tests including data quality checks, analysis of the candidate appearance, parameter consistency studies, coherent analysis, which aim to corroborate a detection or to eliminate a false alarm. In this paper, the general methodology used for candidate validation is presented. The method is illustrated with an ...

  12. Former Head of CNOOC Named as Candidate for Governor

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    @@ The Central Committee of the Chinese Communist Party has appointed Wei Liucheng, Former President of CNOOC and Former Chairman and CEO of CNOOC Limited, as Deputy Secretary of Hainan Provincial Committee and named him as the candidate for Governor of Hainan Province. At a conference of Hainan Provincial Committee of the Party held on October 8, at which the organization department of the Communist Party of China announced nomination of Wei as the deputy Party secretary of Hainan, which is the second highest position in the provincial government. Wei was also chosen as a candidate for the governor of the island province.

  13. On Intrinsic Magnetic Moments In Black Hole Candidates

    CERN Document Server

    Robertson, S L; Robertson, Stanley L.; Leiter, Darryl J.

    2003-01-01

    In previous work we found that many of the spectral properties of low mass x-ray binaries, including galactic black hole candidates could be explained by a magnetic propeller model that requires an intrinsically magnetized central object. Here we describe how the Einstein field equations of General Relativity and equipartition magnetic fields permit the existence of highly red shifted, extremely long lived, collapsing, radiating objects. We examine the properties of these collapsed objects and discuss characteristics that might lead to their confirmation as the source of black hole candidate phenomena.

  14. Dark matter candidates and methods for detecting them

    Science.gov (United States)

    Raffelt, G. G.

    1992-01-01

    A number of experiments employing Ge and Si ionization detectors have excluded large regions in the plane of masses and scattering cross-sections for weakly-interacting dark matter (DM) candidates. It is judged that, before a realistic detection experiment for supersymmetric DM candidates can be conducted, significant development efforts will have to be completed for suitable cryogenic or ionization detectors. Pilot experiments have demonstrated the feasibility of axion searches with microwave cavities, but these are at least two orders of magnitude too low in sensitivity.

  15. Facial discrimination of political candidates and voting behavior

    Directory of Open Access Journals (Sweden)

    Alina Duduciuc

    2012-04-01

    Full Text Available After a review of psychosociological research concerning the sources of prejudices and discriminations, this article brings into discussion the cognitive approach of perceiving the other as being „otherwise” than the members of the in-group. We will discuss the situations, structural and personal factors as being some determining ones for discriminant behavior. Within the lines of cognitive paradigm, we ask how the individual does discriminate, by perceptive processes, between candidates which are considered attractive, which go together with the expectations of the electorate concerning the physical aspects and candidates who are „less desirable”.

  16. Ethical issues in the psychosocial assessment of bariatric surgery candidates.

    Science.gov (United States)

    Rouleau, Codie R; Rash, Joshua A; Mothersill, Kerry J

    2016-07-01

    Psychosocial evaluation is recommended prior to bariatric surgery. Practice guidelines have been published on assessment methods for bariatric surgery candidates, but they have not emphasized ethical issues with this population. This review outlines ethical and professional considerations for behavioral healthcare providers who conduct pre-surgical assessments of bariatric surgery candidates by merging ethical principles for mental health professionals with current practices in pre-surgical assessments. Issues discussed include the following: (a) establishing and maintaining competence, (b) obtaining informed consent, (c) respecting confidentiality, (d) avoiding bias and discrimination, (e) avoiding and addressing dual roles, (f) selecting and using psychological tests, and (g) acknowledging limitations of psychosocial assessments. PMID:25411197

  17. Kepler Mission Discovers Trove of Extrasolar Planet Candidates

    Science.gov (United States)

    Showstack, Randy

    2011-02-01

    NASA's Kepler discovery mission is collecting more than just pennies from heaven. Results from the first 4 months of science operations of the Kepler space telescope, announced on 2 February, include the discovery of 1235 candidate planets orbiting 997 stars in a small portion of the Milky Way galaxy examined by the telescope. Follow-up observations likely could confirm about 80% of the candidates as actual planets rather than false positives, according to researchers. This new trove of possible exoplanets could greatly expand the number of known planets outside of our solar system.

  18. Practical Large Scale Syntheses of New Drug Candidates

    Institute of Scientific and Technical Information of China (English)

    Hui-Yin Li

    2001-01-01

    @@ This presentation will be focus on Practical large scale syntheses of lead compounds and drug candidates from three major therapeutic areas from DuPont Pharmaceuticals Research Laboratory: 1). DMP777-a selective, non-toxic, orally active human elastase inhibitor; 2). DMP754-a potent glycoprotein IIb/IIIa antagonist; 3). R-Wafarin-the pure enantiomeric form of wafarin. The key technology used for preparation these drug candidates is asymmetric hydrogenation under very mild reaction conditions, which produced very high quality final products at large scale (>99% de, >99 A% and >99 wt%). Some practical and GMP aspects of process development will be also discussed.

  19. Practical Large Scale Syntheses of New Drug Candidates

    Institute of Scientific and Technical Information of China (English)

    Hui-Yin; Li

    2001-01-01

    This presentation will be focus on Practical large scale syntheses of lead compounds and drug candidates from three major therapeutic areas from DuPont Pharmaceuticals Research Laboratory: 1). DMP777-a selective, non-toxic, orally active human elastase inhibitor; 2). DMP754-a potent glycoprotein IIb/IIIa antagonist; 3). R-Wafarin-the pure enantiomeric form of wafarin. The key technology used for preparation these drug candidates is asymmetric hydrogenation under very mild reaction conditions, which produced very high quality final products at large scale (>99% de, >99 A% and >99 wt%). Some practical and GMP aspects of process development will be also discussed.……

  20. Efficient cooperative compressive spectrum sensing by identifying multi-candidate and exploiting deterministic matrix

    Science.gov (United States)

    Li, Jia; Wang, Qiang; Yan, Wenjie; Shen, Yi

    2015-12-01

    Cooperative spectrum sensing exploits the spatial diversity to improve the detection of occupied channels in cognitive radio networks (CRNs). Cooperative compressive spectrum sensing (CCSS) utilizing the sparsity of channel occupancy further improves the efficiency by reducing the number of reports without degrading detection performance. In this paper, we firstly and mainly propose the referred multi-candidate orthogonal matrix matching pursuit (MOMMP) algorithms to efficiently and effectively detect occupied channels at fusion center (FC), where multi-candidate identification and orthogonal projection are utilized to respectively reduce the number of required iterations and improve the probability of exact identification. Secondly, two common but different approaches based on threshold and Gaussian distribution are introduced to realize the multi-candidate identification. Moreover, to improve the detection accuracy and energy efficiency, we propose the matrix construction based on shrinkage and gradient descent (MCSGD) algorithm to provide a deterministic filter coefficient matrix of low t-average coherence. Finally, several numerical simulations validate that our proposals provide satisfactory performance with higher probability of detection, lower probability of false alarm and less detection time.

  1. Planet Hunters. VIII. Characterization of 41 Long-Period Exoplanet Candidates from Kepler Archival Data

    CERN Document Server

    Wang, Ji; Barclay, Thomas; Picard, Alyssa; Ma, Bo; Bowler, Brendan P; Schmitt, Joseph R; Boyajian, Tabetha S; Jek, Kian J; LaCourse, Daryll; Baranec, Christoph; Riddle, Reed; Law, Nicholas M; Lintott, Chris; Schawinski, Kevin; Simister, Dean Joseph; Gregoire, Boscher; Babin, Sean P; Poile, Trevor; Jacobs, Thomas Lee; Jebson, Tony; Omohundro, Mark R; Schwengeler, Hans Martin; Sejpka, Johann; Terentev, Ivan A; Gagliano, Robert; Paakkonen, Jari-Pekka; Berge, Hans Kristian Otnes; Winarski, Troy; Green, Gerald R; Schmitt, Allan R

    2015-01-01

    The census of exoplanets is incomplete for orbital distances larger than 1 AU. Here, we present 41 long-period planet candidates in 38 systems identified by Planet Hunters based on Kepler archival data (Q0-Q17). Among them, 17 exhibit only one transit, 14 have two visible transits and 10 have more than three visible transits. For planet candidates with only one visible transit, we estimate their orbital periods based on transit duration and host star properties. The majority of the planet candidates in this work (75%) have orbital periods that correspond to distances of 1-3 AU from their host stars. We conduct follow-up imaging and spectroscopic observations to validate and characterize planet host stars. In total, we obtain adaptive optics images for 33 stars to search for possible blending sources. Six stars have stellar companions within 4". We obtain high-resolution spectra for 6 stars to determine their physical properties. Stellar properties for other stars are obtained from the NASA Exoplanet Archive a...

  2. Molecular genetic gene-environment studies using candidate genes in schizophrenia: a systematic review.

    Science.gov (United States)

    Modinos, Gemma; Iyegbe, Conrad; Prata, Diana; Rivera, Margarita; Kempton, Matthew J; Valmaggia, Lucia R; Sham, Pak C; van Os, Jim; McGuire, Philip

    2013-11-01

    The relatively high heritability of schizophrenia suggests that genetic factors play an important role in the etiology of the disorder. On the other hand, a number of environmental factors significantly influence its incidence. As few direct genetic effects have been demonstrated, and there is considerable inter-individual heterogeneity in the response to the known environmental factors, interactions between genetic and environmental factors may be important in determining whether an individual develops the disorder. To date, a considerable number of studies of gene-environment interactions (G×E) in schizophrenia have employed a hypothesis-based molecular genetic approach using candidate genes, which have led to a range of different findings. This systematic review aims to summarize the results from molecular genetic candidate studies and to review challenges and opportunities of this approach in psychosis research. Finally, we discuss the potential of future prospects, such as new studies that combine hypothesis-based molecular genetic candidate approaches with agnostic genome-wide association studies in determining schizophrenia risk.

  3. Affinity ultrafiltration of DNA topoisomerases-targeted compounds determined with HPLC/ESI-MS for drug candidate screening

    Institute of Scientific and Technical Information of China (English)

    张虹; 潘远江

    2004-01-01

    A method of screening assay is demonstrated. The approach is based on the affinity ofantitumor candidates for topoisomerases. In this method, antitumor candidates are fished out using topoisomerases as targets. Traditional analysis of complex compounds typically encounters signal suppression due to the relatively low concentrations, but enzyme-affinity screening for the active compounds can effectively concentrate the desired analysts into a small volume of high concentration. Active compounds are separated from non-affinity compounds by ultrafiltration. The molecules-enzymes complexes that are retained on the filter are subsequently separated by acidification to obtain the topoisomerases-affinity compounds for analysis on High Performance Liquid Chromatography coupled with electrospray ionization mass spectrometric detection (ESI-MS). This enzyme-affinity based screening assay provides a highly specific and efficient method that can directly screen, identify, and acquire drug candidates thus improving the accuracy and speed of high-throughput screening activities.

  4. Affinity ultrafiltration of DNA topoisomerases-targeted compounds determined with HPLC/ESI-MS for drug candidate screening

    Institute of Scientific and Technical Information of China (English)

    张虹; 潘远江

    2004-01-01

    A method of screening assay is demonstrated. The approach is based on the affinity of antitumor candidates for topoisomerases. In this method, antitumor candidates are fished out using topoisomerases as targets. Traditional analysis of complex compounds typically encounters signal suppression due to the relatively low concentrations, but enzyme-affinity screening for the active compounds can effectively concentrate the desired analysts into a small volume of high concen-tration. Active compounds are separated from non-affinity compounds by ultrafiltration. The molecules-enzymes complexes that are retained on the filter are subsequently separated by acidification to obtain the topoisomerases-affinity compounds for analysis on High Performance Liquid Chromatography coupled with electrospray ionization mass spectrometric detec-tion (ESI-MS). This enzyme-affinity based screening assay provides a highly specific and efficient method that can directly screen, identify, and acquire drug candidates thus improving the accuracy and speed of high-throughput screening activities.

  5. Selection of candidate plus phenotypes of Jatropha curcas L. using method of paired comparisons

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, D.K. [Silviculture Division, Arid Forest Research Institute, P.O. Krishi Mandi, New Pali Road, Jodhpur 342005, Rajasthan (India)

    2009-03-15

    Jatropha curcas L. (Euphorbiaceae) is an oil bearing species with multiple uses and considerable potential as a biodiesel crop. The present communication deals with the method of selecting plus phenotypes of J. curcas for exploiting genetic variability for further improvement. Candidate plus tree selection is the first and most important stage in any tree improvement programme. The selection of candidate plus plants (CPPs) is based upon various important attributes associated with the species and their relative ranking. Relative preference between various traits and scoring for each trait has been worked out by using the method of paired comparisons for the selection of CPP in J. curcas L. The most important ones are seed and oil yields. (author)

  6. Status of the Stardust ISPE and the Origin of Four Interstellar Dust Candidates

    Science.gov (United States)

    Westphal, A. J.; Allen, C.; Ansari, A.; Bajt, S.; Bastien, R. S.; Bassim, N.; Bechtel, H. A.; Borg, J.; Brenker, F. E.; Bridges, J.; Brownlee, D. E.; Burchell, M.; Burghammer, M.; Butterworth, A. L.; Changela, H.; Cloetens, P.; Davis, A. M.; Floss, C.; Flynn, G.; Fougeray, P.; Frank, D.; Gainsforth, Z.; Gruen, E.; Sandford, S. A.; Zolensky, M. E.

    2012-01-01

    Some bulk properties of interstellar dust are known through infrared and X-ray observations of the interstellar medium. However, the properties of individual interstellar dust particles are largely unconstrained, so it is not known whether individual interstellar dust particles can be definitively distinguished from interplanetary dust particles in the Stardust Interstellar Dust Collector (SIDC) based only on chemical, mineralogical or isotopic analyses. It was therefore understood from the beginning of the Stardust Interstellar Preliminary Examination (ISPE) that identification of interstellar dust candidates would rest on three criteria - broad consistency with known extraterrestrial materials, inconsistency with an origin as secondary ejecta from impacts on the spacecraft, and consistency, in a statistical sense, of observed dynamical properties - that is, trajectory and capture speed - with an origin in the interstellar dust stream. Here we quantitatively test four interstellar dust candidates, reported previously [1], against these criteria.

  7. 2WHSP: A catalog of HE and VHE gamma-ray blazars and blazar candidates

    CERN Document Server

    Chang, Yu-Ling; Giommi, Paolo; Padovani, Paolo

    2016-01-01

    Aims. High Synchrotron Peaked blazars (HSPs) dominate the -ray sky at energies larger than a few GeV; however, only a few hundred blazars of this type have been catalogued so far. In this paper we present the 2WHSP sample, the largest and most complete list of HSP blazars available to date, which is an expansion of the 1WHSP catalog of gamma-ray source candidates off the Galactic plane. Methods. We cross-matched a number of multi-wavelength surveys (in the radio, infrared and X-ray bands) and applied selection criteria based on the radio to IR and IR to X-ray spectral slopes. To ensure the selection of genuine HSPs we examined the SED of each candidate and estimated the peak frequency of its synchrotron emission ($\

  8. Using Kepler Candidates to Examine the Properties of Habitable Zone Exoplanets

    CERN Document Server

    Adams, Arthur D

    2016-01-01

    An analysis of the currently known exoplanets in the habitable zones (HZs) of their host stars is of interest in both the wake of the NASA Kepler mission and with prospects for expanding the known planet population through future ground- and space-based projects. In this paper we compare the empirical distributions of the properties of stellar systems with transiting planets to those with transiting HZ planets. This comparison includes two categories: confirmed/validated transiting planet systems, and Kepler planet and candidate planet systems. These two categories allow us to present quantitative analyses on both a conservative dataset of known planets and a more optimistic and numerous sample of Kepler candidates. Both are subject to similar instrumental and detection biases, and vetted against false positive detections. We examine whether the HZ distributions vary from the overall distributions in the Kepler sample with respect to planetary radius as well as stellar mass, effective temperature, and metalli...

  9. Reconsidering Tree Fruit as Candidate Crops Through the Use of Rapid Cycle Crop Breeding Technologies

    Science.gov (United States)

    Graham, Gary Thomas

    2014-01-01

    Tree fruit, although desirable from a crew nutrition and menu diversity perspective, have long been dismissed as candidate crops based on their long juvenile phase, large architecture, low short-term harvest index, and dormancy requirements. Recent developments in Rapid Cycle Crop Breeding (RCCB) have overcome these historical limitations, opening the door to a new era in candidate crop research. Researchers at the United States Department of Agriculture (USDA) have developed FT-construct (Flowering Locus T) dwarf plum lines that have a very short juvenile phase, vine-like architecture, and no obligate dormancy period. In a collaborative research effort, NASA and the USDA are evaluating the performance of these FT-lines under controlled environment conditions relevant to spaceflight.

  10. A transcription map of the 6p22.3 reading disability locus identifying candidate genes

    Directory of Open Access Journals (Sweden)

    Gruen Jeffrey R

    2003-06-01

    Full Text Available Abstract Background Reading disability (RD is a common syndrome with a large genetic component. Chromosome 6 has been identified in several linkage studies as playing a significant role. A more recent study identified a peak of transmission disequilibrium to marker JA04 (G72384 on chromosome 6p22.3, suggesting that a gene is located near this marker. Results In silico cloning was used to identify possible candidate genes located near the JA04 marker. The 2 million base pairs of sequence surrounding JA04 was downloaded and searched against the dbEST database to identify ESTs. In total, 623 ESTs from 80 different tissues were identified and assembled into 153 putative coding regions from 19 genes and 2 pseudogenes encoded near JA04. The identified genes were tested for their tissue specific expression by RT-PCR. Conclusions In total, five possible candidate genes for RD and other diseases mapping to this region were identified.

  11. Global blending optimization of laminated composites with discrete material candidate selection and thickness variation

    DEFF Research Database (Denmark)

    Sørensen, Søren N.; Stolpe, Mathias

    2015-01-01

    but is, however, convex in the original mixed binary nested form. Convexity is the foremost important property of optimization problems, and the proposed method can guarantee the global or near-global optimal solution; unlike most topology optimization methods. The material selection is limited...... to a distinct choice among predefined numbers of candidates. The laminate thickness is variable but the number of plies must be integer. We solve the convex mixed binary non-linear programming problem by an outer approximation cutting-plane method augmented with a few heuristics to accelerate the convergence...... for popular topology optimization methods and heuristics based on solving sequences of non-convex problems. The results will among others demonstrate that the difficulty of the posed problem is highly dependent upon the composition of the constitutive properties of the material candidates....

  12. Multiple Leader Candidate and Competitive Position Allocation for Robust Formation against Member Robot Faults.

    Science.gov (United States)

    Kwon, Ji-Wook; Kim, Jin Hyo; Seo, Jiwon

    2015-05-06

    This paper proposes a Multiple Leader Candidate (MLC) structure and a Competitive Position Allocation (CPA) algorithm which can be applicable for various applications including environmental sensing. Unlike previous formation structures such as virtual-leader and actual-leader structures with position allocation including a rigid allocation and an optimization based allocation, the formation employing the proposed MLC structure and CPA algorithm is robust against the fault (or disappearance) of the member robots and reduces the entire cost. In the MLC structure, a leader of the entire system is chosen among leader candidate robots. The CPA algorithm is the decentralized position allocation algorithm that assigns the robots to the vertex of the formation via the competition of the adjacent robots. The numerical simulations and experimental results are included to show the feasibility and the performance of the multiple robot system employing the proposed MLC structure and the CPA algorithm.

  13. Candidate Screening for the Recruitment of Critical Research and Development Workers

    DEFF Research Database (Denmark)

    Frosch, Katharina; Harhoff, Dietmar; Hoisl, Karin;

    The report focuses on résumé-based screening strategies for the recruitment of highly qualified research and development (R&D) workers (critical R&D workers) in high-tech firms. We investigate which kinds of professional background, job-related experience, motivations, specific skills, and previous...... and mechanical elements fields. A mixed logit model is used to analyse hiring preferences because this model allows us to deal with repeated choices. We find that HR decision makers prefer candidates with technology-specific patenting experience, an engineering background, analytical thinking skills......, and a strong desire to develop path-breaking technologies. Furthermore, no one-size-fits-all candidate exists that is equally preferred in both technology fields. HR decision makers in mechanical element firms prefer specialists to generalists, whereas those in clean technology attach special importance...

  14. Candidates for Long Lived High-K Ground States in Superheavy Nuclei

    CERN Document Server

    Jachimowicz, P; Skalski, J

    2015-01-01

    On the basis of systematic calculations for 1364 heavy and superheavy nuclei, including odd-systems, we have found a few candidates for high-K ground states in superheavy nuclei. The macroscopic-microscopic model based on the deformed Woods-Saxon single particle potential which we use offers a reasonable description of SH systems, including known: nuclear masses, $Q_{\\alpha}$-values, fission barriers, ground state deformations, super- and hyper-deformed minima in the heaviest nuclei. %For odd and odd-odd systems, both ways of including pairing correlations, % blocking and the quasi-particle method, have been applied. Exceptionally untypical high-K intruder contents of the g.s. found for some nuclei accompanied by a sizable excitation of the parent configuration in daughter suggest a dramatic hindrance of the $\\alpha$-decay. Multidimensional hyper-cube configuration - constrained calculations of the Potential Energy Surfaces (PES's) for one especially promising candidate, $^{272}$ Mt, shows a $\\backsimeq$ 6 Me...

  15. Quantitative trait loci mapping reveals candidate pathways regulating cell cycle duration in Plasmodium falciparum

    Directory of Open Access Journals (Sweden)

    Siwo Geoffrey

    2010-10-01

    Full Text Available Abstract Background Elevated parasite biomass in the human red blood cells can lead to increased malaria morbidity. The genes and mechanisms regulating growth and development of Plasmodium falciparum through its erythrocytic cycle are not well understood. We previously showed that strains HB3 and Dd2 diverge in their proliferation rates, and here use quantitative trait loci mapping in 34 progeny from a cross between these parent clones along with integrative bioinformatics to identify genetic loci and candidate genes that control divergences in cell cycle duration. Results Genetic mapping of cell cycle duration revealed a four-locus genetic model, including a major genetic effect on chromosome 12, which accounts for 75% of the inherited phenotype variation. These QTL span 165 genes, the majority of which have no predicted function based on homology. We present a method to systematically prioritize candidate genes using the extensive sequence and transcriptional information available for the parent lines. Putative functions were assigned to the prioritized genes based on protein interaction networks and expression eQTL from our earlier study. DNA metabolism or antigenic variation functional categories were enriched among our prioritized candidate genes. Genes were then analyzed to determine if they interact with cyclins or other proteins known to be involved in the regulation of cell cycle. Conclusions We show that the divergent proliferation rate between a drug resistant and drug sensitive parent clone is under genetic regulation and is segregating as a complex trait in 34 progeny. We map a major locus along with additional secondary effects, and use the wealth of genome data to identify key candidate genes. Of particular interest are a nucleosome assembly protein (PFL0185c, a Zinc finger transcription factor (PFL0465c both on chromosome 12 and a ribosomal protein L7Ae-related on chromosome 4 (PFD0960c.

  16. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    Energy Technology Data Exchange (ETDEWEB)

    Farmer, J.C.; Van Konynenburg, R.A.; McCright, R.D. (Lawrence Livermore National Lab., CA (USA)); Bullen, D.B. (Science and Engineering Associates, Inc., Pleasanton, CA (USA))

    1988-04-01

    Three iron- to nickel-based austenitic alloys (Types 304L and 316L stainless steels and Alloy 825) are being considered as candidate materials for the fabrication of high-level radioactive-waste containers. Waste will include fuel assemblies from reactors as well as high-level waste in borosilicate glass forms, and will be sent to the prospective repository at Yucca Mountain, Nevada. The decay of radionuclides in the repository will result in the generation of substantial heat and in fluences of gamma radiation. Container materials may undergo any of several modes of degradation in this environment, including atmospheric oxidation; uniform aqueous phase corrosion; pitting; crevice corrosion; sensitization and intergranular stress corrosion cracking (IGSCC); and transgranular stress corrosion cracking (TGSCC). This report is an analysis of data relevant to the pitting, crevice corrosion, and stress corrosion cracking (SCC) of the three austenitic candidate alloys. The candidates are compared in terms of their susceptibilities to these forms of corrosion. Although all three candidates have demonstrated pitting and crevice corrosion in chloride-containing environments, Alloy 825 has the greatest resistance to these types of localized corrosion (LC); such resistance is important because pits can penetrate the metal and serve as crack initiation sites. Both Types 304L and 316L stainless steels are susceptible to SCC in acidic chloride media. In contrast, SCC has not been documented in Alloy 825 under comparable conditions. Gamma radiation has been found to enhance SCC in Types 304 and 304L stainless steels, but it has no detectable effect on the resistance of Alloy 825 to SCC. Furthermore, while the effects of microbiologically induced corrosion have been observed for 300-series stainless steels, nickel-based alloys such as Alloy 825 seem to be immune to such problems. 211 refs., 49 figs., 10 tabs.

  17. Survey of degradation modes of candidate materials for high-level radioactive-waste disposal containers

    International Nuclear Information System (INIS)

    Three iron- to nickel-based austenitic alloys (Types 304L and 316L stainless steels and Alloy 825) are being considered as candidate materials for the fabrication of high-level radioactive-waste containers. Waste will include fuel assemblies from reactors as well as high-level waste in borosilicate glass forms, and will be sent to the prospective repository at Yucca Mountain, Nevada. The decay of radionuclides in the repository will result in the generation of substantial heat and in fluences of gamma radiation. Container materials may undergo any of several modes of degradation in this environment, including atmospheric oxidation; uniform aqueous phase corrosion; pitting; crevice corrosion; sensitization and intergranular stress corrosion cracking (IGSCC); and transgranular stress corrosion cracking (TGSCC). This report is an analysis of data relevant to the pitting, crevice corrosion, and stress corrosion cracking (SCC) of the three austenitic candidate alloys. The candidates are compared in terms of their susceptibilities to these forms of corrosion. Although all three candidates have demonstrated pitting and crevice corrosion in chloride-containing environments, Alloy 825 has the greatest resistance to these types of localized corrosion (LC); such resistance is important because pits can penetrate the metal and serve as crack initiation sites. Both Types 304L and 316L stainless steels are susceptible to SCC in acidic chloride media. In contrast, SCC has not been documented in Alloy 825 under comparable conditions. Gamma radiation has been found to enhance SCC in Types 304 and 304L stainless steels, but it has no detectable effect on the resistance of Alloy 825 to SCC. Furthermore, while the effects of microbiologically induced corrosion have been observed for 300-series stainless steels, nickel-based alloys such as Alloy 825 seem to be immune to such problems. 211 refs., 49 figs., 10 tabs

  18. Finding and characterizing candidate targets for the Asteroid Redirect Mission (ARM)

    Science.gov (United States)

    Chodas, P.

    2014-07-01

    suitable for missions launching no earlier than June 2019; the maximum asteroid return masses for these range from 45 to 800 tons according to the orbit. Unfortunately, many of the currently known candidates have not had their sizes, masses and spin rates adequately constrained in order to provide confidence that they are within the capability of the ARM vehicle to return. Still, three candidates have been characterized well enough, two by the Spitzer Space Telescope, 2009 BD and 2011 MD, and one by radar, 2013 EC_{20}. 2009 BD was not actually detected by Spitzer, indicating it was smaller than expected, about 4 meters; similarly, 2013 EC_{20} turned out to be smaller than desired, less than 3 meters. A fourth candidate, 2008 HU_4, should be characterized with radar in 2016 when it passes near the Earth. In general, physical characterization of these very small asteroids is best performed immediately after discovery, while they are still very near the Earth. Radar is important for characterizing size and rotation state, while long-arc high-precision astrometry can help characterize mass through estimation of the area-to-mass ratio. Rapid-response characterization for an ARM candidate was successfully demonstrated last year for 2013 EC_{20}, mentioned earlier. More candidates for the small-asteroid concept are expected: new potential candidates should be detected at the rate of 3 to 5 per year, based on extrapolations from past discovery rates. For the large-asteroid ARM concept, there is an additional characterization challenge: the surface of the asteroid must be observed with enough resolution that the presence of ˜3-meter boulders can be either directly seen or inferred from high-SNR radar. The maximum size and mass of the returnable boulders depends on the asteroid orbit in much the same way as for the other concept. Asteroid Itokawa is a strong candidate because it has already been well characterized by the Japanese Hayabusa spacecraft. The future targets of the

  19. Análise das habilidades cognitivas requeridas dos candidatos ao cargo de contador na Administração Pública Federal, utilizando-se indicadores fundamentados na visão da Taxonomia de Bloom Analysis of cognitive skills required from candidate accountants in the brazilian Federal Public Administration, using indicators based on Bloom's Taxonomy

    Directory of Open Access Journals (Sweden)

    Jorge José Barros de Santana Junior

    2008-04-01

    Full Text Available O presente estudo objetiva detectar, através dos seis níveis de conhecimento da Taxonomia de Bloom, qual a tendência das habilidades cognitivas requeridas, quando da demanda por profissionais contadores pela Administração Direta e Indireta da União, utilizando-se da análise das questões de algumas recentes provas de concursos (1999 a 2006, o que evidenciará um perfil de desempenho intelectual delineado por esse setor público. A partir dessa análise, busca-se fazer uma reflexão sobre os caminhos a serem percorridos, para que o profissional contador possa atingir as demandas de desempenho intelectual exigidas pelo atual cenário de desenvolvimento tecnológico e econômico mundial. O artigo foi desenvolvido utilizando-se do método indutivo, mediante pesquisas bibliográficas e documentais, além de técnicas de investigação estatística. Aborda-se o histórico das últimas mudanças ocorridas no mercado profissional, em especial do setor público, e o entendimento dos fundamentos da Taxonomia de Bloom, apresentando como proposta alguns indicadores de aprendizagem mais voltados para uma realidade atual. O resultado da pesquisa demonstrou que não se está exigindo dos candidatos ao cargo de contador (ou com especialidade em contabilidade os mais altos indicadores de habilidades cognitivas. Verifica-se, portanto, a necessidade de mudanças efetivas nos rumos dessa profissão, para que se possa garantir o espaço almejado para todos aqueles que optaram em trabalhar e desenvolver as Ciências Contábeis.This study aims to detect, by means of the six knowledge levels in Bloom´s Taxonomy, tendencies in the cognitive abilities required when professional accountants are demanded by the Brazilian Direct and Indirect Administration, using the analysis of questions posed during some recent selection exams (1999 to 2006, to evidence the intellectual performance profile outlined by the public sector. Based on this analysis, attempts are made to

  20. NEW YOUNG STAR CANDIDATES IN BRC 27 AND BRC 34

    Energy Technology Data Exchange (ETDEWEB)

    Rebull, L. M.; Laher, R.; Legassie, M. [Spitzer Science Center/Caltech, M/S 220-6, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Johnson, C. H.; Carlson, S.; Clark, M.; Killingstad, N.; Koop, S. [Breck School, 123 Ottawa Avenue N., Golden Valley, MN 55422 (United States); Gibbs, J. C.; Aryal, S.; Canakapalli, T. S. [Glencoe High School, 2700 NW Glencoe Rd., Hillsboro, OR 97124 (United States); Linahan, M.; Ezyk, N.; Fagan, J. [Carmel Catholic High School, One Carmel Parkway, Mundelein, IL 60060 (United States); Sartore, D.; Badura, K. S. [Pine Ridge High School, 926 Howland Blvd., Deltona, FL 32738 (United States); Armstrong, J. D. [Las Cumbres Observatory Global Telescope (LCOGT) Network, Inc., 6740 Cortona Dr. Suite 102, Goleta, CA 93117 (United States); Allen, L. E. [National Optical Astronomy Observatory (NOAO), Tucson, AZ 85719 (United States); McGehee, P. [Infrared Processing and Analysis Center (IPAC), M/S 220-6, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Padgett, D. L., E-mail: rebull@ipac.caltech.edu [NASA' s Goddard Space Flight Center (GSFC), 8800 Greenbelt Rd., Greenbelt, MD 20771 (United States); and others

    2013-01-01

    We used archival Spitzer Space Telescope mid-infrared data to search for young stellar objects (YSOs) in the immediate vicinity of two bright-rimmed clouds, BRC 27 (part of CMa R1) and BRC 34 (part of the IC 1396 complex). These regions both appear to be actively forming young stars, perhaps triggered by the proximate OB stars. In BRC 27, we find clear infrared excesses around 22 of the 26 YSOs or YSO candidates identified in the literature, and identify 16 new YSO candidates that appear to have IR excesses. In BRC 34, the one literature-identified YSO has an IR excess, and we suggest 13 new YSO candidates in this region, including a new Class I object. Considering the entire ensemble, both BRCs are likely of comparable ages, within the uncertainties of small number statistics and without spectroscopy to confirm or refute the YSO candidates. Similarly, no clear conclusions can yet be drawn about any possible age gradients that may be present across the BRCs.

  1. Supporting Clinical Practice Candidates in Learning Community Development

    Science.gov (United States)

    DeJarnette, Nancy K.; Sudeck, Maria

    2015-01-01

    The purpose of this qualitative research study was to monitor pre-service teacher candidates' progression and implementation of the learning community philosophy along with classroom management strategies. The study took place during their final semester of clinical practice. Data were collected from self-reports, surveys, university supervisor…

  2. Are Teacher and Principal Candidates Prepared to Address Student Cyberbullying?

    Science.gov (United States)

    Styron, Ronald A., Jr.; Bonner, Jessica L.; Styron, Jennifer L.; Bridgeforth, James; Martin, Cecelia

    2016-01-01

    The purpose of this study was to examine the preparation of teacher and principal candidates to address problems created in K-12 settings as a result of cyberbullying. Participants included teacher and principal preparation students. Findings indicated that respondents were familiar with the most common forms of cyberbullying and its impact on…

  3. 11 CFR 110.8 - Presidential candidate expenditure limitations.

    Science.gov (United States)

    2010-01-01

    ... the aggregate of expenditures under this paragraph in any one State shall not exceed the greater of 16... CFR 110.18. (b) The expenditure limitations shall not be considered violated if, after the date of the... expenditure limitation under 11 CFR 9035.1. (d)(1) If an individual is a candidate for more than one...

  4. Evaluation of candidate geomagnetic field models for IGRF-12

    DEFF Research Database (Denmark)

    Thébault, Erwan; Finlay, Chris; Alken, Patrick;

    2015-01-01

    by the British Geological Survey (UK), DTU Space (Denmark), ISTerre (France), IZMIRAN (Russia), NOAA/NGDC (USA), GFZ Potsdam (Germany), NASA/GSFC (USA), IPGP (France), LPG Nantes (France), and ETH Zurich (Switzerland). Each candidate model was carefully evaluated and compared to all other models and a mean model...

  5. Candidate new rotavirus species in sheltered dogs, Hungary.

    Science.gov (United States)

    Mihalov-Kovács, Eszter; Gellért, Ákos; Marton, Szilvia; Farkas, Szilvia L; Fehér, Enikő; Oldal, Miklós; Jakab, Ferenc; Martella, Vito; Bányai, Krisztián

    2015-04-01

    We identified unusual rotavirus strains in fecal specimens from sheltered dogs in Hungary by viral metagenomics. The novel rotavirus species displayed limited genome sequence homology to representatives of the 8 rotavirus species, A-H, and qualifies as a candidate new rotavirus species that we tentatively named Rotavirus I. PMID:25811414

  6. First microlensing candidates from the MEGA survey of M 31

    NARCIS (Netherlands)

    de Jong, JTA; Kuijken, K; Crotts, APS; Sackett, PD; Sutherland, WJ; Uglesich, RR; Baltz, EA; Cseresnjes, P; Gyuk, G; Widrow, LM

    2004-01-01

    We present the first M 31 candidate microlensing events from the Microlensing Exploration of the Galaxy and Andromeda (MEGA) survey. MEGA uses several telescopes to detect microlensing towards the nearby Andromeda galaxy, M 3 1, in order to establish whether massive compact objects are a significant

  7. Many-Objective Distinct Candidates Optimization using Differential Evolution

    DEFF Research Database (Denmark)

    Justesen, Peter; Ursem, Rasmus Kjær

    2010-01-01

    , we present the novel MODCODE algorithm incorporating the ROD measure to measure and control candidate distinctiveness. MODCODE is tested against GDE3 on three real world centrifugal pump design problems supplied by Grundfos. Our algorithm outperforms GDE3 on all problems with respect to all...

  8. Identification of candidate genes for susceptibility to reactive arthritis

    NARCIS (Netherlands)

    M. Rihl; C. Barthel; A. Klos; R.E. Schmidt; P.P. Tak; H. Zeidler; J.G. Kuipers

    2009-01-01

    This study was undertaken to evaluate the gene expression profile in monocytes from three patients with reactive arthritis (ReA) in remission in order to identify candidate genes accounting for a potential susceptibility to ReA. Gene expression analyses revealed eight differentially expressed mRNA t

  9. THE 3 MU-M SPECTRA OF CANDIDATE CARBON STARS

    NARCIS (Netherlands)

    GROENEWEGEN, MAT; DEJONG, T; GEBALLE, TR

    1994-01-01

    We have searched for the 3.1 mum absorption feature, a well-known characteristic of optical carbon stars, in a sample of sixteen candidate carbon stars, most of which have very red colors and some of which have no optical counterparts. The sample was selected on the basis of similarity of LRS spectr

  10. Faculty Meeting: A Simulation for Secondary Teacher Candidates.

    Science.gov (United States)

    Hildebrand, Janet E.

    1981-01-01

    Describes a one-hour simulation used in methods courses at the University of Texas at Austin, to provide secondary teacher candidates with insights into the administrative functioning of a school and their future roles as department and school staff members. (SJL)

  11. Teacher Candidates' Attitudes to Using Oral History in History Education

    Science.gov (United States)

    Demircioglu, Ebru

    2016-01-01

    The aim of this research is to determine the views of history teacher candidates towards an oral history project carried out in the Special Teaching Method Course of the history pedagogy program of the Fatih Faculty of Education (FFE) at Karadeniz Technical University in Turkey. An open-ended questionnaire and semi-structured interview were the…

  12. Career Hints for the Doctoral Candidate Interested in Teacher Education.

    Science.gov (United States)

    Frith, Greg

    Guidelines are given to aid doctoral candidates in the selection of a specific career position within the field of teacher education. Various considerations relative to employment at differing types of universities are examined. University philosophy, monetary considerations, communication channels within the department, faculty relationships,…

  13. Candidate genes of idiopathic pulmonary fibrosis: current evidence and research

    Directory of Open Access Journals (Sweden)

    Zhou W

    2016-02-01

    Full Text Available Wei Zhou,1,2 Yaping Wang1,2 1Department of Medical Genetics, 2Jiangsu Key Laboratory of Molecular Medicine, Nanjing University School of Medicine, Nanjing, People's Republic of China Abstract: Idiopathic pulmonary fibrosis (IPF is a group of common and lethal forms of idiopathic interstitial pulmonary disease. IPF is characterized by a progressive decline in lung function with a median survival of 2–3 years after diagnosis. Although the pathogenesis of the disease remains unknown, genetic predisposition could play a causal role in IPF. A set of genes have been identified as candidate genes of IPF in the past 20 years. However, the recent technological advances that allow for the analysis of millions of polymorphisms in different subjects have deepened the understanding of the genetic complexity of IPF susceptibility. Genome-wide association studies and whole-genome sequencing continue to reveal the genetic loci associated with IPF risk. In this review, we describe candidate genes on the basis of their functions and aim to gain a better understanding of the genetic basis of IPF. The discovered candidate genes may help to clarify pivotal aspects in the diagnosis, prognosis, and therapies of IPF. Keywords: idiopathic pulmonary fibrosis, candidate genes, susceptibility 

  14. Assessment of Law Enforcement Candidates: Peer Evaluations and the MMPI.

    Science.gov (United States)

    Schumacher, Joseph E.; Scogin, Forrest

    Screening and evaluating law enforcement candidates for employment as police officers is a complex task. It has been recommended that a clinical interview and comprehensive battery of psychological tests may aid in evaluation. The Minnesota Multiphasic Personality Inventory (MMPI) is often used for this type of psychological screening. Peer…

  15. TECHNICAL BASIS FOR A CANDIDATE BUILDING MATERIALS RADIUM STANDARD

    Science.gov (United States)

    The report summarizes the technical basis for a candidate building materials radium standard. It contains the standard and a summary of the technical basis for the standard. (NOTE: The Florida Radon Research Program (FRRP), sponsored by the Environmental Protection Agency and the...

  16. Education of Doctor of Pharmacy Candidates as Mental Health Professionals.

    Science.gov (United States)

    Hayes, Peggy A.; Rosenbluth, Sidney A.

    1980-01-01

    The University of Tennessee offers an educational program to prepare Doctor of Pharmacy candidates for clinical roles in mental health care. The program consists of two core curricular elements: a didactic module and a clinical clerkship that devotes equal time to inpatient and outpatient care. Clinical guidelines and pharmacist goals are…

  17. Primary School Teacher Candidates' Geometric Habits of Mind

    Science.gov (United States)

    Köse, Nilu¨fer Y.; Tanisli, Dilek

    2014-01-01

    Geometric habits of mind are productive ways of thinking that support learning and using geometric concepts. Identifying primary school teacher candidates' geometric habits of mind is important as they affect the development of their future students' geometric thinking. Therefore, this study attempts to determine primary school…

  18. IT Service Management A guide for ITIL Foundation Exam candidates

    CERN Document Server

    Brewster, Ernest; Lawes, Aidan; Sansbury, John

    2012-01-01

    ITIL® is a framework for IT service management and provides best management practice to meet ISO/IEC 20k. This guide introduces ITIL to Foundation Exam candidates and offers a practical understanding of IT service management. The new edition is fully updated and contains several additional processes. An ITIL® licensed product.

  19. Teacher Candidates' Collaboration and Identity in Online Discussions

    Science.gov (United States)

    Bryce, Nadine

    2014-01-01

    In an online context, without facial, verbal or gestural cues, establishing identities through naming social positions appeared essential to effective written communication for graduate pre-service teacher candidates enrolled in a course on literacy education for elementary students. As they engaged in small group asynchronous discussions about…

  20. Selecting Quasar Candidates by a SVM Classification System

    CERN Document Server

    Peng, Nanbo; Zhao, Yongheng; Wu, Xuebing

    2012-01-01

    We develop and demonstrate a classification system constituted by several Support Vector Machines (SVM) classifiers, which can be applied to select quasar candidates from large sky survey projects, such as SDSS, UKIDSS, GALEX. How to construct this SVM classification system is presented in detail. When the SVM classification system works on the test set to predict quasar candidates, it acquires the efficiency of 93.21% and the completeness of 97.49%. In order to further prove the reliability and feasibility of this system, two chunks are randomly chosen to compare its performance with that of the XDQSO method used for SDSS-III's BOSS. The experimental results show that the high faction of overlap exists between the quasar candidates selected by this system and those extracted by the XDQSO technique in the dereddened i-band magnitude range between 17.75 and 22.45, especially in the interval of dereddened i-band magnitude < 20.0. In the two test areas, 57.38% and 87.15% of the quasar candidates predicted by ...